2E63A

Solution structure of the neuz domain in kiaa1787 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
170
structure length
170
Chain Sequence
b'GSSGSSGELHPRTGRLVSLSACGRTARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPSSATGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTVAGELRLWVNGRDCGVAATGLPPRVWAVVDLYGKCTQITVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1787 protein
publication title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 21
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2006-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2e63A00
2WL1A 2FBEA 5F6LB 4WVMA 4KG0A 3KB5A 4X8NA 4B8EA 3ZO0B 4QT6A 4XW3A 4P9LA 2VOKA 4B3NA 2E63A 5JI7A 5C33A 5JI9A 4WVMB 5JIUA 2YYOA 2LM3A 4N7IA 4P9JA 2IWGB 4P9IA 5JIAA 3TOJA 4V1PA 2YUEA 5F6KA 4X8PA 4N7UA 3UV9A
chains in the Genus database with same CATH superfamily
4OHYA 3VBSA 1PZ9A 2QQWA 2WUHA 2JG9A 5F1RA 2E32A 2R063 1V0AA 3ETPA 3GHMA 1LRHA 2XGXA 1YQ6A 2XONA 3RMYA 3WDYA 4EWAA 3D6EA 4XFHA 1YWKA 4PBPA 2N7GA 2XOMA 4B1MA 5AC93 1W0PA 3CZUA 3NNMA 5GZGA 2ARBA 3GDBA 4YARA 4WZCA 1J58A 1HRI2 3J9SA 5C7GA 5JXJA 2GN7A 5HBAA 1OKOA 2B39A 3OGSA 4E27A 4CDUC 5DPNA 4DXSA 2Y34A 5FY0A 3JZVA 1XNBA 2ARAA 4O65A 5FQ0A 1AR61 2KR2A 2WR9A 1REFA 4AR2A 4EE2A 4JC1A 5KXDA 1D4M2 4YM0A 5A3LA 1DQ2A 3L2HA 4N7UA 4Q1RA 2OA2A 2HWE1 3MGUA 3GBWA 2ZA9A 1PO11 5BNPA 2FMDA 2W94A 3K3NA 1RJ8A 3F2ZA 4IERA 5FZIA 5SV8A 4EV0A 5IK5A 3NJYA 3CNAA 4BWOA 5C5TA 2LALA 4JDNA 2WNUA 4Z82A 2VGDA 3IAPA 1PVC3 1Q8PA 4XETA 3U75A 2Y6GA 1F4AA 3CF6E 1O8SA 5HI0A 5A1LA 1DGRA 4XUQA 1VBD2 1AL22 2BVBA 2WZR3 3AYAA 1SZBA 4NWWA 1W8NA 1FOD2 1JHJA 2SBAA 1MZ6A 3E5UA 2VJXA 1UQXA 1WW6A 4QXCA 1Y9MA 5BNOB 4CCOA 2OW4A 3SKVA 4YVWC 2WFPA 1LU2A 5JSPA 1CONA 2FDGA 1WA6X 4CEYB 1C57A 3AKPA 5C8CA 4TYSA 5GM0A 4LKEA 1GQGA 5LA2A 1I3HA 1OSGA 2A3XA 3LEKA 1W05A 2WNEA 2VW2A 4HK8A 2AUYA 4OFGA 4NHMA 3I3BA 1JS9A 4Z2WA 5DN2A 