2E5YA

Epsilon subunit and atp complex of f1f0-atp synthase from the thermophilic bacillus ps3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase epsilon chain
publication title Structures of the thermophilic F1-ATPase {varepsilon} subunit suggesting ATP-regulated arm motion of its C-terminal domain in F1
pubmed doi rcsb
source organism Bacillus sp. ps3
molecule tags Hydrolase
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2e5yA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2e5yA01
3FKSH 3OFNH 1H8EH 2CK3H 1AQTA 1BSHA 3USSA 5DN6I 2V7QH 2RQ7A 1IFPA 2W6JH 3EFFK 2RQ6A 2E5TA 1E79H 3OE7H 1FS0E 3OEHH 4WVZA 2E5YA 5FL7H 4QMAA 3PJSK 2XNDH 2XOKH 2JDIH 2WSSH 4TLFA 2HLDH 4YXWH 2QE7H 3OAAH 4ASUH 1BSNA 1JEKA 4DJGA
chains in the Genus database with same CATH superfamily
1PP9G 4CPGA 2E76C 3TSIA 2IBZD 3U1CA 3RK3C 3CC7P 3A3YB 2IZ0A 4N78D 5AVXB 2B87B 2E75B 1KQFB 4D6TD 1IFIA 4PD4I 3SWKA 4DCKA 4H44C 2BCCE 3CX5H 2ZT9B 1UIIA 2Q1KA 3CI9A 1LWUA 2WSCJ 1FDMA 5FL7H 3GG2A 1S9KE 3L74G 1KILB 3B4SA 3KZIE 1BDCA 4GT1A 2YO3A 3CMAP 3WUVA 1NTZK 3CWBJ 2RQ7A 2AEMA 3RK2C 5TISH 1KYOE 4JBZA 4N6JA 1VDFA 1KQLA 3O6QB 2QM8A 2BASA 1ZV8A 2KXPB 4PV1B 1FJKA 3AEGC 1VF5B 1W5CE 5KAIE 3N7NA 5EFWB 3AECC 3A0BH 4WB4A 5AVRB 5AW5B 1L4AC 4Y99B 2QVAA 2R3SA 1SQQJ 3NXSA 3CCUP 1PIXA 1SQBE 3L71E 2O1JA 2IBZI 5KLVE 4XA4A 2UWJE 3P8CE 2Q3EA 1KFNA 1SQBK 2YMKA 5CBNA 1Q82Q 4UB8E 5KLVK 3AEEC 2IFMA 3HUSC 3WU2E 4GOFA 1L0LE 3C9IA 2KZJA 4I6MC 2E74D 4EOTA 1RE4C 5KKZC 2E5YA 5APVA 3AEDC 1EDLA 3L75D 3NTNA 3U59A 1L0LK 1U57A 1ZN5A 1QLED 3PLNA 2WZ7A 4PD4H 1WT6A 1GK6A 2FBWC 5KLIC 3GF3A 2B9BA 1R5SA 3H1HE 2WT7A 3TGUG 1Q2NA 3RK3B 1SQPD 1J2JB 4ASWA 1NTMJ 1RY3A 2RKLA 3L71G 2WWWA 3M06A 4WWIA 3Q5RA 4H44B 3GHGB 5AW3B 1KB9I 1NYHA 2P1JA 3AE7C 3H1JD 3NFQA 5KAFE 4L75A 1KTMA 2POHA 1SQXE 3BCCD 3K5BA 1N73C 2BEZF 1NTKJ 1BCCJ 3RK2B 3L73D 4RESB 2JWDA 4WY4A 1SQXK 1UIXA 3RL0D 1FU1A 2XV5A 1M7LA 2C0XA 2M5AA 1JTHA 3TYYA 3B8EB 2KK7A 2QIWA 1D7MA 2KUBA 4LGDE 3CX5E 2LR2A 3H1HG 2NPSA 2W83C 1NKNA 4C46A 1X8YA 2A06D 3VYIA 4C7NA 1DH3A 3E1IA 1BDDA 4BRYB 2WQYC 1GMJA 1PP9J 4RO0A 3BRVB 5TISE 1YI2P 2A45G 3U1AA 2K1AA 2R5DA 2HYNA 2P7JA 1FZEA 3HTKA 2IZ1A 2LXCB 3HD7D 3RL0g 2WSEH 1KD1Q 2H43A 1NU1E 4AYCA 4Y28J 1PGOA 3HUSB 5AW8B 2QG4A 1JO5A 2Y0EA 2C0WA 1T2KD 3RBXA 2NRGA 3L35A 5KKZB 1T8ZA 1NU1K 1BGYJ 1FZGA 5APWA 1GL2D 1FAVA 3LIDA 3CCVP 3S1KA 3V2QA 3IR9A 1S1CX 5CCGC 1VPCA 1SFCC 1KV4A 1KB9H 2HODB 1URQA 1X79B 5KLIB 1S5LH 2HPCB 1SP4A 3H1ID 1QVGO 2OYHA 3VP8A 2OYIA 2Y9YA 1LGHB 1PPJG 3W68A 2ZVOB 1YIJP 1N7SC 2FYUE 3IFMA 2PP6A 4PD4E 3SWFA 5AW9B 5GTIE 4A7PA 1AV1A 1EZVD 2QM7A 3L70G 3M0DA 3B5NC 4HB1A 3HE5B 2FYUK 2Q5UA 3D70A 3G6EP 1S5LX 3G9RA 2BCCJ 3B5ND 2J5UA 2N9YB 2QJYC 3AE1C 1FBMA 1JY2O 4U3FD 1NTMK 1M56D 2VRSA 1S2EA 2M3BA 3ZDMA 3MHVA 1HGZA 5AVWB 2FKWB 2E75C 3L72G 5CJ4A 3OAAH 1PZQA 1VQ6P 3RBZA 1OVRA 