2E5YA

Epsilon subunit and atp complex of f1f0-atp synthase from the thermophilic bacillus ps3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the thermophilic F1-ATPase {varepsilon} subunit suggesting ATP-regulated arm motion of its C-terminal domain in F1
pubmed doi rcsb
source organism Bacillus sp. ps3
molecule tags Hydrolase
molecule keywords ATP synthase epsilon chain
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2e5yA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2e5yA01
4YXWH 4ASUH 2W6JH 1JEKA 4WVZA 1H8EH 2CK3H 1BSHA 2HLDH 2E5YA 3OAAH 2WSSH 2V7QH 3OE7H 3EFFK 5DN6I 4QMAA 2RQ6A 4TLFA 3FKSH 2RQ7A 2JDIH 1BSNA 1AQTA 4DJGA 1FS0E 2XNDH 1E79H 3OEHH 3PJSK 2QE7H 3OFNH 1IFPA 3USSA 2XOKH 5FL7H 2E5TA
chains in the Genus database with same CATH superfamily
2N9YB 1SQXJ 2ZYDA 1HTLC 2OYIC 3O6QA 5CCGA 3H1KE 1SLQA 1NVOA 3B5NA 3H1IE 1OFCX 2WSFH 1SQVK 1KFNA 2I8DA 1RQUA 4PV1B 1D7MA 2KIKA 1PIXA 2ZT9D 4K35A 3CCRP 3CC7P 2OTJP 1K8AQ 1N86A 2AEJA 2POHA 1RH5B 2FFDB 3CCMP 1OX3A 2WSSH 3CWBD 4W7ZA 5KAFH 3RK2B 5CJ0A 4RESB 1FZGA 1HJ0A 1XTGB 3GG2A 4H0LD 5AW1B 3II6A 1SQBE 3PH0A 1M7LA 5KLVK 5C39A 3Q5SA 2IYPA 1NTZK 2FYUE 5AW8B 1R5SA 2C0XA 2FYZA 1L0NE 3R2PA 5GTIE 4WY4B 4XFJA 2IX7C 1M1JB 1L0NK 5AVSB 4W80A 1SFCA 3FXEA 2OGUA 1OW7A 1J1EC 1NTZE 2FYUK 3H1JG 2IZ1A 3GLMA 3N7NA 3E1RA 3VTPC 3P8MC 1VQ7P 1FZFA 3FXDA 3CCLP 1SQXE 1LT1A 3AEGC 5CBNA 2B87B 1SFCD 4YXWH 2O01H 3LW5J 3SWYA 1LTSC 1M57D 1YQ4C 1IZNB 2BEQD 1OW8A 4C7RA 1EC5A 3TGUE 5CBOA 5AW7B 4PD4E 1YJ9P 3CCSP 2H43A 3L70E 2FXOA 4BRYA 3B5NC 2PRRA 3JCUE 2WMMA 3V2NA 1KZUB 4IOIH 2NPSC 4H44C 2JJLA 3H1HE 3L72E 4Y99C 5APVA 1FZCB 1Z56A 1N73C 1DEBA 1N7SA 4LLHA 4OGQD 1DH3A 2KXPB 1G2CB 1LT9A 1QLED 3CXHH 3H1JE 5DJTB 4Z1MH 3CMAP 4JPZB 2I1KA 2KK7A 3VOPA 2IPPA 1NAYA 3AECC 2R5BA 3WUUA 1FZCA 3GMAA 1EZVD 4N78E 3M0DC 1YQ3C 1JTHB 3NFQA 5E79E 5AVQB 1VQLP 5TISE 3FX0A 1AV1A 3AE2C 1VF5C 5KAIE 1VQMP 1PP9J 4U3FE 3NTNA 3B4SA 2E74C 2Q9IA 4R4MA 1M1JA 1HUCA 3C8VA 2Q3EA 4ASUH 4O9BA 1NH4A 4PD4H 3M0DA 3CPWO 1JMMA 1L4AD 2B88A 4EDFA 3OW2O 2H88C 2E76D 4WVZA 5BU8B 4D6TE 1A02F 1L0LD 1NU1D 2ZT9C 3L36A 1LT9C 2JR8A 1P84D 3U59A 2E74B 1KQGB 1N7SC 3AEEC 4UB6H 3CXHE 1M8OB 1A02J 2XU6A 3H6PA 4WY4A 3D6ZA 1L0LG 1NU1G 4LC1A 1SQQD 1FZEA 1PP9E 1W5CE 3L71D 2RMZA 1JY2O 3A2AA 2L91A 3TDKA 1BGYG 2P2UA 1SP4A 2Q3IA 5KAFE 1P84H 2IYOA 1SQVD 3H1LE 4LGDE 4L75A 1LWUC 1NTKE 3OFNH 1USDA 1SQBJ 1NHLA 1J1DB 2AXCA 3HE5A 1YHQP 1JCCA 2YO3A 2WPSA 1PZQA 4H13D 4NPDA 1IK9A 2N1TB 3H32A 1Q81Q 2A45I 2KB7P 3UIAA 2IBZE 1ZR2A 3MHVA 1YJWP 1VQPP 4PJ0H 1LWUB 1EXJA 2A06G 2FY8A 3H1KJ 3BCCJ 1FZAA 3FGAD 4TT3H 2ZVOB 1KN7A 3L72D 3L74E 2IDBA 1S1CX 3OAKA 3P32A 2P1JA 1X22A 4M3LA 2ITAA 2WITA 1M1KQ 1R5LA 3L74J 1NKNA 2KUBA 3SSUA 2YMYA 4UB8E 4XE5B 3NMDA 2QIWA 1IC2A 2WVRA 1BGYE 2H89C 5CHXA 2B87A 3SWKA 1BDCA 2QA4P 5APSA 3WUVA 1OIPA 3IAOA 4MN4C 1L0LK 