4G9SB 1HB3A 4XF9A 2QUOA 3M2MA 4JKKA 3AMPA 3A4UA 4IEVA 5FZFA 2BTVC 1CZVA 4E4HA 4AHXA 4ZPIA 3VKMA 4FBFA 1F2NA 4V1PA 5LBFA 1RUI2 1VMJA 1FMD2 3WNPA 4YM3A 3WW3A 3QACA 3UGGA 4OLLA 4LBQA 2DVBA 3SHRA 4RQPC 1WLWA 4CP0A 3RZHA 1CR7A 1LOBA 3GZTB 1RUC1 1W8UA 2ZACA 3PDQA 4U36A 4Y26A 4ITCA 4CCCA 5FYHA 4AE2A 2DCJA 1J1LA 3AMQA 4W6WA 5CA6A 1HDKA 1IQDC 2V4VA 2VW1A 3N3HA 5JDBA 2IVJA 4MGYE 1DZTA 3O1UA 4BHPA 1VMHA 1FATA 2W47A 1PIV3 4GALA 5AVPA 5J36A 4I30A 1ASJ3 1QIQA 3USUA 1BBT2 1RUF3 3AFKA 3N9LA 1YI9A 1S0JA 2NQYA 2QCSB 3CQOA 4NRQA 2OUHA 2W92A 3J4UH 3WW4A 3ZN6B 3BOPA 1QXJA 2HWF3 4HBNA 3CJIC 5JXGA 4OVEA 3ZXDA 1O4ZA 3EHKA 4FFHA 5CZKA 3APBA 1QJU2 1AR73 3ZYBA 4QKNA 4LT5A 2HWB2 1VBB1 2W39A 1WWYA 4W65A 2ZMLA 3LKJA 1AR92 3ST7A 3N35A 2GSYA 1QEXA 3PURA 1O7FA 1TME2 2XH6A 1ZA7A 1VBC2 4FFFA 1E5IA 4LUKA 3AVSA 3LB9A 1LCLA 5HV4A 3JXSA 1R1ZA 1WZXA 1Q8VA 1TQ5A 1VB4A 4Y1VA 2IXHA 3ZOIA 3MLKA 3FN9A 1PGL2 1W9YA 4OQ8A 1AR83 1SFNA 2E53A 4AK3A 2RM23 2WNVB 4DB5A 1CPMA 1RC6A 4YZ2A 5AFEA 1URXA 4BJ0A 2VOTA 4IGOA 2QZ2A 4QXKA 3NW4A 4K40A 4DY3A 5E8AA 3LD8A 3VBSB 1OF4A 4KU8A 2BGPA 1RUG1 3GBGA 4CDQA 4MGTA 1S0CA 4YG6A 2D6PA 2R071 2MEV2 3CIHA 2EAKA 3KV9A 2ZZJA 4K6BA 3K77A 5BNOC 4FOWA 4Z07A 1G86A 1UOJA 5JIAA 4I09A 4I0WB 4W8JA 4KNCA 5IVBA 4B7KA 1POV3 4CEYC 3KSCA 3AZVA 3U0ZA 2WL1A 3B69A 3GZEA 4XDOA 1POV0 3S57A 4ET7A 1JZ2A 1YCIA 3KMHA 1UX6A 3H3ZA 5FQ0B 2DUQA 1HW5A 4N8MA 2VCCA 5L9RA 4F8AA 2DBNA 1GOFA 5BNNB 2HWC1 5JPNB 1UZYA 2EALA 4BQWA 4COYA 4UYBA 2GC0A 2V72A 2JD9A 3TEWA 2R30A 1COV3 2A6WA 2JE7A 1GZ9A 1YC61 1NT0A 3DL3A 4H7MA 1CAVB 1E5HA 1YI7A 2ID4A 1GOHA 5CU1A 4AVVA 3H7YA 1GWLA 3OPTA 4XZPA 1W06A 5IW0A 3NQHA 3BB6A 3HQXA 4N43B 1I5ZA 3IMMA 3POIA 1YFUA 4OZOA 1QJX1 1ULGA 4LJHA 3V0AA 4XE9A 3ES1A 4JHTA 5JZGC 4I0BA 3NV4A 4ONUA 1VR3A 2WS91 2HBUA 2VZTA 3ILFA 4MXVA 4Y1UA 5CYYA 1NZCA 2E63A 5FBZA 1KS4A 2ZGKA 3ZFGA 3A23A 4OHXA 4Q27A 1HX6A 5A3WA 1WLCA 3AM2A 3CDZB 2A6XA 3IDEA 