3MTUE 1BE3E 3CD6P 3SFDC 2ZT9C 1HJBA 2E75D 3CCEP 1NKZB 2FYUG 1MV8A 1NO4A 2K9JB 1KILC 2FY8A 1ZRTD 2YO2A 1L0NE 1OX3A 1RF1A 3WUUA 1SQQD 4YXDC 3L71J 1DEBA 1JB0J 4MN4C 4M3LA 5KLVJ 1OZHA 4D6TE 3AE3C 1HWTC 1L0NK 2YIUC 2IPPA 4HYTB 1DIPA 1FJPA 5K5GB 1VF5C 1M1JC 2KNCA 2ZVNB 4IL6H 3WU2H 3OAKA 1L0LJ 3IAOA 1NWQA 1ZR4A 5AW0B 2JR8A 2KOGA 4PV1D 1JM0A 2HR3A 1YJNP 1NVOA 3V5BA 2D2CC 4JPZB 1FZFA 3CCJP 4AQRD 5APUA 1K9MQ 5AVVB 3MD0A 2KIKA 2Q3IA 4K35A 1BSHA 1MZ9A 1BE3G 2M3EA 3JCUE 2QSIA 1FZAA 1JOCA 3H1HJ 5CCHA 4OWFA 1N7SB 3BVHA 1QL1A 1EC5A 2PGDA 3L74E 2IBZG 3P32A 1DD3A 4HJGH 3Q1MA 1KB9E 1XTCC 3L36A 1L0NG 4B86A 4U7JA 1AQTA 3A5TA 4IL6X 1LTTC 2N1TA 4XFJA 1S5LE 2OTLP 3AE5C 2A45H 2PRRA 2Y0CA 4D6TG 1S4XA 2KS1A 4IFFA 3PRJA 3D6YA 2H7HA 2FXPA 4HH2A 1JNMA 5TJHA 1SQXJ 2JP3A 2PFXA 1X0TA 2RQ6A 1RE3A 1RHZB 4GKGA 3CCQP 1NTKD 3PTZA 3VN0A 2E76D 1H8AA 4H13C 2P58A 3RK3D 2O01N 4ZNCA 2CPSA 3GHGC 2L5GB 2C9NY 2FYZA 2H89C 1RH5B 1LTJA 2GM4A 4XE5B 1RQUA 3VMAA 1GDTA 2LKMA 4H44D 2CK3H 2E42A 1R5LA 3Q5SA 1PP9D 3FXEA 2AXCA 3II6A 1PGPA 1K8AQ 2YIUB 3RK2D 3HE4B 1M1JB 1NU1J 3TNUA 2YKPA 1G2CB 3TGUE 2V4HA 2KB7P 3BCCE 2MJZA 1HF9A 2QJKC 3OJAB 4YXWH 4DZOA 3H1KD 2D2CB 3D6ZA 1BGYD 1H88A 3L73E 3I55P 1ZXGA 2Q6QA 2B89A 3L75G 5CBOA 1L4AD 1NHLA 3IN6A 2SPZA 1FZCA 2BEQD 2XOKH 3MIWA 4TLFA 2O1KA 1A02F 1H0TB 2Y9ZA 1T3UA 4I1LA 4IL6E 3Q5PA 3MGNA 1SQPG 1QGKB 3H32A 1VL2A 1G1IA 5AVZB 4W7ZA 3SFEC 3A0HE 1RQVA 2XNXA 4JF7A 2FYUJ 1W2EA 3T97B 5GTIH 1KFMA 1L4AA 1LWUB 3VTPC 1LJ2A 5APXA 3BCCG 1X9VA 3S9OA 2R32A 2BCCD 3G71P 5APQA 1NTZD 2I8DA 5KJ7C 1AJYA 4WY4C 1EXJA 1CI6A 3FWNA 1SQVE 3L73G 1IO4A 4H13B 4L73A 1IFPA 2IDBA 4DT0A 3BATA 2Z4EA 3HUSA 4BXLA 3AE4C 1IJDB 1IK7A 1ZP0C 1NOHA 1ZMEC 1SQVK 2NPSC 1KYOD 3LIEA 1RE4A 1LT9C 1PV3A 1Z56A 2A06G 3H1IE 3HRNA 2O3JA 1BE3J 2IYPA 3OEHH 1YTZI 1EXIA 4ASUH 1S3JA 1HTLC 1L0NJ 3A2AA 1SQBD 3O8ZA 1YYCA 2YKOA 3FX0A 1EDIA 3PH0A 4RJTA 4GDOA 5KLVD 4GOEA 4D6TJ 2QJKB 2WPQA 1JUNA 3CL3D 3CMEP 1SQVG 1PPJE 1JY3P 1WRGA 2AXTH 1CSBA 3CCMP 1L0LD 4U3FE 3CXHD 1N73A 1J1EC 1URQC 2ZXEB 3PP5A 1MFTA 2FYNB 3L70E 2WSEJ 3KQGA 3M9BA 2WT7B 2ZXXA 1P84D 2YXRB 1HBWA 3VOPA 2FXOA 3BASA 3H1IG 3KDPB 1OIPA 2OYHC 3V2NA 2G8YA 3JCUH 1K05A 1FDOA 1SLQA 3H1HD 3NMDA 1CW5A 3L74J 2P2UA 5E79H 1OVVA 3H1LE 4HKZH 5CJ0A 2JKVA 3AEAC 2QRXA 1AQ5A 3M0DC 1EZVG 1KC8Q 1GU4A 1YJ9P 3BRTB 3HD7A 3L72E 5CCGD 2DW3A 1SFCD 5APSA 2WPRA 2K9JA 4H0LC 2KLVA 4WY4B 3N4XA 3EFFK 1U7MA 5AW6B 1SQXD 3TDKA 1AVOA 1E79H 4KHXA 2M5AB 1JTHB 1LP1B 1GL2A 4U3FG 1RF0A 2GUSA 1QEXA 3FGAD 2FFDC 3VMXA 1U7JA 2NPSB 1J1DB 4O9BA 1LT9B 3M9HA 2YNYA 5KTBA 1N7SD 3M9QA 4I2LC 4BWNA 4R4MA 3CXHI 2H8PD 3P8MC 3CC2P 1SFCA 3CX5D 2W90A 1TU3F 1P84I 3CCLP 3H1LG 1IFNA 3G3ZA 3CWBD 3M91A 1Q7YQ 1SQQG 1HJ0A 2OTJP 4DOJA 2PAJA 2WITA 4PJ0E 2ZFCA 1LTIC 2YXQB 4YTPC 1NU1D 3B5NA 5GTHE 1Y8AA 3TGUJ 2JDIH 1PFIA 3BCCJ 2IBZE 1YITP 1OXZA 1VQ5P 1J1EB 1URQB 2HLOA 2G3AA 