1L4AA 1NU1K 3CCUP 2KS1A 2E75B 1ZOYC 2IFMA 2QJYB 3USSA 1SQXD 2FFDC 4K3AA 2WSEH 2RN0A 2HR3A 3KZIE 4ZMDA 2QG4A 3QH9A 2OQQA 5AVUB 4YTPC 3SFDC 2GM4A 5L8RJ 2Q7CA 1GW4A 1RE4A 1FDOA 2XDJA 3Q3DA 1LTJA 2ZAEB 2YXQB 2JEEA 1EXIA 2HYNA 3VMYA 2Q6QA 2I1JA 4I7ZB 4L73A 1K9MQ 4D6TD 4U3FG 3BVHA 1GD2E 2HLDH 1LTAC 3L37A 1ZR4A 1URQB 2K9YA 1CW5A 2AEFA 2FYUG 1N8RQ 3KDPB 3U1AA 3S1KA 3O6QB 4PD4I 5B5EH 3CWBG 5KLVG 3B5NB 1IK7A 1KYOH 1LP1B 1SQPE 2FXMA 1RE3C 4JF7A 2KSEA 4AYCA 1VQ5P 1NTZG 2WT7B 3N4XA 2DW3A 3MUDC 5AVTB 3L70D 2BCCE 3CL3D 2Z4EA 3TK1A 4N78D 3RBXA 2FFDA 3CC2P 1BE3J 3S9OA 1NJIQ 1OVUA 3HD7C 3HUSB 2M5AA 3I5CA 3FWNA 3PLNA 1FAVA 3R4YA 1PGOA 2Y9YA 3H1JD 3JC22 2AXTE 2YKQA 1EZVI 4U3FJ 1ZXGA 3I56P 1L0LE 1NU1E 5CCHC 1VQNP 2LR2A 2KZIA 3H1HD 2E75C 1T3UA 3VP8A 4YXDC 1J1EB 1P84I 2Y0EA 3CWBJ 3ZDMA 4IFDK 2LXBA 4PD4D 5FL7H 3CCVP 3JSVC 1W2EA 4IL6X 4WWIA 4PJ0E 1YBKA 1AQ5A 1JB0J 3L70J 1VF5B 2C0WA 2GA1A 3AE8C 1IFMA 1URQD 5AW5B 5KJ7D 3HE4A 1HBWA 1IFNA 3CWBE 2UWJE 2HFED 3ITKA 1S2EA 4GODA 4JYCA 2YIUC 3TNUA 2Z5IA 5GTHH 3H1LD 1OWAA 1QX8A 1SQPJ 2A06E 3H1IJ 5KLIC 2OYHC 3AE1C 3HE4B 5B66H 1EZVG 4C7NB 3HTKA 3H1ID 1T8ZA 4HYTB 3E7KA 2WT7A 1LWUA 1OVVA 2PGDA 1BCCE 2GUSA 2WSFJ 4C46A 1H89A 3LIEA 4AUWA 1H0TB 5APYA 1GU5A 1KB9D 4WBAA 2E42A 3KPEA 1L0ND 3WU2E 2WSEJ 3BRVB 1NTMD 2JWDA 5AVWB 1H0TA 1L0NJ 1OW6A 3MGNA 3BCCG 1VL2A 3KHUA 3L75D 1Q82Q 3A0HE 1MUUA 1U7MA 3B5ND 2KP8A 1JOCA 5GTIH 1EDLA 1S5LX 1K04A 4R4LA 1URQC 1ZLLA 5KJ7C 2R32A 5EFWB 4H0LC 4QMAA 2E74D 4BWNA 4DZOA 2ZVNB 1NTKJ 1SQQK 3E1IA 2M5AB 2K9JB 5AW3B 3PP5A 1T3JA 1SQQG 3L71G 1SQBD 2IFNA 1M1JC 2RKLA 2V4HA 1Q2NA 4XA4A 3VMZA 1RF1C 2FBWC 1QL2A 2WSCJ 5KLVE 2HPCB 1BCCJ 3D6YA 1H8AA 2GUVA 2ZXEB 3G9RA 2B9BA 1ZRTD 3RK3E 5BU5A 1PGQA 2O1KA 3CX5E 3V2RA 1N7LA 1KYOI 2B89A 4EYYQ 2P10A 3WU2H 1BE3E 3PHLA 3L75J 1N2DC 3L72G 3H1KD 3RL0B 1YIJP 3IF4A 2YO2A 4IL6E 3TGUJ 1N73A 3VYIA 2WPVB 1VDFA 1KILC 2Q1KA 2NPSA 3O8ZA 5AVVB 1RY3A 3EWKA 3L73E 3OJAB 4PV1D 3TNUB 1CZQA 4B86A 3M9BA 4DOJA 1OMIA 1LTBC 3CX5D 4ASVA 1N73B 4RO0A 5E79H 2ZXXA 4H13C 2H8PD 2YNYA 2NZ2A 1G1JA 3AE3C 4TLFA 1RF0A 5KAIH 1J1DC 1LGHB 2W6AA 1FS0E 4JBZA 5K5GB 2D2CD 4GT1A 4OWFA 1KILE 4ASWA 3BASA 1LTGC 3Q1MA 1AA0A 5CCGD 1WT6A 1QVGO 2XOKH 1NKZB 2OARA 1RHZB 1SQXK 2G8YA 1SFCC 4JYBA 3Q5RA 1HF9A 1SQXG 1VQ9P 1EDIA 4L76A 2SPZA 2HODB 3CD6P 2O01J 3A0BE 4D6TJ 1KQLA 2AEMA 1ZRTE 3OAAH 1SVFA 1HGZA 1NTME 1SQBK 5CMZA 1GK6A 1YITP 2L5GB 5KLVD 3RL0g 1NYHA 3IR9A 2FYNC 2YKPA 2QM7A 1NTZD 3S4RA 1GW3A 1FDMA 3L70G 2A45H 4I1LA 1GL2B 4GIFA 2QSIA 1LT9B 3LW5H 2LXCB 1PPJE 3M06A 1LNQA 1PPJD 2Z5HA 5CCGC 2FYUD 3IFMA 1VQOP 1ZV8A 2XNDH 3HD7D 2ZJSE 3HTKB 1AVOA 2Q5UA 2FYUJ 3PJSK 2OYIA 2ZFCA 5M1BA 1JTHA 2MKVA 3KXDA 3TSIA 2KLUA 2VRSA 2PAJA 1FZBA 2FXPA 2OYOA 2R44A 4AQRD 2WTYA 2Y0CA 3B71A 1ZN5A 1NGMB 3H1HJ 4CPGA 4Y99B 1KQFB 1FDIA 1IFDA 3L35A 3MIWA 2YMKA 5AVRB 3TYYA 3AE6C 3KYQA 2KZJA 2G3AA 