2E63A

Solution structure of the neuz domain in kiaa1787 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
170
structure length
170
Chain Sequence
GSSGSSGELHPRTGRLVSLSACGRTARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSATGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGVAATGLPPRVWAVVDLYGKCTQITVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA1787 protein
total genus 21
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2006-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2e63A00
2WL1A 4P9IA 4B3NA 4B8EA 3ZO0B 2VOKA 5JI9A 4WVMA 5JIUA 4N7UA 2YUEA 4KG0A 5C33A 4V1PA 4P9LA 4QT6A 4XW3A 4X8PA 2FBEA 5JI7A 4X8NA 4N7IA 2YYOA 5JIAA 4P9JA 3KB5A 5F6KA 3TOJA 2E63A 3UV9A 4WVMB 2IWGB 5F6LB 2LM3A
chains in the Genus database with same CATH superfamily
3S30A 4YSFA 1DG6A 5FAXA 2XB6C 3KT4A 3P1IA 4CDXA 5DDJ3 2B5HA 2P4EA 1TME2 3AP6A 2Q30A 2B39A 1LTEA 1EV12 1HXS3 4JDNA 4XF9A 1AL0G 4Y22A 3VBHA 1TNRA 5ACA2 1JHNA 1BK1A 1QOOA 2JIJA 1YJKA 4KGQA 1ZBA3 3SCGA 2CNAA 4R4XA 4D7YA 1NAEA 3SH3A 3ZXAC 1PIV2 5K0UC 5EYXA 2D3SA 2RS31 3FHAA 1GP6A 5A1AA 2D40A 3FUQA 2G9FA 3K46A 3Q8FA 3HQXA 1G9BA 2Z2SB 5F3IA 2IXJA 3MHZA 2YBSA 4QM9A 2Z42A 2W87A 1V6IA 1ENXA 5L73A 4CDQA 5FYHA 4N8MA 4BQ5A 1CX1A 1LULA 5APAA 5FZCA 1RB8G 2RR13 1DGRA 3CKHA 4FOQA 4YW7A 1RUC3 2QNKA 2VMHA 5JXJA 2R30A 3WNMA 5CU1A 3ZFGA 1IGOA 1F31A 2VULA 4GH4C 4PDWC 3LD8A 2NQYA 4O9GA 1QU0A 1X8MA 3DPRC 4NWWA 5IAXA 3N4MA 3HN1A 2ZHNA 4RFRB 1UD1A 3SH4A 4ZZ5A 3GNEA 4EWAA 3B7MA 1QF3A 3VDDA 5L19A 3QCWA 2FCUA 5JUVA 5JVVA 1YFXA 3TEYA 4HKWA 2RDNA 3EJKA 4D69A 1U5IA 2D44A 4FPJA 4XMAA 2C24A 1I5PA 4JGYA 5FO8B 5SV8A 3LKJA 2PAMA 4UW5A 5KXCA 2QQMA 3OF1A 4CCJA 1LRHA 1H0BA 2IXIA 1WLDA 4Q2FA 3ZPOA 4Z92B 3ZSKA 5BNOA 1SZBA 1RUI2 1LJ7A 3NQHA 3M3CA 1O4ZA 2VR4A 5I8SA 4YGBA 5KHKA 3PUSA 3WUCA 1VE0A 3ZFFA 3I2OA 1DQ2A 2ZJCA 4HFSA 2Q1ZB 2PLV3 3JBG2 5FYMA 3QOPA 2CGPA 3TN91 1Z0HA 3WZ1A 3KV6A 4IEQA 3KGLA 4EN0A 3OY8B 2DFCA 1YFWA 1VJ2A 3CEWA 4JV4A 1AX2A 1SLCA 3HNYM 4I3PA 2Y6HA 5KHJA 3UT0A 5LEKA 4XJZA 2RS12 5L9RA 4LBNA 3OBZA 2C4XA 3D0SA 4BQ3A 1AHSA 2YMZA 5DUXA 4FFIA 4M3CF 3LSDA 2VMFA 4Q4W1 3NV2A 1MVQA 3ALQA 1UF2C 1XB9A 5I0SA 4Q4Y3 4E4DX 1LOGA 3E5XA 5KHHA 4D7TA 1VBB3 3CJIC 4M3CA 2GMEA 4IE6A 4HSLA 2OA2A 3RQ0A 3KSCA 4CZSA 4FSJA 1VRH2 4JX0A 2RDSA 1GQPA 3VD7A 4OHYA 4XXPA 4M00A 5AC92 5H9SA 4XAEA 1G7YA 1IKPA 5FUPA 1AR81 1O3QA 5LRRA 1RUD1 3VBUA 3LFMA 2G9GA 3I2HA 3O1TA 3UJOA 5JI9A 2IXCA 1ZZ9A 3W58A 4CP1A 1OUSA 5FP3A 1BBT3 1IS3A 2LS6A 3AKSA 3HT1A 5FIXA 1CD3G 5A7QA 3BTAA 4LKFA 4HKLA 4N53C 2P2KA 4XXAA 4YZ3A 4Q4Y2 1CONA 3U14A 4AFCA 1OH3A 4A7ZA 1R64A 1US2A 1VBB2 4HVRA 2J1TA 2ZGQA 2X5IB 2R073 1ENQA 1OFNA 1GZWB 4GB33 4IV1C 2VTXJ 5B4XA 1W03A 3MGUA 1KFUL 2JE7A 1QXPA 4AGGA 4AHWA 3IIAA 1N1YA 1NG0A 4LTAA 1ZZ6A 4QKBA 4XUQA 1EAH2 3UNPA 5KC6A 5J36A 2VOTA 1U5XA 3MW3A 2HYKA 1QJX1 2RS11 2UYAA 1LHWA 1KGYA 2DUOA 4BPZA 1BYHA 5CA6A 2QDRA 4S2DA 4CDUB 2UURA 3AMMA 4MO3M 3AMPA 3RYPA 1NLQA 1NZCA 3ECQA 2B9VA 5SV5A 2K9ZA 1F4AA 3AMNA 3WDYA 2VBBA 1UOFA 1GOGA 4V2WA 4P9XA 2JD4A 2RS53 2DBNA 4TLFA 3IN9A 3VN4A 1WCDJ 2ZABA 4OHVA 5ABJC 4OLLA 3G6JB 2R043 3BN6A 5FYIA 1IG0A 1NQJA 1Y4WA 2H6BA 3AZZA 3IWZA 2W1WA 4LUMA 4QX2A 5CKNA 4Q4X2 1UY0A 4CDWB 2W2IA 4QAWA 4GH4A 4PDWA 5FPVA 1QWRA 3T08A 1DZRA 5FZIA 4WVVA 2VO5A 3WNXA 1YRZA 3K4AA 1AJOA 3OEAA 5JXHA 3RZHA 5DG2A 4XPVA 3CZUA 5A3NA 4PLOA 3ILFA 4RS5B 4AHZA 2WNVB 4HPKA 4ORFA 2RVAA 2WQZC 2GAUA 4LBJA 4DIQA 3A7QA 4QX3A 5FWJA 3POWA 2BFUL 3ZSMA 3RPQA 5IFTA 1Q8SA 3BVCA 5M0TA 3BIWE 4LBQB 4Q4Y1 5CIRA 1QQP3 3SKVA 3ZSLA 2VZ1A 3E6DA 1LHNA 3NAPA 3VKMA 4CVUA 3FL7A 1QOTA 2WT0A 3AZVA 3W59A 1RUG3 5CADA 2PHLA 2A6VA 5EYYA 2FHRA 4IV3C 5IVJA 1YQ8A 3QACA 2XQRA 4RHV3 1VBC2 4UBGA 4L92A 3UYJA 4OYUA 3TEWA 5A33A 2R062 4FOYA 4YZ4A 3V0AA 1O3RA 5FPAA 1PO21 2WABA 2QDNA 5C4WA 2TEPA 1RUC1 2VOKA 2BVBA 3USUA 4NIIA 4U36A 5HCFA 2OS2A 3LB9A 1MZ6A 1UOGA 1WUVA 4AQSA 5BV6A 3ZYHA 4FXGB 2ET7A 2XVLA 3WCSA 5FOJB 5C3QA 4Q27A 1QQP2 5FYZA 3H50A 1UOBA 1A8MA 1YFYA 1BLZA 5LBFA 2VNOA 5LRSA 1ALYA 1SDDB 3WUDA 2XR4A 4MH0E 3VUOA 2FDKA 1UZ0A 2C0ZA 4YW1A 3RMYA 1UW8A 4KBZA 4BIFA 2ET1A 1ZREA 1COV1 2NP0A 1W2NA 3MYXA 2DV9A 4IEOA 1PVC3 5ERLA 1O3TA 2YBKA 4CP2A 5L7OB 2WJSA 2XGXA 3KV9A 4ZS3A 1LGNA 4Y5TA 1LENA 4FOVA 2JDNA 2V5DA 2VCAA 4FPHA 4EWEA 3O14A 5DN2A 1R091 2BRTA 1V6JA 3MIDA 4EROA 5FMBA 1F9KA 1YLLA 5DDJ1 4DINB 5JSOA 1KS4A 4DRRA 1MQTC 4D6SA 1Q56A 1W05A 3QD6A 2D3RA 3ZYPA 2VZ3A 5FREA 3PNAA 4CUCA 4CCNA 1ZVFA 3T0AA 3TOJA 1W9SA 3ACLA 3S5AA 2VZOA 4KWUA 5FY5A 2HJIA 1H6YA 2WDBA 4H3WA 2XBO3 1ULOA 3WT3A 2C9AA 2YHJA 5JIUA 2BWCA 4XFHA 2JIGA 5FZ7A 1J58A 1F4HA 5I0RA 3ZSJA 4BA6A 1S2EA 4FQZA 4IESA 4IV1A 1EUTA 1EY2A 4IEUA 4N43A 5F39A 5LEJA 2W9XA 1H8TA 3QH6A 4MZUA 3H3UA 4PI2A 4RGKA 1S2KA 3VD9A 4R9CA 4XUPA 3DF0A 1MR5A 1SDWA 2R49A 4PQQA 4N53A 3VV1A 1QJY1 3GALA 4Q0SA 1HQNA 1HIXA 5I0TA 1RUG1 1ND2B 2MNGA 3J7NA 2O8QA 3CU7A 2XBO2 1W3XA 2BW8A 1MZFA 2HWF1 3PVOA 4EE2A 1RUNA 4JAAA 1HN1A 3U1XA 4KL1A 2DVBA 4P9IA 2WR9A 1EUUA 2YB7A 1LB2A 1XBFA 1ULCA 3SH5A 3O1RA 5DPNA 4YARA 4E27A 1OQEA 2GU9A 5DZEA 4Z07A 4FCAA 1OMIA 2Q1FA 4QM8A 5HXMA 