2ZT9D 5DN6I 1ZOYC 4N78E 4ZKUA 3M0AA 3L73J 1N8RQ 5BU5A 1VQNP 1KILD 4UB6E 2XZRA 4N3YB 2OYHB 1FE6A 2XNDH 1SS1A 1EZVI 1BSNA 1DEEG 5CCHC 2M0BA 3MZWB 1H8EH 5H2FE 2B87A 2IFNA 1LTSC 2AXTE 1LNQA 2XDJA 2Z5HA 3V2RA 1QX8A 2N1TC 4ZMDA 1VQMP 2JJLA 1VF5D 1VQ4P 3A0HH 3FWLA 3V4QA 1KORA 4KT0J 1T3JA 3MUDC 2FYUD 3EFGA 1YQ3C 1KILA 4PD4D 4H0LB 2D2CD 1IZNB 2HLDH 3V4WA 2JEEA 5AW1B 2K9YA 5E79E 3R4YA 5AVQB 1NTMD 3O6QA 2FFDB 1PGQA 1L2PA 3LW5H 3LW5J 1KMIZ 1T6AA 3EWKA 4L76A 4NPFX 1SQVJ 4R4LA 3CCSP 1G2CA 3CPWO 3Q3DA 5AW4B 2KSEA 1X22A 4OGQC 1LTJC 1LWUC 3E7KA 2W6AA 4OVNF 2RN0A 4RKUJ 2QJPC 3F5HA 3H1IJ 3G4SP 1FS0E 5AVUB 1BE3D 1LTBC 1S72P 2IYOA 3KYQA 1A02J 5AW2B 1BCCD 1KQGB 2AEFA 2K3RA 1VQPP 3H25A 3F89A 1QL2A 3L75E 1NGMB 1H0TA 2R5BA 3AEFC 1MUUA 3TF5A 1L0ND 2M8RA 2Y0DA 2KNCB 4H13D 2KYVA 5M1BA 4C7RA 1JEKA 3UIAA 1JCCA 1K73Q 1SQPE 3VMZA 3T97A 1KQSO 4GODA 1NTZE 2FXMA 2W6BA 3H1KG 3I56P 1BGYG 1USDA 2WSCH 4TT3H 1SQPK 1FOSF 4LC1A 4U3FJ 3C8VA 1FZCC 1AVYA 2XKMA 3FKSH 3H1JE 3L70J 2C9LY 2ZJSE 3D71A 2ZYAA 1QVFO 3W67A 2KP8A 2WVRA 2YMYA 3SWYA 1Y47A 3GHGA 1DD4A 2N1TB 4JYBA 1W2BO 1Q86Q 2H88C 3L37A 3WUTA 2IX7C 2XU6A 3L74D 5B66H 1VQLP 1JY2P 2KS1B 4Z1MH 3H1LJ 3V6IA 3TK1A 1KB9D 3L4FA 3CCRP 5CHXA 2FYNC 2WMMA 1EQ7A 2ZAEB 1HH0A 3L72J 1IK9A 3VMYA 5APTA 2CPBA 2A06E 5B5EE 2V7QH 2V7QJ 2WPVB 3SSUA 2BCCG 4JYCA 1NTZG 3I5CA 3B71A 2WTYA 1Y9BA 2E74C 3GW6A 2K37A 4W7YA 1VQ9P 3P7KA 1PGJA 3CXHE 3H1JG 4OGQB 1N7LA 1LTJB 4BRYA 1FOSE 4GIFA 1P84E 1JMBA 4IFMA 2QJPB 1PL5A 2E43A 1NAYA 2Q7CA 3Q2YA 1WMKA 2KLUA 2E76B 1IFJA 1M8OB 1S9KD 1OW7A 1MFZA 4IFDK 5BU8B 5KJ7D 1Q81Q 4WY4D 3PHLA 3TNUB 1SQBG 3CC4P 1J1DC 3OW2O 3GMAA 2OTKE 1JY2N 5KLVG 1NH4A 4PJ0H 1ZW0A 2NPSD 2P10A 2HODA 1DX7A 5GTHH 3EQ2A 3TGUD 3VP9A 2HPCA 3RL0C 1EDKA 2KZIA 1L0LG 1FZCB 3JC22 1HVVA 1EZVE 3L71D 5KJ7A 4ASVA 1GW4A 3AEBC 4NPDA 4UB6H 1GW3A 1G1JA 3P8CD 5C39A 3H32B 1LP1A 1FC2C 2GA1A 4I7ZC 2L91A 4L74A 1K04A 2JWAA 5H2FH 3OA7A 1LT9A 3HE5A 2GUVA 2NZ2A 1AFOA 3A7OA 4EIJA 1L4AB 4K3AA 3CWBE 2P67A 2J58A 3HD7C 1HUCA 5AVSB 4EDFA 3WMM0 1VQKP 1ZR2A 1URQD 2HG5D 2OYIC 1FDIA 3ABVC 1CI6B 3V2PA 1T2KC 1KYOI 2E74B 2RMZA 1SQXG 1HGVA 1GL2C 1JMMA 5B66E 3A0BE 1RF0C 2OGUA 5DJTB 1ZRTE 2B88A 1M57D 2J59M 2E5TA 1SQQE 4AUWA 3H1KJ 5AVYB 1SQVD 2K88A 3AE6C 1KILE 4NPEA 1GU5A 2YKQA 1YTZT 1LTAC 1YHQP 1OWAA 1SQQK 3MP7B 3QH9A 3FXDA 4JQ0D 3H6PA 4H0LD 1VQOP 4DJGA 2JO1A 1GTWA 3CWBG 1JY3N 2N9BA 3KHUA 4C7NB 3L75J 2LXBA 5CCGA 1XTGB 4EYYQ 1IFDA 3R2PA 1LTGC 2R44A 1OW6A 2W8ZA 2AEJA 1NU1G 1CZQA 3ITKA 3RL0B 4EI2A 1OFCX 1N73B 4LLHA 1SQPJ 4WBAA 1NTME 3HTKB 1RF1C 1FZBA 3OE7H 3QWOC 3JSVC 1LT1A 1NTZJ 1OW8A 4QMAA 1PPJD 2WSSH 2I1KA 3AE9C 5DJUB 5AVTB 3KZIH 1N7SA 3C1LA 3KXDA 3GLMA 3H1JJ 3KPEA 4I7ZB 2FFDA 3L70D 2ZYGA 2I1JA 1KN7A 1N86A 1KYOH 3GF7A 2A45I 1VQ7P 3PJSK 1MKMA 1GD2E 1JCDA 1E5WA 1H89A 1NTKE 2OARA 2WSFH 1BCCE 2WSFJ 5BVZA 3HD7B 5KAIH 5AW7B 1NJIQ 4KJMA 