2E5YA

Epsilon subunit and atp complex of f1f0-atp synthase from the thermophilic bacillus ps3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
b'MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase epsilon chain
publication title Structures of the thermophilic F1-ATPase {varepsilon} subunit suggesting ATP-regulated arm motion of its C-terminal domain in F1
pubmed doi rcsb
source organism Bacillus sp. ps3
molecule tags Hydrolase
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2e5yA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2e5yA01
1JEKA 3FKSH 2XNDH 1AQTA 2W6JH 5FL7H 2E5TA 5DN6I 1FS0E 2QE7H 2E5YA 4YXWH 2CK3H 3EFFK 3OEHH 3OE7H 3OAAH 4QMAA 4DJGA 4TLFA 2V7QH 3OFNH 2HLDH 4WVZA 2RQ7A 3USSA 4ASUH 2XOKH 1BSHA 1BSNA 1IFPA 1H8EH 2WSSH 2JDIH 2RQ6A 1E79H 3PJSK
chains in the Genus database with same CATH superfamily
4R4LA 1FS0E 1M57D 2QIWA 1FZBA 1N73C 1GL2B 3OE7H 2NPSB 1OWAA 3MTUE 3AEGC 3C8VA 3Q2YA 3RK2D 4YTPC 4L75A 1JMBA 2B88A 1BSNA 5E79H 4YXDC 1R8EA 1A02J 1SQXG 1PPJD 3RK3B 4PD4H 3TSIA 5BVZA 3BVHA 1NJIQ 1EQ7A 1PGQA 1K73Q 1MFZA 1HF9A 1NWQA 2BCCD 2FFDC 4UB6H 1YJ9P 2OYHC 1VQPP 5APUA 3VMAA 3H1LG 4U3FE 1JTHA 2QJKB 1BCCE 1KYOD 2YNYA 3O6QB 1R5SA 3SFDC 4PJ0E 2G3AA 1TU3F 1G2CB 2O01H 3H25A 5TISE 1LT9B 4DCKA 1JY3N 4C7NA 3WU2E 4H44B 3FKSH 1FZCA 4WWIA 4H13D 5DJUB 3L4FA 2Y0DA 3WUTA 3V5BA 1S1CX 3RL0g 4IL6X 1SQXJ 1SFCB 1KILE 2V7QH 1ZV8A 2Q3EA 1P84I 3L71J 3WMM0 2OGUA 5FL7H 2E5TA 1SQVG 3H1LJ 3AECC 2KSEA 1GW3A 1RF0C 1SQBD 1VQOP 3KXDA 1IFMA 1XTCC 4DJGA 3V6IA 3U1CA 1N7SB 1Q90D 5K5GB 4ZNCA 3PHLA 4U3FG 4HJGH 2A06E 3M9QA 1IZNB 1H0TA 2Z4EA 1L0LG 2FYZA 3G6EP 3IR9A 3CXHI 1YJNP 1AFOA 2WSCH 3OFNH 3CWBG 5CCGD 1JMMA 1YYCA 5AVYB 1EC5A 3V4WA 2P7JA 2Y9YA 1KB9I 2AEMA 3P8MC 3K5BA 1LTJB 3CPWO 4N3YB 1RF1C 1CW5A 2KIKA 2LXCB 1SQVJ 1NTME 2ZT9D 1NKNA 2CPBA 2IBZG 2N1TD 3V2NA 4ASVA 2QM7A 2O1JA 1S3JA 4XFJA 2R32A 3FXDA 1X0TA 4U3FJ 2PAJA 3H32A 1FU1A 2KNCB 4GODA 3HUSC 2O3JA 1L0LJ 1MUUA 2QSIA 1VQ6P 1NTKG 3E7KA 2WITA 4JPZB 1S9KD 2RQ6A 1SLQA 3GHGC 1QL1A 1Y9BA 3CWBJ 1JY2O 3L75E 1M1JC 1GU4A 1URQB 1PIXA 1HTLC 3AEEC 2RMZA 3H1HD 2KXPB 3IFMA 4NPEA 2K9YA 5CCGC 3CMEP 1M8OB 4Y99B 2QJPC 2O01J 1LWUB 1QX8A 1N73A 1NAFA 2K88A 2E76B 1JB0J 3BRTB 3OA7A 4ASWA 1Q2NA 5CMZA 1SS1A 1Y47A 1VF5B 3CC4P 5KLVE 3C9IA 2V7QJ 2KK7A 4B86A 1MZ9A 3S9OA 1LNQA 2FFDA 4L76A 1NTKJ 1Z56A 1ZRTE 1GL2A 3Q5RA 3TDKA 2NPSA 1FDOA 2H88C 2BEZF 3H6PA 2WMMA 3AEAC 1QVFO 1EZVI 4I7ZB 3RL0B 2Z5HA 1QL2A 2C9NY 1DEBA 1T2KC 5H2FH 1H89A 4RO0A 3CCJP 2Y9ZA 1PP9G 2M5AA 1YTZI 2WSCJ 1HJBA 4IL6H 1U7JA 2M8RA 3M9HA 3L70E 4O9BA 2FYUJ 1W5CE 2XDJA 1YITP 2M0BA 4WY4B 1S5LH 3P8CD 3HD7B 3HE5B 3TK1A 4CPGA 4NPFX 1L4AC 3CX5E 4TLFA 4IFFA 1LT9A 3H1KD 1RF0A 1KFMA 1L0NG 2GA1A 2P67A 1KILB 1XTGB 4OGQB 2Q7CA 5APQA 3TNUA 5APSA 1SQPD 1AA0A 3AE9C 3QWOC 1SFCA 4QMAA 2NRGA 1KZUB 3RGUA 2WT7B 4HYTB 2K1AA 1PP9J 2R5BA 