2E5TA

C-terminal domain of epsilon subunit of f1f0-atp synthase from the thermophilic bacillus ps3 in the presence of atp condition
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
IDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the thermophilic F1-ATPase {varepsilon} subunit suggesting ATP-regulated arm motion of its C-terminal domain in F1
pubmed doi rcsb
source organism Bacillus sp. ps3
molecule tags Hydrolase
molecule keywords ATP synthase epsilon chain
total genus 16
structure length 46
sequence length 46
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2e5tA00
1IFPA 1JEKA 1FS0E 2WSSH 2W6JH 2CK3H 4YXWH 2V7QH 1BSNA 4DJGA 3EFFK 4WVZA 3PJSK 2QE7H 1E79H 4QMAA 2E5YA 4TLFA 2JDIH 3USSA 2E5TA 1AQTA 1BSHA 2XNDH
chains in the Genus database with same CATH superfamily
2HFED 2HR3A 3RL0g 1KQGB 1YYCA 1NTZE 2FBWC 2A45H 1LNQA 1M1JC 1W2BO 3CD6P 2Q6QA 1LTGC 1NTKJ 5KLVE 3L75E 1AVYA 4WBAA 3S4RA 4HKZH 1VQ8P 3GHGA 1SQPK 1AFOA 4DJGA 1H0TB 3P8MC 2QJYB 1J2JB 1FAVA 1VQPP 3NXSA 2W8ZA 1KORA 3L74G 3KHUA 4IOIH 1L0NJ 5AVVB 2H8PD 3V2PA 5GTHE 1W5CE 3L73G 1M8OB 2WPVB 1VQNP 3B5NC 1RE4C 3CCSP 3L70G 5B5EE 2ZFCA 3H1KJ 1L0LE 4N78D 4C7RA 2WWWA 5KLVG 2C9NY 3CMAP 3PHLA 2E43A 5APVA 1IFNA 3KPEA 4PV1D 3A3YB 2PFXA 1RE4A 2KXPB 2JJLA 2M3BA 3AE2C 2FYUK 1SVFA 3B4SA 1LTTC 1VDFA 5AVRB 1FDMA 2A45I 2J59M 4GDOA 4GIFA 3CXHI 2V7QJ 1HTLC 2MJZA 1EDKA 2OYOA 3KZIE 4U7JA 1L0LG 3GF3A 5AW7B 2FYUE 1NOHA 2I1JA 3GF7A 3LIDA 4UB6E 2IBZE 2Q3IA 3CI9A 3B5NB 3FWNA 4L76A 4WVZA 5TJHA 3VYIA 1KYOH 4ZNCA 2YXRB 3G71P 2XU6A 2QM8A 1JCCA 1N7LA 3CXHD 1GU4A 3CCVP 2ZYAA 1DEEG 4JBZA 2KSJA 2N1TB 5APQA 3A0BH 3L71E 3QWOC 3CX5I 1FJPA 2OQQA 3GMAA 3O8ZA 2K88A 1BE3G 1LGHB 1RE3C 4IL6E 4PJ0H 3I5CA 3NMDA 1RQVA 4JPZB 2WTYA 2D2CB 2ZVOB 2AXCA 4H13D 1K05A 5KAFE 2YO2A 4DZOA 3G4SP 1NU1K 4K3AA 2QJKB 3M9HA 3MP7B 4L74A 3PLNA 4UB8H 3TGUJ 4B86A 1DD4A 1H88A 4N6JA 2W27A 1IFPA 2BASA 1NVOA 2E76C 2FYUD 3TF5A 2IZ0A 4AYCA 2WSSH 1PP9D 3CCJP 1SQPD 3HUSC 2PP6A 4PV1B 4I2LC 1K73Q 1KQFB 1G1IA 2BCCD 2J58A 4EOTA 2FFDC 1VQ9P 1GDTA 3HRNA 4BRYB 3RK2D 2AXTH 2OTLP 3HUSA 1S5LE 1VQKP 1LT9B 3A5TA 3H1LE 4ASVA 1FZBA 1JM0A 1FU1A 2FXMA 2GA1A 2D2CC 3F5HA 4JYBA 5AVTB 2WT7A 1NJIQ 1BE3E 1LTAC 3Q5SA 1D7MA 2NPSD 2QRXA 4WY4A 5EFWB 2OYIB 2POHA 2A06D 3H1LJ 3H1JE 2L5GB 3N7NA 2P10A 3V2QA 1CSBA 3D71A 1EZVG 1KB9E 3RGUA 4H44B 1VF5B 1N7SC 3HTKA 1R5SA 1KILE 5KLVD 2ZYGA 1NTMJ 3H1ID 1LTSC 3AEFC 1YJNP 1K04A 1GK6A 1UIXA 2M3EA 1AV1A 1IFIA 2Q5UA 1Y8AA 4HB1A 1KN7A 3CC2P 1IO4A 1M1JB 3L37A 3Q5PA 2WQYC 4EIJA 2ZYDA 1Z56A 3CCUP 4NPFX 1IFJA 1BGYE 2K1AA 3RL0D 2Z5IA 3AE9C 3RBZA 3H32B 1L4AB 1X79B 4XE5B 4W7ZA 2IYPA 5AVSB 2N1TA 1JY2P 2E75B 3M06A 1GL2D 1EZVD 2FYNB 2E75C 3R4YA 5CJ4A 3HD7B 3MTUE 1LTJB 2BCCE 2WSEJ 3BRVB 1SQVD 3V5BA 1YTZT 2OYHA 1CZQA 1QX8A 1PFIA 5APTA 