3RK3E 3H1LD 2OYIB 1NTKK 1GZLA 4OH8B 1SQBJ 3AE2C 1NAFA 1YBKA 2HFED 3L72D 1GL2B 2KSJA 5CMZA 2Q9IA 1VQ8P 5B5EH 3CLQA 1NTMG 3CX5I 2ITAA 3IF4A 5CCHD 2W27A 1EDJA 4PV1C 1OMIA 1PP9E 2Z5IA 4UB8H 2ZYDA 1SVFA 3CXHH 1SFCB 2N1TD 4Y99C 1AA0A 1ZLLA 2KI7B 2QEXP 4ZKPA 2R3CA 1P84H 2QA4P 2O01H 2O01J 3RGUA 1Q90D 1RE3C 2MKVA 3OFNH 5L8RJ 1NTKG 2W6JH 1BCCG 3H1KE 5APYA 1BGYE 1IC2A 1GK4A 3HE4A 1M1JA 4WVZA 2OQQA 2WPSA 2OYOA 3E1RA 1YJWP 1R8EA 1IFMA 3B5NB 4YPCA 1N2DC 3USSA 1YQ4C 3AE8C 3S4RA 4W80A 2RH0A 1KZUB 3MUDA 1M1KQ 1OVUA 1M90Q 1RF1B 4IOIH 4OGQD 1USEA 2QE7H 5KAFH 1JY3O 2QJYB
chains in the Genus database with same CATH topology
3FKSH 3OFNH 1H8EH 2CK3H 1AQTA 1BSHA 3USSA 5DN6I 2V7QH 2RQ7A 1IFPA 2W6JH 3EFFK 2RQ6A 2E5TA 1E79H 3OE7H 1FS0E 3OEHH 4WVZA 2E5YA 5FL7H 4QMAA 3PJSK 2XNDH 2XOKH 2JDIH 2WSSH 4TLFA 2HLDH 4YXWH 2QE7H 3OAAH 4ASUH 1BSNA 1JEKA 4DJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKS H;  3OFN H;  1H8E H;  2CK3 H;  1AQT A;  1BSH A;  3USS A;  5DN6 I;  2V7Q H;  2RQ7 A;  1IFP A;  2W6J H;  3EFF K;  2RQ6 A;  2E5T A;  1E79 H;  3OE7 H;  1FS0 E;  3OEH H;  4WVZ A;  2E5Y A;  5FL7 H;  4QMA A;  3PJS K;  2XND H;  2XOK H;  2JDI H;  2WSS H;  4TLF A;  2HLD H;  4YXW H;  2QE7 H;  3OAA H;  4ASU H;  1BSN A;  1JEK A;  4DJG A; 
#chains in the Genus database with same CATH topology
 1PP9 G;  4CPG A;  2E76 C;  3TSI A;  2IBZ D;  3U1C A;  3RK3 C;  3CC7 P;  3A3Y B;  2IZ0 A;  4N78 D;  5AVX B;  2B87 B;  2E75 B;  1KQF B;  4D6T D;  1IFI A;  4PD4 I;  3SWK A;  4DCK A;  4H44 C;  2BCC E;  3CX5 H;  2ZT9 B;  1UII A;  2Q1K A;  3CI9 A;  1LWU A;  2WSC J;  1FDM A;  5FL7 H;  3GG2 A;  1S9K E;  3L74 G;  1KIL B;  3B4S A;  3KZI E;  1BDC A;  4GT1 A;  2YO3 A;  3CMA P;  3WUV A;  1NTZ K;  3CWB J;  2RQ7 A;  2AEM A;  3RK2 C;  5TIS H;  1KYO E;  4JBZ A;  4N6J A;  1VDF A;  1KQL A;  3O6Q B;  2QM8 A;  2BAS A;  1ZV8 A;  2KXP B;  4PV1 B;  1FJK A;  3AEG C;  1VF5 B;  1W5C E;  5KAI E;  3N7N A;  5EFW B;  3AEC C;  3A0B H;  4WB4 A;  5AVR B;  5AW5 B;  1L4A C;  4Y99 B;  2QVA A;  2R3S A;  1SQQ J;  3NXS A;  3CCU P;  1PIX A;  1SQB E;  3L71 E;  2O1J A;  2IBZ I;  5KLV E;  4XA4 A;  2UWJ E;  3P8C E;  2Q3E A;  1KFN A;  1SQB K;  2YMK A;  5CBN A;  1Q82 Q;  4UB8 E;  5KLV K;  3AEE C;  2IFM A;  3HUS C;  3WU2 E;  4GOF A;  1L0L E;  3C9I A;  2KZJ A;  4I6M C;  2E74 D;  4EOT A;  1RE4 C;  5KKZ C;  2E5Y A;  5APV A;  3AED C;  1EDL A;  3L75 D;  3NTN A;  3U59 A;  1L0L K;  1U57 A;  1ZN5 A;  1QLE D;  3PLN A;  2WZ7 A;  4PD4 H;  1WT6 A;  1GK6 A;  2FBW C;  5KLI C;  3GF3 A;  2B9B A;  1R5S A;  3H1H E;  2WT7 A;  3TGU G;  1Q2N A;  3RK3 B;  1SQP D;  1J2J B;  4ASW A;  1NTM J;  1RY3 A;  2RKL A;  3L71 G;  2WWW A;  3M06 A;  4WWI A;  3Q5R A;  4H44 B;  3GHG B;  5AW3 B;  1KB9 I;  1NYH A;  2P1J A;  3AE7 C;  3H1J D;  3NFQ A;  5KAF E;  4L75 A;  1KTM A;  2POH A;  1SQX E;  3BCC D;  3K5B A;  1N73 C;  2BEZ F;  1NTK J;  1BCC J;  3RK2 B;  3L73 D;  4RES B;  2JWD A;  4WY4 A;  1SQX K;  1UIX A;  3RL0 D;  1FU1 A;  2XV5 A;  1M7L A;  2C0X A;  2M5A A;  1JTH A;  3TYY A;  3B8E B;  2KK7 A;  2QIW A;  1D7M A;  2KUB A;  4LGD E;  3CX5 E;  2LR2 A;  3H1H G;  2NPS A;  2W83 C;  1NKN A;  4C46 A;  1X8Y A;  2A06 D;  3VYI A;  4C7N A;  1DH3 A;  3E1I A;  1BDD A;  4BRY B;  2WQY C;  1GMJ A;  1PP9 J;  4RO0 A;  3BRV B;  5TIS E;  1YI2 P;  2A45 G;  3U1A A;  2K1A A;  2R5D A;  2HYN A;  2P7J A;  1FZE A;  3HTK A;  2IZ1 A;  2LXC B;  3HD7 D;  3RL0 g;  2WSE H;  1KD1 Q;  2H43 A;  1NU1 E;  4AYC A;  4Y28 J;  1PGO A;  3HUS B;  5AW8 B;  2QG4 A;  1JO5 A;  2Y0E A;  2C0W A;  1T2K D;  3RBX A;  2NRG A;  3L35 A;  5KKZ B;  1T8Z A;  1NU1 K;  1BGY J;  1FZG A;  5APW A;  1GL2 D;  1FAV A;  3LID A;  3CCV P;  3S1K A;  3V2Q A;  3IR9 A;  1S1C X;  5CCG C;  1VPC A;  1SFC C;  1KV4 A;  1KB9 H;  2HOD B;  1URQ A;  1X79 B;  5KLI B;  1S5L H;  2HPC B;  1SP4 A;  3H1I D;  1QVG O;  2OYH A;  3VP8 A;  2OYI A;  2Y9Y A;  1LGH B;  1PPJ G;  3W68 A;  2ZVO B;  1YIJ P;  1N7S C;  2FYU E;  3IFM A;  2PP6 A;  4PD4 E;  3SWF A;  5AW9 B;  5GTI E;  4A7P A;  1AV1 A;  1EZV D;  2QM7 A;  3L70 G;  3M0D A;  3B5N C;  4HB1 A;  3HE5 B;  2FYU K;  2Q5U A;  3D70 A;  3G6E P;  1S5L X;  3G9R A;  2BCC J;  3B5N D;  2J5U A;  2N9Y B;  2QJY C;  3AE1 C;  1FBM A;  1JY2 O;  4U3F D;  1NTM K;  1M56 D;  2VRS A;  1S2E A;  2M3B A;  3ZDM A;  3MHV A;  1HGZ A;  5AVW B;  2FKW B;  2E75 C;  3L72 G;  5CJ4 A;  3OAA H;  1PZQ A;  1VQ6 P;  3RBZ A;  1OVR A;  3MTU E;  1BE3 E;  3CD6 P;  3SFD C;  2ZT9 C;  1HJB A;  2E75 D;  3CCE P;  1NKZ B;  2FYU G;  1MV8 A;  1NO4 A;  2K9J B;  1KIL C;  2FY8 A;  1ZRT D;  2YO2 A;  1L0N E;  1OX3 A;  1RF1 A;  3WUU A;  1SQQ D;  4YXD C;  3L71 J;  1DEB A;  1JB0 J;  4MN4 C;  4M3L A;  5KLV J;  1OZH A;  4D6T E;  3AE3 C;  1HWT C;  1L0N K;  2YIU C;  2IPP A;  4HYT B;  1DIP A;  1FJP A;  5K5G B;  1VF5 C;  1M1J C;  2KNC A;  2ZVN B;  4IL6 H;  3WU2 H;  3OAK A;  1L0L J;  3IAO A;  1NWQ A;  1ZR4 A;  5AW0 B;  2JR8 A;  2KOG A;  4PV1 D;  1JM0 A;  2HR3 A;  1YJN P;  1NVO A;  3V5B A;  2D2C C;  4JPZ B;  1FZF A;  3CCJ P;  4AQR D;  5APU A;  1K9M Q;  5AVV B;  3MD0 A;  2KIK A;  2Q3I A;  4K35 A;  1BSH A;  1MZ9 A;  1BE3 G;  2M3E A;  3JCU E;  2QSI A;  1FZA A;  1JOC A;  3H1H J;  5CCH A;  4OWF A;  1N7S B;  3BVH A;  1QL1 A;  1EC5 A;  2PGD A;  3L74 E;  2IBZ G;  3P32 A;  1DD3 A;  4HJG H;  3Q1M A;  1KB9 E;  1XTC C;  3L36 A;  1L0N G;  4B86 A;  4U7J A;  1AQT A;  3A5T A;  4IL6 X;  1LTT C;  2N1T A;  4XFJ A;  1S5L E;  2OTL P;  3AE5 C;  2A45 H;  2PRR A;  2Y0C A;  4D6T G;  1S4X A;  2KS1 A;  4IFF A;  3PRJ A;  3D6Y A;  2H7H A;  2FXP A;  4HH2 A;  1JNM A;  5TJH A;  1SQX J;  2JP3 A;  2PFX A;  1X0T A;  2RQ6 A;  1RE3 A;  1RHZ B;  4GKG A;  3CCQ P;  1NTK D;  3PTZ A;  3VN0 A;  2E76 D;  1H8A A;  4H13 C;  2P58 A;  3RK3 D;  2O01 N;  4ZNC