2WQYC 2P58A 5KKZC 2IZ0A 1KQSO 1LTTC 4H0LB 2CPBA 5APXA 5H2FH 4I2LC 2BEZF 1VF5D 1GTWA 4UB8H 2E76B 1IJDB 4IFFA 3G4SP 3VMXA 1PGPA 5AW9B 2XV5A 5KLIB 1SS1A 4UB6E 3V6IA 2BASA 1AFOA 3RBZA 1JNMA 1IFIA 4NPFX 3RK2D 2RQ7A 2D2CB 2BCCJ 4OGQC 2JO1A 4HKZH 3M9QA 1N7SD 1Y8AA 2QE7H 2JWAA 2QRXA 1CSBA 1PP9G 3AEDC 4HJGH 3Q5PA 1S9KD 2M3EA 3HE5B 4EIJA 1BCCG 1SQPD 2E75D 4ZKUA 2QVAA 3H1LG 2ZYAA 1Q90D 1JY3P 1X8YA 5AVXB 2W6JH 2WZ7A 3W68A 2R5DA 4EOTA 2FYNB 3L75G 1JM0A 2A45G 2E5TA 1GK4A 2KSJA 4HH2A 1FJKA 1YTZI 2CPSA 1QVFO 1H8EH 3IN6A 4DT0A 1KFMA 3CMEP 3P7KA 4KHXA 3C9IA 1L0LJ 1NU1J 2QJPC 2BCCG 3AE4C 2O01N 3CX5I 1KYOD 1JY3O 2FKWB 3CCJP 1KB9E 1VQ6P 2RH0A 2WPQA 3RK2C 2QJKC 3V4QA 4GOFA 2OYIB 1K05A 2N1TA 3H32B 1K73Q 4L74A 2BCCD 2RQ6A 1S72P 3H1LJ 2W90A 4OVNF 1SQVJ 4WY4D 2JDIH 1DEEG 4W7YA 1JMBA 2AXTH 3W67A 3GHGB 3T97B 1J2JB 3CLQA 3GF7A 1NO4A 1T2KC 2HG5D 1BGYD 1YYCA 2WSCH 5KKZB 3SFEC 3G6EP 3WUTA 3VMAA 2M0BA 1USEA 1SQBG 2HODA 2M3BA 5AW2B 4NPEA 2KLVA 3BRTB 1NAFA 2J58A 1NTMJ 3MTUE 3GW6A 2N9BA 1CI6A 1VQ8P 1QGKB 2K3RA 1KILB 1HVVA 3L73G 1YTZT 3TF5A 3SWFA 3U1CA 1L4AB 1WMKA 2YIUB 3PRJA 3H25A 1IO4A 4BRYB 2IBZD 3RGUA 1QEXA 2A06D 3L72J 3L74D 3RK3C 1PFIA 3FWLA 3EFFK 4I7ZC 3TGUG 3CCEP 1EDJA 2NRGA 1NOHA 4KJMA 1G2CA 5H2FE 1OZHA 1LP1A 1VQKP 3MD0A 2KI7B 4RJTA 2W83C 1OVRA 1GU4A 4Y28J 2OTKE 4C7NA 1Y9BA 2QJYC 2WWWA 1JY3N 1JY2P 3GHGA 3M9HA 3T97A 3V2QA 4YPCA 2W27A 3AEBC 1PL5A 4GDOA 2XZRA 4U3FD 3A5TA 3CXHD 3NXSA 2E76C 1KD1Q 4PV1C 3AEFC 1RF0C 3CC4P 2N1TD 2QEXP 3M0AA 1U7JA 2E5YA 1KILD 1E5WA 1SQQE 3L71E 3QWOC 1BDDA 2KYVA 3K5BA 3PTZA 4KT0J 5AVZB 1MFZA 1XTCC 5KTBA 2C9NY 3ABVC 2PP6A 1PGJA 5KLVJ 1FOSF 4D6TG 1R8EA 2ZYGA 1KILA 1NTZJ 1X9VA 2XKMA 5AVYB 1NWQA 2J5UA 1OXZA 4IFMA 1KB9H 1IFJA 1BE3G 3GHGC 3EFGA 3KZIH 2P7JA 2K1AA 3MUDA 1DD3A 1EZVE 2R3SA 2JKVA 1PPJG 2KS1B 2YXRB 3AE9C 4JQ0D 5APTA 3I55P 1BE3D 1ZW0A 1GL2C 1M56D 1P84E 1KV4A 1RF1A 3BATA 3A7OA 2K88A 1RQVA 5BVZA 2QJPB 3VP9A 4U7JA 1GZLA 5AW4B 1AJYA 1KMIZ 3MZWB 3H1HG 3C1LA 1L2PA 1GDTA 5APUA 5B5EE 1S4XA 3G71P 1EDKA 1URQA 5KJ7A 1RE4C 3CCQP 1Q7YQ 1S5LH 1S9KE 1S3JA 1DIPA 1FC2C 3OA7A 1UIIA 3BCCE 1W2BO 1DX7A 2E43A 1G1IA 5APWA 5APQA 1L4AC 2O3JA 3HD7B 3HUSC 1E79H 3M91A 1SQPG 3H1IG 4OGQB 3H1JJ 1SQVE 3RK3D 5TJHA 1MFTA 1MKMA 1HWTC 1ZMEC 3A0BH 1EQ7A 1MV8A 2JP3A 1X0TA 3G3ZA 2C9LY 3Q2YA 4BXLA 1SFCB 2OYHA 2MJZA 1PP9D 2XNXA 1NTMG 3V5BA 1BCCD 4I6MC 4EI2A 1YI2P 3F89A 4HB1A 4GOEA 5CJ4A 1KC8Q 2OYHB 4GKGA 1S5LE 2N1TC 4RKUJ 1LTIC 1BSHA 3GF3A 2IBZI 1UIXA 2O1JA 3EQ2A 1L0NG 3AE5C 1FBMA 2K37A 3RL0C 1PV3A 1H88A 1FOSE 4IL6H 3MP7B 3OE7H 4ZNCA 3BCCD 1NTKD 1VQ4P 2QJKB 5DN6I 1Q86Q 1T6AA 5GTHE 1ZP0C 5AW6B 3B8EB 1NTKK 1KORA 1SQQJ 1VPCA 3L71J 3P8CD 2H7HA 3FKSH 1Y47A 2KNCA 1AQTA 1NTKG 2LKMA 2P67A 3AEAC 4DJGA 5B66E 2OTLP 1N7SB 1JUNA 1FU1A 1RF1B 3OEHH 1HGVA 1IFPA 3KQGA 5CCHA 1MZ9A 2KNCB 1KYOE 3D70A 1SQVG 3HUSA 3HD7A 1JO5A 3H1KG 3RK3B 2ZT9B 