1BSHA 2P7JA 3FGAD 3P8CE 1BE3J 1BGYG 3KQGA 3O6QA 3C9IA 2AEJA 3SSUA 1R8EA 2XDJA 1EXJA 1JEKA 1MV8A 1S9KD 2KOGA 4NPEA 2CK3H 1X0TA 1NAFA 2E74C 2K9YA 2N9BA 2XV5A 1FDOA 1FE6A 3CWBD 1LWUA 1CI6A 1NO4A 1PPJD 3OJAB 3ZDMA 4RJTA 3O6QB 1SQXG 2ZAEB 5L8RJ 1KB9H 1NTZG 2IBZI 2KK7A 1JY2N 1GL2C 1KILB 1SQQE 1WMKA 1NTME 1FBMA 2O3JA 3RK3D 3KDPB 1LT1A 5APYA 3L71D 2LXCB 2W6BA 4YPCA 3SWKA 1EZVE 1OW6A 1QGKB 1VF5D 4QMAA 3S9OA 3W67A 3L74E 2BCCG 5APWA 2NPSC 4YXDC 3CX5E 3M9QA 2IBZG 3AEGC 3GHGC 5E79H 1Q2NA 5AW5B 3TNUB 1NH4A 2PRRA 1DIPA 1L0NE 1SQVG 1VPCA 3Q3DA 1MKMA 2N9YB 2B89A 1N7SD 1AQTA 1CW5A 3TYYA 3AE4C 2IDBA 2KZJA 2NPSA 5AW4B 3MUDA 1NKNA 4L73A 2RN0A 2E76D 1FS0E 1M7LA 3JCUE 1BCCJ 1YQ3C 4R4LA 5CJ0A 3CCQP 1K9MQ 1FZCC 1VQMP 1Q86Q 1OFCX 2PGDA 3JSVC 3W68A 3FX0A 3OAKA 1NU1E 3I55P 2V4HA 3U1AA 1L0NG 1SQVE 2XKMA 5AVQB 5KJ7A 3V2NA 1SS1A 2VRSA 3RL0C 2H88C 2I8DA 2O01H 1J1EB 2YMKA 3PJSK 1NWQA 2KIKA 1KV4A 1VQOP 1NTKG 1USDA 3GHGB 5B66H 1S2EA 5K5GB 1QLED 1JCDA 2O01J 1KC8Q 5E79E 3CX5H 3H32A 1EDLA 1FJKA 2D2CD 1S9KE 5B66E 4RESB 2FFDA 1KD1Q 1KYOE 1PGQA 5AW0B 1XTCC 1ZW0A 5AW1B 3L71J 4O9BA 2HPCB 1ZRTD 2KS1A 1ZN5A 3BATA 1PP9J 3G9RA 3L75J 5CCGA 1QVGO 2KLVA 2FYZA 4OVNF 2FY8A 1PL5A 2FKWB 3ABVC 3RK3B 3JCUH 4Y28J 3G6EP 3M0DC 1L2PA 5AW8B 1VQLP 1YTZI 2J5UA 2KB7P 4KHXA 1J1EC 3FXDA 2WPRA 2B88A 3BASA 3L72D 4W7YA 3VMXA 4AQRD 1H8AA 1BGYD 2A06E 2ZJSE 3WUTA 2H7HA 2QG4A 2FXPA 2C0XA 4KJMA 3GLMA 3H1IJ 3CWBG 1E79H 1WRGA 1MFZA 1M57D 1ZP0C 3FWLA 1RF1B 4GOEA 2B87B 1L0LD 3E1RA 1G2CB 2A06G 1OXZA 4XFJA 1YJ9P 1KTMA 3EWKA 2O1KA 2QJKC 2IX7C 2GM4A 2E75D 1KMIZ 5CHXA 1A02J 1OWAA 1YJWP 2IFMA 3RK2B 2JR8A 4R4MA 1Q82Q 1SLQA 3H1KE 4GKGA 1HJ0A 3VTPC 2Z4EA 2I1KA 2Q9IA 3HE4A 3CLQA 1BE3D 4RKUJ 4ZMDA 3L72J 1U57A 4NPDA 1IC2A 4KT0J 1EC5A 4IFMA 3TSIA 5CBNA 3Q5RA 4ASWA 2YKQA 1SQBJ 3H1JD 1NTMD 3G3ZA 3ITKA 3P32A 1A02F 2HG5D 4GOFA 1Y9BA 2WPQA 1BDDA 3E7KA 3EFFK 1YQ4C 2QM7A 3L75D 2JWAA 3B5NA 2ZT9C 1HGVA 2YXQB 2R3SA 3AECC 1SQPG 1U7JA 2ZXXA 3TNUA 3IFMA 2QJYC 1YHQP 3HE4B 1S1CX 1IZNB 2OYIC 1RE3A 1ZV8A 3AE7C 1LP1A 1SQBK 2R3CA 2KUBA 2G3AA 1WT6A 3AEEC 3QH9A 1SFCB 2L91A 4TLFA 1IFDA 2HLOA 4IL6X 5KTBA 1HF9A 1KZUB 3SWFA 1RHZB 1HGZA 5CCGC 1OMIA 2WPSA 3L72E 3VN0A 5AW2B 3H25A 1KILA 1G1JA 4U3FJ 5DJUB 1S5LX 1SQBE 3T97A 1SQPE 4WY4D 1JTHA 1KYOD 4OWFA 1T2KD 1IJDB 1PPJG 2KZIA 2KYVA 2UWJE 2WZ7A 1SQXD 2WMMA 1N73C 1JUNA 4IFFA 3IN6A 1S72P 1DX7A 1JMMA 2OYHC 1JY3O 3BCCE 1GL2B 1KILC 2K9JB 3P7KA 1PV3A 1W2EA 3P8CD 5KAFH 2Y0CA 1KFNA 3L70E 3NFQA 4IL6H 4PJ0E 1SQBG 2IBZD 2QVAA 1RF0A 3H1HD 3L73E 2Z5HA 3M0AA 4Y99C 4DT0A 2E5YA 4BXLA 3L72G 2YIUC 4WY4C 3S1KA 4LLHA 4D6TG 1RF1A 3R2PA 2Q3EA 2P1JA 2QEXP 1Y47A 1S5LH 4BWNA 2HPCA 1NTMK 3LIEA 1AQ5A 1SQQD 3BCCG 1PIXA 2IZ1A 3D6ZA 1HBWA 1RF0C 4RO0A 1T3JA 5AVYB 1GZLA 1E5WA 4UB6H 3SWYA 5BU8B 3K5BA 1EXIA 3MD0A 4ZKPA 