2WT2A 1POV1 3CO2A 3KZ4C 3TN92 3RZKA 4EN9B 3DKQA 1SFYA 3U0ZA 1XNKA 2YDEA 2YPDA 1VRH3 2KA3A 4CXYA 3B02A 3O12A 4IETA 3WF1A 2Z4FA 4RYDA 4AEDC 1CGPA 4LIUA 1OQ1A 2HWE1 2HWE2 4BISA 2BNNA 1K5MC 3BOWA 4XFFA 4CCLA 3U4XA 1HRV1 4RR3A 1CIYA 5FY8A 5FWEA 1PMIA 1W0PA 3J8F2 5E1RA 4OQ9A 3CMGA 3SMHA 2GSYA 1YWKA 3LAGA 1IQDC 1RUH1 1W9FA 2W3JA 3RDIA 4EN7B 4HANA 3OOXA 3WP5A 5C71A 5GZGA 5EXOA 1RVF3 2Q4SA 3HIFA 1W2TA 4CUBA 3MLKA 4JDMA 4XYXA 1R1A2 4MV2A 1VRH1 2WZR1 4MXVA 4Q4V1 4XHBA 2VW2A 3WNNA 4PI0A 3LA7A 5FZMA 3FFZA 4EYUA 2IVIB 2VCMA 5BNNA 2VMIA 1WMXA 3B5LB 5KHGA 4ASKA 1APNA 3KGZA 2E6VA 1IPKA 4FXKB 3RWKX 1CJDA 1TE1B 2JJ6A 4GMP0 4PBPA 4DO0A 4QPGC 4JGZA 4IEYA 4QDSA 2VNRA 2YU1A 3CL1A 4AE2A 1LEDA 2W39A 1LOFC 2DCZA 3KF3A 4OI0A 3WDVA 1UN1A 2XBO1 4RQPC 4XMIA 3POYA 2HWC3 1FXZA 2OYZA 3DXTA 3WG1A 4HVOA 3ZKYA 2BDRA 2WWJA 3ZYIB 2W95A 2ZTNA 5ACA3 2VTFA 5A32B 1YQ2A 1QXJA 2R1BA 4YM3A 2Y6JA 1O6UA 1JN2P 1K3IA 1JZ3A 1PGSA 5LW9A 5CYYA 4N53B 5C9AC 1JZ7A 1ASJ2 1JTZX 2VZSA 4UF0A 4YW4A 1PIV3 3MBWA 4Q0PA 3WDTA 1AX1A 3WF4A 1GWMA 3M70A 4LO4B 1RUE3 1GKBA 1LGCA 3IPVB 1OVPA 2CU5A 3ACHA 3GJBA 2BTVC 1DQ4A 2E63A 2FDGA 5IT6A 4Q4X3 5FCCA 2A6WA 5CFCA 3GZAA 4QX1A 2OX0A 4I01A 1NE6A 4MHRA 1OF3A 1O7FA 5EHDA 3EXUA 5LK7B 4AR2A 2O1QA 1C1LA 1FI2A 1KQRA 2SLIA 3ETQA 5IK5A 5JR2A 2XWBB 3CJIB 2XWJB 4DNYA 1HXS2 3GM8A 1NOVA 4YVWB 1DU3D 1WWYA 3N36A 2JG8A 2WYFA 3DYMA 3S57A 1R1A1 4CRQA 1JOJA 1AXKA 4GWNA 2RM23 4LBQD 5GLTA 4AW7A 5FDBA 3KB5A 3GCXA 3NNJA 1JZ5A 5JDBA 1B35C 4WM7A 3I3MA 1NY72 2ZGKA 1RGSA 4MGTA 2TBVA 4NHXA 2WUHA 4DY5A 1XYPA 1GNZA 3I2KA 4ZS2A 3JQXA 4JVAA 1HRV3 2AREA 4OUMA 4Q8LA 4A45A 2WN3A 5F2SA 1RUOA 5FYVA 1VIWB 3FMGA 1X82A 2BERA 2ETEA 4QQ2A 4W8JA 1GZ9A 1PHMA 4AHYA 4QMAA 4QDQA 3OYWB 3IDAA 2FMYA 3OUIA 1DGLA 2ZAHA 4J6GA 3RVHA 5AFEA 1AYM2 1CAVB 2ES3A 3MW4A 3P5BA 2H0VA 2JDPA 3GF6A 1TME1 3S7IA 3ZM8A 3MV11 4NPMA 2XDVA 4QPGB 5FOBB 5EV7A 1H30A 4LLOA 2W46A 1W8ZA 4RHV1 2CAVA 4B3NA 3PUHA 5ANNA 4IV3A 4QXBA 4AI0A 2I07B 3SLIA 5LA2A 2DTWA 2H0BA 4FP2A 1D4M2 3A21A 4LEJA 3EMRA 3D8CA 4NPLA 3NAPC 2V73A 2XJRA 4K40A 1RUD3 2OXBA 4COVA 3JD71 3PVBB 1EPZA 3HOBA 2NPIA 4YVSB 3AL5A 1GQHA 4LIVA 5JCTA 3DYPA 1G8WA 3PJQA 2P3IA 4GKYA 2VM9A 4BJ0A 5IK7A 3H7JA 4QDRA 1ZBA1 4YLZA 1AVBA 1RUJ3 3BKZA 5DUUA 5AFBA 5A7NA 2GC1A 1NY71 2X5IC 1UZZA 5FP4A 1CWPA 1GZWA 4NOTA 2RHPA 1H1IA 5FZ3A 1ENSA 1IS4A 3T1LA 2XMLA 4QX8A 5FXZA 1FOD2 1V6OA 2JDAA 3VBSA 4F7ZA 3WP3A 4CEWA 2BNMA 5A7WB 2PQQA 2ZA9A 4RSUA 4XJ8A 1US3A 3L2YA 3ME2A 4YVWA 2XH6A 3ZXGA 4KI5M 1S55A 2OUJA 2RJKA 3D0JA 3ILNA 3LOBA 4G4FA 1QJEA 5FPUA 5IVYA 3W21A 2AEZA 2HWE3 2PHRA 4LT5A 4AFBA 4JKLA 5LK5A 1NCRB 4DMIA 5CBLA 4JTOA 3LPGA 1N3PA 1EAH3 1Q8QA 2UWBA 3CQOA 3ZN6B 1E57A 5F1RA 5IVBA 4NHYA 2D6OX 2VG9A 4QPWA 5BYNA 1BEV1 3AP5A 1BEV2 1D2QA 1C3HA 1MS8A 4P08A 5T5OA 4D6QA 1RHI2 1FOD3 1MEC1 2ZKNA 3AFKA 4YYOA 3I2IA 4RL7A 1Z78A 5FXWA 3URFA 4AXOA 3MFCA 3G7DA 5DZFA 3RG0A 3T2TA 4A42A 4C8DA 3BODA 3GZUC 1REDA 3VBRB 2WAAA 4XW3A 3FBYA 3MF9A 4S2GA 1G9AA 3LEGA 5C6CA 4UW6A 3VBOB 2C9KA 2KM2A 1XNTA 3USSA 1B35A 2K2SA 5D8AC 4CSWA 3TAYA 3VHRA 4YRDA 2PELA 3OCPA 1CPMA 4AEJA 1ZRIA 2GNBA 4IE7A 4Q26A 3WQ1A 3VBUC 1S2BA 3LDKA 3MPPG 2ARCA 2WBKA 2J1SA 5F5AA 1AF9A 1V9U1 4TYSA 5JMOA 4QB6A 1NLRA 1XE8A 1SPPB 1H4GA 1REFA 2B7YA 4QT6A 3WLUA 4TSVA 4BQWA 2DU1A 2W1UA 2ZMNA 4LBKA 5A1LA 4YZ2A 2QQOA 4OZOA 3BCWA 1NUKA 1GANA 2A75A 1U5YA 1AUYA 1XSRA 3INAA 2WQ8A 3CDZB 2ZX3A 4PF5A 1GP5A 4M0HA 4M01A 3VL8A 3VKFC 1QEXA 4RS5A 5C9AA 5HCHA 4W6XA 5CZKA 2X05A 1FT9A 3POEA 4NAOA 4K9SA 2A3WA 4FPFA 3M2MA 1H1AA 3DYOA 4XF4A 4HLTA 5E89A 1TME3 2Q5TA 1W8UA 1VBC1 2JICA 2OVUA 3N7LA 1V0AA 4IERA 1WCQA 4QGMA 5EZWA 5C33A 1V6KA 2VBPA 5EWSA 1W8TA 1QQP1 2QQIA 1SCSA 4JCKA 4JHTA 1OSGA 1GZCA 2P3KA 3NV4A 4LBOA 4M3CE 4O65A 4CEWB 1VB4A 1PX3A 1UXZA 3NJZA 4IL7A 1S0BA 2ZEXA 1RUG2 2RMU3 3TB0A 2WFF1 2RS33 2EIDA 2VXJA 1YEWA 3TRSB 4I0AA 4FPEA 2IZWA 2D97A 5BNNC 5CISA 4ZHNA 3VZNA 3WDUA 2W92A 5A3PA 1CAUB 2RDQA 1JHJA 2BGOA 1YCIA 3K51A 4PJYA 3VDDC 1PVXA 1MS4A 2B45X 1SLAA 2VVEA 4XJUA 2IXLA 2VZPA 4C91A 4YNIA 2WNVC 5JOWA 2XPJA 3A0NA 2X29A 3ON7A 3VGIA 2BU9A 2PLV2 2AH2A 3OUHA 3POGA 2ZZJA 3OPWA 4RR3C 2LTNA 3DCQA 4CU7A 4XHXA 1K5MA 4BWOA 2YROA 3POJA 4XILA 3TNPB 4ZZ8A 5F37A 1COV3 4N43B 3D82A 4CPBD 4NWVA 1ZYBA 4M4PA 4OHWA 4ARYA 4LBLA 3IDEA 1UY4A 2QBXA 1NCQA 1HV1A 4WM8B 1OD3A 2R0HA 4UXAA 4Y5SA 2X8KA 4HN0A 5JR7B 3W5NA 3IDCB 2DVGA 1WBFA 1YQCA 1AR72 2JKBA 3WNLA 4Q8KA 3T4HB 4GB31 3ZYRA 4NHMA 1PZ8A 2W1QA 3NJYA 3AVRA 2D6LX 1OHFA 4P9LA 5EJ1B 1YNAA 3IZOA 1OUXA 3P3NA 2GNMA 2BWAA 4Q0VA 3TEZA 3LIHA 5K7PA 4FFHA 1OA3A 5GKAC 3VBHC 4JRAA 4ISQA 5HI0A 1RTVA 3PVNA 4NIHA 5A6XA 4IDZA 5GALA 3ZXJA 3ZYBA 1RVF1 2JE8A 1OVSA 3S5QA 3ZXLA 4WVMB 4QHBA 3DL3A 2Z5WA 1AR62 4P5HA 3S0MA 2OZ6A 3O0VA 1DGWX 1W2UA 1GR3A 1BBT2 4AEDB 3O0XA 4IV1B 5LBEA 1RMU1 2JX9A 1SHWB 2KXLA 3LSEA 1OOPA 1YC61 3CBNA 4GWJA 4CA9A 2V09A 3J9SA 3CLPA 4KU7A 4UYBA 3W20A 1DCSA 3O1MA 2IUWA 1QDOA 5FZOB 3Q9OA 5FZKA 3TBDA 1RUF3 5E6HA 3J26N 4CP0A 5CG8A 2GNTA 1ONAA 5CAZA 1W3VA 4ZXKA 3JU9A 2J1UA 4DEQA 3KHCA 1BCXA 2QJVA 3QBQA 1WD3A 1GZTA 2GMMA 2DFBA 1GWKA 2BNOA 1DQ0A 2IFRA 3J8F1 1ND2C 