2E5YA

Epsilon subunit and atp complex of f1f0-atp synthase from the thermophilic bacillus ps3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the thermophilic F1-ATPase {varepsilon} subunit suggesting ATP-regulated arm motion of its C-terminal domain in F1
pubmed doi rcsb
source organism Bacillus sp. ps3
molecule tags Hydrolase
molecule keywords ATP synthase epsilon chain
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 2e5yA02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2e5yA01
3OE7H 1BSHA 3FKSH 4DJGA 4QMAA 2HLDH 1IFPA 4YXWH 5DN6I 2XNDH 2WSSH 3EFFK 2E5TA 1E79H 2W6JH 2RQ6A 2XOKH 1JEKA 3OEHH 3OFNH 3USSA 2QE7H 3OAAH 5FL7H 2V7QH 4ASUH 2JDIH 4WVZA 3PJSK 2E5YA 1AQTA 4TLFA 2CK3H 1BSNA 2RQ7A 1FS0E 1H8EH
chains in the Genus database with same CATH superfamily
1QEXA 1SQVK 1PP9E 5AVZB 4AQRD 2HLDH 1SQXD 4U7JA 4I6MC 3H1ID 1OX3A 1JY3O 1L0NE 1ZR2A 1VQ4P 1BE3J 5DN6I 4WY4D 1KQGB 2WPSA 1X79B 2FKWB 3GG2A 2B89A 1FZCA 3RK2C 1SQBE 2N9BA 1G1JA 4HB1A 2FFDC 3A0BE 2QSIA 1RQUA 3TGUG 2AXTH 2BEZF 3B4SA 2IZ0A 3O8ZA 5KLIC 3BCCE 3LIEA 1VQLP 3HTKB 1NTMJ 1PPJD 1J1DB 1W5CE 3KPEA 4EI2A 1K73Q 2YXQB 1LGHB 2P58A 2C9LY 2K9YA 2HPCA 3RBZA 2W6BA 4Y99B 1N73A 1FZBA 3HTKA 3JCUH 2KS1A 3M0DC 1NWQA 3D71A 2Q9IA 1FZEA 3RK2B 4I2LC 2HG5D 3OE7H 4DJGA 1OWAA 3L70E 1NGMB 2PAJA 2WQYC 4HH2A 3H25A 1SQPJ 1VQ8P 1OMIA 1SQXJ 2Q5UA 2ZVOB 3CXHE 5CCGC 1H8AA 1EDJA 1NYHA 2ZFCA 2IYOA 1NKNA 2O01H 3BRVB 3CL3D 3MHVA 4LC1A 5AVYB 4BRYA 1LNQA 1OVRA 2N9YB 4EOTA 3KXDA 1KB9D 1GU5A 5AW5B 1N86A 3G71P 1KILC 2PP6A 2E75D 2BCCE 2WPQA 2KYVA 1FOSE 4ASUH 4Z1MH 5L8RJ 4GKGA 2Y0DA 3L72J 3PRJA 5APSA 2Y9ZA 1G2CA 1L0NJ 4Y99C 1M1JA 1FJPA 1PV3A 1QL1A 3HUSC 4H0LD 3W67A 1NTZD 2ZYGA 1FDOA 3OA7A 1KN7A 4DT0A 3UIAA 2O1KA 1RE4A 2KZIA 3T97A 3CCRP 2KZJA 1Y9BA 1ZXGA 3C9IA 3F89A 5DJTB 1OVUA 1WT6A 5GTHH 3H1JE 1U57A 3NXSA 1KILB 1SQBD 2ZXXA 2E74C 3C8VA 5BU8B 5BVZA 5KLVK 2OYIC 1PP9D 3H6PA 2JJLA 2YXRB 4R4LA 4NPEA 1N73C 1FDMA 1MFTA 2BCCJ 3BRTB 2R44A 4JF7A 2WSFH 1K8AQ 1JEKA 1MKMA 2IZ1A 4EYYQ 2O3JA 3AE7C 1OW7A 3OAAH 4N6JA 1S1CX 3WMM0 1KC8Q 2GA1A 1KYOE 3H1KG 4GOEA 1QVFO 1GL2A 3GF7A 1S9KD 2E5YA 3H1KD 4H0LC 2FYUJ 1LT9C 2R32A 3CD6P 2IBZD 2PFXA 2DW3A 3TNUA 5CBOA 5AW4B 4D6TD 3TYYA 1RE3C 1Q82Q 3VMAA 1S72P 5AVRB 1SFCB 1DX7A 3RL0C 2A45G 4H44C 3H32B 2G8YA 3SFDC 2FBWC 4UB6E 1NTKJ 1PPJG 2J5UA 3GW6A 2WT7A 1T8ZA 1X0TA 3MGNA 4U3FJ 4Y28J 1UIIA 1SQVD 3I55P 3L36A 2V4HA 2GUSA 3MP7B 2RH0A 1W2BO 2WT7B 1LT9A 3OFNH 4W80A 1BCCG 1SQQG 2HR3A 1NTKE 4U3FD 1Z56A 2V7QH 1RE3A 3RK3D 1SQXG 4C7RA 3H1IG 1K04A 4M3LA 2HODB 2BEQD 1A02F 3CI9A 5AW3B 3CCVP 5CCHD 3SSUA 3CCSP 1SFCD 3VMXA 4DCKA 1DD4A 4XFJA 5AVWB 2RQ7A 1JMBA 4OH8B 4TT3H 5AVTB 2WSCH 1Q86Q 1H8EH 4IL6E 1NTZE 1FAVA 2XDJA 3HE5B 3S4RA 3FKSH 5FL7H 2WSCJ 2NPSA 1R5SA 2ITAA 1IFNA 1CI6A 1IFIA 2QVAA 2XNDH 1JTHA 1SQVJ 1JB0J 2D2CB 1HJ0A 3H1HJ 4GDOA 3HUSB 1NTZG 3QH9A 