5CCHD 1JCDA 1NTMK 2NPSD 3CXHI 1X79B 3JCUH 2M8RA 4H44D 4N6JA 4WY4C 3A0HH 4A7PA 3HRNA 1JEKA 1AVYA 3F5HA 3VN0A 1LJ2A 1HJBA 1KB9I 1RE3A 2IBZG 3RL0D 2CK3H 3L74G 5DJUB 2D2CC 2QM8A 3LIDA 2PFXA 2HLOA 5AW0B 3TGUD 2KOGA 2W8ZA 1GL2D 1SQPK 1TU3F 2J59M 2W6BA 1T2KD 3D71A 4DCKA 2V7QH 1JY2N 1DD4A 3AE7C 3L4FA 2R3CA 3L73D 3V2PA 4WB4A 4ZKPA 3L73J 3V4WA 1M90Q 5TISH 2WPRA 1CI6B 2YKOA 1GL2A 2K9JA 4OH8B 1BGYJ 2Y9ZA 1LTJB 1U57A 1LTJC 1GMJA 1HH0A 3A3YB 1WRGA 3L75E 4N3YB 2V7QJ 1FJPA 1KTMA 1YJNP 1FZCC 2HPCA 2NPSB 4H44B 3CX5H 3WMM0 1QL1A 3P8CE 1BSNA 3CI9A 4H13B 1FE6A 2Y0DA
chains in the Genus database with same CATH topology
4YXWH 4ASUH 2W6JH 1JEKA 4WVZA 1H8EH 2CK3H 1BSHA 2HLDH 2E5YA 3OAAH 2WSSH 2V7QH 3OE7H 3EFFK 5DN6I 4QMAA 2RQ6A 4TLFA 3FKSH 2RQ7A 2JDIH 1BSNA 1AQTA 4DJGA 1FS0E 2XNDH 1E79H 3OEHH 3PJSK 2QE7H 3OFNH 1IFPA 3USSA 2XOKH 5FL7H 2E5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXW H;  4ASU H;  2W6J H;  1JEK A;  4WVZ A;  1H8E H;  2CK3 H;  1BSH A;  2HLD H;  2E5Y A;  3OAA H;  2WSS H;  2V7Q H;  3OE7 H;  3EFF K;  5DN6 I;  4QMA A;  2RQ6 A;  4TLF A;  3FKS H;  2RQ7 A;  2JDI H;  1BSN A;  1AQT A;  4DJG A;  1FS0 E;  2XND H;  1E79 H;  3OEH H;  3PJS K;  2QE7 H;  3OFN H;  1IFP A;  3USS A;  2XOK H;  5FL7 H;  2E5T A; 
#chains in the Genus database with same CATH topology
 2N9Y B;  1SQX J;  2ZYD A;  1HTL C;  2OYI C;  3O6Q A;  5CCG A;  3H1K E;  1SLQ A;  1NVO A;  3B5N A;  3H1I E;  1OFC X;  2WSF H;  1SQV K;  1KFN A;  2I8D A;  1RQU A;  4PV1 B;  1D7M A;  2KIK A;  1PIX A;  2ZT9 D;  4K35 A;  3CCR P;  3CC7 P;  2OTJ P;  1K8A Q;  1N86 A;  2AEJ A;  2POH A;  1RH5 B;  2FFD B;  3CCM P;  1OX3 A;  2WSS H;  3CWB D;  4W7Z A;  5KAF H;  3RK2 B;  5CJ0 A;  4RES B;  1FZG A;  1HJ0 A;  1XTG B;  3GG2 A;  4H0L D;  5AW1 B;  3II6 A;  1SQB E;  3PH0 A;  1M7L A;  5KLV K;  5C39 A;  3Q5S A;  2IYP A;  1NTZ K;  2FYU E;  5AW8 B;  1R5S A;  2C0X A;  2FYZ A;  1L0N E;  3R2P A;  5GTI E;  4WY4 B;  4XFJ A;  2IX7 C;  1M1J B;  1L0N K;  5AVS B;  4W80 A;  1SFC A;  3FXE A;  2OGU A;  1OW7 A;  1J1E C;  1NTZ E;  2FYU K;  3H1J G;  2IZ1 A;  3GLM A;  3N7N A;  3E1R A;  3VTP C;  3P8M C;  1VQ7 P;  1FZF A;  3FXD A;  3CCL P;  1SQX E;  1LT1 A;  3AEG C;  5CBN A;  2B87 B;  1SFC D;  4YXW H;  2O01 H;  3LW5 J;  3SWY A;  1LTS C;  1M57 D;  1YQ4 C;  1IZN B;  2BEQ D;  1OW8 A;  4C7R A;  1EC5 A;  3TGU E;  5CBO A;  5AW7 B;  4PD4 E;  1YJ9 P;  3CCS P;  2H43 A;  3L70 E;  2FXO A;  4BRY A;  3B5N C;  2PRR A;  3JCU E;  2WMM A;  3V2N A;  1KZU B;  4IOI H;  2NPS C;  4H44 C;  2JJL A;  3H1H E;  3L72 E;  4Y99 C;  5APV A;  1FZC B;  1Z56 A;  1N73 C;  1DEB A;  1N7S A;  4LLH A;  4OGQ D;  1DH3 A;  2KXP B;  1G2C B;  1LT9 A;  1QLE D;  3CXH H;  3H1J E;  5DJT B;  4Z1M H;  3CMA P;  4JPZ B;  2I1K A;  2KK7 A;  3VOP A;  2IPP A;  1NAY A;  3AEC C;  2R5B A;  3WUU A;  1FZC A;  3GMA A;  1EZV D;  4N78 E;  3M0D