3WQ7A 4BQ1A 3O1SA 1C8NA 1F8VA 4DS0A 3TEXA 1HRI3 2EVXA 3AKQA 3H9AA 3PJYA 2RS13 4UFLA 1T6GC 1ND3A 4BMEA 1PO13 4J1WA 3AP4A 3HBZA 3OGGA 4WZCA 4PF1A 2P17A 3RI8A 4BM8A 4YW5A 1VBE2 2ADDA 2EF6A 1IPJA 1O4YA 1W6MA 4X6RB 4XVHA 4CXXA 2K46A 4EWDA 2BJSA 2GN7A 3N7MA 3AKTA 2VZVA 3WD5A 1DQ5A 3BOPA 3S7EA 5GZFA 4GB32 4A3ZA 5HXVA 1FOD1 3FHIB 4NUBA 1QNYA 2XQXA 3LOIA 1JUHA 1RYYA 5FLIA 2E9QA 3FX3A 3I2DA 5EJ3A 1C5HA 2IVJA 3AMHA 3RWNA 3WG3A 4FI9A 4GWMA 3WW3A 4WM8A 5F3CA 3IB3A 3MI8A 1A6CA 3AJZA 3T0DA 4IW3A 5DAWA 3GCWA 3JB4C 4FAHA 5EJZB 1D0HA 1W99A 2NMOA 3V56A 3WNKA 4MGKE 2WS92 4NRPA 4QPYA 4DZGA 5J7MA 3ACIA 1SLLA 1UIJA 3C7FA 1VBD1 2VOWA 4AHXA 5BY5A 2VZQA 3RFRA 1PO22 4RQPB 5FMDA 5H9RA 4CEYA 2CYFA 2QQNA 5LA1A 2VAUA 4AEKA 2A73B 4YFZA 3BTYA 4BH9A 2OW4A 4D94A 3I3DA 4AFDA 2GZWA 3AYEA 1Y7BA 2MEV3 3OUJA 3BTZA 1RL3A 3AM2A 2J1VA 5IAVA 1QGLA 3R4DB 1KITA 1BHGA 3Q8EA 4ATFA 4FPCA 1QKQA 2RR12 2P1BA 1D4M1 1XRUA 3KV4A 4XJAA 1J59A 2P3JA 4COZA 4WBBA 4DPNA 2I74A 2JWPA 2Y8KA 3WXPA 3IKWA 3UKTA 1LU1A 1O4TA 1RUH3 3JD72 3QLQA 5FZ1A 2I45A 1JZ8A 4XDOA 4L9BA 5FXVA 2GP5A 1QHDA 2UWAA 2Y60A 1GOFA 1RC6A 4LBMA 2VCCA 4LORA 3MUY1 3I2JA 3MIFA 1D0GA 2VBDA 4QHOA 1UNBA 3OYWA 1PK6A 1ZBA2 5ABJA 1CX4A 1AR93 2PYTA 3IIIA 4P9GA 2WO1A 2EAAA 1JYWA 1E5SA 1BXHA 1W9YA 3LZZA 5D2AA 3T2PA 2ZX0A 3WF0A 3PTRB 1RXGA 1XOYA 4QD2A 3T0BA 4UAPA 4Y33A 4LMFA 2OUHA 2XLGA 3ZR5A 4HK8A 2ZHLA 4M4RA 4H14A 2HWC2 2NM1A 2CSGA 2Q8DA 4BMBA 4C0HA 1ULFA 4D3WA 2DCYA 2VJXA 3NVCA 4W4ZA 1DYOA 3HNBM 3JBG3 1NX9A 4QQHA 1N1VA 2CGNA 3VBSC 4RGGA 3SITA 1YO8A 4W65A 1IOAA 1AR92 2HEWF 3U75A 3T1MA 5FYUA 1E5RA 3FUOA 3R05A 3ZDVA 2RS51 3ENRA 2XL7A 3RZGA 5GM0A 2P6HA 4COYA 3KM5A 1W8HA 4FFGA 2R061 4RHV2 3VDBA 1F2NA 1AYN2 1JYNA 3RS6A 1OLQA 3WHUA 5H9QA 3WQ0A 3C7HA 2JEMA 1CPNA 4XQDA 3T4VA 4I0WB 4ZU4A 1GP4A 2VVFA 4IE5A 2AZ5A 1CAVA 1TMF3 2HWF2 4GULA 4LO7A 4RQPA 2HWB2 2VMEA 3GZEA 3M3QA 4CEYB 3RYKA 1WZXA 3LF7A 1EPWA 3THTA 2XJTA 1ZA7A 1IS6A 1X8EA 2WNEA 2P6CA 1HB3A 2V72A 3FLTA 4IGOA 2JXAA 5F6KA 3I3EA 2PHTA 5FPZA 3D5OA 5FLJA 3IAQA 4XABA 5A1FA 5J48A 1LEMA 1UKGA 1XU1A 1DIWA 2CHHA 3ZN4A 1FATA 4XZUG 2PXJA 4X6QB 5FYSA 3JUUA 5CB7A 5I8YA 4OQ8A 2VQ0A 2VXRA 2WINB 4Q4X1 3VBFC 4MG2A 4XQWA 2JDKA 5D8AA 4CDQB 1PK6C 1BVP1 3THCA 1FX5A 1AL23 4QPIB 5FZ0A 3WG2A 3N9PA 5DUVA 5JWPA 2GC3A 4XUOA 1J3QA 1N1SA 1IS5A 1VLNA 2WO2A 2FDJA 2R1DA 2JG9A 2VW0A 4UFHA 3ZFGB 4AVCA 1RJ7A 2J1EA 3PUAA 4AEDA 1HJGA 1YQ5A 5CG9A 1S0FA 1S0JA 5FQ0B 5CFDC 3RZMA 2WNOA 3L9JT 4PIZA 2ATFA 2ZEYA 2BGPA 3ZFFC 1LHUA 4BOWA 5KC5A 3MDPA 2FZ1A 4AI9A 3J7LA 4RFT0 1UIKA 1PO12 4IEWA 1L7RA 2XVKA 4IQPA 4BQXA 1I1EA 1YI9A 3H8OA 4META 2VC9A 3BPZA 1Y43B 3AKRA 3H8UA 1UAIA 4PHZA 3RNSA 1DHKB 2GN3A 2JD9A 1R1ZA 4YM1A 4OUSA 2DDUA 2DUQA 4AOCA 1ZBE3 3K48A 2QQPA 4NIDA 3ZN6A 5GLZA 3USUB 2QE3A 3N9MA 1B09A 1UMHA 3HR9A 1DP0A 3LEKA 3NNGA 4LOSA 4XIKA 3SKJE 3U78A 2VY0A 3B01A 2JB8A 2JDHA 2VUCA 1RUJ2 1VAKA 4XIOA 1OA4A 4ATEA 4FPGA 2PN5A 1KRIA 3I59A 1W04A 3GYDA 1Q8PA 4ONUA 2CV6A 4QPIC 4CU8A 3TWIA 5A6QA 4DXRA 1E5IA 1O91A 1RMU3 1WW6A 1S4CA 4CDQC 1NXMA 4P9YA 4J25A 4NIAA 3NKGA 4DXTA 3NV1A 2C26A 5B2GB 2ARXA 3VKLA 2CDPA 5KHIA 3OD0A 2VOVA 3OGSA 2YYOA 3KHBA 5BPXA 4J1XA 4LHNA 4ASMB 3KCXA 5DUWA 1DBNA 4CDWC 4LA3A 1YFUA 4EN8B 1ND3C 1SLTA 4N9HA 4D0QA 5LA9A 1BQPA 3SEPA 5FY9A 4N90A 3ZSEA 1ND2A 4YW3A 4Y22B 1JI6A 2UYBA 2ZEWA 5A32A 3B00A 2LALA 1R081 1TVGA 1RUH2 3ZO0B 2VZTA 4P02B 1ULGA 1UCXA 3AX4A 3OTFA 2GH2A 3NNMA 1QOSA 3VBRC 5F3EA 2VU9A 2UU8A 3WHTA 4AL9A 1MS3A 1TEIA 4A7KA 3VHNA 1R1A3 3I8TA 3NKTA 1YXWA 1FAYA 2LROA 5BNPA 4SBVA 3ZLIA 5T5JA 1SCRA 4AI2A 3UGHA 4E4SA 2VVDA 3CIHA 4FO9A 5CFCB 3W9AA 4KMQA 1F35A 5HPOA 5ISLA 1E5HA 2ZOEB 3BALA 1QDCA 3VZLA 1OC1A 2DCTA 4YZ5A 1RUI1 2W91A 4PIYA 2YG0A 5IK8A 2QCSB 2LRPA 2LUWA 1UMZA 4Z2WA 1QJY3 1T6BX 1LR5A 2MHFA 4E9KA 2QQKA 1PGW1 1ASJ1 2GNDA 2HLEA 2OZJA 3GZTB 3NL1A 4INDA 4QU1A 5G05L 4AVVA 1JH5A 2ZGUA 3MEPA 2ZGPA 3ACFA 1NA1B 3OEBA 4C1XA 3R6SA 2RS32 2YFUA 5LB6A 2Y6FA 1W2AX 2BQPA 4CDWA 4Y4YA 4CCCA 5J09A 3MLJA 3BUCA 1UY3A 4MX3A 2QFEA 2RJLA 5I0UA 3I59B 4FBFA 5CFCC 3UK9A 4FPKA 2E7TA 3C3VA 3LA2A 4B8EA 4EZ4A 4BXSV 3NO8A 3VD4A 1Z7S1 2WO7A 3CF6E 3VDCA 2JENA 2UWCA 4IEVA 3M4FA 3ITQA 2E31A 5C8WA 2XJVA 2WN2A 5CEHA 3WDXA 1W39A 5F8PA 2AEYA 4BHPA 2B8MA 2IXHA 3BU7A 1J83A 3JD73 3A23A 5A7PA 3I2FA 1GU3A 4XTPA 2AC1A 2BYVE 4Y20A 3AP7A 5D1IA 1VMJA 2GMPA 2WNVA 2EA7A 4GKXA 1GYKA 4PQ9A 1OXCA 5T5LA 2VTXA 3AK0A 5JXGA 1PGL2 4W50A 5A3MA 1CVNA 3AXEA 3NNLA 2PHFA 4JTNA 3OGVA 1DLCA 4DUXA 1UKRA 2JDUA 4LUKA 4QQOA 4CPBA 5EP9A 1YIFA 1PVC2 3AYDA 4HSJA 5GZDA 3N9QA 4JGZC 4A7YA 3GBGA 1DLLA 1PNGA 1XNCA 2WFF2 1A78A 2YC2A 3TN93 3LEIA 4C90A 5J98B 2YUEA 3VZMA 3PU8A 3MZHA 1VBD2 1VAMA 2D5FA 1MQTB 1XNBA 3BPSA 4KWKA 4OFGA 4TN7A 4YVSA 3FLPA 5LA0A 4QXCA 4P00B 5FPXA 5FJKA 3N9NA 3VZKA 5FY1A 3JBG1 4IEXA 4GA9A 3Q8BA 3RZLA 2QQWA 1QJX2 1XPWA 4I30A 3ACGA 5FBJA 3AYAA 3ST7A 4Z2AA 5FZAA 1AYN1 5FJHA 1OPOA 4QGNA 1AR63 2JG9C 1OOPB 4KGGA 3PIGA 4KG8A 1WLCA 1N47A 3N9LA 5E88A 5L9VA 4QB2A 4YPJA 3VBOC 5JOXA 3ZXDA 2B9UA 2WQ4A 5C3OA 2ZGSA 3RZJA 3H8XA 2WNUA 3LWCA 3MIEA 2DBIA 1XQNA 1RUI3 4N7UA 4AFMA 1YJLA 1Z7S2 4GWIA 