3KZIH 2FYUJ 1EZVI 3H1LD 1MUUA 3B71A 1QL1A 1GD2E 1LTIC 2C9LY 1L0ND 2KSEA 1P84D 4PD4I 2NRGA 2JKVA 1FZCB 1NHLA 2WVRA 1PP9E 1SFCD 1NKZB 1UIIA 1HJBA 4UB8E 5AVWB 4XA4A 1BSNA 3H1HG 4D6TE 4Y99B 4EDFA 2YIUB 2M5AA 2OYIA 1FZCA 1VQ5P 2HODB 1T3UA 3AE8C 2N1TC 1YI2P 1KQLA 3KYQA 3RBXA 3H1JG 5B5EH 3A0BE 1SQQG 2XNXA 3BCCD 1NTZD 1ZXGA 1FOSE 4C46A 1JB0J 1FDIA 1RY3A 1SQXE 3L75G 3USSA 1ZOYC 1BCCD 1QL2A 5DJTB 1QEXA 3A7OA 5AVXB 3GG2A 3L71G 3IAOA 5BU5A 1VQ7P 1KB9I 1L0NK 3Q2YA 5TISH 2QJPC 1FZGA 4A7PA 1NU1J 1OW8A 2WSCJ 2DW3A 2ZXEB 2XNDH 3PH0A 2OARA 1LWUC 1NGMB 4HH2A 1OVUA 3HD7D 2YKOA 3AE3C 2QIWA 3U59A 3V4QA 3CL3D 1SQQK 1Q7YQ 2LXBA 1LT9A 3SFDC 2R5DA 2K9JA 3U1CA 1AA0A 2QE7H 4EYYQ 2XZRA 4I1LA 4JF7A 5KLIC 1OIPA 2W6AA 1SFCA 2YO3A 5KKZC 3MGNA 2ZT9B 1BCCG 1NTKK 1PGPA 5AW3B 2R5BA 2SPZA 1LTBC 1BDCA 1ZLLA 4C7NB 2LKMA 3TGUE 1ZR4A 5GTHH 2HYNA 1URQD 2AEFA 2O1JA 1NTKD 3WMM0 1HUCA 1SQXK 1DH3A 2Q1KA 4N78E 4GODA 3D70A 2A45G 2WSCH 3AE1C 3MZWB 1S4XA 1SQVJ 4N3YB 4CPGA 1SP4A 3B5ND 3L74D 1ZMEC 3PRJA 2FFDB 1J1DB 1P84I 1YBKA 2BCCJ 4PD4D 3C8VA 5KJ7C 1LP1B 2M5AB 2K3RA 1PGJA 3L70D 1EQ7A 2KP8A 1YITP 3B8EB 4HJGH 1X22A 2E74B 3BRTB 3IR9A 4EI2A 1PPJE 1BCCE 2O01N 2QSIA 3L36A 1H89A 1LJ2A 1NTZJ 2YKPA 4DCKA 1SQXJ 5BVZA 2R32A 2Q7CA 4DOJA 2IFNA 2KLUA 4JYCA 1OZHA 4PD4H 3HE5B 3CXHE 5AW9B 2IPPA 2GUVA 5AVUB 5CMZA 2JDIH 1BGYJ 1NU1G 2AXTE 1PZQA 2ITAA 3Q1MA 1HWTC 4TT3H 1NTZK 1EDJA 1M1JA 3OW2O 4OGQB 2FXOA 2H89C 3VOPA 3PP5A 3CCMP 1Q81Q 2WT7B 1P84E 3M0DA 3AE5C 1IK9A 4OGQD 1OX3A 1L4AA 4WWIA 5GTIH 1SQQJ 2RMZA 2W6JH 3H1JJ 4K35A 5H2FH 1OW7A 5CCHA 1M1KQ 2KNCB 4U3FE 2E74D 2RH0A 4BRYA 1N73B 3TK1A 3BVHA 3I56P 1FOSF 3V2RA 1M56D 1YIJP 1LTJA 1QVFO 3H1HJ 1L0LK 1L4AC 1KB9D 1XTGB 1HVVA 1JY2O 2KNCA 2P67A 1N73A 1DD3A 1FZEA 2MKVA 3FXEA 4WY4B 1JMBA 5AW6B 2P2UA 5KAIE 4I6MC 1KILD 2FYNC 1NTMG 3AEBC 1VQ6P 3HE5A 1GW3A 2BEQD 3H1HE 3L73D 1LTJC 2JO1A 2NPSB 3M91A 2FYUG 1S3JA 2AEMA 1KYOI 2OTKE 5C39A 2WITA 3WU2E 1K8AQ 2YMYA 4LC1A 3H1LG 5KLVK 2ZT9D 1T6AA 3TGUD 1M90Q 3BCCJ 1GMJA 1X8YA 2CPSA 3M9BA 1IK7A 4U3FD 3CC7P 3EQ2A 2GUSA 2JEEA 3V6IA 2OTJP 4ZKUA 4D6TJ 4H0LC 3CPWO 3VMYA 4H0LB 3WUUA 3CMEP 3CC4P 1FZAA 3CCEP 4L75A 5TISE 2Y0EA 1JOCA 3HUSB 3MHVA 5CCHD 2OGUA 1Q90D 3A0HH 4W80A 3WU2H 2IYOA 3KXDA 3RL0B 2Y9ZA 3CX5D 3V4WA 1U7MA 4H13C 1AVOA 3L4FA 4H13B 3F89A 4LGDE 2W90A 2B9BA 3MIWA 1ZRTE 3VP9A 4H0LD 1HH0A 3TGUG 4WB4A 1ZR2A 4U3FG 1URQC 1SQBD 2N1TD 3A0HE 3HTKB 3CCRP 1GK4A 3LW5H 2H43A 1VL2A 1N86A 4IFDK 2KI7B 5AVZB 1GU5A 2E76B 5CCHC 1LWUB 1NYHA 1T8ZA 2NZ2A 2QJPB 3GW6A 4D6TD 5H2FE 3IF4A 1FC2C 1NU1D 5APUA 5GTIE 1EDIA 3H1KD 3RK2C 1N7SB 1URQA 1OVVA 5KJ7D 3SFEC 3T97B 3WUVA 3TDKA 1JTHB 1SQPJ 2OYHB 1JO5A 5APXA 3NTNA 2WSFJ 1N8RQ 4HYTB 2M0BA 4OH8B 1MFTA 5KLIB 2QA4P 2JWDA 3H6PA 5KKZB 5CBOA 1L0LJ 1JNMA 3II6A 1RF1C 2CPBA 3AE6C 2ZVNB 4M3LA 2M8RA 3E1IA 5M1BA 1GW4A 4GT1A 1LT9C 2WSFH 3C1LA 3N4XA 1N7SA 1URQB 1PGOA 2WSEH 2BEZF 4I7ZB 4PD4E 5KAIH 4I7ZC 4AUWA 3H1IE 2W83C 1KQSO 2E5TA 2LR2A 1T2KC 1JY3N 5APSA 1SFCC 3UIAA 1RH5B 3OA7A 4H44C 1GTWA 3JC22 3RK3C 2R44A 1NTKE 5KLVJ 3H1KG 2PAJA 1KFMA 2JP3A 2Y9YA 4JQ0D 4PV1C 1CI6B 1DEBA 1VF5C 1X9VA 2B87A 3LW5J 1TU3F 2P58A 4OGQC 1SQVK 3L70J 3MUDC 4MN4C 1G2CA 2RKLA 3VMAA 4C7NA 4YXWH 1USEA 3RK3E 1J1DC 1P84H 3L73J 3VP8A 3CWBJ 3L35A 1FZFA 3H1IG 3L74J 2V7QH 1VQ4P 1MZ9A 2K37A 3HD7A 3VMZA 3CCLP 1IFMA 1L4AD 3AEAC 1JY3P 4H44D 3A2AA 2E42A 3CWBE 4Z1MH 1N2DC 3CXHH 2YNYA 3D6YA 1RQUA 2Y0DA 4YTPC 2C0WA 2KS1B 2HODA 2G8YA 3HD7C 1PP9G 3AEDC 5CCGD 1R5LA 1AJYA 3PTZA 1NAYA 1H0TA 3EFGA 1OVRA 1GL2A
chains in the Genus database with same CATH topology
1IFPA 1JEKA 1FS0E 2WSSH 2W6JH 2CK3H 4YXWH 2V7QH 1BSNA 4DJGA 3EFFK 4WVZA 3PJSK 2QE7H 1E79H 4QMAA 2E5YA 4TLFA 2JDIH 3USSA 2E5TA 1AQTA 1BSHA 2XNDH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFP A;  1JEK A;  1FS0 E;  2WSS H;  2W6J H;  2CK3 H;  4YXW H;  2V7Q H;  1BSN A;  4DJG A;  3EFF K;  4WVZ A;  3PJS K;  2QE7 H;  1E79 H;  4QMA A;  2E5Y A;  4TLF A;  2JDI H;  3USS A;  2E5T A;  1AQT A;  1BSH A;  2XND H; 
#chains in the Genus database with same CATH topology
 2HFE D;  2HR3 A;  3RL0 g;  1KQG B;  1YYC A;  1NTZ E;  2FBW C;  2A45 H;  1LNQ A;  1M1J C;  1W2B O;  3CD6 P;  2Q6Q A;  1LTG C;  1NTK J;  5KLV E;  3L75 E;  1AVY A;  4WBA A;  3S4R A;  4HKZ H;  1VQ8 P;  3GHG A;  1SQP K;  1AFO A;  4DJG A;  1H0T B;  3P8M C;  2QJY B;  1J2J B;  1FAV A;  1VQP P;  3NXS A;  2W8Z A;  1KOR A;  3L74 G;  3KHU A;  4IOI H;  1L0N J;  5AVV B;  2H8P D;  3V2P A;  5GTH E;  1W5C E;  3L73 G;  1M8O B;  2WPV B;  1VQN P;  3B5N C;  1RE4 C;  3CCS P;  3L70 G;  5B5E E;  2ZFC A;  3H1K J;  1L0L E;  4N78 D;  4C7R A;  2WWW A;  5KLV G;  2C9N Y;  3CMA P;  3PHL A;  2E43 A;  5APV A;  1IFN A;  3KPE A;  4PV1 D;  3A3Y B;  2PFX A;  1RE4 A;  2KXP B;  2JJL A;  2M3B A;  3AE2 C;  2FYU K;  1SVF A;  3B4S A;  1LTT C;  1VDF A;  5AVR B;  1FDM A;  2A45 I;  2J59 M;  4GDO A;  4GIF A;  3CXH I;  2V7Q J;  1HTL C;  2MJZ A;  1EDK A;  2OYO A;  3KZI E;  4U7J A;  1L0L G;  3GF3 A;  5AW7 B;  2FYU E;  1NOH A;  2I1J A;  3GF7 A;  3LID A;  4UB6 E;  2IBZ E;  2Q3I A;  3CI9 A;  3B5N B;  3FWN A;  4L76 A;  4WVZ A;  5TJH A;  3VYI A;  1KYO H;  4ZNC A;  2YXR B;  3G71 P;  2XU6 A;  2QM8 A;  1JCC A;  1N7L A;  3CXH D;  1GU4 A;  3CCV P;  2ZYA A;  1DEE G;  4JBZ A;  2KSJ A;  2N1T B;  5APQ A;  3A0B H;  3L71 E;  3QWO C;  3CX5 I;  1FJP A;  2OQQ A;  3GMA A;  3O8Z A;  2K88 A;  1BE3 G;  1LGH B;  1RE3 C;  4IL6 E;  4PJ0 H;  3I5C A;  3NMD A;  1RQV A;  4JPZ B;  2WTY A;  2D2C B;  2ZVO B;  2AXC A;  4H13 D;  1K05 A;  5KAF E;  2YO2 A;  4DZO A;  3G4S P;  1NU1 K;  4K3A A;  2QJK B;  3M9H A;  3MP7 B;  4L74 A;  3PLN A;  