3MF6A 1W3XA 1AX1A 1SFPA 2JWPA 2QQMA 4R8HA 5F3IA 1VBA2 4FAHA 2E51A 1U5IA 3VZKA 1GR3A 1F8VA 3LF7A 1EAH1 4QB1A 1OOPC 1OKQA 4JGZA 1SPPA 4E4ZA 3VL9A 2J22A 4IE6A 3O1PA 1VB2A 2ZGSA 4A4AA 2BPA2 2DUPA 1QGLA 4AAXA 1UF2C 1ZBA1 2VQ0A 3K75B 4NRMA 3SH3A 4QQPA 4RN5A 4LBKA 5FZCA 3MBWA 4XW3A 3VBRB 4AQTA 3EYPA 1GQPA 4FSJA 1RHI2 4FP3A 4Y33A 5ANQA 2BGOA 5LA9A 1R1A3 1RUE2 1H2NA 5J96B 5JI9A 5LCWL 1ULPA 2WRAA 4XUPA 2IFRA 3THCA 3I3DA 4YW6A 1MS1A 5FTTC 1VBE3 3D3AA 4I3GA 1O6UA 2Y33A 1XXNA 3HOBA 2VW0A 1AYM1 4PCRA 4C91A 4AVAA 1JUIA 3VB9A 4DS0A 2YUEA 3I7DA 2YGMA 2B4KA 3B9IA 1V6IA 3ELNA 3IPVB 4YZ1A 1NY72 2WNVC 1VALA 4GB31 3I2KA 4LKDA 4MV2A 2VMHA 4UBHA 3UV9A 3VBOC 1C8M1 3DKQA 4Y1XA 4DUVA 1RMU2 1V00A 3TEZA 3NV1A 4MO3M 3USUB 1SBDA 4FOVA 5ANNA 3TRSB 1HRI3 2JG9C 3VBSC 4IW3A 1W8WA 1PMIA 1W8OA 3V64A 2WYFA 2VMEA 1EV11 2B8MA 2W9XA 2OX0A 4JVAA 4ZXKA 3SCFA 3VHNA 3IT8A 2PAEA 4COWA 4JTNA 3A0NA 5J7MA 1ZVFA 4INDA 2Z4FA 4OMDA 3X29B 1D4M3 4HLTA 2ORZA 2ZEYA 3RDIA 4MGZE 1O3RA 2G1MA 2YC2A 5JR7B 1OI6A 5FV3A 3RI8A 4OHZA 5IUQA 3LOIA 1O5UA 2D44A 3Q8AA 2FD8A 4SBVA 4S2DA 1OMIA 4HG6B 2ZPXA 1TE1B 3I8TA 4DEVA 5E1RA 5LASA 4HVRA 3KS7A 1AL0G 2NM1A 2R061 3E5QA 4XABA 3LEIA 2BBAA 3K51A 5JLVA 2GNBA 5BNPC 3U14A 1BQPA 4DUWA 4COVA 2O14A 3CKHA 4ARXA 3HD8B 3ACHA 1W9WA 3WQ1A 1VBD3 2D5FA 1AL23 4EZ4A 1UMHA 1RVF1 2F4LA 1JOJA 2WQ4A 4FTEA 1FOD3 2XJUA 2Y6KA 1DCSA 5LY2A 3EMRA 4CPBD 3I54A 2WABA 4XBLA 3UL2A 2WZ8A 2D40A 3NWKA 3WF3A 4Q0PA 4B4PA 5DG1A 3CZJA 3S6PA 5C9AB 3UJQA 4CDQB 2XVGA 4CUCA 3GNEA 5B4XA 5LEKA 3KLSA 2LROA 2R041 2BOIA 4YPJA 3WP3A 5JMCA 5F6LB 2Q4SA 1Y9GA 1RUH2 4PIZA 4IV1A 3FL7A 4QX0A 1PMJX 3GXUA 3WHUA 1IPJA 4Q29A 3Q8CA 3AL5A 4E2QA 5C8CC 1QF3A 2VTFA 1HV1A 5FK7A 4X6RB 3MIGA 2YB7A 4XBNA 5FOBB 1GV9A 2Z42A 2BOJA 2VR4A 2Z2SB 5KHIA 4GXLA 2OZJA 4RS5A 3ZM8A 1FMD3 1UKRA 3CHXA 1VLNA 2RMU2 3ZYFA 2FDJA 2YBPA 4NO4A 4TLGA 1OFSA 2Y26A 3O0WA 2SLIA 1IQAA 1QWRA 1YJLA 4WBBA 3RJ2X 3QBQA 4MH0E 