A;  2CPS A;  3GHG C;  2L5G B;  2C9N Y;  2FYZ A;  2H89 C;  1RH5 B;  1LTJ A;  2GM4 A;  4XE5 B;  1RQU A;  3VMA A;  1GDT A;  2LKM A;  4H44 D;  2CK3 H;  2E42 A;  1R5L A;  3Q5S A;  1PP9 D;  3FXE A;  2AXC A;  3II6 A;  1PGP A;  1K8A Q;  2YIU B;  3RK2 D;  3HE4 B;  1M1J B;  1NU1 J;  3TNU A;  2YKP A;  1G2C B;  3TGU E;  2V4H A;  2KB7 P;  3BCC E;  2MJZ A;  1HF9 A;  2QJK C;  3OJA B;  4YXW H;  4DZO A;  3H1K D;  2D2C B;  3D6Z A;  1BGY D;  1H88 A;  3L73 E;  3I55 P;  1ZXG A;  2Q6Q A;  2B89 A;  3L75 G;  5CBO A;  1L4A D;  1NHL A;  3IN6 A;  2SPZ A;  1FZC A;  2BEQ D;  2XOK H;  3MIW A;  4TLF A;  2O1K A;  1A02 F;  1H0T B;  2Y9Z A;  1T3U A;  4I1L A;  4IL6 E;  3Q5P A;  3MGN A;  1SQP G;  1QGK B;  3H32 A;  1VL2 A;  1G1I A;  5AVZ B;  4W7Z A;  3SFE C;  3A0H E;  1RQV A;  2XNX A;  4JF7 A;  2FYU J;  1W2E A;  3T97 B;  5GTI H;  1KFM A;  1L4A A;  1LWU B;  3VTP C;  1LJ2 A;  5APX A;  3BCC G;  1X9V A;  3S9O A;  2R32 A;  2BCC D;  3G71 P;  5APQ A;  1NTZ D;  2I8D A;  5KJ7 C;  1AJY A;  4WY4 C;  1EXJ A;  1CI6 A;  3FWN A;  1SQV E;  3L73 G;  1IO4 A;  4H13 B;  4L73 A;  1IFP A;  2IDB A;  4DT0 A;  3BAT A;  2Z4E A;  3HUS A;  4BXL A;  3AE4 C;  1IJD B;  1IK7 A;  1ZP0 C;  1NOH A;  1ZME C;  1SQV K;  2NPS C;  1KYO D;  3LIE A;  1RE4 A;  1LT9 C;  1PV3 A;  1Z56 A;  2A06 G;  3H1I E;  3HRN A;  2O3J A;  1BE3 J;  2IYP A;  3OEH H;  1YTZ I;  1EXI A;  4ASU H;  1S3J A;  1HTL C;  1L0N J;  3A2A A;  1SQB D;  3O8Z A;  1YYC A;  2YKO A;  3FX0 A;  1EDI A;  3PH0 A;  4RJT A;  4GDO A;  5KLV D;  4GOE A;  4D6T J;  2QJK B;  2WPQ A;  1JUN A;  3CL3 D;  3CME P;  1SQV G;  1PPJ E;  1JY3 P;  1WRG A;  2AXT H;  1CSB A;  3CCM P;  1L0L D;  4U3F E;  3CXH D;  1N73 A;  1J1E C;  1URQ C;  2ZXE B;  3PP5 A;  1MFT A;  2FYN B;  3L70 E;  2WSE J;  3KQG A;  3M9B A;  2WT7 B;  2ZXX A;  1P84 D;  2YXR B;  1HBW A;  3VOP A;  2FXO A;  3BAS A;  3H1I G;  3KDP B;  1OIP A;  2OYH C;  3V2N A;  2G8Y A;  3JCU H;  1K05 A;  1FDO A;  1SLQ A;  3H1H D;  3NMD A;  1CW5 A;  3L74 J;  2P2U A;  5E79 H;  1OVV A;  3H1L E;  4HKZ H;  5CJ0 A;  2JKV A;  3AEA C;  2QRX A;  1AQ5 A;  3M0D C;  1EZV G;  1KC8 Q;  1GU4 A;  1YJ9 P;  3BRT B;  3HD7 A;  3L72 E;  5CCG D;  2DW3 A;  1SFC D;  5APS A;  2WPR A;  2K9J A;  4H0L C;  2KLV A;  4WY4 B;  3N4X A;  3EFF K;  1U7M A;  5AW6 B;  1SQX D;  3TDK A;  1AVO A;  1E79 H;  4KHX A;  2M5A B;  1JTH B;  1LP1 B;  1GL2 A;  4U3F G;  1RF0 A;  2GUS A;  1QEX A;  3FGA D;  2FFD C;  3VMX A;  1U7J A;  2NPS B;  1J1D B;  4O9B A;  1LT9 B;  3M9H A;  2YNY A;  5KTB A;  1N7S D;  3M9Q A;  4I2L C;  4BWN A;  4R4M A;  3CXH I;  2H8P D;  3P8M C;  3CC2 P;  1SFC A;  3CX5 D;  2W90 A;  1TU3 F;  1P84 I;  3CCL P;  3H1L G;  1IFN A;  3G3Z A;  3CWB D;  3M91 A;  1Q7Y Q;  1SQQ G;  1HJ0 A;  2OTJ P;  4DOJ A;  2PAJ A;  2WIT A;  4PJ0 E;  2ZFC A;  1LTI C;  2YXQ B;  4YTP C;  1NU1 D;  3B5N A;  5GTH E;  1Y8A A;  3TGU J;  2JDI