5C70A 4XBLA 2VMDA 3IPVA 2D6KA 4LKSA 4AZZA 4E2SA 4ES9A 2XLAA 2Y38A 2J42A 3O1VA 4GXLA 3FFQA 1V9U2 2BBAA 1KS5A 1F5FA 3KMHA 4XJWA 3O1PA 1OURA 5EQUA 1AR71 1W6NB 4XDQA 3U37A 5AC91 1NQDA 1H2MA 2HBUA 2A3YA 2A6ZA 2D3PA 4LKDA 2A70A 5IYYA 4BQ4A 1PGL1 1SG3A 2D6PA 4IV3B 4BZ4A 1Y9MA 1J3RA 3H1YA 4QB1A 3OB8A 5DZGA 4B29A 5C7GA 1X33A 5FUNA 1WBLA 1LOEA 2A5ZA 5A7SA 4Q4W3 3AVSA 3HJRA 1DYKA 4LITA 1UYXA 1RVF2 4XFAA 2J7MA 5C5UA 1FV2A 2DCJA 3NW4A 2WWSA 1KJRA 2CTVA 1IPSA 1AR83 4H2AA 1RINA 2VE1A 5FK7A 2E53A 5IJRA 1AL21 1ZBE2 3DECA 1RITA 3ZXEA 2RS52 1JZ4A 5A7OA 3RJ2X 1ZRFA 1FMD3 2J1AA 2RG4A 2NYYA 3IAPA 5J96B 2E7QA 4OVEA 2FZ2A 1RUF1 2CWMA 3GBFA 3IMNA 2WRAA 5EFUA 2JKXA 3PMSA 4C0BA 4HPKB 1W6OB 1YHFA 1K12A 2BFUS 3HPNA 4XFBA 1JXNA 3LDBA 4YVSC 1TNFA 2PHXA 3WY6A 2Q0AA 4OHZA 3M3EA 5F7UA 2R7EB 4LBQA 5JPNB 2KD7A 4CUGA 1LAJA 5DXDA 1HRI2 1HRI1 2A6XA 5T55A 4AVBA 1JYCA 2XL9A 3GXUA 4JRLA 1K42A 1X36A 4JGYC 1SMVA 4A2UA 4AVSA 3MPBA 3CNAA 4FT8A 4OULA 4NMIA 1LKNA 5IATA 5JIAA 4A6SA 4QU2A 1CR7A 3CZJA 4LO8A 3UKVA 3APBA 2E7AA 3R4SA 2HWD3 3V0AB 4FTEA 3GHMA 4MGIE 4LNVA 3GDBA 1JBCA 2XKOA 5FTTC 4ISRA 1XYNA 4Y4RA 5FFOC 3K3OA 1A8DA 2PLV1 3LQCA 1OKOA 1K5JA 5DQ0A 4COWA 2WAOA 4KH9A 3LFIA 4L99A 1IKQA 1QIQA 4LA2A 3VZOA 2YV8A 1QH7A 4I2OA 4XOGA 4OUEA 1R092 3VL9A 3BI3A 3RI9A 4LHSA 1O5LA 1XC6A 2ZGLA 1NKGA 2DUPA 3NNFA 1BZWA 3VHPA 3VLBB 2ZCWA 5FUIA 2DF7A 3HD8B 1AZDA 4NR1A 2ZGOA 4CYDA 1ZZ8A 3IDBB 3POIA 5FYYA 2EICA 3HT2A 4Y24A 5FZ4A 2JB4A 3KQRA 1IZ3A 4B7KA 3VDDB 2VL4A 1HV0A 1ULDA 4OZXA 1MS1A 5L7OA 3GGLA 3ZIXA 4UWDA 4Z8BA 4BYYA 1ZX5A 1XYOA 3ELNA 2E26A 1W6PA 1ZBE1 3NMBA 4JHZA 3RRDA 1CAUA 4HOOA 1IQAA 1UU4A 2XJPA 1DQ1A 3H1MA 4MLOA 2F4LA 2CGOA 4K20A 1OI6A 3O0WA 3KWVA 1Q8OA 4DQAA 1HW5A 2XG3A 2JDZA 2GC2A 3N3HA 3SCFA 3ZYGA 5J3UA 1LU2A 2W68A 2WKKA 3THPA 3T2OA 4BE3A 5BXXA 5BNOB 2FBEA 3KT1A 2XVGA 5FZ9A 1JZ6A 3MICA 3AMQA 3SEEA 3I97A 1EAH1 4K8FA 3ZFFB 2VW1A 3H1WA 1BVVA 3UESA 3ZN5A 4BXFA 4NHLA 3T09A 1COV2 3M3IA 3I7DA 4L2NA 5CKMA 4EV0A 1TQ5A 1ZZBA 2K0GA 4LOTA 1CZSA 3ROUA 4HVQA 1MEC3 5KR7A 2GDFA 1JW6A 2OQ6A 1DGRN 1JYTA 3EQEA 1JUIA 2CAUA 2R32A 2XHNA 3C7GA 3V0BB 1CAXB 1H2NA 3B9IA 2YGMA 3MO4A 5KWRA 4AI1A 2B4KA 3U4SA 1UMIA 4Y20B 3DGTA 1GICA 4AVTA 3MIBA 1FPN1 5CKQA 4E8DA 1FPN2 1XNAA 2AYHA 3ZFEC 4JGZB 4K7JA 4LK6A 1C8M2 5F5IA 2OQ7A 4K8RB 1SFNA 5C8CB 5EPAA 4LPLA 1BKZA 4P9WA 3VBUB 3NJVA 1FNYA 4GD4A 4HBNA 2DYCA 4NJ4A 1JZ2A 2G1MA 1GNHA 4NN0A 1KXGA 4CUAA 4BU2A 5HBAA 5A3OA 2ZGTA 4L97A 1WA6X 5A6ZA 4BB3A 2XUEA 2GP3A 4AK3A 5BUVA 4Y1YA 2FD8A 4PIXA 4E2QA 2PA7A 2VMGA 4QPIA 3B9CA 4XTMA 4Y1VA 3O5SA 2BEOA 3SNMA 1CJPA 4AG4A 3PHMA 2VD7A 4BK4A 1ZZ7A 1ULEA 2JDYA 1C8M3 4MUVA 5EIYB 1UOJA 5JXIA 1GSLA 4GMP3 3B69A 5FQ0A 2H6CA 2FDHA 2WZR3 1AR61 2GH8A 4Q4V3 5HCAA 2EXJA 2WFPA 1OKQA 1KFXL 3DUIA 3JXSA 4S2HA 1OLMA 3OBRA 1LODA 2HWB1 2WSUA 1LOFA 5FY7A 5B4NA 3H3ZA 4I09A 4NVPA 3O7OA 4QPGA 4UOJA 3VD5A 1RMU2 3J4UH 1UZVA 3JB8A 3PVEA 1JU3A 2MPFA 1Z7S3 1U0AA 2WZEA 3BGAA 2WFF3 1SACA 4AFAA 5FZFA 1V6NA 2JECA 1VBE3 4CDUA 1OF4A 2Q8EA 5F9TA 1Q8VA 1NCQC 1PX4A 2BVVA 1XNDA 4B1LA 3F95A 4FP3A 3QH7A 1MS9A 1ULPA 3PURA 5HV0A 1UYPA 1WCUA 3AXDA 4IE4A 3MIGA 2WNUC 1DYPA 2QVSB 1DZTA 1URXA 5D21A 1HDKA 3FE5A 3DKWA 1GWLA 1YIPA 2R16A 2PTMA 5FY4A 1MACA 4GAZA 1HXS1 2C6SA 2D43A 2NN8A 1KDMA 5JLVA 2EIGA 2ZX2A 3ABZA 2X09A 4UF0B 5CNAA 3VBHB 4AAPA 2YC4A 4CDXB 2ZPXA 1ZNPA 3WX5A 5FK8A 3O1UA 2P34A 3NAPB 1VMFA 1ODMA 3I3BA 1EP0A 2QQLA 5FP9A 4BLIA 4CDUC 1WW7A 3UJQA 3T30A 1XU2A 4YW2A 2OT7A 5IUQA 1JOPA 1VBA2 2ARBA 4A6OA 4XAAA 5A3LA 5JMCA 2Y0OA 4O61A 1RUE1 3C8XA 4HKOA 1RUE2 5FPLA 3WDWA 1LHVA 1TZOA 5LY1A 3FWEA 3OPTA 4HT1T 4YG0A 4HN1A 2EXHA 1QXRA 4H55A 1HJFA 4L0PA 4GIQA 2FQPA 1ODNA 2XXZA 1QJY2 2A71A 3B94A 1A34A 1BBT1 1H4HA 3NJXA 5F3GA 4W6WA 4R52A 4CTEA 3MUZ1 1BJQA 1EV11 3K4DA 3AKPA 4YZ1A 2G9ZA 1OT5A 4YW6A 1M4WA 4DUWA 3DPRA 4LULA 1W6MB 3ORJA 1REEA 2WS93 1RUJ1 3WNOA 2ZAAA 1AX0A 2HWD2 4CXWA 3ZXKA 3WG4A 2IXKA 1A3KA 5JZGA 2ILMA 1H8TB 2WWUA 2XJSA 2QQJA 2R042 1SBDA 5LY2A 2NZ9A 5LBCA 4HG6B 4JZRA 5FYBA 3EO6A 2ZMKA 3IBMA 2BOIA 3HBKA 2ENRA 2ZEZA 2UY8A 4JKKA 1PM7A 1HRV2 3NWKA 3E97A 4LHLA 4Y5Z0 2JDMA 1T2XA 2VNGA 1I9RA 1PZ7A 1AJKA 2B46X 4QXHA 2YY1A 5K0UA 2VUJA 2FDFA 1R083 3SXWA 2DU0A 1GMMA 2W0XA 4OHXA 3POSA 1ASJ3 4Q29A 1J3PA 2ARAA 3AYCA 4IE0A 4NO4A 4EN6B 1G6NA 5FRAA 1K45A 1W0OA 5FKBA 1FYUA 4HMZA 2YFZA 1HQWA 1CQ9A 3JZVA 5H9PA 5F2WA 3WEZA 4F3JA 5DAVA 5FYCA 3H3LA 4AYUA 1J1TA 1WMDA 1MPXA 2HWC1 4GMP1 1S0IA 2R063 3A4UA 2XKPA 3E6BA 4CCKA 5FZBA 1WMEA 3WP6A 4AVAA 1M06G 1JU4A 5C9AB 2ZHKA 1YYNA 1CAWA 5T50A 1BMV1 2DCKA 1AYN3 1FV3A 1RJ8A 2A7AA 3VD3A 5IFPA 1AR73 4UT5A 4B7EA 1YI7A 2E51A 3WSOA 1D4M3 4K3UA 1W6QB 3N7KA 1PZ9A 1VBB1 3PIJA 4UW3A 4KNCA 5BNPC 5JAXA 4NROA 1JYIA 4Y26A 3VBFB 4GQ7A 4Q1PA 3MIHA 2W1SA 1NZIA 2PHWA 2Y6LA 4QHZA 4MHUA 2VUDA 5DAQA 3WV6A 5BNQA 2HWD1 2JG8B 4FVVA 1SQ4A 1G9FA 3NRUA 1F5JA 5C4WC 1UX6A 2Y33A 3KCCA 1PM4A 2VH9A 3AFGA 1RHI1 3C7OA 4IEZA 4S2FA 5F6LB 5A7WA 4R9AA 3KV5A 4Z1VA 3HWJA 1TG7A 4DY3A 1PGW2 1W6NA 5D8AB 4H7LA 4FOWA 1XE0A 2DWRA 3N35A 5FY0A 4A44A 2RR11 2ZX4A 5LWBA 2HBTA 4QKDA 2ORZA 2VQAA 3KS7A 4JKMA 4Y1ZA 2V4VA 