C;  1YQ3 C;  1JTH B;  3NFQ A;  5E79 E;  5AVQ B;  1VQL P;  5TIS E;  3FX0 A;  1AV1 A;  3AE2 C;  1VF5 C;  5KAI E;  1VQM P;  1PP9 J;  4U3F E;  3NTN A;  3B4S A;  2E74 C;  2Q9I A;  4R4M A;  1M1J A;  1HUC A;  3C8V A;  2Q3E A;  4ASU H;  4O9B A;  1NH4 A;  4PD4 H;  3M0D A;  3CPW O;  1JMM A;  1L4A D;  2B88 A;  4EDF A;  3OW2 O;  2H88 C;  2E76 D;  4WVZ A;  5BU8 B;  4D6T E;  1A02 F;  1L0L D;  1NU1 D;  2ZT9 C;  3L36 A;  1LT9 C;  2JR8 A;  1P84 D;  3U59 A;  2E74 B;  1KQG B;  1N7S C;  3AEE C;  4UB6 H;  3CXH E;  1M8O B;  1A02 J;  2XU6 A;  3H6P A;  4WY4 A;  3D6Z A;  1L0L G;  1NU1 G;  4LC1 A;  1SQQ D;  1FZE A;  1PP9 E;  1W5C E;  3L71 D;  2RMZ A;  1JY2 O;  3A2A A;  2L91 A;  3TDK A;  1BGY G;  2P2U A;  1SP4 A;  2Q3I A;  5KAF E;  1P84 H;  2IYO A;  1SQV D;  3H1L E;  4LGD E;  4L75 A;  1LWU C;  1NTK E;  3OFN H;  1USD A;  1SQB J;  1NHL A;  1J1D B;  2AXC A;  3HE5 A;  1YHQ P;  1JCC A;  2YO3 A;  2WPS A;  1PZQ A;  4H13 D;  4NPD A;  1IK9 A;  2N1T B;  3H32 A;  1Q81 Q;  2A45 I;  2KB7 P;  3UIA A;  2IBZ E;  1ZR2 A;  3MHV A;  1YJW P;  1VQP P;  4PJ0 H;  1LWU B;  1EXJ A;  2A06 G;  2FY8 A;  3H1K J;  3BCC J;  1FZA A;  3FGA D;  4TT3 H;  2ZVO B;  1KN7 A;  3L72 D;  3L74 E;  2IDB A;  1S1C X;  3OAK A;  3P32 A;  2P1J A;  1X22 A;  4M3L A;  2ITA A;  2WIT A;  1M1K Q;  1R5L A;  3L74 J;  1NKN A;  2KUB A;  3SSU A;  2YMY A;  4UB8 E;  4XE5 B;  3NMD A;  2QIW A;  1IC2 A;  2WVR A;  1BGY E;  2H89 C;  5CHX A;  2B87 A;  3SWK A;  1BDC A;  2QA4 P;  5APS A;  3WUV A;  1OIP A;  3IAO A;  4MN4 C;  1L0L K;  1L4A A;  1NU1 K;  3CCU P;  2KS1 A;  2E75 B;  1ZOY C;  2IFM A;  2QJY B;  3USS A;  1SQX D;  2FFD C;  4K3A A;  2WSE H;  2RN0 A;  2HR3 A;  3KZI E;  4ZMD A;  2QG4 A;  3QH9 A;  2OQQ A;  5AVU B;  4YTP C;  3SFD C;  2GM4 A;  5L8R J;  2Q7C A;  1GW4 A;  1RE4 A;  1FDO A;  2XDJ A;  3Q3D A;  1LTJ A;  2ZAE B;  2YXQ B;  2JEE A;  1EXI A;  2HYN A;  3VMY A;  2Q6Q A;  2I1J A;  4I7Z B;  4L73 A;  1K9M Q;  4D6T D;  4U3F G;  3BVH A;  1GD2 E;  2HLD H;  1LTA C;  3L37 A;  1ZR4 A;  1URQ B;  2K9Y A;  1CW5 A;  2AEF A;  2FYU G;  1N8R Q;  3KDP B;  3U1A A;  3S1K A;  3O6Q B;  4PD4 I;  5B5E H;  3CWB G;  5KLV G;  3B5N B;  1IK7 A;  1KYO H;  1LP1 B;  1SQP E;  2FXM A;  1RE3 C;  4JF7 A;  2KSE A;  4AYC A;  1VQ5 P;  1NTZ G;  2WT7 B;  3N4X A;  2DW3 A;  3MUD C;  5AVT B;  3L70 D;  2BCC E;  3CL3 D;  2Z4E A;  3TK1 A;  4N78 D;  3RBX A;  2FFD A;  3CC2 P;  1BE3 J;  3S9O A;  1NJI Q;  1OVU A;  3HD7 C;  3HUS B;  2M5A A;  3I5C A;  3FWN A;  3PLN A;  1FAV A;  3R4Y A;  1PGO A;  2Y9Y A;  3H1J D;  3JC2 2;  2AXT E;  2YKQ A;  1EZV I;  4U3F J;  1ZXG A;  3I56 P;  1L0L E;  1NU1 E;  5CCH C;  1VQN P;  2LR2 A;  2KZI A;  3H1H D;  2E75 C;  1T3U A;  3VP8 A;  4YXD C;  1J1E B;  1P84 I;  2Y0E A;  3CWB J;  3ZDM A;  4IFD K;  2LXB A;  4PD4 D;  5FL7 H;  3CCV P;  3JSV C;  1W2E A;  4IL6 X;  4WWI A;  4PJ0 E;  1YBK A;  1AQ5 