1JUNA 3L70G 2Z4EA 1KILA 1SQXE 2K88A 3KDPB 2IYPA 1KB9H 1X22A 1RF1B 1SQBJ 1G1IA 1L2PA 2WMMA 4UB8H 3CMEP 1QLED 2JDIH 1SQBG 2ZYAA 3E1RA 3PJSK 1FDIA 1HVVA 3PH0A 3Q5RA 1KQSO 2KSJA 1AQTA 4CPGA 1HH0A 1IFJA 1YI2P 3AEFC 3V6IA 3P8CE 1NTZJ 1MFZA 3AE1C 1KD1Q 4KJMA 3RBXA 1GL2B 1EXIA 3HRNA 1SQQK 3L72G 1N7SB 1NTME 4LGDE 2Y9YA 3NMDA 3CWBJ 3OAKA 2KP8A 1HWTC 5KKZC 2M3BA 2QJKC 2YIUC 3CWBG 1PGOA 2N1TB 3V2QA 1AVYA 3B5NB 5AW6B 1URQC 1GK6A 1SQBK 2I8DA 3L74D 3PTZA 1E79H 5AW7B 3RL0D 3L73E 1XTCC 1GW3A 2P10A 2N1TD 1TU3F 3CC2P 3O6QA 2J59M 2XU6A 2YMYA 3IN6A 2LXBA 3EWKA 1L0NK 2A45H 3B5NA 1PIXA 2M8RA 5KLIB 1IFDA 2L5GB 4B86A 5E79E 1FU1A 1IC2A 1SQPD 2ZJSE 4RO0A 1S5LH 1N2DC 1NAFA 1RY3A 1GK4A 1IK7A 1VDFA 4PV1C 1ZRTD 2R5DA 4TLFA 5C39A 4H0LB 1BSNA 2OYHA 1VQNP 1M56D 2KK7A 2Z5IA 2PGDA 1CZQA 2QEXP 1USDA 3WUUA 1H88A 4QMAA 1DH3A 3H1HG 4JQ0D 3AEDC 2M5AA 5AVVB 1FZCC 3LIDA 3CCMP 3P8CD 4IL6X 2Q7CA 4KT0J 3B5NC 1JY2O 3HD7A 5CCGA 5GTIH 2ZYDA 1Q90D 3GLMA 2QJKB 1OIPA 3VYIA 4EDFA 3TDKA 3CXHD 5KTBA 1Q81Q 3VMZA 4IFFA 1KTMA 1J2JB 1P84H 1SFCA 3M06A 5AVSB 2A06D 3S9OA 1IJDB 4LLHA 4WY4B 3H1KJ 1NU1E 1RF0C 3IAOA 1VQMP 1EXJA 1S5LE 3GMAA 1GDTA 1P84D 4OGQB 2K37A 2ZXEB 3H1IJ 2E43A 4O9BA 3L70J 3KZIH 1VF5C 1BCCJ 1SQQE 1SQPK 2WZ7A 3A3YB 1NU1G 3L71G 3A7OA 1RQVA 3PLNA 1HUCA 1JY2N 2FYUE 2P1JA 1X9VA 2JO1A 3L71D 3E7KA 3L75D 3RGUA 4A7PA 4NPDA 2FYNC 4ZNCA 1RF1A 2GM4A 1H0TB 3HE4B 3H1KE 1YTZI 2HPCB 2YNYA 1IO4A 1FJKA 4ZKPA 1FE6A 4JPZB 2ZT9C 4N78D 1NJIQ 2BASA 1BCCD 2OYIA 1KV4A 5GTIE 3VMYA 1GMJA 3MTUE 3EFGA 1D7MA 3HE4A 2KLUA 1LWUC 2A06E 2R3SA 3GF3A 2Y0EA 4PV1D 3RK3E 3VN0A 1WRGA 2D2CD 2QM8A 1P84E 1AJYA 3BCCG 3H1JJ 5AW1B 1EQ7A 5TJHA 2P67A 1S2EA 3L73G 4HJGH 2W8ZA 4GIFA 1M1JC 3L37A 3M9HA 3ABVC 3V2RA 5B5EE 1EDLA 1M8OB 2ZT9B 2WVRA 3AE9C 3AEBC 3BASA 1VF5D 4PJ0E 4UB6H 1CI6B 1NOHA 2AEJA 2GUVA 5AW0B 3Q1MA 1ZMEC 2CPBA 4YXWH 1VQ6P 2IX7C 3TGUD 2KB7P 2K1AA 4L76A 4W7ZA 2FYNB 2KI7B 3FX0A 3L71J 1FBMA 4C7NB 1S9KE 1ZN5A 2E75C 3L70D 4JYBA 3CCQP 1LTBC 1FZGA 5KJ7D 5CJ0A 1MV8A 4PD4H 2FFDA 1LWUA 1BDCA 4ASVA 1XTGB 4D6TJ 4K3AA 3CC7P 2B88A 3MD0A 1Y8AA 2I1KA 4NPFX 3VP8A 1EC5A 1G2CB 3CXHH 1YBKA 1GL2D 5H2FE 5AVXB 1YYCA 3M0AA 3VTPC 1YQ3C 2LR2A 2RQ6A 2M5AB 2XOKH 3CCUP 3V5BA 1USEA 3TF5A 3RK3C 2OTJP 1LTJC 1PP9G 1YITP 1HGVA 1VQ9P 1KORA 3WU2H 5GTHE 3ITKA 1EDKA 2QM7A 1JCCA 1AVOA 1HF9A 3TGUJ 3L74J 2WSFJ 3H1HD 3V2NA 5KLVG 1FZCB 1IZNB 4OVNF 5KAIE 1SQQJ 2QRXA 2BCCG 2K9JA 3N7NA 4BXLA 5KJ7C 1YIJP 1NAYA 4I7ZC 3PP5A 3CXHI 3HD7D 1NTZK 4D6TG 1KB9E 3AECC 3AE5C 3H1LJ 3TNUB 3D6ZA 4PD4D 2FY8A 3JC22 1L0LD 1LJ2A 1VPCA 4UB8E 4L73A 1SP4A 2A06G 1URQD 3TK1A 3TGUE 4PD4I 4WBAA 1Q7YQ 1OFCX 2FXPA 2LKMA 1ZOYC 4WY4A 1DD3A 1FZAA 1NTMK 2XNXA 3L75G 2QIWA 1SFCC 3USSA 5CCHC 2O01J 2WWWA 4ZMDA 1BE3E 1KILE 1J1EC 4GT1A 4ASWA 1H0TA 1RF0A 1U7JA 2SPZA 2YO3A 3M0DA 2H88C 2PRRA 3GHGA 4JBZA 2YMKA 1KYOH 4OGQD 4U3FG 2OYHB 5AW8B 1LT9B 