1VPHA 1AYM3 4YGDA 1N1TA 3E5UA 4BIOA 2Y34A 4B4QA 3PL0A 4KBBA 1Y9GA 3N7JA 4RN5A 5A3UA 3HVDA 2O14A 1X50A 4TXWA 5AC93 4JC1A 5C3PA 1S0DA 3VKOA 5IVEA 5LBBA 1QJFA 2EXIA 5FO7B 5JZGB 2XOMA 3WF2A 1K5MB 4AQTA 5E16A 4M0NA 4V2VA 1LOCA 1X9PA 2BZDA 2WNUB 3ZR6A 1G9CA 1OD5A 4FTBA 1NCQB 2E32A 5J37A 1L7LA 2DVAA 3CJXA 5IVCA 5K0UB 1VALA 3A0KA 1DF0A 1KD7A 3MLLA 5A70A 4ZU5A 2BPA2 2A6YA 1LGBA 1H6XA 1DFQA 1NYWA 4ITCA 5FMCA 3OD4A 1PO23 2N7GA 2WSVA 4R8HA 4AF9A 3UGGA 2OPWA 4DEVA 3KF5A 1V6LA 4MXWB 2QQUA 1VBD3 5JI7A 5GJ6A 4MGZE 4XJ9A 3U11A 1AL22 4DB5A 1FPN3 3H42B 1Y3TA 4ZU7A 1Q3EA 1D7PM 3MF6A 5FR3A 3JCIA 3AZXA 3PTYA 1RUF2 1QJX3 4E2GA 3VB9A 1SLBA 2JE9A 2IWGB 2TUNA 1YQ6A 2OPKA 5FP8A 1CAWB 1VAVA 1AYM1 3LCPA 3EHKA 2WO3A 5F32A 5CFDA 3T3YA 5KXBA 3HN3A 2VNVA 5DAXA 4BCUA 5FLHA 1W6QA 3UKNA 4GJYA 4QXKA 2BBVA 4XF1A 4TTGA 4D7SA 1PNFA 1UWWA 4LHKA 1POV0 1W28A 1WMFA 2F6BA 5FZOA 4K1ZA 1WA4A 2BV4A 4X8PA 4HETA 1P8JA 5IK4A 1UYYA 1QNWA 1Y9QA 5HV4A 2VGDA 1H8VA 4WM7C 4L11A 3FC0A 3WW2A 4XURA 5ACA1 3EYPA 2Y64A 3KCYA 1MS5A 4AGVA 3BB6A 1QJU3 2B42B 5C4WB 1HB1A 4HZFA 4Q0UA 5C5TA 1RHI3 2JG8C 4K1YA 4LK7A 5F5QA 2EIBA 3POFA 5A33B 2HEVF 3PLQA 2PMWB 4YWAA 4NIGA 1STMA 4XBNA 1QJZA 4LJHA 4DOUA 1W9WA 4M3CB 4MADA 5C8CC 1O5UA 5I8TA 3HEIA 3CJIA 2GC0A 3ZFEB 2CL2A 1LNSA 1PMJX 1ZRDA 5BNPB 4ET7A 4HONA 4JDOA 4NE9A 3AJYA 1ST8A 5ANQA 1KDKA 1ZRCA 4P9JA 1UPIA 2YU2A 3U07A 3AZWA 4QKFA 2VQTA 1VBC3 5K8SA 4WVZA 3ASIA 4ZPIA 5L9BA 2C1FA 2ERFA 3LA3A 1GLHA 2X10A 1MS0A 2F17A 2WC2A 4HXCA 3UV9A 3VBOA 4DUVA 4WM7B 2MEV2 3LIGA 4XACA 4OMCA 3SHRA 3OBTA 4QKNA 4Y3OA 1RUC2 1RXFA 5FMOS 4WV8A 1R082 3K4ZA 4XBQA 1L7QA 3I3QA 3I4IA 3ZX7A 1O3SA 5GZEA 1KEXA 2QZ2A 2E33A 1J84A 1DGWA 1N3OA 3UETA 3F2ZA 4L8QA 5IW0A 2AACA 2ZXQA 1CZTA 1SLIA 1AXZA 3J7MA 4E4HA 5IVFA 1PVC1 1CN1A 3RSJA 3FBMA 4MXWA 4YM2A 1OH4A 5FZHA 1JODA 1VBA3 3V64A 3H7YA 2CY6A 1O8PA 2RDRA 2RJ2A 5TSWA 1ACCA 2ZHMA 1UY2A 4YG6A 3WINE 3K2OA 2W47A 1W90A 4CCDA 4FTSA 1W8NA 4R4ZA 4LE4A 3VKNA 3ZDSA 5KBFA 2A1XA 4A3XA 1D4VB 5GLWA 2XUMA 3OSDA 1S0EA 1ZA4A 1OA2A 5DDJ2 5E8AA 3FZ3A 4YGEA 4CCOA 1FNZA 4TZDA 2RV9A 1NLSA 2W94A 4RS5C 4UI9L 1I6XA 2RMU2 4N7IA 4Q5OA 4QQLA 4RA0A 3RMXA 1VB2A 3SISA 2XJUA 3ZXFA 4SLIA 4FFFA 3ZYFA 2P5BA 2BP6A 3ZPYA 4XE9A 3K77A 1JMUB 1H1MA 4NHKA 1C57A 4ASLA 1H2KA 5GLUA 2BGCA 1V00A 1VBE1 3BU0A 1UYZA 4QX5A 1O8SA 4ZONA 2AENA 3J7HA 4G3YC 3M8LA 2YBPA 3PUIA 4HK9A 4Q0QA 5C8CA 5JOYA 1OFSA 4B1MA 4CU9A 3ZVXA 1FMD1 1LECA 3LGRA 4I02A 1LCLA 2LW8A 5AVPA 2PHDA 4EJRA 5JOZA 4XC9A 4CEYC 2ZACA 2DVFA 4XCBA 4XUNA 1HLCA 1WD4A 1X7NA 1UPSA 3OGRA 1TMF2 2HWF3 3DEMA 2WYSA 5FKCA 1WLWA 5GLVA 4AI8A 4HL0A 4AEMA 1QMJA 5T3NA 4P14A 2P37A 2NLRA 1SPPA 2QUOA 2WIIB 3AL6A 3LE0A 3OBAA 1G9DA 1UU6A 3WP4A 3KVBA 1PMHX 2FCVA 2HYXA 1I3HA 2PQSA 3MV01 3OGJA 4WM8C 4XF3A 1OLRA 4KWLA 4Q1RA 4BDVB 4IGQA 2DTYA 3ILRA 5DG1A 2LM3A 3POBA 2G19A 4JQTA 1POV3 1GFF2 3PUQA 4AI3A 1SBFA 4WZFA 4RR3B 2V4AA 4N43C 4CCMA 2Y26A 5IVVA 1WCSA 1VMHA 3DV8A 2PAEA 1MZ5A 4UW4A 2QKDA 5DAPA 5FYTA 2W08A 1N3QA 3R0RA 3I2GA 4D6RA 4V1PA 2WLQA 1ZM1A 2DVDA 4O9EA 4XFGA 3WVJA 1ZRRA 3HQUA 4OI4A 4G9SB 3VBRA 4MYEA 2R041 2Q8CA 2AGSA 2ORXA 2G4IA 5BNNB 1DQ6A 1W8FA 1B35B 3WNPA 2RM21 1PIV1 2YGLA 3WF3A 2ZX1A 4WVWA 3BIEA 3DN7A 5A3TA 2XLFA 4OI2A 3WQBA 5FV3A 3WW4A 5A6YA 1UX7A 2WL1A 4CEWC 1XSQA 4FQ4A 4WVMA 4K21A 2HKXA 5FXXA 2WA4A 4Q4W2 4TLGA 4AAXA 1O59A 2FCTA 1W8WA 1JS9A 5JPMB 3MW2A 4A41A 1V6MA 3U10A 4LLFA 5A3WA 1OOPC 2JG9B 2WZR2 4Q4V2 4TWTA 4UFKA 1V70A 1FMD2 1V9U3 3L2HA 5K9YA 5C3RA 4AGRA 2ZGMA 4FPLA 4OI1A 3TYJA 3B3QE 4YG3A 1XJAA 4EQVA 4FAGA 1BEV3 4NPRA 4W6YA 2R0FA 3RZZA 3P3PA 1TMF1 2FMDA 1WGPA 3KQ4B 3AP9A 4ZY9A 4PCRA 1EV13 1IHMA 4XF0A 1J1LA 2VZRA 3HMYA 4C1WA 3H8RA 1X9TA 1S0GA 1W0NA 4DXZA 1PK6B 2QTWB 3THDA 5C3SA 1XXNA 2WS91 4UFJA 3E6CC 5F5CA 3AZYA 4X8NA 2NMNA 2SBAA 4AQ2A 4MSVA 1W06A 3GBWA 3E1F1 3A22A 5IWFA 3OJBA 1L3JA 2PAKA 4XFIA 3M7AA 3IMMA 5L7OC 3HQRA 1QJU2 2Q1MA 2WT1A 1GNYA 5KXEA 2Q8OA 4JQRA 3UL2A 5LCWL 3WR0A 2VECA 4COUA 1ENRA 1U5ZA 2CDOA 4MVTA 4GH4B 1Q43A 3N9OA 4PDWB 2D7FA 4QX0A 5FBZA 3HAGA 1MZEA 4U2AA 3ZYJB 3ES1A 1W8OA 4P5YA 1XE7A 4N9IA 2RM22 3V0BA 4PBOA 1C28A 2XJQA 3RJRA 5DMYA 3FHQA 3RGBA 1GOHA 1W6PB 1HB2A 2VZUA 1I5ZA 1W2OA 1OLME 1LHOA 3VBFA 2ZMLA 3BTXA 3KLSA 1JOBA 3EB7A 1GBGA 1U12A 3ZOIA 4R9DA 3FLRA 2VCBA 1C8M1 2IC1A 1NCRC 1WLTA 2EAKA 3GHNA 4ZXEA 1NA1C 3Q8CA 3FJSA 1W6OA 2RE9A 3VBSB 1ZZCA 5AVAA 3T2QA 3KT7A 3SCHA 4LXLA 2L9LA 4UBHA 4KQ7A 4KG0A 3V65A 4QGLA 2ZGNA 5DABA 2AR6A 2FDIA 1S1AA 2YPJA 3SQOA 2HWB3 2Y6GA 3ZKUA 4F8AA 3AC0A 1S0CA 1YUDA 4XQ4A 2MEV1 1PO11 1UU5A 2D6MA 4KU8A 1AR91 5HCBA 3FN9A 4I0BA 2OIIA 3CHXA 3IM0A 4O7XA 3VZJA 5JZGC 2XONA 3D4KA 3ES4A 3VDAA 4KWJA 1C1FA 4LR4A 3SC7X 5FZEA 5LZ6A 2IFWA 5GZCA 5ABJB 1QJU1 1SEFA 5J1XA 2QZ3A 4LO5B 1OPMA 4CP9B 1HN0A 1EYBA 2ADEA 5T52A 2ID4A 2W5FA 4XEZA 5G04L 1OBNA 4LO6B 1HQLA 2HH9A 4OCTA 1GUIA 3KD4A 2OKXA 2ZS6B 4JGYB 4ZKTB 5LASA 1H9WA 2VOXA 3RYRA 4CCEA 1NT0A 4YFWA 3VHOA 2YC0A 3WW1A 4BQYA 4LE3A 5L36A 3I49A 5JSRA 3MFAA 2J22A 4EZHA 2W52A 4IEPA 3I54A 4I3GA 2AUYA 2Z69A 1NA1A 5FZDA 3X29B 2WZPP 4E8CA 1ND3B 1NCRA 2ZGRA 4URTA 4MOAA 4D8MA 1GV9A 1JYXA 4MGYE 