A;  1JB0 J;  3L70 J;  1VF5 B;  2C0W A;  2GA1 A;  3AE8 C;  1IFM A;  1URQ D;  5AW5 B;  5KJ7 D;  3HE4 A;  1HBW A;  1IFN A;  3CWB E;  2UWJ E;  2HFE D;  3ITK A;  1S2E A;  4GOD A;  4JYC A;  2YIU C;  3TNU A;  2Z5I A;  5GTH H;  3H1L D;  1OWA A;  1QX8 A;  1SQP J;  2A06 E;  3H1I J;  5KLI C;  2OYH C;  3AE1 C;  3HE4 B;  5B66 H;  1EZV G;  4C7N B;  3HTK A;  3H1I D;  1T8Z A;  4HYT B;  3E7K A;  2WT7 A;  1LWU A;  1OVV A;  2PGD A;  1BCC E;  2GUS A;  2WSF J;  4C46 A;  1H89 A;  3LIE A;  4AUW A;  1H0T B;  5APY A;  1GU5 A;  1KB9 D;  4WBA A;  2E42 A;  3KPE A;  1L0N D;  3WU2 E;  2WSE J;  3BRV B;  1NTM D;  2JWD A;  5AVW B;  1H0T A;  1L0N J;  1OW6 A;  3MGN A;  3BCC G;  1VL2 A;  3KHU A;  3L75 D;  1Q82 Q;  3A0H E;  1MUU A;  1U7M A;  3B5N D;  2KP8 A;  1JOC A;  5GTI H;  1EDL A;  1S5L X;  1K04 A;  4R4L A;  1URQ C;  1ZLL A;  5KJ7 C;  2R32 A;  5EFW B;  4H0L C;  4QMA A;  2E74 D;  4BWN A;  4DZO A;  2ZVN B;  1NTK J;  1SQQ K;  3E1I A;  2M5A B;  2K9J B;  5AW3 B;  3PP5 A;  1T3J A;  1SQQ G;  3L71 G;  1SQB D;  2IFN A;  1M1J C;  2RKL A;  2V4H A;  1Q2N A;  4XA4 A;  3VMZ A;  1RF1 C;  2FBW C;  1QL2 A;  2WSC J;  5KLV E;  2HPC B;  1BCC J;  3D6Y A;  1H8A A;  2GUV A;  2ZXE B;  3G9R A;  2B9B A;  1ZRT D;  3RK3 E;  5BU5 A;  1PGQ A;  2O1K A;  3CX5 E;  3V2R A;  1N7L A;  1KYO I;  2B89 A;  4EYY Q;  2P10 A;  3WU2 H;  1BE3 E;  3PHL A;  3L75 J;  1N2D C;  3L72 G;  3H1K D;  3RL0 B;  1YIJ P;  3IF4 A;  2YO2 A;  4IL6 E;  3TGU J;  1N73 A;  3VYI A;  2WPV B;  1VDF A;  1KIL C;  2Q1K A;  2NPS A;  3O8Z A;  5AVV B;  1RY3 A;  3EWK A;  3L73 E;  3OJA B;  4PV1 D;  3TNU B;  1CZQ A;  4B86 A;  3M9B A;  4DOJ A;  1OMI A;  1LTB C;  3CX5 D;  4ASV A;  1N73 B;  4RO0 A;  5E79 H;  2ZXX A;  4H13 C;  2H8P D;  2YNY A;  2NZ2 A;  1G1J A;  3AE3 C;  4TLF A;  1RF0 A;  5KAI H;  1J1D C;  1LGH B;  2W6A A;  1FS0 E;  4JBZ A;  5K5G B;  2D2C D;  4GT1 A;  4OWF A;  1KIL E;  4ASW A;  3BAS A;  1LTG C;  3Q1M A;  1AA0 A;  5CCG D;  1WT6 A;  1QVG O;  2XOK H;  1NKZ B;  2OAR A;  1RHZ B;  1SQX K;  2G8Y A;  1SFC C;  4JYB A;  3Q5R A;  1HF9 A;  1SQX G;  1VQ9 P;  1EDI A;  4L76 A;  2SPZ A;  2HOD B;  3CD6 P;  2O01 J;  3A0B E;  4D6T J;  1KQL A;  2AEM A;  1ZRT E;  3OAA H;  1SVF A;  1HGZ A;  1NTM E;  1SQB K;  5CMZ A;  1GK6 A;  1YIT P;  2L5G B;  5KLV D;  3RL0 g;  1NYH A;  3IR9 A;  2FYN C;  2YKP A;  2QM7 A;  1NTZ D;  3S4R A;  1GW3 A;  1FDM A;  3L70 G;  2A45 H;  4I1L A;  1GL2 B;  4GIF A;  2QSI A;  1LT9 B;  3LW5 H;  2LXC B;  1PPJ E;  3M06 A;  1LNQ A;  1PPJ D;  2Z5H A;  5CCG C;  2FYU D;  3IFM A;  1VQO P;  1ZV8 A;  2XND H;  3HD7 D;  2ZJS E;  3HTK B;  1AVO A;  2Q5U A;  2FYU J;  3PJS K;  2OYI A;  2ZFC A;  5M1B A;  1JTH A;  2MKV A;  3KXD A;  3TSI A;  2KLU A;  2VRS A;  2PAJ A;  1FZB A;  2FXP A;  2OYO A;  2R44 A;  4AQR D;  2WTY A;  2Y0C A;  3B71 A;  1ZN5 A;  1NGM B;  3H1H J;  4CPG A;  4Y99 B;  1KQF B;  1FDI