4XA4A 4YTPC 3N4XA 1MZ9A 3H1LE 1E5WA 2QG4A 3HD7B 2KUBA 3JCUE 2QA4P 1OW8A 2HYNA 2O1JA 1ZV8A 2NPSC 2V7QJ 3WUTA 1GL2C 4H44B 1Y47A 4I1LA 1S3JA 2AXTE 3P7KA 5AVUB 1BSHA 1MUUA 3KYQA 4K35A 3H1LG 3R4YA 1EZVG 4L75A 3PHLA 5CCHA 4C7NA 3NTNA 1J1EB 4RJTA 1AV1A 1EZVD 2YIUB 2OTKE 3L73D 4R4MA 1M1JB 4BWNA 1SLQA 5TISH 2KXPB 1K05A 2LXCB 1FC2C 4H44D 1N7SC 2NPSB 1NU1D 2YKQA 2W27A 3MUDC 3Q5PA 1SQPE 1L4AB 1KQFB 1LWUB 1VQ7P 3HE5A 3D70A 1JY3P 1SQVG 2FXMA 1JOCA 1JY3N 1UIXA 2KIKA 2KS1B 3AE8C 1QL2A 1RE4C 1OVVA 2B9BA 1JMMA 2WPRA 2Y0CA 3OJAB 1JTHB 1DEEG 2IFNA 3V2PA 2R5BA 3WU2E 2KNCB 2E76B 1KYOD 2CK3H 1NVOA 2NPSD 3L71E 3G4SP 2C9NY 1QX8A 3H1JG 3BATA 5AW2B 2Q6QA 4KHXA 2JR8A 2WSEJ 3AE2C 3H1IE 2VRSA 3L4FA 3ZDMA 3SFEC 4IFDK 1N8RQ 4EIJA 1L0NG 2WSEH 1BCCE 2POHA 3P32A 2JEEA 2ZT9D 4IFMA 1ZR4A 3R2PA 1GTWA 1M57D 2IBZE 2NZ2A 1LTJB 2AEFA 1RH5B 2HFED 1U7MA 3MUDA 3BCCD 1HTLC 5CBNA 2FFDB 3CCEP 1VL2A 2K9JB 3L72D 1BGYD 1L4AD 2YO2A 3A2AA 4JYCA 2XKMA 2RKLA 3B71A 1AFOA 2IBZG 2JKVA 1LTJA 2K3RA 5APYA 4OWFA 3VP9A 1VQPP 3WUVA 1VQOP 2MKVA 2OARA 3A0HE 4DOJA 2H43A 2B87B 3L75E 5BU5A 1NU1K 2C0WA 4WVZA 1AQ5A 3CX5H 2KLVA 3NFQA 3CPWO 1PZQA 2HLOA 2NRGA 3M9QA 1J1DC 3I5CA 1EZVI 3II6A 3A0BH 4N78E 1PP9J 5K5GB 2QJYB 3A5TA 1PFIA 3B5ND 2OGUA 4ZKUA 3O6QB 3BVHA 1URQB 3L35A 3P8MC 2P2UA 1YTZT 1KZUB 4H13D 1CW5A 1M90Q 3CCJP 2O01N 1NH4A 2FYUD 5KKZB 3Q3DA 3IR9A 2HODA 2Q1KA 1SQQD 5KAIH 4N3YB 2J58A 2WSSH 4PJ0H 1NU1J 1EDIA 1IK9A 5M1BA 2BCCD 2KOGA 2IBZI 1HBWA 1SQVE 2OYOA 2WITA 3OEHH 3SWFA 3A0HH 2OYHC 3W68A 3RK2D 3GHGC 3H32A 3SWYA 3LW5H 1N7SA 4GOFA 3V4QA 3U1CA 2N1TC 3AEGC 3E1IA 2H89C 1KFNA 5DJUB 1K9MQ 2UWJE 3KZIE 1L0LG 4MN4C 4W7YA 2QJYC 2CPSA 1P84I 3CX5D 3U1AA 2QJPC 4WWIA 3HUSA 5KAFE 2M0BA 1HJBA 1FOSF 1LTIC 5APQA 3S1KA 3CCLP 3HD7C 1JCDA 2I1JA 2A45I 4IOIH 1JM0A 2E76D 1FS0E 5CHXA 5H2FH 1A02J 1L0LE 4IL6H 5CMZA 1YJNP 1FZFA 1T3UA 1NHLA 3FWLA 2H7HA 2D2CC 1ZW0A 3QWOC 4YPCA 1T2KC 2JWAA 1IFPA 1N73B 3Q2YA 3MZWB 3L74E 1NKZB 3MIWA 5APTA 1Q2NA 3FWNA 1GZLA 1IFMA 2QJPB 2JP3A 3F5HA 2KSEA 3IF4A 3L73J 2FYZA 1GD2E 3V4WA 1WMKA 1KMIZ 1GW4A 3BCCJ 3L75J 1JNMA 3CC4P 1LP1A 3I56P 1NTKK 3B8EB 3H1HE 1YHQP 1LT1A 5B66E 3FXEA 1ZRTE 4L74A 1VF5B 3AEEC 1AA0A 1DEBA 2QE7H 3H1JD 1YQ4C 3K5BA 4D6TE 3CLQA 1H89A 1LTAC 3G3ZA 4DZOA 3H1LD 3VOPA 4H13C 3RK3B 4C46A 2OTLP 5APVA 1L0LJ 1W2EA 1VQKP 1T2KD 1S4XA 4I7ZB 2W90A 2E76C 2XZRA 5AW9B 1N7LA 2P7JA 2Z5HA 2Q3EA 2IDBA 1ZLLA 1BGYJ 4RESB 2IPPA 2L91A 3L74G 5KLVJ 2XV5A 1L4AA 3FGAD 3RL0g 3D6YA 1NTKG 2AXCA 3EQ2A 1NTMG 1KILD 2M3EA 3C1LA 2WPVB 3JSVC 1NTKD 1PL5A 1JY2P 1NTMD 3LW5J 3M91A 4RKUJ 3TSIA 5KAFH 1DIPA 2KNCA 2Q3IA 3KHUA 3RL0B 1QVGO 5B66H 4YXDC 2RN0A 4XE5B 4PV1B 2AEMA 3T97B 1LTGC 4PD4E 3G9RA 1HGZA 1LTTC 1QGKB 4WB4A 1KFMA 1BE3G 5EFWB 1RHZB 4HYTB 5B5EH 1SVFA 1PGPA 2G3AA 1BE3D 5KJ7A 1S5LX 3CMAP 3AE4C 4U3FE 1L0ND 2E75B 1PGQA 1PPJE 2N1TA 2E74D 4H13B 3CX5I 5APWA 1KQLA 1KYOI 