4CE8A 3GJAA 3NV3A 1C4RA 2CWSA 2R6QA 3OY8A 4YGCA 1G86A 1AR82 5T54A 3R4UA 1RUD2 3ZIWA 3D6EA 2WA3A 4PLNA 3K75B 1SBEA 1LESA 3Q8AA 2TNFA 2XHKA 4UFIA 3OPZA 2UY9A 4PT6A 4LKEA 1VP6A 5I93A 1H2LA 3HNMA 1NE4A 4AWDA 2D98A 3TNQA 5FZ6A 3LPFA 4H7MA 4R9BA 2EALA 1UY1A 1CAXA 4URAA 1W9TA 3K3NA 3ZMNA 5FO9B 3M1HA 4QX7A 4NRQA 1QY4A 3B93A 1WKYA 5BNOC 1GQGA 5FZGA 2BOJA 2VPVA 2YXSA 2HEYF 5I0DA 4XFCA 5T5PA 1LOAA 2DURA 2V5YA 5K4LA 3LEMA 3S6PA 1HKDA 4YVWC 1D2SA 1OQDA 3BYWA 2KR2A 5A80A 5FZLA 4XCAA 4LQRA 4DRVA 3IT8A 4BQ2A 1IG3A 4RGAA 2D93A 4ES8A 4BLJA 4MGQA 3O1OA 2PFWA 2C5DA 4Z82A 3NSTA 5CFDB 3UGFA 2D6NA 2J1RA 3J8F3 4CP9A 2X5IA 1Q5OA 2GALA 3H0OA 3ZFGC 1DZQA 1UZYA 4QQPA 1AXYA 1H8TC 5FMOL 5KXDA 2O8OA 3ETPA 2Z79A 4GZ9A 5LATA 4AQ6A 5IHRA 3M3OA 4RD7A 3ZMOA 4GJZA 2O0OA 1WW4A 2F4PA 4A4AA 4DFSA 2RMU1 4YM0A 2D5HA 1BK0A 1CZVA 3KVAA 3P6BA 5JSPA 2EXKA 2I2SA 4XUTA 1UXXX 1UZWA 1H9PA 3PDQA 2X53S 2Y6KA 3C7EA 1QH6A 5FZ8A 5FPBA 1UO9A 3PMEA 2VMCA 3PU3A 3DXUA 3WCRA 5I91A 2R071 3AB0A 4FPYA 2R072 1CIWA 4IUGA 4B4RA 1UL9A 2A3XA 4XZPA 2WLPA 4UFMA 1RIRA 1MVEA 2ZKLA 5CVRA 3ZFEA 1HB4A 1VR3A 3D3AA 1MQTA 2QQVA 2P3YA 2VUAA 3W5MA 1R093 1CESA 1WCKA 2VQUA 1LOBA 4BK5A 3DPRB 4DXSA 1VRBA 4Y1UA 3WOGA 4ARXA 3C2UA 2YZ4A 4CDXC 4CU6A 2ZZQA 2ZBJA 1C5IA 3EBRA 4E4ZA 1DDLA 4FPOB 4IXLA 4F83A 3LDRA 2WZ8A 2BUKA 4OMDA 4XDPA 4QWNA 5FP7A 1F15A 1WW5A 3OG2A 1BMV2 1VBA1 4PLMA 2EIEA 1MEC2 1HX6A 4B4PA 4NRMA 1JYVA 2Y0IA 4K6BA 2PHUA 1UQXA 3JQWA 4MGSA 4NAMA 4Y1XA 1NXD1 4GALA 1SFPA 1KJLA 4XETA 3E5QA 3ATGA 4IGPA 1POQA
chains in the Genus database with same CATH topology
3S30A 4YSFA 1DG6A 5FAXA 2XB6C 3KT4A 4CDXA 5DDJ3 2B5HA 1TME2 3AP6A 2Q30A 2B39A 1LTEA 1EV12 1HXS3 4JDNA 4XF9A 1AL0G 4Y22A 3VBHA 1TNRA 5ACA2 1JHNA 1BK1A 1QOOA 1YJKA 4KGQA 1ZBA3 3SCGA 2CNAA 4R4XA 4D7YA 3ZXAC 3SH3A 5K0UC 1PIV2 5EYXA 2D3SA 2RS31 2D40A 3FUQA 2G9FA 3HQXA 1G9BA 2Z2SB 2IXJA 4QM9A 2Z42A 1V6IA 1ENXA 5L73A 4CDQA 1LULA 1RB8G 2RR13 1DGRA 4FOQA 1RUC3 2QNKA 2VMHA 2R30A 5CU1A 3ZFGA 1IGOA 1F31A 2VULA 4GH4C 4PDWC 2NQYA 4O9GA 1QU0A 1X8MA 3DPRC 4NWWA 3N4MA 3HN1A 2ZHNA 1UD1A 3SH4A 3GNEA 4EWAA 3B7MA 1QF3A 3VDDA 5L19A 3QCWA 5JVVA 1YFXA 4HKWA 3EJKA 4D69A 1U5IA 2D44A 4FPJA 4XMAA 4JGYA 5FO8B 5SV8A 3LKJA 2PAMA 4UW5A 5KXCA 3OF1A 1LRHA 1H0BA 2IXIA 1WLDA 4Q2FA 4Z92B 3ZSKA 5BNOA 1RUI2 1LJ7A 3M3CA 1O4ZA 5I8SA 4YGBA 5KHKA 3WUCA 3ZFFA 1DQ2A 2ZJCA 4HFSA 2Q1ZB 2PLV3 3JBG2 3QOPA 2CGPA 3TN91 1Z0HA 3WZ1A 4IEQA 3KGLA 4EN0A 3OY8B 2DFCA 1YFWA 1VJ2A 3CEWA 4JV4A 1AX2A 1SLCA 4I3PA 5KHJA 5LEKA 4XJZA 2RS12 4LBNA 3D0SA 1AHSA 2YMZA 5DUXA 4M3CF 4Q4W1 3LSDA 3NV2A 1MVQA 3ALQA 1UF2C 5I0SA 4Q4Y3 4E4DX 1LOGA 3E5XA 5KHHA 4D7TA 1VBB3 3CJIC 4M3CA 2GMEA 3RQ0A 4HSLA 2OA2A 4CZSA 3KSCA 4FSJA 1VRH2 4OHYA 4XXPA 4M00A 5AC92 5H9SA 1G7YA 1IKPA 1AR81 1O3QA 5LRRA 1RUD1 3VBUA 2G9GA 3UJOA 5JI9A 2IXCA 1ZZ9A 3W58A 4CP1A 1BBT3 3AKSA 1IS3A 3HT1A 1CD3G 3BTAA 4XXAA 4HKLA 4N53C 2P2KA 4YZ3A 4Q4Y2 1CONA 4AFCA 4A7ZA 1VBB2 4HVRA 2ZGQA 2X5IB 2R073 1ENQA 1OFNA 1GZWB 4GB33 4IV1C 3MGUA 1KFUL 2JE7A 1QXPA 4AGGA 4AHWA 3IIAA 1N1YA 1NG0A 4LTAA 1ZZ6A 1EAH2 5KC6A 5J36A 1U5XA 3MW3A 2HYKA 1QJX1 2RS11 2UYAA 1LHWA 2DUOA 4BPZA 1BYHA 5CA6A 2QDRA 4S2DA 4CDUB 2UURA 3AMMA 3AMPA 3RYPA 1NZCA 3ECQA 5SV5A 2K9ZA 3AMNA 3WDYA 4P9XA 2JD4A 2RS53 4TLFA 3IN9A 3VN4A 1WCDJ 2ZABA 4OHVA 5ABJC 4OLLA 3G6JB 2R043 1NQJA 2H6BA 3AZZA 3IWZA 4LUMA 4Q4X2 4CDWB 4GH4A 4PDWA 1QWRA 1DZRA 4WVVA 3WNXA 1YRZA 1AJOA 5DG2A 4XPVA 4PLOA 3ILFA 4RS5B 4AHZA 2WNVB 4HPKA 4ORFA 4LBJA 2WQZC 2GAUA 3POWA 2BFUL 3ZSMA 3RPQA 1Q8SA 3BIWE 4LBQB 4Q4Y1 5CIRA 1QQP3 3ZSLA 3E6DA 3NAPA 1LHNA 3VKMA 1QOTA 2WT0A 3AZVA 3W59A 1RUG3 5CADA 2PHLA 2A6VA 5EYYA 2FHRA 4IV3C 3QACA 4RHV3 1VBC2 4UBGA 4L92A 5A33A 2R062 4FOYA 4YZ4A 3V0AA 1O3RA 1PO21 2QDNA 5C4WA 2TEPA 1RUC1 2VOKA 2BVBA 3USUA 4U36A 5HCFA 3LB9A 1MZ6A 1WUVA 4AQSA 5BV6A 4FXGB 2ET7A 2XVLA 3WCSA 5FOJB 4Q27A 1QQP2 3H50A 1A8MA 1YFYA 5LRSA 2VNOA 1ALYA 3WUDA 4MH0E 3VUOA 2C0ZA 4YW1A 3RMYA 1UW8A 4BIFA 1ZREA 2ET1A 1COV1 2NP0A 3MYXA 2DV9A 4IEOA 1PVC3 1O3TA 4CP2A 5L7OB 2WJSA 2XGXA 1LGNA 1LENA 4FOVA 4FPHA 4EWEA 3O14A 4EROA 1R091 1V6JA 3MIDA 1F9KA 1YLLA 5DDJ1 4DINB 5JSOA 1KS4A 4DRRA 1MQTC 1Q56A 3QD6A 2D3RA 3ZYPA 5FREA 3PNAA 1ZVFA 3TOJA 3ACLA 2HJIA 4H3WA 2XBO3 3WT3A 2C9AA 2YHJA 5JIUA 2BWCA 4XFHA 1J58A 5I0RA 3ZSJA 4BA6A 4FQZA 4IESA 4IV1A 4IEUA 1EY2A 4N43A 5LEJA 1H8TA 3QH6A 4MZUA 3H3UA 1S2KA 4R9CA 3DF0A 1MR5A 1SDWA 2R49A 4N53A 3VV1A 1QJY1 3GALA 4Q0SA 1HQNA 1HIXA 5I0TA 1RUG1 1ND2B 2MNGA 2O8QA 3CU7A 2XBO2 2BW8A 1MZFA 2HWF1 3PVOA 1RUNA 4JAAA 4KL1A 2DVBA 4P9IA 1LB2A 1ULCA 3SH5A 4YARA 4E27A 1OQEA 2GU9A 5DZEA 4Z07A 4FCAA 1OMIA 4QM8A 2WT2A 1POV1 3CO2A 3KZ4C 3TN92 4EN9B 1SFYA 3U0ZA 1XNKA 2YDEA 1VRH3 2KA3A 3B02A 3O12A 4IETA 4AEDC 1CGPA 1OQ1A 2HWE1 2HWE2 2BNNA 1K5MC 3BOWA 4XFFA 3U4XA 1HRV1 4RR3A 1PMIA 1W0PA 3J8F2 5E1RA 3SMHA 2GSYA 1YWKA 3LAGA 1RUH1 3RDIA 5GZGA 4EN7B 4HANA 3WP5A 5EXOA 1RVF3 2Q4SA 3HIFA 3MLKA 4JDMA 4XYXA 1R1A2 4MV2A 1VRH1 2WZR1 4MXVA 4Q4V1 4XHBA 2VW2A 3LA7A 3FFZA 5BNNA 2VMIA 3B5LB 5KHGA 1APNA 3KGZA 2E6VA 1IPKA 4FXKB 1CJDA 1TE1B 2JJ6A 4GMP0 4PBPA 4QPGC 4JGZA 4IEYA 