1QLED 1KTMA 2YIUB 2KB7P 4KHXA 1HGVA 1JY2N 1YQ3C 4PV1B 1WT6A 3OAAH 3KHUA 1AVYA 3CCSP 1SQQG 2PRRA 1S72P 4C46A 1NTZG 2W27A 2M3EA 2E75B 4Z1MH 3AE3C 1NU1D 3C1LA 3L72D 1Q82Q 4PD4I 1PPJE 3UIAA 3L70G 4H0LB 1FBMA 1VQ4P 3L35A 2E5YA 3L74G 1L0NJ 5DJTB 1VPCA 4W7YA 1LTTC 2A45H 5AW3B 2XV5A 4JYBA 1KORA 2OQQA 1MKMA 1GK4A 1L0LK 2BCCE 3B71A 1FZCC 3JCUE 2KS1A 4EYYQ 3G4SP 2D2CD 1KYOE 3HUSA 2W6JH 3VMXA 3W67A 2AXTH 2IYOA 5APXA 3G71P 1DD3A 2GUSA 1H8EH 3R4YA 2IBZI 3HTKB 4IFDK 1EDKA 1SQQJ 4OWFA 2WQYC 4I1LA 1NTZJ 3H1JG 2WSFH 3B4SA 1GMJA 3L70J 3L74J 3U59A 4UB8H 1T8ZA 2KUBA 1NTKK 3PP5A 1NO4A 1J1EC 2QG4A 4ZKPA 1SQBE 3RBZA 1HUCA 5KLIB 4D6TG 1N86A 2KLUA 1IK9A 1LWUA 5KTBA 2UWJE 4EIJA 1BGYG 4Y28J 3PRJA 4BRYA 5KAIE 3NXSA 2A45G 3B5NB 3D70A 4YXWH 2YMKA 3IN6A 2PGDA 3KQGA 3CC7P 1P84D 3H1JJ 3GLMA 2E74C 3CC2P 2FYUK 2JO1A 1GL2D 3VMZA 1VQ9P 2KI7B 2J58A 4K3AA 3PH0A 1W2EA 1J2JB 2RH0A 5AVUB 3MD0A 4D6TJ 2B89A 3HE4B 2IPPA 1L4AA 3L73J 2YKOA 3CXHD 1NHLA 3D71A 1SVFA 2QA4P 1BGYJ 2SPZA 1SQBG 2BASA 1KB9D 2ZAEB 3AE6C 5KKZC 3VP9A 3LIDA 4OH8B 1S9KE 2W90A 2JDIH 2HPCB 4A7PA 1HGZA 3H1HE 3A0BE 2JJLA 3VP8A 4PJ0H 1UIXA 3A3YB 2KSJA 2JWAA 2V4HA 1GL2C 2NPSC 1H88A 1QVGO 3A5TA 2JWDA 5TISH 1RHZB 3BCCG 3WU2H 2WSFJ 1J1DB 2CPSA 1FZEA 3RK3C 2LKMA 4N78D 2KZIA 1G1IA 1PGJA 2HYNA 3AEBC 3RK2B 1SQBJ 2Z5IA 1M7LA 3M0AA 3O8ZA 1NVOA 4AUWA 3W68A 3GW6A 2QJKC 1WRGA 5AVVB 1H8AA 4JBZA 1DX7A 1SQQK 2R44A 4U7JA 2C0WA 1S5LX 4EDFA 4L73A 2O1KA 5M1BA 3VTPC 1LP1B 1LT9C 5AW1B 3KPEA 3BCCJ 3H1HG 3PTZA 3LW5H 4ZMDA 1BSHA 5AW0B 2B9BA 5KJ7A 1SFCC 1BCCG 2ZVNB 3EFFK 3U1AA 4H13B 3P8CE 1EZVD 1AVOA 2OYIB 4OVNF 2Y0EA 1YTZT 3SWKA 1SQXD 3AE4C 1NH4A 3H1KE 3A2AA 3M91A 1RF1B 4JF7A 3HTKA 3A0HE 2FXOA 3L37A 3S4RA 1SQPE 3L71D 2WTYA 3H1LD 1JY3P 3T97A 5TJHA 2IX7C 1IFJA 1E5WA 4ASUH 1CSBA 2IZ1A 2AEJA 4XE5B 2XNDH 2QRXA 5CCHC 3I56P 1HVVA 1EDLA 3FX0A 3SFEC 1OVUA 1VQ5P 4HB1A 2L91A 2XNXA 2GM4A 1BCCJ 4RESB 2L5GB 1LTJC 1FZGA 5GTIE 1NU1E 3L72E 3V2PA 2ZFCA 2P2UA 1VL2A 1JCDA 2M3BA 2JKVA 2A45I 2QVAA 2A06G 5B5EE 1GZLA 1OZHA 1T2KD 1Q7YQ 1R5LA 1SQVD 2ZJSE 2MJZA 3H1KG 2ZT9B 3CCEP 1S4XA 2HR3A 1RH5B 2N1TB 4R4MA 1K9MQ 3AE2C 3LIEA 3V2RA 1SQPG 1IC2A 2ZVOB 4PD4D 2ZYGA 1L4AD 2HFED 5AW7B 1URQC 1T3UA 3P32A 3RL0D 1NTMG 1A02F 1L0LD 3SWYA 4Y99C 2YKQA 1LWUC 3RBXA 3CWBD 5KAFE 2O01N 1CI6B 3CCVP 1AV1A 5C39A 2E76C 2KZJA 4HKZH 2R5DA 5AW4B 1X79B 4WBAA 5GTHE 3LW5J 3VN0A 1NU1G 1VF5C 3L72G 2LXBA 4DT0A 1SQXK 3H1ID 3H1KJ 3L75G 1ZXGA 4AYCA 3TGUE 2IBZD 1JOCA 3HRNA 3M0DA 3F89A 3CX5H 3O6QA 1KD1Q 1PZQA 4KJMA 3F5HA 1JM0A 1NTMJ 2Y0CA 2ZXXA 3BATA 4W80A 1G2CA 1NTKD 1P84E 2PFXA 4I7ZC 3CCRP 3RL0C 1YBKA 1YQ4C 5KLVG 2N9YB 1X22A 1OVVA 1FC2C 1CZQA 1K04A 2E75D 2C0XA 2WPVB 1FDIA 5B66E 3MHVA 5CJ0A 4WY4C 3L75J 2PP6A 1JTHB 1BDDA 3TF5A 3HD7C 1GW4A 2ZYDA 3CXHE 2FYUD 3OW2O 1KILC 5CBOA 1SQVK 1BE3E 4OGQC 2HLDH 1KB9E 1RQVA 1N8RQ 2W6AA 1NGMB 1N7SA 4KT0J 4C7NB 2AEFA 4AQRD 