4BRYB 1BGYG 3G6EP 1SQXK 2RMZA 2FYUK 5TISE 1BDDA 2MJZA 5KLVD 2H8PD 2E74B 2R3CA 3KQGA 2W6AA 1R8EA 3CX5E 2OQQA 1X8YA 2B87A 1SS1A 2FXOA 2YKPA 1LTSC 2ZVNB 3CWBD 4HKZH 5E79H 2ZAEB 1JO5A 5APUA 2YKOA 1N7SD 3FXDA 1YJWP 1NO4A 3EFFK 1ZP0C 5CJ4A 2C0XA 3M9BA 2E5TA 2W6JH 1R5LA 1L4AC 1OW6A 2IFMA 3AE3C 1URQA 3Q5SA 1M1KQ 4WY4C 2W83C 1EZVE 5APXA 1SQPG 4AUWA 5CCGD 3SWKA 3OW2O 2FYUG 1LP1B 5KLVE 5AVQB 2WTYA 4AYCA 1M7LA 1BGYE 1RF1C 1VQ5P 3AEAC 2OYIB 2E42A 3CWBE 1PGJA 2JWDA 3U59A 3AE6C 1YJ9P 1KB9I 1OZHA 3IFMA 3GHGB 1GU4A 1OXZA 1T6AA 3L72E 1T3JA 4GODA 1L0LK 1CSBA 4OGQC
chains in the Genus database with same CATH topology
3OE7H 1BSHA 3FKSH 4DJGA 4QMAA 2HLDH 1IFPA 4YXWH 5DN6I 2XNDH 2WSSH 3EFFK 2E5TA 1E79H 2W6JH 2RQ6A 2XOKH 1JEKA 3OEHH 3OFNH 3USSA 2QE7H 3OAAH 5FL7H 2V7QH 4ASUH 2JDIH 4WVZA 3PJSK 2E5YA 1AQTA 4TLFA 2CK3H 1BSNA 2RQ7A 1FS0E 1H8EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OE7 H;  1BSH A;  3FKS H;  4DJG A;  4QMA A;  2HLD H;  1IFP A;  4YXW H;  5DN6 I;  2XND H;  2WSS H;  3EFF K;  2E5T A;  1E79 H;  2W6J H;  2RQ6 A;  2XOK H;  1JEK A;  3OEH H;  3OFN H;  3USS A;  2QE7 H;  3OAA H;  5FL7 H;  2V7Q H;  4ASU H;  2JDI H;  4WVZ A;  3PJS K;  2E5Y A;  1AQT A;  4TLF A;  2CK3 H;  1BSN A;  2RQ7 A;  1FS0 E;  1H8E H; 
#chains in the Genus database with same CATH topology
 1QEX A;  1SQV K;  1PP9 E;  5AVZ B;  4AQR D;  2HLD H;  1SQX D;  4U7J A;  4I6M C;  3H1I D;  1OX3 A;  1JY3 O;  1L0N E;  1ZR2 A;  1VQ4 P;  1BE3 J;  5DN6 I;  4WY4 D;  1KQG B;  2WPS A;  1X79 B;  2FKW B;  3GG2 A;  2B89 A;  1FZC A;  3RK2 C;  1SQB E;  2N9B A;  1G1J A;  4HB1 A;  2FFD C;  3A0B E;  2QSI A;  1RQU A;  3TGU G;  2AXT H;  2BEZ F;  3B4S A;  2IZ0 A;  3O8Z A;  5KLI C;  3BCC E;  3LIE A;  1VQL P;  3HTK B;  1NTM J;  1PPJ D;  1J1D B;  1W5C E;  3KPE A;  4EI2 A;  1K73 Q;  2YXQ B;  1LGH B;  2P58 A;  2C9L Y;  2K9Y A;  2HPC A;  3RBZ A;  2W6B A;  4Y99 B;  1N73 A;  1FZB A;  3HTK A;  3JCU H;  2KS1 A;  3M0D C;  1NWQ A;  3D71 A;  2Q9I A;  1FZE A;  3RK2 B;  4I2L C;  2HG5 D;  3OE7 H;  4DJG A;  1OWA A;  3L70 E;  1NGM B;  2PAJ A;  2WQY C;  4HH2 A;  3H25 A;  1SQP J;  1VQ8 P;  1OMI A;  1SQX J;  2Q5U A;  2ZVO B;  3CXH E;  5CCG C;  1H8A A;  1EDJ A;  1NYH A;  2ZFC A;  2IYO A;  1NKN A;  2O01 H;  3BRV B;  3CL3 D;  3MHV A;  4LC1 A;  5AVY B;  4BRY A;  1LNQ A;  1OVR A;  2N9Y B;  4EOT A;  3KXD A;  1KB9 D;  1GU5 A;  5AW5 B;  1N86 A;  3G71 P;  1KIL C;  2PP6 A;  2E75 D;  2BCC E;  2WPQ A;  2KYV A;  1FOS E;  4ASU H;  4Z1M H;  5L8R J;  4GKG A;  2Y0D A;  3L72 J;  3PRJ A;  5APS A;  2Y9Z A;  1G2C A;  1L0N J;  4Y99 C;  1M1J A;  1FJP A;  1PV3 A;  1QL1 A;  3HUS C;  4H0L D;  3W67 A;  1NTZ D;  2ZYG A;  1FDO A;  3OA7 A;  1KN7 A;  4DT0 A;  3UIA A;  2O1K A;  1RE4 A;  2KZI A;  3T97 A;  3CCR P;  2KZJ A;  1Y9B A;  1ZXG A;  3C9I A;  3F89 A;  5DJT B;  1OVU A;  1WT6 A;  5GTH H;  3H1J E;  1U57 