2VNRA 3CL1A 4AE2A 1LEDA 2W39A 1LOFC 2DCZA 4OI0A 3WDVA 1UN1A 2XBO1 4RQPC 4XMIA 3POYA 2HWC3 1FXZA 2OYZA 3ZYIB 3WG1A 4HVOA 5ACA3 2ZTNA 5A32B 1QXJA 2R1BA 4YM3A 1JN2P 1PGSA 4N53B 5C9AC 1ASJ2 1JTZX 4YW4A 3WDTA 1PIV3 4Q0PA 1AX1A 3M70A 4LO4B 1RUE3 1GKBA 1LGCA 3IPVB 2BTVC 1DQ4A 2E63A 5IT6A 4Q4X3 5FCCA 2A6WA 5CFCA 3GZAA 4I01A 1NE6A 5LK7B 1O7FA 3EXUA 2O1QA 1C1LA 1FI2A 1KQRA 2SLIA 3ETQA 5IK5A 2XWBB 3CJIB 2XWJB 4DNYA 1HXS2 1NOVA 4YVWB 1DU3D 3N36A 2JG8A 1R1A1 4CRQA 1JOJA 1AXKA 4GWNA 2RM23 4LBQD 5GLTA 4AW7A 5FDBA 3KB5A 5JDBA 1B35C 4WM7A 1NY72 2ZGKA 1RGSA 2TBVA 4DY5A 1XYPA 1GNZA 3JQXA 4JVAA 1HRV3 2AREA 4OUMA 4Q8LA 1RUOA 1VIWB 3FMGA 1X82A 2ETEA 4QQ2A 1GZ9A 1PHMA 4AHYA 4QMAA 3OYWB 2FMYA 1DGLA 2ZAHA 4J6GA 5AFEA 1AYM2 1CAVB 2ES3A 3MW4A 2H0VA 3GF6A 1TME1 3S7IA 4QPGB 5FOBB 5EV7A 1H30A 4LLOA 4RHV1 2CAVA 4B3NA 4IV3A 4AI0A 2I07B 3SLIA 2DTWA 2H0BA 4FP2A 1D4M2 4LEJA 3D8CA 3NAPC 2V73A 2XJRA 4K40A 1RUD3 4COVA 3JD71 3PVBB 1EPZA 2NPIA 4YVSB 1GQHA 5JCTA 1G8WA 3PJQA 2P3IA 4GKYA 5IK7A 3H7JA 1ZBA1 4YLZA 1AVBA 1RUJ3 5DUUA 5AFBA 2X5IC 2GC1A 1NY71 1UZZA 1GZWA 4NOTA 2RHPA 1H1IA 1ENSA 1IS4A 3T1LA 1FOD2 1V6OA 4F7ZA 3WP3A 4CEWA 2BNMA 2PQQA 2ZA9A 4RSUA 4XJ8A 3ME2A 3L2YA 4YVWA 2XH6A 3ZXGA 1S55A 2OUJA 2RJKA 3D0JA 3ILNA 3LOBA 4G4FA 2HWE3 2PHRA 4LT5A 4AFBA 5LK5A 1NCRB 4DMIA 5CBLA 4JTOA 1N3PA 1EAH3 1Q8QA 2UWBA 3ZN6B 1E57A 5F1RA 2D6OX 2VG9A 5BYNA 1BEV1 3AP5A 1BEV2 1D2QA 1C3HA 1MS8A 5T5OA 1RHI2 1FOD3 1MEC1 2ZKNA 3AFKA 4YYOA 4RL7A 1Z78A 3URFA 4AXOA 3MFCA 3G7DA 5DZFA 3RG0A 3T2TA 3BODA 3GZUC 1REDA 3VBRB 4XW3A 3FBYA 3MF9A 4S2GA 1G9AA 5C6CA 4UW6A 3VBOB 2KM2A 3USSA 1B35A 2K2SA 5D8AC 3TAYA 3VHRA 4YRDA 2PELA 3OCPA 1CPMA 4AEJA 2GNBA 4Q26A 3WQ1A 3VBUC 1S2BA 3MPPG 1AF9A 1V9U1 4TYSA 1NLRA 1XE8A 1H4GA 1REFA 2B7YA 4QT6A 3WLUA 4TSVA 2DU1A 2ZMNA 4LBKA 4YZ2A 3BCWA 3INAA 1GANA 2A75A 1U5YA 1AUYA 2ZX3A 4PF5A 4M0HA 4M01A 3VL8A 3VKFC 4RS5A 5C9AA 4W6XA 1FT9A 4K9SA 2A3WA 4FPFA 3M2MA 1H1AA 5E89A 4XF4A 4HLTA 1TME3 2Q5TA 2JICA 1VBC1 2OVUA 3N7LA 5EZWA 4QGMA 4IERA 5C33A 1V6KA 5EWSA 1QQP1 4LBOA 1SCSA 4JCKA 1OSGA 1GZCA 2P3KA 3NV4A 4M3CE 4CEWB 1VB4A 3NJZA 4IL7A 1S0BA 1RUG2 2RMU3 3TB0A 2WFF1 2RS33 3TRSB 4I0AA 4FPEA 2IZWA 2D97A 5BNNC 3VZNA 3WDUA 1CAUB 3K51A 1YCIA 4PJYA 3VDDC 1PVXA 1MS4A 2B45X 1SLAA 2VVEA 4XJUA 2IXLA 4C91A 2XPJA 4YNIA 2WNVC 5JOWA 3A0NA 2X29A 3VGIA 2PLV2 2AH2A 2ZZJA 4RR3C 2LTNA 4XHXA 1K5MA 4BWOA 2YROA 4XILA 3TNPB 1COV3 4N43B 3D82A 4NWVA 1ZYBA 4OHWA 4LBLA 3IDEA 1NCQA 1HV1A 4WM8B 2R0HA 4UXAA 2X8KA 4HN0A 5JR7B 3IDCB 2DVGA 1WBFA 2JKBA 1AR72 4Q8KA 4GB31 3ZYRA 4NHMA 1PZ8A 2D6LX 1OHFA 4P9LA 1YNAA 3P3NA 2GNMA 2BWAA 4Q0VA 5K7PA 1OA3A 5GKAC 3VBHC 4JRAA 4ISQA 5HI0A 1RTVA 3PVNA 5GALA 3ZXJA 1RVF1 3ZXLA 4WVMB 4QHBA 3DL3A 2Z5WA 1AR62 4P5HA 3S0MA 2OZ6A 3O0VA 1DGWX 1W2UA 1GR3A 1BBT2 4AEDB 3O0XA 4IV1B 1RMU1 2JX9A 2KXLA 3LSEA 1OOPA 2V09A 3J9SA 3CLPA 4KU7A 1QDOA 3Q9OA 4CP0A 3TBDA 1RUF3 3J26N 5CG8A 2GNTA 1ONAA 5CAZA 4ZXKA 3JU9A 1BCXA 2QJVA 3QBQA 1WD3A 2GMMA 2DFBA 2BNOA 3WQ7A 1DQ0A 2IFRA 3J8F1 1ND2C 4BQ1A 1C8NA 1F8VA 4DS0A 1HRI3 2EVXA 3AKQA 3H9AA 3PJYA 2RS13 1T6GC 1ND3A 4BMEA 1PO13 4J1WA 3AP4A 3HBZA 3OGGA 4WZCA 2P17A 3RI8A 4BM8A 4YW5A 1VBE2 2EF6A 1IPJA 1O4YA 1W6MA 4X6RB 4EWDA 2GN7A 3N7MA 3AKTA 3WD5A 1DQ5A 3BOPA 3S7EA 5GZFA 4GB32 5HXVA 1FOD1 3FHIB 1QNYA 3LOIA 1JUHA 5FLIA 2E9QA 3FX3A 3I2DA 5EJ3A 1C5HA 3AMHA 3RWNA 3WG3A 4GWMA 3WW3A 4WM8A 3MI8A 1A6CA 3AJZA 3JB4C 4FAHA 1D0HA 2NMOA 3V56A 4MGKE 2WS92 4QPYA 4DZGA 5J7MA 1SLLA 1UIJA 4AHXA 1VBD1 2VOWA 5BY5A 1PO22 4RQPB 5H9RA 4CEYA 2CYFA 4AEKA 2A73B 4YFZA 4BH9A 2OW4A 4D94A 4AFDA 2GZWA 3AYEA 1Y7BA 2MEV3 1RL3A 3AM2A 1QGLA 3R4DB 1KITA 4ATFA 4FPCA 1QKQA 2RR12 1D4M1 1XRUA 4XJAA 1J59A 2P3JA 4COZA 4WBBA 4DPNA 2I74A 3WXPA 3IKWA 3UKTA 1LU1A 1O4TA 1RUH3 3JD72 3QLQA 2I45A 4L9BA 2UWAA 1QHDA 1RC6A 4LBMA 3MIFA 1D0GA 3OYWA 1PK6A 1ZBA2 5ABJA 1CX4A 1AR93 2PYTA 4P9GA 2EAAA 1BXHA 3LZZA 2ZX0A 4QD2A 2OUHA 2XLGA 4HK8A 2ZHLA 4H14A 2HWC2 2NM1A 4C0HA 4BMBA 1ULFA 4D3WA 2DCYA 3NVCA 3JBG3 4QQHA 1N1VA 2CGNA 3VBSC 4RGGA 3SITA 1YO8A 4W65A 1IOAA 1AR92 2HEWF 3T1MA 3FUOA 3R05A 2RS51 3ENRA 2XL7A 5GM0A 4COYA 3KM5A 2R061 4RHV2 1F2NA 1AYN2 3RS6A 1OLQA 3WHUA 5H9QA 3WQ0A 2JEMA 1CPNA 4XQDA 4I0WB 4ZU4A 2VVFA 2AZ5A 1CAVA 1TMF3 2HWF2 4GULA 4LO7A 4RQPA 2HWB2 4CEYB 3M3QA 3RYKA 1EPWA 3THTA 2XJTA 2WNEA 1IS6A 1X8EA 3FLTA 2JXAA 5F6KA 2PHTA 5FPZA 3D5OA 5FLJA 5J48A 1LEMA 1UKGA 1XU1A 1DIWA 3ZN4A 1FATA 4X6QB 5CB7A 3JUUA 5I8YA 2VQ0A 2VXRA 2WINB 4Q4X1 3VBFC 4XQWA 5D8AA 4CDQB 1PK6C 1BVP1 1FX5A 1AL23 4QPIB 3WG2A 5DUVA 5JWPA 2GC3A 1J3QA 1N1SA 1IS5A 1VLNA 3ZFGB 2R1DA 2JG9A 2VW0A 4AVCA 1RJ7A 4AEDA 5CG9A 1S0FA 1S0JA 5FQ0B 5CFDC 4PIZA 3L9JT 4BOWA 2ATFA 3ZFFC 1LHUA 5KC5A 3MDPA 2FZ1A 4RFT0 1UIKA 1PO12 4IEWA 2XVKA 4IQPA 1I1EA 1YI9A 4META 3BPZA 1Y43B 3AKRA 3H8UA 1UAIA 3RNSA 1DHKB 2GN3A 1R1ZA 4YM1A 4OUSA 2DUQA 1ZBE3 3K48A 2QQPA 3ZN6A 5GLZA 3USUB 2QE3A 4XIKA 1B09A 4DXZA 3HR9A 2VY0A 3B01A 1RUJ2 1VAKA 4XIOA 1OA4A 4ATEA 4FPGA 2PN5A 1KRIA 3I59A 4ONUA 3GYDA 1Q8PA 2CV6A 4QPIC 3TWIA 1O91A 1RMU3 1WW6A 4CDQC 1NXMA 4P9YA 3NKGA 3NV1A 5B2GB 2ARXA 3VKLA 5KHIA 3OD0A 2VOVA 