2GUVA 1FZCB 3JCUH 3G9RA 2H89C 2QM8A 1M90Q 1VQ7P 5KLVJ 1KYOH 1W2BO 5AVQB 4RKUJ 1GK6A 2OYIA 2YIUC 4XA4A 1LTIC 5CCHA 1KV4A 4I6MC 4PV1C 1HWTC 2WPRA 2FYNB 2FY8A 1LTJA 3P7KA 3AEFC 1PP9D 1FJKA 2E75C 5AW5B 4JQ0D 3E1RA 1M56D 1MV8A 4N6JA 4H0LC 5AVSB 4N78E 1OW7A 1PGOA 1ZR4A 2E74D 3VOPA 1H0TB 1DEEG 1X9VA 5AVZB 2E43A 2Q1KA 3KZIE 5KJ7C 2KNCA 2FBWC 1L0ND 4GDOA 5AVRB 2K37A 3L36A 3FGAD 1T6AA 4EOTA 1VQNP 1VQ8P 2D2CB 1URQA 1PPJG 2R3CA 1KFNA 1SP4A 5KAIH 3TGUD 1JY3O 3BRVB 1LTBC 2XOKH 2BCCG 1LTSC 2OTKE 3CMAP 1K8AQ 1YJWP 1E79H 3CCQP 3AE1C 1AQTA 2OARA 3I5CA 2K3RA 1SQQD 1EZVE 1NTZD 4LC1A 3M06A 2R3SA 1SQXE 3PLNA 5CHXA 4K35A 1DH3A 4GKGA 2WVRA 3ZDMA 1YI2P 4GIFA 1FOSF 1NYHA 2NPSD 2ZYAA 3OAKA 1L2PA 3L71E 1Q81Q 3H1LE 3B5NC 1N73B 3RK3D 1UIIA 3EQ2A 2YXRB 3Q5SA 2BCCJ 2RN0A 2QJYC 3AEDC 1U57A 2YKPA 1BE3D 1FAVA 5AVTB 3A0BH 3N4XA 1QGKB 5AW2B 2I8DA 3VMYA 1IFIA 3PJSK 3H1JD 2FFDB 2Q3IA 4JYCA 2OYHB 4WY4A 1LJ2A 1RY3A 3FWNA 3OEHH 1FZAA 3HD7A 3HE5A 2N9BA 4LGDE 4H44D 1EZVG 1WMKA 5AW6B 3MUDC 1KILA 2IFNA 4WB4A 1SQVE 1LTAC 5DN6I 1L0NK 5KLVK 1SFCD 2JP3A 2HLOA 1M1KQ 5APYA 1G1JA 4D6TD 3D6ZA 2WPSA 1OXZA 5E79E 3L73D 3FWLA 3SSUA 3NMDA 2WSEH 2M5AB 2B87B 1KQGB 3L71G 2WT7A 2RQ7A 4PD4E 3B8EB 1BGYD 1VQLP 3CL3D 2H43A 2YO2A 1PL5A 1L0LE 3CCLP 1KC8Q 4M3LA 4W7ZA 4UB6E 2OTLP 3CWBE 3E1IA 2ITAA 1N7SD 3M0DC 2YO3A 1FE6A 2HODB 3AE8C 1NTZK 1J1DC 2H8PD 1RE4C 3TNUB 1ZR2A 5CCHD 3H1IE 3AE7C 3RK2C 1OVRA 4H44C 4I2LC 2IBZE 1USDA 4IOIH 3MZWB 2BEQD 3CX5I 3GG2A 1YHQP 1NAYA 3G3ZA 4GOFA 1ZOYC 1GU5A 1FDMA 3A0HH 5AVWB 1NTKE 1RQUA 2IDBA 2FXMA 2K9JB 2WSSH 1BDCA 1EXJA 1RE3C 3IAOA 2MKVA 1T3JA 1N7SC 1FOSE 3Q3DA 3FXEA 2W8ZA 2Q9IA 3NTNA 2KS1B 3GMAA 4H13C 1URQD 3Q1MA 3BCCD 3V4QA 1OX3A 3HUSB 3H1HJ 2OYIC 3KYQA 5GTIH 2FYUE 2Q5UA 1JO5A 3GHGB 3H1IG 1M1JB 4ZKUA 2JEEA 2E76D 5B5EH 2KLVA 3CCUP 4NPDA 2QJPB 1OFCX 5APVA 3B5NA 1VF5D 1KYOI 3SWFA 3BASA 2I1JA 1VQMP 2NZ2A 2WSEJ 1AQ5A 2WZ7A 1K05A 1IO4A 1OMIA 3AE5C 1KQFB 1OW8A 1MFTA 3M9BA 1PP9E 1HH0A 1VDFA 1VQKP 2AXCA 4BXLA 1X8YA 1N2DC 1QEXA 2Q6QA 4U3FD 5KAFH 1BCCD 3H1IJ 3HE4A 4BRYB 1JCCA 2E42A 1LTGC 5AVXB 1GTWA 1PFIA 1Q86Q 5GTHH 1HJ0A 3MUDA 5BU8B 1EDJA 2FYUG 2ZT9C 2WPQA 1L0NE 3A7OA 2N1TC 3JC22 1ZLLA 1SQBK 4RJTA 4WY4D 5L8RJ 2HPCA 1JUNA 2OYHA 3HD7D 1FJPA 2KYVA 3I55P 1Y8AA 3GF7A 5BU5A 1KILD 2J5UA 4OGQD 1DD4A 2KP8A 1P84H 1L4AB 1SQPJ 1GD2E 2VRSA 2IYPA 1SQQE 2DW3A 1NTZE 3CI9A 2B87A 1RE4A 2C9LY 2XKMA 2FKWB 1ZW0A 1HBWA 5H2FE 3L74E 5B66H 4PV1D 2A06D 2QE7H 2HG5D 2OTJP 4IL6E 3D6YA 3VYIA 1GDTA 3CXHH 1NU1J 1PV3A 1S2EA 3L72J 4HH2A 1KQSO 2W6BA 3RK3E 4H0LD 3QH9A 2HODA 1S5LE 3S1KA 1JNMA 2QEXP 1KB9H 1AJYA 3EWKA 2POHA 3CLQA 3TYYA 4IFMA 1LP1A 1ZMEC 1KN7A 3CCMP 1LGHB 1NTMD 5KJ7D 3MIWA 3USSA 1RE3A 2XU6A 1IJDB 3TGUG 3H1JE 2I1KA 2XZRA 3V2QA 1IFDA 3NFQA 2CK3H 1IK7A 4DOJA 2K9JA 1IFPA 4GOEA 1NOHA 3R2PA 1RF1A 4GT1A 3L75D 1N7LA 2ZXEB 4D6TE 3JSVC 3L73E 2P10A 4DZOA 1IFNA 5APWA 