A;  1IFD A;  3L35 A;  3MIW A;  2YMK A;  5AVR B;  3TYY A;  3AE6 C;  3KYQ A;  2KZJ A;  2G3A A;  2WQY C;  2P58 A;  5KKZ C;  2IZ0 A;  1KQS O;  1LTT C;  4H0L B;  2CPB A;  5APX A;  5H2F H;  4I2L C;  2BEZ F;  1VF5 D;  1GTW A;  4UB8 H;  2E76 B;  1IJD B;  4IFF A;  3G4S P;  3VMX A;  1PGP A;  5AW9 B;  2XV5 A;  5KLI B;  1SS1 A;  4UB6 E;  3V6I A;  2BAS A;  1AFO A;  3RBZ A;  1JNM A;  1IFI A;  4NPF X;  3RK2 D;  2RQ7 A;  2D2C B;  2BCC J;  4OGQ C;  2JO1 A;  4HKZ H;  3M9Q A;  1N7S D;  1Y8A A;  2QE7 H;  2JWA A;  2QRX A;  1CSB A;  1PP9 G;  3AED C;  4HJG H;  3Q5P A;  1S9K D;  2M3E A;  3HE5 B;  4EIJ A;  1BCC G;  1SQP D;  2E75 D;  4ZKU A;  2QVA A;  3H1L G;  2ZYA A;  1Q90 D;  1JY3 P;  1X8Y A;  5AVX B;  2W6J H;  2WZ7 A;  3W68 A;  2R5D A;  4EOT A;  2FYN B;  3L75 G;  1JM0 A;  2A45 G;  2E5T A;  1GK4 A;  2KSJ A;  4HH2 A;  1FJK A;  1YTZ I;  2CPS A;  1QVF O;  1H8E H;  3IN6 A;  4DT0 A;  1KFM A;  3CME P;  3P7K A;  4KHX A;  3C9I A;  1L0L J;  1NU1 J;  2QJP C;  2BCC G;  3AE4 C;  2O01 N;  3CX5 I;  1KYO D;  1JY3 O;  2FKW B;  3CCJ P;  1KB9 E;  1VQ6 P;  2RH0 A;  2WPQ A;  3RK2 C;  2QJK C;  3V4Q A;  4GOF A;  2OYI B;  1K05 A;  2N1T A;  3H32 B;  1K73 Q;  4L74 A;  2BCC D;  2RQ6 A;  1S72 P;  3H1L J;  2W90 A;  4OVN F;  1SQV J;  4WY4 D;  2JDI H;  1DEE G;  4W7Y A;  1JMB A;  2AXT H;  3W67 A;  3GHG B;  3T97 B;  1J2J B;  3CLQ A;  3GF7 A;  1NO4 A;  1T2K C;  2HG5 D;  1BGY D;  1YYC A;  2WSC H;  5KKZ B;  3SFE C;  3G6E P;  3WUT A;  3VMA A;  2M0B A;  1USE A;  1SQB G;  2HOD A;  2M3B A;  5AW2 B;  4NPE A;  2KLV A;  3BRT B;  1NAF A;  2J58 A;  1NTM J;  3MTU E;  3GW6 A;  2N9B A;  1CI6 A;  1VQ8 P;  1QGK B;  2K3R A;  1KIL B;  1HVV A;  3L73 G;  1YTZ T;  3TF5 A;  3SWF A;  3U1C A;  1L4A B;  1WMK A;  2YIU B;  3PRJ A;  3H25 A;  1IO4 A;  4BRY B;  2IBZ D;  3RGU A;  1QEX A;  2A06 D;  3L72 J;  3L74 D;  3RK3 C;  1PFI A;  3FWL A;  3EFF K;  4I7Z C;  3TGU G;  3CCE P;  1EDJ A;  2NRG A;  1NOH A;  4KJM A;  1G2C A;  5H2F E;  1OZH A;  1LP1 A;  1VQK P;  3MD0 A;  2KI7 B;  4RJT A;  2W83 C;  1OVR A;  1GU4 A;  4Y28 J;  2OTK E;  4C7N A;  1Y9B A;  2QJY C;  2WWW A;  1JY3 N;  1JY2 P;  3GHG A;  3M9H A;  3T97 A;  3V2Q A;  4YPC A;  2W27 A;  3AEB C;  1PL5 A;  4GDO A;  2XZR A;  4U3F D;  3A5T A;  3CXH D;  3NXS A;  2E76 C;  1KD1 Q;  4PV1 C;  3AEF C;  1RF0 C;  3CC4 P;  2N1T D;  2QEX P;  3M0A A;  1U7J A;  2E5Y A;  1KIL D;  1E5W A;  1SQQ E;  3L71 E;  3QWO C;  1BDD A;  2KYV A;  3K5B A;  3PTZ A;  4KT0 J;  5AVZ B;  1MFZ A;  1XTC C;  5KTB A;  2C9N Y;  3ABV C;  2PP6 A;  1PGJ A;  5KLV J;  1FOS F;  4D6T G;  1R8E A;  2ZYG A;  1KIL A;  1NTZ J;  1X9V A;  2XKM A;  5AVY B;  1NWQ A;  2J5U A;  1OXZ A;  4IFM A;  1KB9 H;  1IFJ A;  1BE3 G;  3GHG C;  3EFG A;  3KZI H;  2P7J A;  2K1A A;  3MUD A;  1DD3 A;  1EZV E;  2R3S A;  2JKV A;  1PPJ G;  2KS1 B;  2YXR B;  3AE9 C;  4JQ0 D;  5APT A;  3I55 P;  1BE3 