2YYOA 5BPXA 4J1XA 4LHNA 4ASMB 3KCXA 5DUWA 1DBNA 4CDWC 4LA3A 1YFUA 4EN8B 1ND3C 1SLTA 4N9HA 1BQPA 4N90A 3ZSEA 1ND2A 4YW3A 4Y22B 2UYBA 5A32A 3B00A 2LALA 1R081 1RUH2 3ZO0B 1ULGA 1UCXA 3AX4A 3OTFA 2GH2A 3VBRC 1QOSA 2VU9A 2UU8A 3WHTA 1MS3A 1TEIA 4A7KA 3VHNA 1R1A3 3I8TA 3NKTA 1YXWA 1FAYA 5BNPA 4SBVA 5T5JA 1SCRA 4AI2A 4E4SA 2VVDA 4FO9A 5CFCB 3W9AA 2ZOEB 3BALA 1QDCA 3VZLA 2DCTA 4YZ5A 1RUI1 4PIYA 5IK8A 2QCSB 2LUWA 1UMZA 4Z2WA 1QJY3 1LR5A 2MHFA 4E9KA 1PGW1 1ASJ1 2GNDA 2OZJA 3GZTB 3NL1A 4INDA 4AVVA 1JH5A 2ZGUA 3MEPA 2ZGPA 1NA1B 4C1XA 3R6SA 2RS32 2BQPA 4CDWA 4Y4YA 5J09A 3MLJA 4MX3A 2QFEA 2RJLA 5I0UA 3I59B 4FBFA 5CFCC 3UK9A 4FPKA 2E7TA 3C3VA 3LA2A 4B8EA 3NO8A 1Z7S1 3CF6E 2JENA 2UWCA 4IEVA 3M4FA 5C8WA 2XJVA 3WDXA 1W39A 4BHPA 2B8MA 2IXHA 3BU7A 3JD73 4XTPA 2BYVE 4Y20A 3AP7A 5D1IA 2GMPA 2WNVA 2EA7A 4GKXA 1GYKA 4PQ9A 5T5LA 3AK0A 1PGL2 5A3MA 1CVNA 3AXEA 2PHFA 4JTNA 1UKRA 4LUKA 4QQOA 1YIFA 1PVC2 3AYDA 4HSJA 5GZDA 4A7YA 4JGZC 3GBGA 1DLLA 1PNGA 1XNCA 2WFF2 1A78A 3TN93 4C90A 5J98B 2YUEA 3VZMA 3MZHA 1VBD2 1VAMA 2D5FA 1MQTB 1XNBA 4KWKA 4OFGA 4YVSA 3FLPA 5FPXA 3VZKA 3JBG1 4IEXA 4GA9A 1QJX2 4I30A 3AYAA 3ST7A 1AYN1 1OPOA 4QGNA 1AR63 2JG9C 1OOPB 4KGGA 4KG8A 1WLCA 1N47A 5E88A 3VBOC 5JOXA 3ZXDA 2B9UA 2WQ4A 2ZGSA 2WNUA 3LWCA 3MIEA 1XQNA 1RUI3 4N7UA 4AFMA 1YJLA 1Z7S2 4XBLA 3IPVA 2D6KA 4E2SA 4ES9A 2XLAA 2Y38A 4GXLA 3FFQA 1V9U2 1KS5A 1F5FA 3KMHA 4XJWA 1AR71 1W6NB 4XDQA 5AC91 1NQDA 1H2MA 2A3YA 2A6ZA 2D3PA 2A70A 1PGL1 4IV3B 2D6PA 4BZ4A 3H1YA 1J3RA 5DZGA 4B29A 1X33A 1WBLA 1LOEA 2A5ZA 4Q4W3 1DYKA 1RVF2 4XFAA 1FV2A 2DCJA 3NW4A 2WWSA 1KJRA 2CTVA 1AR83 1RINA 2E53A 1AL21 1ZBE2 1RITA 3ZXEA 2RS52 3RJ2X 1ZRFA 1FMD3 2NYYA 5J96B 2E7QA 4OVEA 2FZ2A 1RUF1 2CWMA 3GBFA 3IMNA 5EFUA 3PMSA 4C0BA 4HPKB 1W6OB 1YHFA 3VBSA 2BFUS 4XFBA 4YVSC 1JXNA 3WY6A 1TNFA 2PHXA 2Q0AA 4OHZA 3M3EA 4LBQA 5JPNB 5DXDA 1HRI2 1HRI1 2A6XA 5T55A 4AVBA 1JYCA 2XL9A 4JRLA 1X36A 4JGYC 1SMVA 4A2UA 4AVSA 3MPBA 3CNAA 4FT8A 4OULA 1LKNA 5JIAA 4QU2A 1CR7A 4LO8A 3UKVA 3APBA 2E7AA 3R4SA 2HWD3 3V0AB 4FTEA 3GHMA 4MGIE 4LNVA 1JBCA 2XKOA 5FTTC 4ISRA 1XYNA 5FFOC 1A8DA 2PLV1 4COWA 4KH9A 4L99A 4LA2A 1IKQA 3VZOA 2YV8A 1QH7A 4I2OA 4XOGA 1R092 3VL9A 3RI9A 1O5LA 2ZGLA 2DUPA 1BZWA 3VHPA 3VLBB 2ZCWA 2DF7A 3HD8B 1AZDA 4NR1A 2ZGOA 4CYDA 1ZZ8A 3IDBB 3HT2A 4Y24A 3KQRA 1IZ3A 4B7KA 3VDDB 1HV0A 1ULDA 4OZXA 1MS1A 5L7OA 3ZIXA 4Z8BA 4BYYA 1ZX5A 1XYOA 3ELNA 1W6PA 1ZBE1 3RRDA 1CAUA 1IQAA 1UU4A 2XJPA 1DQ1A 3H1MA 4MLOA 4K20A 2CGOA 1OI6A 3O0WA 1Q8OA 4DQAA 2XG3A 1HW5A 2JDZA 2GC2A 3N3HA 3SCFA 3ZYGA 5J3UA 1LU2A 2W68A 2WKKA 3THPA 4BE3A 5BXXA 5BNOB 2FBEA 3KT1A 2XVGA 3MICA 3AMQA 1EAH1 4K8FA 3ZFFB 2VW1A 3H1WA 1BVVA 3ZN5A 4NHLA 1COV2 3M3IA 3I7DA 4L2NA 4EV0A 1TQ5A 1ZZBA 2K0GA 3ROUA 4HVQA 1MEC3 2GDFA 1JW6A 1DGRN 3EQEA 1JUIA 2CAUA 2R32A 3V0BB 1CAXB 1H2NA 3B9IA 2YGMA 5KWRA 4AI1A 4Y20B 3DGTA 1GICA 4AVTA 3MIBA 1FPN1 1FPN2 2AYHA 3ZFEC 4JGZB 4K7JA 1C8M2 5C8CB 1SFNA 1BKZA 4P9WA 3VBUB 1FNYA 4HBNA 2DYCA 1GNHA 4NN0A 1KXGA 5HBAA 2ZGTA 4L97A 4AK3A 5BUVA 4Y1YA 4PIXA 4E2QA 2PA7A 2VMGA 4QPIA 3B9CA 4XTMA 4Y1VA 3O5SA 2BEOA 3SNMA 1CJPA 4AG4A 3PHMA 1ZZ7A 1ULEA 1C8M3 4MUVA 1GSLA 4GMP3 3B69A 5FQ0A 2H6CA 2WZR3 1AR61 2GH8A 4Q4V3 5HCAA 2EXJA 2WFPA 1OKQA 1KFXL 3DUIA 4S2HA 3OBRA 1LODA 2HWB1 2WSUA 1LOFA 3H3ZA 4I09A 4NVPA 3O7OA 4QPGA 1RMU2 3J4UH 3JB8A 3PVEA 2MPFA 1Z7S3 1U0AA 4AFAA 2WFF3 1SACA 1V6NA 2JECA 1VBE3 4CDUA 5F9TA 1Q8VA 1NCQC 2BVVA 1XNDA 4FP3A 3QH7A 1MS9A 3AXDA 3MIGA 2WNUC 1DYPA 2QVSB 1DZTA 1URXA 1HDKA 3FE5A 3DKWA 1YIPA 2R16A 2PTMA 1MACA 1HXS1 2D43A 2NN8A 1KDMA 5JLVA 2EIGA 2ZX2A 5CNAA 3VBHB 4CDXB 2ZPXA 1ZNPA 3WX5A 2P34A 3NAPB 1EP0A 4BLIA 4CDUC 1WW7A 3UJQA 1XU2A 4YW2A 5IUQA 1VBA2 2ARBA 5A3LA 5JMCA 2Y0OA 1RUE1 4HKOA 1RUE2 3WDWA 1LHVA 3FWEA 4YG0A 4HT1T 4HN1A 2EXHA 1QXRA 4H55A 4GIQA 2FQPA 1QJY2 2A71A 3B94A 1BBT1 1H4HA 4CTEA 4W6WA 4R52A 1BJQA 1EV11 4YZ1A 3AKPA 1M4WA 3DPRA 4LULA 1W6MB 1REEA 2WS93 1RUJ1 2ZAAA 1AX0A 2HWD2 3ZXKA 3WG4A 2IXKA 1A3KA 5JZGA 2ILMA 1H8TB 2XJSA 2R042 1SBDA 2NZ9A 3EO6A 2ZMKA 3IBMA 2ENRA 4Y5Z0 2UY8A 4LHLA 1PM7A 1HRV2 3NWKA 3E97A 2VNGA 1I9RA 1PZ7A 1AJKA 2B46X 5K0UA 2YY1A 2VUJA 1R083 3SXWA 2DU0A 4OHXA 2W0XA 3POSA 1ASJ3 4Q29A 3AYCA 1J3PA 4EN6B 4NO4A 1G6NA 5FRAA 1W0OA 1FYUA 4HMZA 1HQWA 1CQ9A 3JZVA 5H9PA 4F3JA 4AYUA 1J1TA 1WMDA 2HWC1 4GMP1 1S0IA 2R063 3A4UA 2XKPA 3E6BA 1M06G 1WMEA 3WP6A 4AVAA 5C9AB 2ZHKA 1YYNA 1CAWA 5T50A 1BMV1 2DCKA 1AYN3 1FV3A 1RJ8A 2A7AA 1AR73 4B7EA 1YI7A 2E51A 1D4M3 4K3UA 1W6QB 3N7KA 1PZ9A 1VBB1 4UW3A 5BNPC 4KNCA 1JYIA 5JAXA 4Y26A 3VBFB 4GQ7A 4Q1PA 3MIHA 2PHWA 3WV6A 5BNQA 2HWD1 2JG8B 4FVVA 1SQ4A 1G9FA 1F5JA 5C4WC 1UX6A 3KCCA 2VH9A 3AFGA 1RHI1 4IEZA 4S2FA 5F6LB 4R9AA 4Z1VA 3HWJA 4DY3A 1PGW2 1W6NA 5D8AB 4H7LA 4FOWA 2DWRA 3N35A 2RR11 2ZX4A 3KS7A 2VQAA 4Y1ZA 1AYM3 4YGDA 1N1TA 3E5UA 4BIOA 4B4QA 4KBBA 3N7JA 5AC93 1X50A 4JC1A 1S0DA 3VKOA 2EXIA 5FO7B 5JZGB 4AQTA 1K5MB 5E16A 4M0NA 1LOCA 1G9CA 2WNUB 4FTBA 1OD5A 1NCQB 5J37A 2DVAA 3CJXA 5K0UB 1VALA 3A0KA 1DF0A 1KD7A 3MLLA 4ZU5A 2BPA2 2A6YA 1LGBA 1DFQA 1NYWA 4ITCA 3OD4A 1PO23 2N7GA 2WSVA 4R8HA 4AF9A 1V6LA 4MXWB 1VBD3 <