3II6A 4WVZA 5AW9B 1BGYE 1OW6A 3KZIH 1FZFA 3OJAB 3EFGA 3TGUJ 1USEA 3GHGA 3KDPB 2FYNC 1M1JA 1J1EB 5KLVD 5CBNA 2AXTE 3ITKA 3CD6P 1BE3G 4MN4C 2KOGA 3B5ND 5CCGA 1JY2P 4TT3H 2FXPA 1ZRTD 3Q5PA 2G8YA 1KMIZ 2W83C 3IF4A 2OYOA 3T97B 2H7HA 1ZN5A 2IFMA 3ABVC 1D7MA 3GF3A 4YPCA 1DIPA 2YXQB 3WUUA 2E74B 2N1TA 3N7NA 4UB8E 3H32B 3L73G 4C7RA 2D2CC 1U7MA 1SQPK 3L70D 1PGPA 4BWNA 4EI2A 3L74D 1JEKA 5KLIC 2IZ0A 1ZP0C 1BE3J 1NTMK 1NKZB 2YMYA 5APTA 1CI6A 3CX5D 2QJYB 1EXIA 4L74A 3WUVA 2J59M 1EDIA 3BCCE 5AW8B 3MP7B 5KKZB 4LLHA 1OIPA 1YIJP 2P1JA 1NU1K 5CJ4A 2RKLA 5EFWB 2WWWA 2P58A 3MGNA 1LT1A 1KQLA 2JR8A 2LR2A
chains in the Genus database with same CATH topology
1JEKA 3FKSH 2XNDH 1AQTA 2W6JH 5FL7H 2E5TA 5DN6I 1FS0E 2QE7H 2E5YA 4YXWH 2CK3H 3EFFK 3OEHH 3OE7H 3OAAH 4QMAA 4DJGA 4TLFA 2V7QH 3OFNH 2HLDH 4WVZA 2RQ7A 3USSA 4ASUH 2XOKH 1BSHA 1BSNA 1IFPA 1H8EH 2WSSH 2JDIH 2RQ6A 1E79H 3PJSK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JEK A;  3FKS H;  2XND H;  1AQT A;  2W6J H;  5FL7 H;  2E5T A;  5DN6 I;  1FS0 E;  2QE7 H;  2E5Y A;  4YXW H;  2CK3 H;  3EFF K;  3OEH H;  3OE7 H;  3OAA H;  4QMA A;  4DJG A;  4TLF A;  2V7Q H;  3OFN H;  2HLD H;  4WVZ A;  2RQ7 A;  3USS A;  4ASU H;  2XOK H;  1BSH A;  1BSN A;  1IFP A;  1H8E H;  2WSS H;  2JDI H;  2RQ6 A;  1E79 H;  3PJS K; 
#chains in the Genus database with same CATH topology
 4R4L A;  1FS0 E;  1M57 D;  2QIW A;  1FZB A;  1N73 C;  1GL2 B;  3OE7 H;  2NPS B;  1OWA A;  3MTU E;  3AEG C;  3C8V A;  3Q2Y A;  3RK2 D;  4YTP C;  4L75 A;  1JMB A;  2B88 A;  1BSN A;  5E79 H;  4YXD C;  1R8E A;  1A02 J;  1SQX G;  1PPJ D;  3RK3 B;  4PD4 H;  3TSI A;  5BVZ A;  3BVH A;  1NJI Q;  1EQ7 A;  1PGQ A;  1K73 Q;  1MFZ A;  1HF9 A;  1NWQ A;  2BCC D;  2FFD C;  4UB6 H;  1YJ9 P;  2OYH C;  1VQP P;  5APU A;  3VMA A;  3H1L G;  4U3F E;  1JTH A;  2QJK B;  1BCC E;  1KYO D;  2YNY A;  3O6Q B;  1R5S A;  3SFD C;  4PJ0 E;  2G3A A;  1TU3 F;  1G2C B;  2O01 H;  3H25 A;  5TIS E;  1LT9 B;  4DCK A;  1JY3 N;  4C7N A;  3WU2 E;  4H44 B;  3FKS H;  1FZC A;  4WWI A;  4H13 D;  5DJU B;  3L4F A;  2Y0D A;  3WUT A;  3V5B A;  1S1C X;  3RL0 g;  4IL6 X;  1SQX J;  1SFC B;  1KIL E;  2V7Q H;  1ZV8 A;  2Q3E A;  1P84 I;  3L71 J;  3WMM 0;  2OGU A;  5FL7 H;  2E5T A;  1SQV G;  3H1L J;  3AEC C;  2KSE A;  1GW3 A;  1RF0 C;  1SQB D;  1VQO P;  3KXD A;  1IFM A;  1XTC C;  4DJG A;  3V6I A;  3U1C A;  1N7S B;  1Q90 D;  5K5G B;  4ZNC A;  3PHL A;  4U3F G;  4HJG H;  2A06 E;  3M9Q A;  1IZN B;  1H0T A;  2Z4E A;  1L0L G;  2FYZ A;  3G6E P;  3IR9 A;  3CXH I;  1YJN P;  1AFO A;  2WSC H;  3OFN H;  3CWB G;  5CCG D;  1JMM A;  1YYC A;  5AVY B;  1EC5 A;  3V4W A;  2P7J A;  2Y9Y A;  1KB9 I;  2AEM A;  3P8M C;  3K5B A;  1LTJ B;  3CPW O;  4N3Y B;  1RF1 C;  1CW5 A;  2KIK A;  2LXC B;  1SQV J;  1NTM E;  2ZT9 D;  1NKN A;  2CPB A;  2IBZ G;  2N1T D;  3V2N A;  4ASV A;  2QM7 A;  2O1J A;  