A;  3NXS A;  1KIL B;  1SQB D;  2ZXX A;  2E74 C;  3C8V A;  5BU8 B;  5BVZ A;  5KLV K;  2OYI C;  1PP9 D;  3H6P A;  2JJL A;  2YXR B;  4R4L A;  4NPE A;  1N73 C;  1FDM A;  1MFT A;  2BCC J;  3BRT B;  2R44 A;  4JF7 A;  2WSF H;  1K8A Q;  1JEK A;  1MKM A;  2IZ1 A;  4EYY Q;  2O3J A;  3AE7 C;  1OW7 A;  3OAA H;  4N6J A;  1S1C X;  3WMM 0;  1KC8 Q;  2GA1 A;  1KYO E;  3H1K G;  4GOE A;  1QVF O;  1GL2 A;  3GF7 A;  1S9K D;  2E5Y A;  3H1K D;  4H0L C;  2FYU J;  1LT9 C;  2R32 A;  3CD6 P;  2IBZ D;  2PFX A;  2DW3 A;  3TNU A;  5CBO A;  5AW4 B;  4D6T D;  3TYY A;  1RE3 C;  1Q82 Q;  3VMA A;  1S72 P;  5AVR B;  1SFC B;  1DX7 A;  3RL0 C;  2A45 G;  4H44 C;  3H32 B;  2G8Y A;  3SFD C;  2FBW C;  4UB6 E;  1NTK J;  1PPJ G;  2J5U A;  3GW6 A;  2WT7 A;  1T8Z A;  1X0T A;  3MGN A;  4U3F J;  4Y28 J;  1UII A;  1SQV D;  3I55 P;  3L36 A;  2V4H A;  2GUS A;  3MP7 B;  2RH0 A;  1W2B O;  2WT7 B;  1LT9 A;  3OFN H;  4W80 A;  1BCC G;  1SQQ G;  2HR3 A;  1NTK E;  4U3F D;  1Z56 A;  2V7Q H;  1RE3 A;  3RK3 D;  1SQX G;  4C7R A;  3H1I G;  1K04 A;  4M3L A;  2HOD B;  2BEQ D;  1A02 F;  3CI9 A;  5AW3 B;  3CCV P;  5CCH D;  3SSU A;  3CCS P;  1SFC D;  3VMX A;  4DCK A;  1DD4 A;  4XFJ A;  5AVW B;  2RQ7 A;  1JMB A;  4OH8 B;  4TT3 H;  5AVT B;  2WSC H;  1Q86 Q;  1H8E H;  4IL6 E;  1NTZ E;  1FAV A;  2XDJ A;  3HE5 B;  3S4R A;  3FKS H;  5FL7 H;  2WSC J;  2NPS A;  1R5S A;  2ITA A;  1IFN A;  1CI6 A;  1IFI A;  2QVA A;  2XND H;  1JTH A;  1SQV J;  1JB0 J;  2D2C B;  1HJ0 A;  3H1H J;  4GDO A;  3HUS B;  1NTZ G;  3QH9 A;  1JUN A;  3L70 G;  2Z4E A;  1KIL A;  1SQX E;  2K88 A;  3KDP B;  2IYP A;  1KB9 H;  1X22 A;  1RF1 B;  1SQB J;  1G1I A;  1L2P A;  2WMM A;  4UB8 H;  3CME P;  1QLE D;  2JDI H;  1SQB G;  2ZYA A;  3E1R A;  3PJS K;  1FDI A;  1HVV A;  3PH0 A;  3Q5R A;  1KQS O;  2KSJ A;  1AQT A;  4CPG A;  1HH0 A;  1IFJ A;  1YI2 P;  3AEF C;  3V6I A;  3P8C E;  1NTZ J;  1MFZ A;  3AE1 C;  1KD1 Q;  4KJM A;  3RBX A;  1GL2 B;  1EXI A;  3HRN A;  1SQQ K;  3L72 G;  1N7S B;  1NTM E;  4LGD E;  2Y9Y A;  3NMD A;  3CWB J;  3OAK A;  2KP8 A;  1HWT C;  5KKZ C;  2M3B A;  2QJK C;  2YIU C;  3CWB G;  1PGO A;  2N1T B;  3V2Q A;  1AVY A;  3B5N B;  5AW6 B;  1URQ C;  1GK6 A;  1SQB K;  2I8D A;  3L74 D;  3PTZ A;  1E79 H;  5AW7 B;  3RL0 D;  3L73 E;  1XTC C;  1GW3 A;  2P10 A;  2N1T D;  1TU3 F;  3CC2 P;  3O6Q A;  2J59 M;  2XU6 A;  2YMY A;  3IN6 A;  2LXB A;  3EWK A;  1L0N K;  2A45 H;  3B5N A;  1PIX A;  2M8R A;  5KLI B;  1IFD A;  2L5G B;  4B86 A;  5E79 E;  1FU1 A;  1IC2 A;  1SQP D;  2ZJS E;  4RO0 A;  1S5L H;  1N2D C;  1NAF A;  1RY3 A;  1GK4 A;  1IK7 A;  1VDF A;  4PV1 C;  1ZRT D;  2R5D A;  4TLF A;  5C39 A;  4H0L B;  1BSN A;  2OYH A;  1VQN P;  1M56 D;  2KK7 A;  2Z5I A;  2PGD A;  1CZQ A;  2QEX P;  1USD A;  3WUU A;  1H88 A;  4QMA A;  1DH3 A;  3H1H G;  4JQ0 D;  3AED C;  2M5A A;  5AVV B;  1FZC C;  3LID A;  3CCM