1H9WA 2RS31 5IVYA 3THPA 2BUKA 1PO21 3AYDA 3ACLA 2XHKA 4LR4A 3MDPA 3VBRC 1OA3A 2WWJA 2E6VA 2UYAA 3FWEA 3M3CA 1W9FA 3RZLA 3ATGA 4A6SA 3RZKA 4KWLA 3U37A 1DQ1A 1MZFA 4LQRA 5CNAA 1US3A 2Q1ZB 2VZPA 1BLZA 3AKTA 5C3RA 4Q0VA 2UYBA 1BBT3 4FOQA 1CZSA 2XLAA 4P00B 2WA4A 3OGGA 1DLCA 2XG3A 4Y20A 3AL6A 3OJBA 4LBOA 1QQP1 3LDKA 1QJU3 5IVFA 1MS8A 3TNQA 4KWJA 4RR3A 3BTXA 5EV7A 1BYHA 1YJKA 2BFUS 4GMP3 4LNVA 3LDBA 1AR93 4JGZB 1AYN2 2KM2A 4WM8A 3VKFC 1G9CA 2QJVA 2FCVA 5GKAC 1TME3 2IC1A 1VBC3 1WA4A 2JDAA 1A34A 2C9AA 2ET7A 3T2PA 3ZPOA 3H42B 4AEKA 1O4YA 1WKYA 1NLSA 4Y3OA 5JMOA 4RFT0 5JPMB 4XJUA 4KBZA 4GKYA 2QDRA 5EZWA 4AFAA 5JVVA 4UW4A 2CDOA 1NXD1 2CDPA 2OPWA 2JG8B 1J83A 4GQ7A 3DXUA 3I49A 2DU0A 5GZCA 3ZXFA 4QX5A 3I2OA 1JOPA 1L7QA 3KF3A 1S2EA 2HBTA 3HNBM 5BNQA 1AR71 1ZYBA 3K48A 2HEWF 5FO7B 3VDCA 2JB8A 2VXRA 3JQWA 2MEV3 2EA7A 3OSDA 4E2GA 2RV9A 5T5LA 1JZ5A 3K2OA 2O8OA 3AX4A 4CDQC 3AKSA 3BTZA 1DLLA 1SHWB 2IWGB 3TOJA 3UJOA 2Q5TA 3LFIA 2DFCA 1NAEA 1SLAA 4EWDA 1CAUB 2VE1A 2E26A 3C7GA 4XJ8A 5EFUA 1POQA 1Y4WA 1C5IA 2PHRA 3P5BA 5F3GA 3ZKUA 1EPWA 3TYJA 2V09A 4FFIA 1GP6A 2X10A 1VIWB 3PL0A 4RHV2 4TXWA 2RM21 2X09A 2D93A 2ZGTA 1OURA 2EVXA 4CPBA 4W4ZA 1NCRA 1N1YA 2CAUA 1BHGA 4EN7B 3VL8A 2B46X 4YW2A 1RUD2 5FYZA 5IVVA 4XYXA 4HKOA 1SDWA 2GH2A 4BH9A 5GALA 4LTAA 1N3OA 4A44A 5A3UA 5A6XA 1PK6A 4PIXA 1OC1A 5EPAA 5FYSA 1OLQA 3IBMA 4N9HA 2BNNA 4D6QA 4QPGA 1OPMA 2PELA 2G9FA 1Z7S2 1OVPA 3M3QA 3MIEA 3AFGA 4LO5B 2VULA 3A0KA 3H3UA 5EYXA 4XCAA 1XE7A 2BGCA 3PUQA 3VUOA 2P4EA 1IKPA 1Z0HA 3O14A 4AOCA 4PBOA 2PAMA 5E6HA 4YSFA 5A3NA 3FFQA 2ETEA 3GZAA 3I2JA 1H1MA 4LO6B 2PXJA 1YUDA 4KMQA 2H6CA 3ZFEB 2P37A 4BQXA 2P6CA 3ENRA 1LHNA 1VBA3 5CFDB 4OUSA 5HCBA 3O1OA 4UOJA 5JR2A 1DQ0A 1QU0A 1ZZ7A 1H2LA 5CB7A 1G9DA 1BKZA 3B93A 1QJY2 1UAIA 4QB2A 5K0UA 3WDVA 2VVDA 2FCUA 2R1BA 4X8PA 4HONA 4Y22B 3VDDB 5A6ZA 2VMDA 4GJZA 3KV4A 2DURA 1V6KA 3LGRA 3MYXA 4RS5B 3U11A 4CTEA 4QPYA 5M0TA 