1S3J A;  4XFJ A;  2R32 A;  3FXD A;  1X0T A;  4U3F J;  2PAJ A;  3H32 A;  1FU1 A;  2KNC B;  4GOD A;  3HUS C;  2O3J A;  1L0L J;  1MUU A;  2QSI A;  1VQ6 P;  1NTK G;  3E7K A;  2WIT A;  4JPZ B;  1S9K D;  2RQ6 A;  1SLQ A;  3GHG C;  1QL1 A;  1Y9B A;  3CWB J;  1JY2 O;  3L75 E;  1M1J C;  1GU4 A;  1URQ B;  1PIX A;  1HTL C;  3AEE C;  2RMZ A;  3H1H D;  2KXP B;  3IFM A;  4NPE A;  2K9Y A;  5CCG C;  3CME P;  1M8O B;  4Y99 B;  2QJP C;  2O01 J;  1LWU B;  1QX8 A;  1N73 A;  1NAF A;  2K88 A;  2E76 B;  1JB0 J;  3BRT B;  3OA7 A;  4ASW A;  1Q2N A;  5CMZ A;  1SS1 A;  1Y47 A;  1VF5 B;  3CC4 P;  5KLV E;  3C9I A;  2V7Q J;  2KK7 A;  4B86 A;  1MZ9 A;  3S9O A;  1LNQ A;  2FFD A;  4L76 A;  1NTK J;  1Z56 A;  1ZRT E;  1GL2 A;  3Q5R A;  3TDK A;  2NPS A;  1FDO A;  2H88 C;  2BEZ F;  3H6P A;  2WMM A;  3AEA C;  1QVF O;  1EZV I;  4I7Z B;  3RL0 B;  2Z5H A;  1QL2 A;  2C9N Y;  1DEB A;  1T2K C;  5H2F H;  1H89 A;  4RO0 A;  3CCJ P;  2Y9Z A;  1PP9 G;  2M5A A;  1YTZ I;  2WSC J;  1HJB A;  4IL6 H;  1U7J A;  2M8R A;  3M9H A;  3L70 E;  4O9B A;  2FYU J;  1W5C E;  2XDJ A;  1YIT P;  2M0B A;  4WY4 B;  1S5L H;  3P8C D;  3HD7 B;  3HE5 B;  3TK1 A;  4CPG A;  4NPF X;  1L4A C;  3CX5 E;  4TLF A;  4IFF A;  1LT9 A;  3H1K D;  1RF0 A;  1KFM A;  1L0N G;  2GA1 A;  2P67 A;  1KIL B;  1XTG B;  4OGQ B;  2Q7C A;  5APQ A;  3TNU A;  5APS A;  1SQP D;  1AA0 A;  3AE9 C;  3QWO C;  1SFC A;  4QMA A;  2NRG A;  1KZU B;  3RGU A;  2WT7 B;  4HYT B;  2K1A A;  1PP9 J;  2R5B A;  1QLE D;  1KTM A;  2YIU B;  2KB7 P;  4KHX A;  1HGV A;  1JY2 N;  1YQ3 C;  4PV1 B;  1WT6 A;  3OAA H;  3KHU A;  1AVY A;  3CCS P;  1SQQ G;  2PRR A;  1S72 P;  4C46 A;  1NTZ G;  2W27 A;  2M3E A;  2E75 B;  4Z1M H;  3AE3 C;  1NU1 D;  3C1L A;  3L72 D;  1Q82 Q;  4PD4 I;  1PPJ E;  3UIA A;  3L70 G;  4H0L B;  1FBM A;  1VQ4 P;  3L35 A;  2E5Y A;  3L74 G;  1L0N J;  5DJT B;  1VPC A;  4W7Y A;  1LTT C;  2A45 H;  5AW3 B;  2XV5 A;  4JYB A;  1KOR A;  2OQQ A;  1MKM A;  1GK4 A;  1L0L K;  2BCC E;  3B71 A;  1FZC C;  3JCU E;  2KS1 A;  4EYY Q;  3G4S P;  2D2C D;  1KYO E;  3HUS A;  2W6J H;  3VMX A;  3W67 A;  2AXT H;  2IYO A;  5APX A;  3G71 P;  1DD3 A;  2GUS A;  1H8E H;  3R4Y A;  2IBZ I;  3HTK B;  4IFD K;  1EDK A;  1SQQ J;  4OWF A;  2WQY C;  4I1L A;  1NTZ J;  3H1J G;  2WSF H;  3B4S A;  1GMJ A;  3L70 J;  3L74 J;  3U59 A;  4UB8 H;  1T8Z A;  2KUB A;  1NTK K;  3PP5 A;  1NO4 A;  1J1E C;  2QG4 A;  4ZKP A;  1SQB E;  3RBZ A;  1HUC A;  5KLI B;  4D6T G;  1N86 A;  2KLU A;  1IK9 A;  1LWU A;  5KTB A;  2UWJ E;  4EIJ A;  1BGY G;  4Y28 J;  3PRJ A;  4BRY A;  5KAI E;  3NXS A;  2A45 G;  3B5N B;  3D70 A;  4YXW H;  2YMK A;  3IN6 A;  2PGD A;  3KQG A;  3CC7 P;  1P84 D;  3H1J J;  3GLM A;  2E74 C;  3CC2 P;  2FYU K;  2JO1 A;  1GL2 D;  3VMZ A;  1VQ9 P;  2KI7 B;  2J58 A;  4K3A A;  3PH0 A;  1W2E A;  1J2J B;  2RH0 A;  5AVU B;  3MD0 A;  4D6T J;  2B89 A;  3HE4 B;  