4UB8 H;  3TGU J;  4B86 A;  1DD4 A;  1H88 A;  4N6J A;  2W27 A;  1IFP A;  2BAS A;  1NVO A;  2E76 C;  2FYU D;  3TF5 A;  2IZ0 A;  4AYC A;  2WSS H;  1PP9 D;  3CCJ P;  1SQP D;  3HUS C;  2PP6 A;  4PV1 B;  4I2L C;  1K73 Q;  1KQF B;  1G1I A;  2BCC D;  2J58 A;  4EOT A;  2FFD C;  1VQ9 P;  1GDT A;  3HRN A;  4BRY B;  3RK2 D;  2AXT H;  2OTL P;  3HUS A;  1S5L E;  1VQK P;  1LT9 B;  3A5T A;  3H1L E;  4ASV A;  1FZB A;  1JM0 A;  1FU1 A;  2FXM A;  2GA1 A;  2D2C C;  3F5H A;  4JYB A;  5AVT B;  2WT7 A;  1NJI Q;  1BE3 E;  1LTA C;  3Q5S A;  1D7M A;  2NPS D;  2QRX A;  4WY4 A;  5EFW B;  2OYI B;  2POH A;  2A06 D;  3H1L J;  3H1J E;  2L5G B;  3N7N A;  2P10 A;  3V2Q A;  1CSB A;  3D71 A;  1EZV G;  1KB9 E;  3RGU A;  4H44 B;  1VF5 B;  1N7S C;  3HTK A;  1R5S A;  1KIL E;  5KLV D;  2ZYG A;  1NTM J;  3H1I D;  1LTS C;  3AEF C;  1YJN P;  1K04 A;  1GK6 A;  1UIX A;  2M3E A;  1AV1 A;  1IFI A;  2Q5U A;  1Y8A A;  4HB1 A;  1KN7 A;  3CC2 P;  1IO4 A;  1M1J B;  3L37 A;  3Q5P A;  2WQY C;  4EIJ A;  2ZYD A;  1Z56 A;  3CCU P;  4NPF X;  1IFJ A;  1BGY E;  2K1A A;  3RL0 D;  2Z5I A;  3AE9 C;  3RBZ A;  3H32 B;  1L4A B;  1X79 B;  4XE5 B;  4W7Z A;  2IYP A;  5AVS B;  2N1T A;  1JY2 P;  2E75 B;  3M06 A;  1GL2 D;  1EZV D;  2FYN B;  2E75 C;  3R4Y A;  5CJ4 A;  3HD7 B;  3MTU E;  1LTJ B;  2BCC E;  2WSE J;  3BRV B;  1SQV D;  3V5B A;  1YTZ T;  2OYH A;  1CZQ A;  1QX8 A;  1PFI A;  5APT A;  1BSH A;  2P7J A;  3FGA D;  3P8C E;  1BE3 J;  1BGY G;  3KQG A;  3O6Q A;  3C9I A;  2AEJ A;  3SSU A;  1R8E A;  2XDJ A;  1EXJ A;  1JEK A;  1MV8 A;  1S9K D;  2KOG A;  4NPE A;  2CK3 H;  1X0T A;  1NAF A;  2E74 C;  2K9Y A;  2N9B A;  2XV5 A;  1FDO A;  1FE6 A;  3CWB D;  1LWU A;  1CI6 A;  1NO4 A;  1PPJ D;  3OJA B;  3ZDM A;  4RJT A;  3O6Q B;  1SQX G;  2ZAE B;  5L8R J;  1KB9 H;  1NTZ G;  2IBZ I;  2KK7 A;  1JY2 N;  1GL2 C;  1KIL B;  1SQQ E;  1WMK A;  1NTM E;  1FBM A;  2O3J A;  3RK3 D;  3KDP B;  1LT1 A;  5APY A;  3L71 D;  2LXC B;  2W6B A;  4YPC A;  3SWK A;  1EZV E;  1OW6 A;  1QGK B;  1VF5 D;  4QMA A;  3S9O A;  3W67 A;  3L74 E;  2BCC G;  5APW A;  2NPS C;  4YXD C;  3CX5 E;  3M9Q A;  2IBZ G;  3AEG C;  3GHG C;  5E79 H;  1Q2N A;  5AW5 B;  3TNU B;  1NH4 A;  2PRR A;  1DIP A;  1L0N E;  1SQV G;  1VPC A;  3Q3D A;  1MKM A;  2N9Y B;  2B89 A;  1N7S D;  1AQT A;  1CW5 A;  3TYY A;  3AE4 C;  2IDB A;  2KZJ A;  2NPS A;  5AW4 B;  3MUD A;  1NKN A;  4L73 A;  2RN0 A;  2E76 D;  1FS0 E;  1M7L A;  3JCU E;  1BCC J;  1YQ3 C;  4R4L A;  5CJ0 A;  3CCQ P;  1K9M Q;  1FZC C;  1VQM P;  1Q86 Q;  1OFC X;  2PGD A;  3JSV C;  3W68 A;  3FX0 A;  3OAK A;  1NU1 E;  3I55 P;  2V4H A;  3U1A A;  1L0N G;  1SQV E;  2XKM A;  5AVQ B;  5KJ7 A;  3V2N A;  1SS1 A;  2VRS A;  3RL0 C;  2H88 C;  2I8D A;  2O01 H;  1J1E B;  2YMK A;  3PJS K;  1NWQ A;  2KIK A;  1KV4 A;  1VQO P;  1NTK