H;  1PFI A;  3BCC J;  2IBZ E;  1YIT P;  1OXZ A;  1VQ5 P;  1J1E B;  1URQ B;  2HLO A;  2G3A A;  2ZT9 D;  5DN6 I;  1ZOY C;  4N78 E;  4ZKU A;  3M0A A;  3L73 J;  1N8R Q;  5BU5 A;  1VQN P;  1KIL D;  4UB6 E;  2XZR A;  4N3Y B;  2OYH B;  1FE6 A;  2XND H;  1SS1 A;  1EZV I;  1BSN A;  1DEE G;  5CCH C;  2M0B A;  3MZW B;  1H8E H;  5H2F E;  2B87 A;  2IFN A;  1LTS C;  2AXT E;  1LNQ A;  2XDJ A;  2Z5H A;  3V2R A;  1QX8 A;  2N1T C;  4ZMD A;  1VQM P;  2JJL A;  1VF5 D;  1VQ4 P;  3A0H H;  3FWL A;  3V4Q A;  1KOR A;  4KT0 J;  1T3J A;  3MUD C;  2FYU D;  3EFG A;  1YQ3 C;  1KIL A;  4PD4 D;  4H0L B;  2D2C D;  1IZN B;  2HLD H;  3V4W A;  2JEE A;  5AW1 B;  2K9Y A;  5E79 E;  3R4Y A;  5AVQ B;  1NTM D;  3O6Q A;  2FFD B;  1PGQ A;  1L2P A;  3LW5 H;  3LW5 J;  1KMI Z;  1T6A A;  3EWK A;  4L76 A;  4NPF X;  1SQV J;  4R4L A;  3CCS P;  1G2C A;  3CPW O;  3Q3D A;  5AW4 B;  2KSE A;  1X22 A;  4OGQ C;  1LTJ C;  1LWU C;  3E7K A;  2W6A A;  4OVN F;  2RN0 A;  4RKU J;  2QJP C;  3F5H A;  3H1I J;  3G4S P;  1FS0 E;  5AVU B;  1BE3 D;  1LTB C;  1S72 P;  2IYO A;  3KYQ A;  1A02 J;  5AW2 B;  1BCC D;  1KQG B;  2AEF A;  2K3R A;  1VQP P;  3H25 A;  3F89 A;  1QL2 A;  3L75 E;  1NGM B;  1H0T A;  2R5B A;  3AEF C;  1MUU A;  3TF5 A;  1L0N D;  2M8R A;  2Y0D A;  2KNC B;  4H13 D;  2KYV A;  5M1B A;  4C7R A;  1JEK A;  3UIA A;  1JCC A;  1K73 Q;  1SQP E;  3VMZ A;  3T97 A;  1KQS O;  4GOD A;  1NTZ E;  2FXM A;  2W6B A;  3H1K G;  3I56 P;  1BGY G;  1USD A;  2WSC H;  4TT3 H;  1SQP K;  1FOS F;  4LC1 A;  4U3F J;  3C8V A;  1FZC C;  1AVY A;  2XKM A;  3FKS H;  3H1J E;  3L70 J;  2C9L Y;  2ZJS E;  3D71 A;  2ZYA A;  1QVF O;  3W67 A;  2KP8 A;  2WVR A;  2YMY A;  3SWY A;  1Y47 A;  3GHG A;  1DD4 A;  2N1T B;  4JYB A;  1W2B O;  1Q86 Q;  2H88 C;  3L37 A;  3WUT A;  2IX7 C;  2XU6 A;  3L74 D;  5B66 H;  1VQL P;  1JY2 P;  2KS1 B;  4Z1M H;  3H1L J;  3V6I A;  3TK1 A;  1KB9 D;  3L4F A;  3CCR P;  5CHX A;  2FYN C;  2WMM A;  1EQ7 A;  2ZAE B;  1HH0 A;  3L72 J;  1IK9 A;  3VMY A;  5APT A;  2CPB A;  2A06 E;  5B5E E;  2V7Q H;  2V7Q J;  2WPV B;  3SSU A;  2BCC G;  4JYC A;  1NTZ G;  3I5C A;  3B71 A;  2WTY A;  1Y9B A;  2E74 C;  3GW6 A;  2K37 A;  4W7Y A;  1VQ9 P;  3P7K A;  1PGJ A;  3CXH E;  3H1J G;  4OGQ B;  1N7L A;  1LTJ B;  4BRY A;  1FOS E;  4GIF A;  1P84 E;  1JMB A;  4IFM A;  2QJP B;  1PL5 A;  2E43 A;  1NAY A;  2Q7C A;  3Q2Y A;  1WMK A;  2KLU A;  2E76 B;  1IFJ A;  1M8O B;  1S9K D;  1OW7 A;  1MFZ A;  4IFD K;  5BU8 B;  5KJ7 D;  1Q81 Q;  4WY4 D;  3PHL A;  3TNU B;  1SQB G;  3CC4 P;  1J1D C;  3OW2 O;  3GMA A;  2OTK E;  1JY2 N;  5KLV G;  1NH4 A;  4PJ0 H;  1ZW0 A;  2NPS D;  2P10 A;  2HOD A;  1DX7 A;  5GTH H;  3EQ2 A;  3TGU D;  3VP9 A;  2HPC A;  3RL0 C;  1EDK A;  2KZI A;  1L0L G;  1FZC B;  3JC2 2;  1HVV A;  1EZV E;  3L71 D;  5KJ7 A;  4ASV A;  1GW4 A;  3AEB C;  4NPD A;  4UB6 H;  1GW3 A;  1G1J A;  3P8C