2IPP A;  1L4A A;  3L73 J;  2YKO A;  3CXH D;  1NHL A;  3D71 A;  1SVF A;  2QA4 P;  1BGY J;  2SPZ A;  1SQB G;  2BAS A;  1KB9 D;  2ZAE B;  3AE6 C;  5KKZ C;  3VP9 A;  3LID A;  4OH8 B;  1S9K E;  2W90 A;  2JDI H;  2HPC B;  4A7P A;  1HGZ A;  3H1H E;  3A0B E;  2JJL A;  3VP8 A;  4PJ0 H;  1UIX A;  3A3Y B;  2KSJ A;  2JWA A;  2V4H A;  1GL2 C;  2NPS C;  1H88 A;  1QVG O;  3A5T A;  2JWD A;  5TIS H;  1RHZ B;  3BCC G;  3WU2 H;  2WSF J;  1J1D B;  2CPS A;  1FZE A;  3RK3 C;  2LKM A;  4N78 D;  2KZI A;  1G1I A;  1PGJ A;  2HYN A;  3AEB C;  3RK2 B;  1SQB J;  2Z5I A;  1M7L A;  3M0A A;  3O8Z A;  1NVO A;  4AUW A;  3W68 A;  3GW6 A;  2QJK C;  1WRG A;  5AVV B;  1H8A A;  4JBZ A;  1DX7 A;  1SQQ K;  2R44 A;  4U7J A;  2C0W A;  1S5L X;  4EDF A;  4L73 A;  2O1K A;  5M1B A;  3VTP C;  1LP1 B;  1LT9 C;  5AW1 B;  3KPE A;  3BCC J;  3H1H G;  3PTZ A;  3LW5 H;  4ZMD A;  1BSH A;  5AW0 B;  2B9B A;  5KJ7 A;  1SFC C;  1BCC G;  2ZVN B;  3EFF K;  3U1A A;  4H13 B;  3P8C E;  1EZV D;  1AVO A;  2OYI B;  4OVN F;  2Y0E A;  1YTZ T;  3SWK A;  1SQX D;  3AE4 C;  1NH4 A;  3H1K E;  3A2A A;  3M91 A;  1RF1 B;  4JF7 A;  3HTK A;  3A0H E;  2FXO A;  3L37 A;  3S4R A;  1SQP E;  3L71 D;  2WTY A;  3H1L D;  1JY3 P;  3T97 A;  5TJH A;  2IX7 C;  1IFJ A;  1E5W A;  4ASU H;  1CSB A;  2IZ1 A;  2AEJ A;  4XE5 B;  2XND H;  2QRX A;  5CCH C;  3I56 P;  1HVV A;  1EDL A;  3FX0 A;  3SFE C;  1OVU A;  1VQ5 P;  4HB1 A;  2L91 A;  2XNX A;  2GM4 A;  1BCC J;  4RES B;  2L5G B;  1LTJ C;  1FZG A;  5GTI E;  1NU1 E;  3L72 E;  3V2P A;  2ZFC A;  2P2U A;  1VL2 A;  1JCD A;  2M3B A;  2JKV A;  2A45 I;  2QVA A;  2A06 G;  5B5E E;  1GZL A;  1OZH A;  1T2K D;  1Q7Y Q;  1R5L A;  1SQV D;  2ZJS E;  2MJZ A;  3H1K G;  2ZT9 B;  3CCE P;  1S4X A;  2HR3 A;  1RH5 B;  2N1T B;  4R4M A;  1K9M Q;  3AE2 C;  3LIE A;  3V2R A;  1SQP G;  1IC2 A;  2ZVO B;  4PD4 D;  2ZYG A;  1L4A D;  2HFE D;  5AW7 B;  1URQ C;  1T3U A;  3P32 A;  3RL0 D;  1NTM G;  1A02 F;  1L0L D;  3SWY A;  4Y99 C;  2YKQ A;  1LWU C;  3RBX A;  3CWB D;  5KAF E;  2O01 N;  1CI6 B;  3CCV P;  1AV1 A;  5C39 A;  2E76 C;  2KZJ A;  4HKZ H;  2R5D A;  5AW4 B;  1X79 B;  4WBA A;  5GTH E;  3LW5 J;  3VN0 A;  1NU1 G;  1VF5 C;  3L72 G;  2LXB A;  4DT0 A;  1SQX K;  3H1I D;  3H1K J;  3L75 G;  1ZXG A;  4AYC A;  3TGU E;  2IBZ D;  1JOC A;  3HRN A;  3M0D A;  3F89 A;  3CX5 H;  3O6Q A;  1KD1 Q;  1PZQ A;  4KJM A;  3F5H A;  1JM0 A;  1NTM J;  2Y0C A;  2ZXX A;  3BAT A;  4W80 A;  1G2C A;  1NTK D;  1P84 E;  2PFX A;  4I7Z C;  3CCR P;  3RL0 C;  1YBK A;  1YQ4 C;  5KLV G;  2N9Y B;  1X22 A;  1OVV A;  1FC2 C;  1CZQ A;  1K04 A;  2E75 D;  2C0X A;  2WPV B;  1FDI A;  5B66 E;  3MHV A;  5CJ0 A;  4WY4 C;  3L75 J;  2PP6 A;  1JTH B;  1BDD A;  3TF5 A;  3HD7 C;  1GW4 A;  2ZYD A;  3CXH E;  2FYU D;  3OW2 O;  1KIL C;  5CBO A;  1SQV K;  1BE3 E;  4OGQ C;  2HLD H;  1KB9 E;  1RQV A;  1N8R Q;  2W6A A;  1NGM B;  