2W5FA 4JGZC 4NIHA 2V73A 1F5FA 2EXIA 4GULA 1WBLA 1ZRRA 2JDHA 2K0GA 3WUCA 2RHPA 1RHI3 2IXCA 4CU8A 3ZFFA 3O0XA 3KB5A 1W2UA 3POBA 3PVNA 3R05A 1RUE3 3WUDA 4A7KA 2GP3A 2WIIB 3PJQA 3VDAA 5DAQA 5L9VA 3LFMA 1ZNPA 3ZR6A 1H1IA 4E8CA 2GH8A 5BNOA 5D8AB 1STMA 3WR0A 4GAZA 1JBCA 4GWJA 2LUWA 4CEYA 3EQEA 1S4CA 1AXZA 3ETQA 1RMU3 3FE5A 2XKOA 1JMUB 2JIGA 3B3QE 4BXSV 5A6YA 1MS9A 5JUVA 4MSVA 3HNMA 4A41A 4OULA 2X53S 3OUIA 4HN1A 3FLPA 3DYOA 2VNRA 2AEYA 5IWFA 3PVEA 1W28A 1D7PM 4ZY9A 1UIKA 1W39A 1W8HA 1W99A 3LDRA 1CX4A 3WX5A 4AFMA 4IE7A 1M4WA 3WSOA 2MNGA 3C7FA 1UOBA 2R32A 4Q4V2 4A6OA 5FXWA 4QQ2A 2TNFA 1SLCA 4IGPA 3DYPA 4UFHA 5IAVA 4XVHA 3FHIB 2DTYA 1WBFA 2WQ8A 1H30A 4LUMA 1H6YA 1MZEA 2ZBJA 1WW4A 2R0HA 1UX7A 1AX2A 1NE6A 4Q5OA 5FBJA 3URFA 1PX4A 4MADA 1IG0A 1DQ4A 2D98A 3GCWA 1NG0A 2ADDA 1S1AA 2W46A 3BUCA 4IEXA 2H0VA 4XTPA 4Q4Y1 2PMWB 2Q30A 4K8FA 1JTZX 1CD3G 2O8QA 1LENA 2OZ6A 4P08A 5I8TA 3LQCA 5A3PA 2BP6A 3AK0A 5IFPA 1EUUA 2EXKA 2HWD2 1JYIA 3QOPA 2CGOA 4AVCA 1W2NA 2ERFA 1EUTA 3J8F2 4L0PA 4XHXA 2QQPA 2V5YA 1HB1A 1JODA 4Q0SA 5LBEA 1RXFA 4Q2FA 4QX1A 4QGNA 5G04L 3AVRA 4BZ4A 3KT7A 3POYA 3CU7A 1V6LA 1O4TA 1RUH3 3POWA 5LBCA 4FO9A 3ITQA 1LGBA 3ZIWA 1W6QA 4CCEA 2WO7A 3MICA 3UGHA 3PMSA 3J7LA 2TEPA 4GWMA 5FFOC 1QJEA 3GHNA 2ZMKA 2CGNA 2GMEA 4IV1C 5I91A 1KS5A 4E9KA 3ACFA 4Q4X2 4IEYA 2CWSA 1IHMA 4CDWB 4Q1PA 1VBD1 3T0DA 2Y6LA 2RMU3 3KZ4C 1KJLA 5CADA 3JUUA 3VD3A 3DF0A 3BCWA 1HJGA 1SMVA 3B9CA 1ZBE1 4RS5C 3NNFA 3JD71 1NYWA 2FZ1A 1VE0A 2P3IA 2QNKA 3IKWA 5FUNA 4DXRA 5FY7A 3SH4A 3MFCA 3POJA 3OY8A 1ZA4A 2WZEA 4HT1T 1PK6B 3VZNA 4AI1A 1TVGA 4XBQA 4QPGB 2AR6A 3UESA 1FX5A 3VZMA 1J3PA 1K5JA 1FPN2 4JCKA 4OI2A 2VTXA 2VXJA 5IYYA 4YGDA 3RWKX 1UWWA 4HOOA 4Q4W2 4S2FA 3W20A 3WG1A 3SQOA 2I45A 5FZBA 4CXWA 2K46A 3KCCA 4MGIE 2KA3A 4CP9B 1ENRA 1QXRA 1W6MB 4NPRA 4RSUA 4XDPA 1LKNA 1SBEA 4UFJA 3UKVA 3ZKYA 4M4PA 1GBGA 2WT2A 1N3QA 2W68A 3MUZ1 5BNNA 1OF3A 4YM2A 2JX9A 1GICA 