D;  5C39 A;  3H32 B;  1LP1 A;  1FC2 C;  2GA1 A;  4I7Z C;  2L91 A;  4L74 A;  1K04 A;  2JWA A;  5H2F H;  3OA7 A;  1LT9 A;  3HE5 A;  2GUV A;  2NZ2 A;  1AFO A;  3A7O A;  4EIJ A;  1L4A B;  4K3A A;  3CWB E;  2P67 A;  2J58 A;  3HD7 C;  1HUC A;  5AVS B;  4EDF A;  3WMM 0;  1VQK P;  1ZR2 A;  1URQ D;  2HG5 D;  2OYI C;  1FDI A;  3ABV C;  1CI6 B;  3V2P A;  1T2K C;  1KYO I;  2E74 B;  2RMZ A;  1SQX G;  1HGV A;  1GL2 C;  1JMM A;  5B66 E;  3A0B E;  1RF0 C;  2OGU A;  5DJT B;  1ZRT E;  2B88 A;  1M57 D;  2J59 M;  2E5T A;  1SQQ E;  4AUW A;  3H1K J;  5AVY B;  1SQV D;  2K88 A;  3AE6 C;  1KIL E;  4NPE A;  1GU5 A;  2YKQ A;  1YTZ T;  1LTA C;  1YHQ P;  1OWA A;  1SQQ K;  3MP7 B;  3QH9 A;  3FXD A;  4JQ0 D;  3H6P A;  4H0L D;  1VQO P;  4DJG A;  2JO1 A;  1GTW A;  3CWB G;  1JY3 N;  2N9B A;  3KHU A;  4C7N B;  3L75 J;  2LXB A;  5CCG A;  1XTG B;  4EYY Q;  1IFD A;  3R2P A;  1LTG C;  2R44 A;  1OW6 A;  2W8Z A;  2AEJ A;  1NU1 G;  1CZQ A;  3ITK A;  3RL0 B;  4EI2 A;  1OFC X;  1N73 B;  4LLH A;  1SQP J;  4WBA A;  1NTM E;  3HTK B;  1RF1 C;  1FZB A;  3OE7 H;  3QWO C;  3JSV C;  1LT1 A;  1NTZ J;  1OW8 A;  4QMA A;  1PPJ D;  2WSS H;  2I1K A;  3AE9 C;  5DJU B;  5AVT B;  3KZI H;  1N7S A;  3C1L A;  3KXD A;  3GLM A;  3H1J J;  3KPE A;  4I7Z B;  2FFD A;  3L70 D;  2ZYG A;  2I1J A;  1KN7 A;  1N86 A;  1KYO H;  3GF7 A;  2A45 I;  1VQ7 P;  3PJS K;  1MKM A;  1GD2 E;  1JCD A;  1E5W A;  1H89 A;  1NTK E;  2OAR A;  2WSF H;  1BCC E;  2WSF J;  5BVZ A;  3HD7 B;  5KAI H;  5AW7 B;  1NJI Q;  4KJM A;  3RK3 E;  3H1L D;  2OYI B;  1NTK K;  1GZL A;  4OH8 B;  1SQB J;  3AE2 C;  1NAF A;  1YBK A;  2HFE D;  3L72 D;  1GL2 B;  2KSJ A;  5CMZ A;  2Q9I A;  1VQ8 P;  5B5E H;  3CLQ A;  1NTM G;  3CX5 I;  2ITA A;  3IF4 A;  5CCH D;  2W27 A;  1EDJ A;  4PV1 C;  1OMI A;  1PP9 E;  2Z5I A;  4UB8 H;  2ZYD A;  1SVF A;  3CXH H;  1SFC B;  2N1T D;  4Y99 C;  1AA0 A;  1ZLL A;  2KI7 B;  2QEX P;  4ZKP A;  2R3C A;  1P84 H;  2QA4 P;  2O01 H;  2O01 J;  3RGU A;  1Q90 D;  1RE3 C;  2MKV A;  3OFN H;  5L8R J;  1NTK G;  2W6J H;  1BCC G;  3H1K E;  5APY A;  1BGY E;  1IC2 A;  1GK4 A;  3HE4 A;  1M1J A;  4WVZ A;  2OQQ A;  2WPS A;  2OYO A;  3E1R A;  1YJW P;  1R8E A;  1IFM A;  3B5N B;  4YPC A;  1N2D C;  3USS A;  1YQ4 C;  3AE8 C;  3S4R A;  4W80 A;  2RH0 A;  1KZU B;  3MUD A;  1M1K Q;  1OVU A;  1M90 Q;  1RF1 B;  4IOI H;  4OGQ D;  1USE A;  2QE7 H;  5KAF H;  1JY3 O;  2QJY B; 
#chains in the Genus database with same CATH homology
 3FKS H;  3OFN H;  1H8E H;  2CK3 H;  1AQT A;  1BSH A;  3USS A;  5DN6 I;  2V7Q H;  2RQ7 A;  1IFP A;  2W6J H;  3EFF K;  2RQ6 A;  2E5T A;  1E79 H;  3OE7 H;  1FS0 E;  3OEH H;  4WVZ A;  2E5Y A;  5FL7 H;  4QMA A;  3PJS K;  2XND H;  2XOK H;  2JDI H;  2WSS H;  4TLF A;  2HLD H;  4YXW H;  2QE7 H;  3OAA H;  4ASU H;  1BSN A;  1JEK A;  4DJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...