P;  3P8C D;  4IL6 X;  2Q7C A;  4KT0 J;  3B5N C;  1JY2 O;  3HD7 A;  5CCG A;  5GTI H;  2ZYD A;  1Q90 D;  3GLM A;  2QJK B;  1OIP A;  3VYI A;  4EDF A;  3TDK A;  3CXH D;  5KTB A;  1Q81 Q;  3VMZ A;  4IFF A;  1KTM A;  1J2J B;  1P84 H;  1SFC A;  3M06 A;  5AVS B;  2A06 D;  3S9O A;  1IJD B;  4LLH A;  4WY4 B;  3H1K J;  1NU1 E;  1RF0 C;  3IAO A;  1VQM P;  1EXJ A;  1S5L E;  3GMA A;  1GDT A;  1P84 D;  4OGQ B;  2K37 A;  2ZXE B;  3H1I J;  2E43 A;  4O9B A;  3L70 J;  3KZI H;  1VF5 C;  1BCC J;  1SQQ E;  1SQP K;  2WZ7 A;  3A3Y B;  1NU1 G;  3L71 G;  3A7O A;  1RQV A;  3PLN A;  1HUC A;  1JY2 N;  2FYU E;  2P1J A;  1X9V A;  2JO1 A;  3L71 D;  3E7K A;  3L75 D;  3RGU A;  4A7P A;  4NPD A;  2FYN C;  4ZNC A;  1RF1 A;  2GM4 A;  1H0T B;  3HE4 B;  3H1K E;  1YTZ I;  2HPC B;  2YNY A;  1IO4 A;  1FJK A;  4ZKP A;  1FE6 A;  4JPZ B;  2ZT9 C;  4N78 D;  1NJI Q;  2BAS A;  1BCC D;  2OYI A;  1KV4 A;  5GTI E;  3VMY A;  1GMJ A;  3MTU E;  3EFG A;  1D7M A;  3HE4 A;  2KLU A;  1LWU C;  2A06 E;  2R3S A;  3GF3 A;  2Y0E A;  4PV1 D;  3RK3 E;  3VN0 A;  1WRG A;  2D2C D;  2QM8 A;  1P84 E;  1AJY A;  3BCC G;  3H1J J;  5AW1 B;  1EQ7 A;  5TJH A;  2P67 A;  1S2E A;  3L73 G;  4HJG H;  2W8Z A;  4GIF A;  1M1J C;  3L37 A;  3M9H A;  3ABV C;  3V2R A;  5B5E E;  1EDL A;  1M8O B;  2ZT9 B;  2WVR A;  3AE9 C;  3AEB C;  3BAS A;  1VF5 D;  4PJ0 E;  4UB6 H;  1CI6 B;  1NOH A;  2AEJ A;  2GUV A;  5AW0 B;  3Q1M A;  1ZME C;  2CPB A;  4YXW H;  1VQ6 P;  2IX7 C;  3TGU D;  2KB7 P;  2K1A A;  4L76 A;  4W7Z A;  2FYN B;  2KI7 B;  3FX0 A;  3L71 J;  1FBM A;  4C7N B;  1S9K E;  1ZN5 A;  2E75 C;  3L70 D;  4JYB A;  3CCQ P;  1LTB C;  1FZG A;  5KJ7 D;  5CJ0 A;  1MV8 A;  4PD4 H;  2FFD A;  1LWU A;  1BDC A;  4ASV A;  1XTG B;  4D6T J;  4K3A A;  3CC7 P;  2B88 A;  3MD0 A;  1Y8A A;  2I1K A;  4NPF X;  3VP8 A;  1EC5 A;  1G2C B;  3CXH H;  1YBK A;  1GL2 D;  5H2F E;  5AVX B;  1YYC A;  3M0A A;  3VTP C;  1YQ3 C;  2LR2 A;  2RQ6 A;  2M5A B;  2XOK H;  3CCU P;  3V5B A;  1USE A;  3TF5 A;  3RK3 C;  2OTJ P;  1LTJ C;  1PP9 G;  1YIT P;  1HGV A;  1VQ9 P;  1KOR A;  3WU2 H;  5GTH E;  3ITK A;  1EDK A;  2QM7 A;  1JCC A;  1AVO A;  1HF9 A;  3TGU J;  3L74 J;  2WSF J;  3H1H D;  3V2N A;  5KLV G;  1FZC B;  1IZN B;  4OVN F;  5KAI E;  1SQQ J;  2QRX A;  2BCC G;  2K9J A;  3N7N A;  4BXL A;  5KJ7 C;  1YIJ P;  1NAY A;  4I7Z C;  3PP5 A;  3CXH I;  3HD7 D;  1NTZ K;  4D6T G;  1KB9 E;  3AEC C;  3AE5 C;  3H1L J;  3TNU B;  3D6Z A;  4PD4 D;  2FY8 A;  3JC2 2;  1L0L D;  1LJ2 A;  1VPC A;  4UB8 E;  4L73 A;  1SP4 A;  2A06 G;  1URQ D;  3TK1 A;  3TGU E;  4PD4 I;  4WBA A;  1Q7Y Q;  1OFC X;  2FXP A;  2LKM A;  1ZOY C;  4WY4 A;  1DD3 A;  1FZA A;  1NTM K;  2XNX A;  3L75 G;  2QIW A;  1SFC C;  3USS A;  5CCH C;  2O01 J;  2WWW A;  4ZMD A;  1BE3 E;  1KIL E;  1J1E C;  4GT1 A;  4ASW A;  1H0T A;  1RF0 A;  1U7J A;  2SPZ A;  2YO3 A;  3M0D A;  2H88 