1N7S A;  4KT0 J;  4C7N B;  2AEF A;  4AQR D;  2GUV A;  1FZC B;  3JCU H;  3G9R A;  2H89 C;  2QM8 A;  1M90 Q;  1VQ7 P;  5KLV J;  1KYO H;  1W2B O;  5AVQ B;  4RKU J;  1GK6 A;  2OYI A;  2YIU C;  4XA4 A;  1LTI C;  5CCH A;  1KV4 A;  4I6M C;  4PV1 C;  1HWT C;  2WPR A;  2FYN B;  2FY8 A;  1LTJ A;  3P7K A;  3AEF C;  1PP9 D;  1FJK A;  2E75 C;  5AW5 B;  4JQ0 D;  3E1R A;  1M56 D;  1MV8 A;  4N6J A;  4H0L C;  5AVS B;  4N78 E;  1OW7 A;  1PGO A;  1ZR4 A;  2E74 D;  3VOP A;  1H0T B;  1DEE G;  1X9V A;  5AVZ B;  2E43 A;  2Q1K A;  3KZI E;  5KJ7 C;  2KNC A;  2FBW C;  1L0N D;  4GDO A;  5AVR B;  2K37 A;  3L36 A;  3FGA D;  1T6A A;  4EOT A;  1VQN P;  1VQ8 P;  2D2C B;  1URQ A;  1PPJ G;  2R3C A;  1KFN A;  1SP4 A;  5KAI H;  3TGU D;  1JY3 O;  3BRV B;  1LTB C;  2XOK H;  2BCC G;  1LTS C;  2OTK E;  3CMA P;  1K8A Q;  1YJW P;  1E79 H;  3CCQ P;  3AE1 C;  1AQT A;  2OAR A;  3I5C A;  2K3R A;  1SQQ D;  1EZV E;  1NTZ D;  4LC1 A;  3M06 A;  2R3S A;  1SQX E;  3PLN A;  5CHX A;  4K35 A;  1DH3 A;  4GKG A;  2WVR A;  3ZDM A;  1YI2 P;  4GIF A;  1FOS F;  1NYH A;  2NPS D;  2ZYA A;  3OAK A;  1L2P A;  3L71 E;  1Q81 Q;  3H1L E;  3B5N C;  1N73 B;  3RK3 D;  1UII A;  3EQ2 A;  2YXR B;  3Q5S A;  2BCC J;  2RN0 A;  2QJY C;  3AED C;  1U57 A;  2YKP A;  1BE3 D;  1FAV A;  5AVT B;  3A0B H;  3N4X A;  1QGK B;  5AW2 B;  2I8D A;  3VMY A;  1IFI A;  3PJS K;  3H1J D;  2FFD B;  2Q3I A;  4JYC A;  2OYH B;  4WY4 A;  1LJ2 A;  1RY3 A;  3FWN A;  3OEH H;  1FZA A;  3HD7 A;  3HE5 A;  2N9B A;  4LGD E;  4H44 D;  1EZV G;  1WMK A;  5AW6 B;  3MUD C;  1KIL A;  2IFN A;  4WB4 A;  1SQV E;  1LTA C;  5DN6 I;  1L0N K;  5KLV K;  1SFC D;  2JP3 A;  2HLO A;  1M1K Q;  5APY A;  1G1J A;  4D6T D;  3D6Z A;  2WPS A;  1OXZ A;  5E79 E;  3L73 D;  3FWL A;  3SSU A;  3NMD A;  2WSE H;  2M5A B;  2B87 B;  1KQG B;  3L71 G;  2WT7 A;  2RQ7 A;  4PD4 E;  3B8E B;  1BGY D;  1VQL P;  3CL3 D;  2H43 A;  2YO2 A;  1PL5 A;  1L0L E;  3CCL P;  1KC8 Q;  4M3L A;  4W7Z A;  4UB6 E;  2OTL P;  3CWB E;  3E1I A;  2ITA A;  1N7S D;  3M0D C;  2YO3 A;  1FE6 A;  2HOD B;  3AE8 C;  1NTZ K;  1J1D C;  2H8P D;  1RE4 C;  3TNU B;  1ZR2 A;  5CCH D;  3H1I E;  3AE7 C;  3RK2 C;  1OVR A;  4H44 C;  4I2L C;  2IBZ E;  1USD A;  4IOI H;  3MZW B;  2BEQ D;  3CX5 I;  3GG2 A;  1YHQ P;  1NAY A;  3G3Z A;  4GOF A;  1ZOY C;  1GU5 A;  1FDM A;  3A0H H;  5AVW B;  1NTK E;  1RQU A;  2IDB A;  2FXM A;  2K9J B;  2WSS H;  1BDC A;  1EXJ A;  1RE3 C;  3IAO A;  2MKV A;  1T3J A;  1N7S C;  1FOS E;  3Q3D A;  3FXE A;  2W8Z A;  2Q9I A;  3NTN A;  2KS1 B;  3GMA A;  4H13 C;  1URQ D;  3Q1M A;  3BCC D;  3V4Q A;  1OX3 A;  3HUS B;  3H1H J;  2OYI C;  3KYQ A;  5GTI H;  2FYU E;  2Q5U A;  1JO5 A;  3GHG B;  3H1I G;  1M1J B;  4ZKU A;  2JEE A;  2E76 D;  5B5E H;  2KLV A;  3CCU P;  4NPD A;  2QJP B;  1OFC X;  5APV A;  3B5N A;  1VF5 D;  1KYO I;  3SWF A;  3BAS A;  2I1J A;  1VQM P;  2NZ2 A;  