G;  1USD A;  3GHG B;  5B66 H;  1S2E A;  5K5G B;  1QLE D;  1JCD A;  2O01 J;  1KC8 Q;  5E79 E;  3CX5 H;  3H32 A;  1EDL A;  1FJK A;  2D2C D;  1S9K E;  5B66 E;  4RES B;  2FFD A;  1KD1 Q;  1KYO E;  1PGQ A;  5AW0 B;  1XTC C;  1ZW0 A;  5AW1 B;  3L71 J;  4O9B A;  2HPC B;  1ZRT D;  2KS1 A;  1ZN5 A;  3BAT A;  1PP9 J;  3G9R A;  3L75 J;  5CCG A;  1QVG O;  2KLV A;  2FYZ A;  4OVN F;  2FY8 A;  1PL5 A;  2FKW B;  3ABV C;  3RK3 B;  3JCU H;  4Y28 J;  3G6E P;  3M0D C;  1L2P A;  5AW8 B;  1VQL P;  1YTZ I;  2J5U A;  2KB7 P;  4KHX A;  1J1E C;  3FXD A;  2WPR A;  2B88 A;  3BAS A;  3L72 D;  4W7Y A;  3VMX A;  4AQR D;  1H8A A;  1BGY D;  2A06 E;  2ZJS E;  3WUT A;  2H7H A;  2QG4 A;  2FXP A;  2C0X A;  4KJM A;  3GLM A;  3H1I J;  3CWB G;  1E79 H;  1WRG A;  1MFZ A;  1M57 D;  1ZP0 C;  3FWL A;  1RF1 B;  4GOE A;  2B87 B;  1L0L D;  3E1R A;  1G2C B;  2A06 G;  1OXZ A;  4XFJ A;  1YJ9 P;  1KTM A;  3EWK A;  2O1K A;  2QJK C;  2IX7 C;  2GM4 A;  2E75 D;  1KMI Z;  5CHX A;  1A02 J;  1OWA A;  1YJW P;  2IFM A;  3RK2 B;  2JR8 A;  4R4M A;  1Q82 Q;  1SLQ A;  3H1K E;  4GKG A;  1HJ0 A;  3VTP C;  2Z4E A;  2I1K A;  2Q9I A;  3HE4 A;  3CLQ A;  1BE3 D;  4RKU J;  4ZMD A;  3L72 J;  1U57 A;  4NPD A;  1IC2 A;  4KT0 J;  1EC5 A;  4IFM A;  3TSI A;  5CBN A;  3Q5R A;  4ASW A;  2YKQ A;  1SQB J;  3H1J D;  1NTM D;  3G3Z A;  3ITK A;  3P32 A;  1A02 F;  2HG5 D;  4GOF A;  1Y9B A;  2WPQ A;  1BDD A;  3E7K A;  3EFF K;  1YQ4 C;  2QM7 A;  3L75 D;  2JWA A;  3B5N A;  2ZT9 C;  1HGV A;  2YXQ B;  2R3S A;  3AEC C;  1SQP G;  1U7J A;  2ZXX A;  3TNU A;  3IFM A;  2QJY C;  1YHQ P;  3HE4 B;  1S1C X;  1IZN B;  2OYI C;  1RE3 A;  1ZV8 A;  3AE7 C;  1LP1 A;  1SQB K;  2R3C A;  2KUB A;  2G3A A;  1WT6 A;  3AEE C;  3QH9 A;  1SFC B;  2L91 A;  4TLF A;  1IFD A;  2HLO A;  4IL6 X;  5KTB A;  1HF9 A;  1KZU B;  3SWF A;  1RHZ B;  1HGZ A;  5CCG C;  1OMI A;  2WPS A;  3L72 E;  3VN0 A;  5AW2 B;  3H25 A;  1KIL A;  1G1J A;  4U3F J;  5DJU B;  1S5L X;  1SQB E;  3T97 A;  1SQP E;  4WY4 D;  1JTH A;  1KYO D;  4OWF A;  1T2K D;  1IJD B;  1PPJ G;  2KZI A;  2KYV A;  2UWJ E;  2WZ7 A;  1SQX D;  2WMM A;  1N73 C;  1JUN A;  4IFF A;  3IN6 A;  1S72 P;  1DX7 A;  1JMM A;  2OYH C;  1JY3 O;  3BCC E;  1GL2 B;  1KIL C;  2K9J B;  3P7K A;  1PV3 A;  1W2E A;  3P8C D;  5KAF H;  2Y0C A;  1KFN A;  3L70 E;  3NFQ A;  4IL6 H;  4PJ0 E;  1SQB G;  2IBZ D;  2QVA A;  1RF0 A;  3H1H D;  3L73 E;  2Z5H A;  3M0A A;  4Y99 C;  4DT0 A;  2E5Y A;  4BXL A;  3L72 G;  2YIU C;  4WY4 C;  3S1K A;  4LLH A;  4D6T G;  1RF1 A;  3R2P A;  2Q3E A;  2P1J A;  2QEX P;  1Y47 A;  1S5L H;  4BWN A;  2HPC A;  1NTM K;  3LIE A;  1AQ5 A;  1SQQ D;  3BCC G;  1PIX A;  2IZ1 A;  3D6Z A;  1HBW A;  1RF0 C;  4RO0 A;  1T3J A;  5AVY B;  1GZL A;  1E5W A;  4UB6 H;  3SWY A;  5BU8 B;  3K5B A;  1EXI A;  3MD0 A;  4ZKP