C;  2PRR A;  3GHG A;  4JBZ A;  2YMK A;  1KYO H;  4OGQ D;  4U3F G;  2OYH B;  5AW8 B;  1LT9 B;  4XA4 A;  4YTP C;  3N4X A;  1MZ9 A;  3H1L E;  1E5W A;  2QG4 A;  3HD7 B;  2KUB A;  3JCU E;  2QA4 P;  1OW8 A;  2HYN A;  2O1J A;  1ZV8 A;  2NPS C;  2V7Q J;  3WUT A;  1GL2 C;  4H44 B;  1Y47 A;  4I1L A;  1S3J A;  2AXT E;  3P7K A;  5AVU B;  1BSH A;  1MUU A;  3KYQ A;  4K35 A;  3H1L G;  3R4Y A;  1EZV G;  4L75 A;  3PHL A;  5CCH A;  4C7N A;  3NTN A;  1J1E B;  4RJT A;  1AV1 A;  1EZV D;  2YIU B;  2OTK E;  3L73 D;  4R4M A;  1M1J B;  4BWN A;  1SLQ A;  5TIS H;  2KXP B;  1K05 A;  2LXC B;  1FC2 C;  4H44 D;  1N7S C;  2NPS B;  1NU1 D;  2YKQ A;  2W27 A;  3MUD C;  3Q5P A;  1SQP E;  1L4A B;  1KQF B;  1LWU B;  1VQ7 P;  3HE5 A;  3D70 A;  1JY3 P;  1SQV G;  2FXM A;  1JOC A;  1JY3 N;  1UIX A;  2KIK A;  2KS1 B;  3AE8 C;  1QL2 A;  1RE4 C;  1OVV A;  2B9B A;  1JMM A;  2WPR A;  2Y0C A;  3OJA B;  1JTH B;  1DEE G;  2IFN A;  3V2P A;  2R5B A;  3WU2 E;  2KNC B;  2E76 B;  1KYO D;  2CK3 H;  1NVO A;  2NPS D;  3L71 E;  3G4S P;  2C9N Y;  1QX8 A;  3H1J G;  3BAT A;  5AW2 B;  2Q6Q A;  4KHX A;  2JR8 A;  2WSE J;  3AE2 C;  3H1I E;  2VRS A;  3L4F A;  3ZDM A;  3SFE C;  4IFD K;  1N8R Q;  4EIJ A;  1L0N G;  2WSE H;  1BCC E;  2POH A;  3P32 A;  2JEE A;  2ZT9 D;  4IFM A;  1ZR4 A;  3R2P A;  1GTW A;  1M57 D;  2IBZ E;  2NZ2 A;  1LTJ B;  2AEF A;  1RH5 B;  2HFE D;  1U7M A;  3MUD A;  3BCC D;  1HTL C;  5CBN A;  2FFD B;  3CCE P;  1VL2 A;  2K9J B;  3L72 D;  1BGY D;  1L4A D;  2YO2 A;  3A2A A;  4JYC A;  2XKM A;  2RKL A;  3B71 A;  1AFO A;  2IBZ G;  2JKV A;  1LTJ A;  2K3R A;  5APY A;  4OWF A;  3VP9 A;  1VQP P;  3WUV A;  1VQO P;  2MKV A;  2OAR A;  3A0H E;  4DOJ A;  2H43 A;  2B87 B;  3L75 E;  5BU5 A;  1NU1 K;  2C0W A;  4WVZ A;  1AQ5 A;  3CX5 H;  2KLV A;  3NFQ A;  3CPW O;  1PZQ A;  2HLO A;  2NRG A;  3M9Q A;  1J1D C;  3I5C A;  1EZV I;  3II6 A;  3A0B H;  4N78 E;  1PP9 J;  5K5G B;  2QJY B;  3A5T A;  1PFI A;  3B5N D;  2OGU A;  4ZKU A;  3O6Q B;  3BVH A;  1URQ B;  3L35 A;  3P8M C;  2P2U A;  1YTZ T;  1KZU B;  4H13 D;  1CW5 A;  1M90 Q;  3CCJ P;  2O01 N;  1NH4 A;  2FYU D;  5KKZ B;  3Q3D A;  3IR9 A;  2HOD A;  2Q1K A;  1SQQ D;  5KAI H;  4N3Y B;  2J58 A;  2WSS H;  4PJ0 H;  1NU1 J;  1EDI A;  1IK9 A;  5M1B A;  2BCC D;  2KOG A;  2IBZ I;  1HBW A;  1SQV E;  2OYO A;  2WIT A;  3OEH H;  3SWF A;  3A0H H;  2OYH C;  3W68 A;  3RK2 D;  3GHG C;  3H32 A;  3SWY A;  3LW5 H;  1N7S A;  4GOF A;  3V4Q A;  3U1C A;  2N1T C;  3AEG C;  3E1I A;  2H89 C;  1KFN A;  5DJU B;  1K9M Q;  2UWJ E;  3KZI E;  1L0L G;  4MN4 C;  4W7Y A;  2QJY C;  2CPS A;  1P84 I;  3CX5 D;  3U1A A;  2QJP C;  4WWI A;  3HUS A;  5KAF E;  2M0B A;  1HJB A;  1FOS F;  1LTI C;  5APQ A;  3S1K A;  3CCL P;  3HD7 C;  1JCD A;  2I1J A;  2A45 I;  4IOI H;  1JM0 A;  2E76 D;  1FS0 E;  5CHX A;  5H2F H;  1A02 J;  1L0L E;  4IL6 H;  5CMZ A;  1YJN