D;  1ZW0 A;  1GL2 C;  1M56 D;  1P84 E;  1KV4 A;  1RF1 A;  3BAT A;  3A7O A;  2K88 A;  1RQV A;  5BVZ A;  2QJP B;  3VP9 A;  4U7J A;  1GZL A;  5AW4 B;  1AJY A;  1KMI Z;  3MZW B;  3H1H G;  3C1L A;  1L2P A;  1GDT A;  5APU A;  5B5E E;  1S4X A;  3G71 P;  1EDK A;  1URQ A;  5KJ7 A;  1RE4 C;  3CCQ P;  1Q7Y Q;  1S5L H;  1S9K E;  1S3J A;  1DIP A;  1FC2 C;  3OA7 A;  1UII A;  3BCC E;  1W2B O;  1DX7 A;  2E43 A;  1G1I A;  5APW A;  5APQ A;  1L4A C;  2O3J A;  3HD7 B;  3HUS C;  1E79 H;  3M91 A;  1SQP G;  3H1I G;  4OGQ B;  3H1J J;  1SQV E;  3RK3 D;  5TJH A;  1MFT A;  1MKM A;  1HWT C;  1ZME C;  3A0B H;  1EQ7 A;  1MV8 A;  2JP3 A;  1X0T A;  3G3Z A;  2C9L Y;  3Q2Y A;  4BXL A;  1SFC B;  2OYH A;  2MJZ A;  1PP9 D;  2XNX A;  1NTM G;  3V5B A;  1BCC D;  4I6M C;  4EI2 A;  1YI2 P;  3F89 A;  4HB1 A;  4GOE A;  5CJ4 A;  1KC8 Q;  2OYH B;  4GKG A;  1S5L E;  2N1T C;  4RKU J;  1LTI C;  1BSH A;  3GF3 A;  2IBZ I;  1UIX A;  2O1J A;  3EQ2 A;  1L0N G;  3AE5 C;  1FBM A;  2K37 A;  3RL0 C;  1PV3 A;  1H88 A;  1FOS E;  4IL6 H;  3MP7 B;  3OE7 H;  4ZNC A;  3BCC D;  1NTK D;  1VQ4 P;  2QJK B;  5DN6 I;  1Q86 Q;  1T6A A;  5GTH E;  1ZP0 C;  5AW6 B;  3B8E B;  1NTK K;  1KOR A;  1SQQ J;  1VPC A;  3L71 J;  3P8C D;  2H7H A;  3FKS H;  1Y47 A;  2KNC A;  1AQT A;  1NTK G;  2LKM A;  2P67 A;  3AEA C;  4DJG A;  5B66 E;  2OTL P;  1N7S B;  1JUN A;  1FU1 A;  1RF1 B;  3OEH H;  1HGV A;  1IFP A;  3KQG A;  5CCH A;  1MZ9 A;  2KNC B;  1KYO E;  3D70 A;  1SQV G;  3HUS A;  3HD7 A;  1JO5 A;  3H1K G;  3RK3 B;  2ZT9 B;  5CCH D;  1JCD A;  1NTM K;  2NPS D;  3CXH I;  1X79 B;  3JCU H;  2M8R A;  4H44 D;  4N6J A;  4WY4 C;  3A0H H;  4A7P A;  3HRN A;  1JEK A;  1AVY A;  3F5H A;  3VN0 A;  1LJ2 A;  1HJB A;  1KB9 I;  1RE3 A;  2IBZ G;  3RL0 D;  2CK3 H;  3L74 G;  5DJU B;  2D2C C;  2QM8 A;  3LID A;  2PFX A;  2HLO A;  5AW0 B;  3TGU D;  2KOG A;  2W8Z A;  1GL2 D;  1SQP K;  1TU3 F;  2J59 M;  2W6B A;  1T2K D;  3D71 A;  4DCK A;  2V7Q H;  1JY2 N;  1DD4 A;  3AE7 C;  3L4F A;  2R3C A;  3L73 D;  3V2P A;  4WB4 A;  4ZKP A;  3L73 J;  3V4W A;  1M90 Q;  5TIS H;  2WPR A;  1CI6 B;  2YKO A;  1GL2 A;  2K9J A;  4OH8 B;  1BGY J;  2Y9Z A;  1LTJ B;  1U57 A;  1LTJ C;  1GMJ A;  1HH0 A;  3A3Y B;  1WRG A;  3L75 E;  4N3Y B;  2V7Q J;  1FJP A;  1KTM A;  1YJN P;  1FZC C;  2HPC A;  2NPS B;  4H44 B;  3CX5 H;  3WMM 0;  1QL1 A;  3P8C E;  1BSN A;  3CI9 A;  4H13 B;  1FE6 A;  2Y0D A; 
#chains in the Genus database with same CATH homology
 4YXW H;  4ASU H;  2W6J H;  1JEK A;  4WVZ A;  1H8E H;  2CK3 H;  1BSH A;  2HLD H;  2E5Y A;  3OAA H;  2WSS H;  2V7Q H;  3OE7 H;  3EFF K;  5DN6 I;  4QMA A;  2RQ6 A;  4TLF A;  3FKS H;  2RQ7 A;  2JDI H;  1BSN A;  1AQT A;  4DJG A;  1FS0 E;  2XND H;  1E79 H;  3OEH H;  3PJS K;  2QE7 H;  3OFN H;  1IFP A;  3USS A;  2XOK H;  5FL7 H;  2E5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...