A;  3KZI H;  2FYU J;  1EZV I;  3H1L D;  1MUU A;  3B71 A;  1QL1 A;  1GD2 E;  1LTI C;  2C9L Y;  1L0N D;  2KSE A;  1P84 D;  4PD4 I;  2NRG A;  2JKV A;  1FZC B;  1NHL A;  2WVR A;  1PP9 E;  1SFC D;  1NKZ B;  1UII A;  1HJB A;  4UB8 E;  5AVW B;  4XA4 A;  1BSN A;  3H1H G;  4D6T E;  4Y99 B;  4EDF A;  2YIU B;  2M5A A;  2OYI A;  1FZC A;  1VQ5 P;  2HOD B;  1T3U A;  3AE8 C;  2N1T C;  1YI2 P;  1KQL A;  3KYQ A;  3RBX A;  3H1J G;  5B5E H;  3A0B E;  1SQQ G;  2XNX A;  3BCC D;  1NTZ D;  1ZXG A;  1FOS E;  4C46 A;  1JB0 J;  1FDI A;  1RY3 A;  1SQX E;  3L75 G;  3USS A;  1ZOY C;  1BCC D;  1QL2 A;  5DJT B;  1QEX A;  3A7O A;  5AVX B;  3GG2 A;  3L71 G;  3IAO A;  5BU5 A;  1VQ7 P;  1KB9 I;  1L0N K;  3Q2Y A;  5TIS H;  2QJP C;  1FZG A;  4A7P A;  1NU1 J;  1OW8 A;  2WSC J;  2DW3 A;  2ZXE B;  2XND H;  3PH0 A;  2OAR A;  1LWU C;  1NGM B;  4HH2 A;  1OVU A;  3HD7 D;  2YKO A;  3AE3 C;  2QIW A;  3U59 A;  3V4Q A;  3CL3 D;  1SQQ K;  1Q7Y Q;  2LXB A;  1LT9 A;  3SFD C;  2R5D A;  2K9J A;  3U1C A;  1AA0 A;  2QE7 H;  4EYY Q;  2XZR A;  4I1L A;  4JF7 A;  5KLI C;  1OIP A;  2W6A A;  1SFC A;  2YO3 A;  5KKZ C;  3MGN A;  2ZT9 B;  1BCC G;  1NTK K;  1PGP A;  5AW3 B;  2R5B A;  2SPZ A;  1LTB C;  1BDC A;  1ZLL A;  4C7N B;  2LKM A;  3TGU E;  1ZR4 A;  5GTH H;  2HYN A;  1URQ D;  2AEF A;  2O1J A;  1NTK D;  3WMM 0;  1HUC A;  1SQX K;  1DH3 A;  2Q1K A;  4N78 E;  4GOD A;  3D70 A;  2A45 G;  2WSC H;  3AE1 C;  3MZW B;  1S4X A;  1SQV J;  4N3Y B;  4CPG A;  1SP4 A;  3B5N D;  3L74 D;  1ZME C;  3PRJ A;  2FFD B;  1J1D B;  1P84 I;  1YBK A;  2BCC J;  4PD4 D;  3C8V A;  5KJ7 C;  1LP1 B;  2M5A B;  2K3R A;  1PGJ A;  3L70 D;  1EQ7 A;  2KP8 A;  1YIT P;  3B8E B;  4HJG H;  1X22 A;  2E74 B;  3BRT B;  3IR9 A;  4EI2 A;  1PPJ E;  1BCC E;  2O01 N;  2QSI A;  3L36 A;  1H89 A;  1LJ2 A;  1NTZ J;  2YKP A;  4DCK A;  1SQX J;  5BVZ A;  2R32 A;  2Q7C A;  4DOJ A;  2IFN A;  2KLU A;  4JYC A;  1OZH A;  4PD4 H;  3HE5 B;  3CXH E;  5AW9 B;  2IPP A;  2GUV A;  5AVU B;  5CMZ A;  2JDI H;  1BGY J;  1NU1 G;  2AXT E;  1PZQ A;  2ITA A;  3Q1M A;  1HWT C;  4TT3 H;  1NTZ K;  1EDJ A;  1M1J A;  3OW2 O;  4OGQ B;  2FXO A;  2H89 C;  3VOP A;  3PP5 A;  3CCM P;  1Q81 Q;  2WT7 B;  1P84 E;  3M0D A;  3AE5 C;  1IK9 A;  4OGQ D;  1OX3 A;  1L4A A;  4WWI A;  5GTI H;  1SQQ J;  2RMZ A;  2W6J H;  3H1J J;  4K35 A;  5H2F H;  1OW7 A;  5CCH A;  1M1K Q;  2KNC B;  4U3F E;  2E74 D;  2RH0 A;  4BRY A;  1N73 B;  3TK1 A;  3BVH A;  3I56 P;  1FOS F;  3V2R A;  1M56 D;  1YIJ P;  1LTJ A;  1QVF O;  3H1H J;  1L0L K;  1L4A C;  1KB9 D;  1XTG B;  1HVV A;  1JY2 O;  2KNC A;  2P67 A;  1N73 A;  1DD3 A;  1FZE A;  2MKV A;  3FXE A;  4WY4 B;  1JMB A;  5AW6 B;  2P2U A;  5KAI E;  4I6M C;  1KIL D;  2FYN C;  1NTM G;  3AEB C;  1VQ6 P;  3HE5 A;  1GW3 A;  2BEQ D;  3H1H E;  3L73 D;  1LTJ C;  