P;  1FZF A;  1T3U A;  1NHL A;  3FWL A;  2H7H A;  2D2C C;  1ZW0 A;  3QWO C;  4YPC A;  1T2K C;  2JWA A;  1IFP A;  1N73 B;  3Q2Y A;  3MZW B;  3L74 E;  1NKZ B;  3MIW A;  5APT A;  1Q2N A;  3FWN A;  1GZL A;  1IFM A;  2QJP B;  2JP3 A;  3F5H A;  2KSE A;  3IF4 A;  3L73 J;  2FYZ A;  1GD2 E;  3V4W A;  1WMK A;  1KMI Z;  1GW4 A;  3BCC J;  3L75 J;  1JNM A;  3CC4 P;  1LP1 A;  3I56 P;  1NTK K;  3B8E B;  3H1H E;  1YHQ P;  1LT1 A;  5B66 E;  3FXE A;  1ZRT E;  4L74 A;  1VF5 B;  3AEE C;  1AA0 A;  1DEB A;  2QE7 H;  3H1J D;  1YQ4 C;  3K5B A;  4D6T E;  3CLQ A;  1H89 A;  1LTA C;  3G3Z A;  4DZO A;  3H1L D;  3VOP A;  4H13 C;  3RK3 B;  4C46 A;  2OTL P;  5APV A;  1L0L J;  1W2E A;  1VQK P;  1T2K D;  1S4X A;  4I7Z B;  2W90 A;  2E76 C;  2XZR A;  5AW9 B;  1N7L A;  2P7J A;  2Z5H A;  2Q3E A;  2IDB A;  1ZLL A;  1BGY J;  4RES B;  2IPP A;  2L91 A;  3L74 G;  5KLV J;  2XV5 A;  1L4A A;  3FGA D;  3RL0 g;  3D6Y A;  1NTK G;  2AXC A;  3EQ2 A;  1NTM G;  1KIL D;  2M3E A;  3C1L A;  2WPV B;  3JSV C;  1NTK D;  1PL5 A;  1JY2 P;  1NTM D;  3LW5 J;  3M91 A;  4RKU J;  3TSI A;  5KAF H;  1DIP A;  2KNC A;  2Q3I A;  3KHU A;  3RL0 B;  1QVG O;  5B66 H;  4YXD C;  2RN0 A;  4XE5 B;  4PV1 B;  2AEM A;  3T97 B;  1LTG C;  4PD4 E;  3G9R A;  1HGZ A;  1LTT C;  1QGK B;  4WB4 A;  1KFM A;  1BE3 G;  5EFW B;  1RHZ B;  4HYT B;  5B5E H;  1SVF A;  1PGP A;  2G3A A;  1BE3 D;  5KJ7 A;  1S5L X;  3CMA P;  3AE4 C;  4U3F E;  1L0N D;  2E75 B;  1PGQ A;  1PPJ E;  2N1T A;  2E74 D;  4H13 B;  3CX5 I;  5APW A;  1KQL A;  1KYO I;  4BRY B;  1BGY G;  3G6E P;  1SQX K;  2RMZ A;  2FYU K;  5TIS E;  1BDD A;  2MJZ A;  5KLV D;  2H8P D;  2E74 B;  2R3C A;  3KQG A;  2W6A A;  1R8E A;  3CX5 E;  2OQQ A;  1X8Y A;  2B87 A;  1SS1 A;  2FXO A;  2YKP A;  1LTS C;  2ZVN B;  3CWB D;  4HKZ H;  5E79 H;  2ZAE B;  1JO5 A;  5APU A;  2YKO A;  1N7S D;  3FXD A;  1YJW P;  1NO4 A;  3EFF K;  1ZP0 C;  5CJ4 A;  2C0X A;  3M9B A;  2E5T A;  2W6J H;  1R5L A;  1L4A C;  1OW6 A;  2IFM A;  3AE3 C;  1URQ A;  3Q5S A;  1M1K Q;  4WY4 C;  2W83 C;  1EZV E;  5APX A;  1SQP G;  4AUW A;  5CCG D;  3SWK A;  3OW2 O;  2FYU G;  1LP1 B;  5KLV E;  5AVQ B;  2WTY A;  4AYC A;  1M7L A;  1BGY E;  1RF1 C;  1VQ5 P;  3AEA C;  2OYI B;  2E42 A;  3CWB E;  1PGJ A;  2JWD A;  3U59 A;  3AE6 C;  1YJ9 P;  1KB9 I;  1OZH A;  3IFM A;  3GHG B;  1GU4 A;  1OXZ A;  1T6A A;  3L72 E;  1T3J A;  4GOD A;  1L0L K;  1CSB A;  4OGQ C; 
#chains in the Genus database with same CATH homology
 3OE7 H;  1BSH A;  3FKS H;  4DJG A;  4QMA A;  2HLD H;  1IFP A;  4YXW H;  5DN6 I;  2XND H;  2WSS H;  3EFF K;  2E5T A;  1E79 H;  2W6J H;  2RQ6 A;  2XOK H;  1JEK A;  3OEH H;  3OFN H;  3USS A;  2QE7 H;  3OAA H;  5FL7 H;  2V7Q H;  4ASU H;  2JDI H;  4WVZ A;  3PJS K;  2E5Y A;  1AQT A;  4TLF A;  2CK3 H;  1BSN A;  2RQ7 A;  1FS0 E;  1H8E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...