2WSE J;  1AQ5 A;  2WZ7 A;  1K05 A;  1IO4 A;  1OMI A;  3AE5 C;  1KQF B;  1OW8 A;  1MFT A;  3M9B A;  1PP9 E;  1HH0 A;  1VDF A;  1VQK P;  2AXC A;  4BXL A;  1X8Y A;  1N2D C;  1QEX A;  2Q6Q A;  4U3F D;  5KAF H;  1BCC D;  3H1I J;  3HE4 A;  4BRY B;  1JCC A;  2E42 A;  1LTG C;  5AVX B;  1GTW A;  1PFI A;  1Q86 Q;  5GTH H;  1HJ0 A;  3MUD A;  5BU8 B;  1EDJ A;  2FYU G;  2ZT9 C;  2WPQ A;  1L0N E;  3A7O A;  2N1T C;  3JC2 2;  1ZLL A;  1SQB K;  4RJT A;  4WY4 D;  5L8R J;  2HPC A;  1JUN A;  2OYH A;  3HD7 D;  1FJP A;  2KYV A;  3I55 P;  1Y8A A;  3GF7 A;  5BU5 A;  1KIL D;  2J5U A;  4OGQ D;  1DD4 A;  2KP8 A;  1P84 H;  1L4A B;  1SQP J;  1GD2 E;  2VRS A;  2IYP A;  1SQQ E;  2DW3 A;  1NTZ E;  3CI9 A;  2B87 A;  1RE4 A;  2C9L Y;  2XKM A;  2FKW B;  1ZW0 A;  1HBW A;  5H2F E;  3L74 E;  5B66 H;  4PV1 D;  2A06 D;  2QE7 H;  2HG5 D;  2OTJ P;  4IL6 E;  3D6Y A;  3VYI A;  1GDT A;  3CXH H;  1NU1 J;  1PV3 A;  1S2E A;  3L72 J;  4HH2 A;  1KQS O;  2W6B A;  3RK3 E;  4H0L D;  3QH9 A;  2HOD A;  1S5L E;  3S1K A;  1JNM A;  2QEX P;  1KB9 H;  1AJY A;  3EWK A;  2POH A;  3CLQ A;  3TYY A;  4IFM A;  1LP1 A;  1ZME C;  1KN7 A;  3CCM P;  1LGH B;  1NTM D;  5KJ7 D;  3MIW A;  3USS A;  1RE3 A;  2XU6 A;  1IJD B;  3TGU G;  3H1J E;  2I1K A;  2XZR A;  3V2Q A;  1IFD A;  3NFQ A;  2CK3 H;  1IK7 A;  4DOJ A;  2K9J A;  1IFP A;  4GOE A;  1NOH A;  3R2P A;  1RF1 A;  4GT1 A;  3L75 D;  1N7L A;  2ZXE B;  4D6T E;  3JSV C;  3L73 E;  2P10 A;  4DZO A;  1IFN A;  5APW A;  3II6 A;  4WVZ A;  5AW9 B;  1BGY E;  1OW6 A;  3KZI H;  1FZF A;  3OJA B;  3EFG A;  3TGU J;  1USE A;  3GHG A;  3KDP B;  2FYN C;  1M1J A;  1J1E B;  5KLV D;  5CBN A;  2AXT E;  3ITK A;  3CD6 P;  1BE3 G;  4MN4 C;  2KOG A;  3B5N D;  5CCG A;  1JY2 P;  4TT3 H;  2FXP A;  1ZRT D;  3Q5P A;  2G8Y A;  1KMI Z;  2W83 C;  3IF4 A;  2OYO A;  3T97 B;  2H7H A;  1ZN5 A;  2IFM A;  3ABV C;  1D7M A;  3GF3 A;  4YPC A;  1DIP A;  2YXQ B;  3WUU A;  2E74 B;  2N1T A;  3N7N A;  4UB8 E;  3H32 B;  3L73 G;  4C7R A;  2D2C C;  1U7M A;  1SQP K;  3L70 D;  1PGP A;  4BWN A;  4EI2 A;  3L74 D;  1JEK A;  5KLI C;  2IZ0 A;  1ZP0 C;  1BE3 J;  1NTM K;  1NKZ B;  2YMY A;  5APT A;  1CI6 A;  3CX5 D;  2QJY B;  1EXI A;  4L74 A;  3WUV A;  2J59 M;  1EDI A;  3BCC E;  5AW8 B;  3MP7 B;  5KKZ B;  4LLH A;  1OIP A;  1YIJ P;  2P1J A;  1NU1 K;  5CJ4 A;  2RKL A;  5EFW B;  2WWW A;  2P58 A;  3MGN A;  1LT1 A;  1KQL A;  2JR8 A;  2LR2 A; 
#chains in the Genus database with same CATH homology
 1JEK A;  3FKS H;  2XND H;  1AQT A;  2W6J H;  5FL7 H;  2E5T A;  5DN6 I;  1FS0 E;  2QE7 H;  2E5Y A;  4YXW H;  2CK3 H;  3EFF K;  3OEH H;  3OE7 H;  3OAA H;  4QMA A;  4DJG A;  4TLF A;  2V7Q H;  3OFN H;  2HLD H;  4WVZ A;  2RQ7 A;  3USS A;  4ASU H;  2XOK H;  1BSH A;  1BSN A;  1IFP A;  1H8E H;  2WSS H;  2JDI H;  2RQ6 A;  1E79 H;  3PJS K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...