2JO1 A;  2NPS B;  3M91 A;  2FYU G;  1S3J A;  2AEM A;  1KYO I;  2OTK E;  5C39 A;  2WIT A;  3WU2 E;  1K8A Q;  2YMY A;  4LC1 A;  3H1L G;  5KLV K;  2ZT9 D;  1T6A A;  3TGU D;  1M90 Q;  3BCC J;  1GMJ A;  1X8Y A;  2CPS A;  3M9B A;  1IK7 A;  4U3F D;  3CC7 P;  3EQ2 A;  2GUS A;  2JEE A;  3V6I A;  2OTJ P;  4ZKU A;  4D6T J;  4H0L C;  3CPW O;  3VMY A;  4H0L B;  3WUU A;  3CME P;  3CC4 P;  1FZA A;  3CCE P;  4L75 A;  5TIS E;  2Y0E A;  1JOC A;  3HUS B;  3MHV A;  5CCH D;  2OGU A;  1Q90 D;  3A0H H;  4W80 A;  3WU2 H;  2IYO A;  3KXD A;  3RL0 B;  2Y9Z A;  3CX5 D;  3V4W A;  1U7M A;  4H13 C;  1AVO A;  3L4F A;  4H13 B;  3F89 A;  4LGD E;  2W90 A;  2B9B A;  3MIW A;  1ZRT E;  3VP9 A;  4H0L D;  1HH0 A;  3TGU G;  4WB4 A;  1ZR2 A;  4U3F G;  1URQ C;  1SQB D;  2N1T D;  3A0H E;  3HTK B;  3CCR P;  1GK4 A;  3LW5 H;  2H43 A;  1VL2 A;  1N86 A;  4IFD K;  2KI7 B;  5AVZ B;  1GU5 A;  2E76 B;  5CCH C;  1LWU B;  1NYH A;  1T8Z A;  2NZ2 A;  2QJP B;  3GW6 A;  4D6T D;  5H2F E;  3IF4 A;  1FC2 C;  1NU1 D;  5APU A;  5GTI E;  1EDI A;  3H1K D;  3RK2 C;  1N7S B;  1URQ A;  1OVV A;  5KJ7 D;  3SFE C;  3T97 B;  3WUV A;  3TDK A;  1JTH B;  1SQP J;  2OYH B;  1JO5 A;  5APX A;  3NTN A;  2WSF J;  1N8R Q;  4HYT B;  2M0B A;  4OH8 B;  1MFT A;  5KLI B;  2QA4 P;  2JWD A;  3H6P A;  5KKZ B;  5CBO A;  1L0L J;  1JNM A;  3II6 A;  1RF1 C;  2CPB A;  3AE6 C;  2ZVN B;  4M3L A;  2M8R A;  3E1I A;  5M1B A;  1GW4 A;  4GT1 A;  1LT9 C;  2WSF H;  3C1L A;  3N4X A;  1N7S A;  1URQ B;  1PGO A;  2WSE H;  2BEZ F;  4I7Z B;  4PD4 E;  5KAI H;  4I7Z C;  4AUW A;  3H1I E;  2W83 C;  1KQS O;  2E5T A;  2LR2 A;  1T2K C;  1JY3 N;  5APS A;  1SFC C;  3UIA A;  1RH5 B;  3OA7 A;  4H44 C;  1GTW A;  3JC2 2;  3RK3 C;  2R44 A;  1NTK E;  5KLV J;  3H1K G;  2PAJ A;  1KFM A;  2JP3 A;  2Y9Y A;  4JQ0 D;  4PV1 C;  1CI6 B;  1DEB A;  1VF5 C;  1X9V A;  2B87 A;  3LW5 J;  1TU3 F;  2P58 A;  4OGQ C;  1SQV K;  3L70 J;  3MUD C;  4MN4 C;  1G2C A;  2RKL A;  3VMA A;  4C7N A;  4YXW H;  1USE A;  3RK3 E;  1J1D C;  1P84 H;  3L73 J;  3VP8 A;  3CWB J;  3L35 A;  1FZF A;  3H1I G;  3L74 J;  2V7Q H;  1VQ4 P;  1MZ9 A;  2K37 A;  3HD7 A;  3VMZ A;  3CCL P;  1IFM A;  1L4A D;  3AEA C;  1JY3 P;  4H44 D;  3A2A A;  2E42 A;  3CWB E;  4Z1M H;  1N2D C;  3CXH H;  2YNY A;  3D6Y A;  1RQU A;  2Y0D A;  4YTP C;  2C0W A;  2KS1 B;  2HOD A;  2G8Y A;  3HD7 C;  1PP9 G;  3AED C;  5CCG D;  1R5L A;  1AJY A;  3PTZ A;  1NAY A;  1H0T A;  3EFG A;  1OVR A;  1GL2 A; 
#chains in the Genus database with same CATH homology
 1IFP A;  1JEK A;  1FS0 E;  2WSS H;  2W6J H;  2CK3 H;  4YXW H;  2V7Q H;  1BSN A;  4DJG A;  3EFF K;  4WVZ A;  3PJS K;  2QE7 H;  1E79 H;  4QMA A;  2E5Y A;  4TLF A;  2JDI H;  3USS A;  2E5T A;  1AQT A;  1BSH A;  2XND H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...