2ZS6B 3LWCA 4E8DA 1HB4A 1BCXA 3WNNA 1XQNA 4E2SA 1WMDA 1KDKA 5K0UB 1AYN3 1W8TA 2GMPA 1HQWA 1NXMA 1HXS2 2PLV2 3HJRA 3O1RA 1DYPA 3ZYJB 4H7LA 4RR3C 3Q8EA 3SCGA 1JZ6A 2ZCWA 1YFXA 4LEJA 3VHPA 4AHWA 1LAJA 1ULOA 1CAVA 1U5YA 2X29A 2EIBA 1W2OA 2ES3A 4JKMA 4WM8C 3ZFFB 3AKQA 4FTBA 2JECA 3VBHB 4QHBA 2VZ1A 4DUXA 1KGYA 4N43A 5J3UA 1HRV2 2TUNA 2A70A 2XVLA 1W3VA 4CCNA 1UKGA 3IAQA 5C4WB 3ES4A 4QQOA 3UNPA 3VKOA 5KHJA 2GNDA 2VD7A 1OVSA 1QJU1 2NYYA 3NJZA 1TMF3 4D94A 2GNTA 3WF2A 4PF5A 3CL1A 4XJ9A 1LNSA 4GMP1 2DUOA 1AR91 4Y4RA 4AF9A 1ULFA 2C1FA 1RYYA 2V5DA 1D2SA 3AMHA 4AFCA 1JZ7A 4XFCA 5FKCA 1AVBA 1D4VB 1H1AA 2P6HA 2RDNA 4XQWA 4HK9A 3UETA 5CG9A 2HLEA 5IK4A 1G6NA 4FPOB 1GNZA 4AFDA 5IFTA 2YY1A 4B7EA 5DDJ1 4MYEA 4WVVA 1XOYA 1A8DA 1GU3A 4RHV3 3VDBA 1CZTA 3BYWA 3VBRA 2RS11 1QY4A 2AENA 3N9PA 5A80A 2RR12 5FZDA 5J09A 4BXFA 1IS6A 3IB3A 5JXHA 3HN3A 5FZ9A 1OBNA 1RUD3 3LCPA 4BK5A 4FVVA 1KJRA 2GNMA 1UN1A 1OH4A 3GZUC 3HWJA 3NNGA 2ZABA 3QD6A 4I01A 5T3NA 2E31A 2ZGUA 1NCRC 4XFFA 1DG6A 2VL4A 3IPVA 3LAGA 3OYWA 4QHOA 5FWEA 2WFF1 2WWUA 2XVKA 3U10A 1RUOA 5A7SA 2PFWA 1Z7S3 3MZHA 4GJYA 4PIYA 1AR62 2VOWA 2OS2A 3ZXEA 3HN1A 1OD5A 1F15A 3EO6A 1PK6C 5A7NA 4CCDA 5T5JA 2YMZA 3LEGA 4JDMA 2HWE2 3WDXA 1MPXA 5HXVA 1CJPA 2WSVA 4QPGC 1PO12 5CAZA 3JBG1 4PT6A 1EY2A 2JD4A 2XUEA 2RS53 4EN8B 1BK0A 1ZZ8A 2DU1A 2A75A 1CAXB 1KXGA 2BW8A 3RYKA 5CISA 5A7PA 3RS6A 1W6QB 2VMIA 4QWNA 3WNOA 4ATFA 4IETA 2XBO1 5FZ1A 3O1SA 2VBPA 4N9IA 3RRDA 1LGNA 1QJY3 4QDQA 1NLRA 5DAWA 4MXWA 2WN2A 1UU5A 4JQRA 1LHOA 3TEXA 3L2YA 5FJKA 2QKDA 2Y6HA 2ET1A 1UPIA 2EIDA 2L9LA 2W3JA 3B5LB 1TNFA 4UF0A 4XEZA 3THTA 5K0UC 1FV3A 1X9PA 1C5HA 3BN6A 4BPZA 5F3EA 3DXTA 1WW7A 5FJHA 4DOUA 2NMOA 2WT0A 4LO7A 1RTVA 1Y7BA 1LU1A 4TLFA 1BEV1 3ZFFC 3GBFA 3OY8B 3QLQA 4LE3A 4GA9A 5C9AA 4R4XA 3VBFB 3KT4A 2JDUA 4LO4B 1MVQA 2BEOA 2BWCA 2GC2A 2WZPP 3PHMA 4AI3A 1V9U3 3ZYHA 5LA0A 3B7MA 1RUJ2 3T0BA 3VD5A 3OOXA 1G9BA 1UZZA 2VBDA 5FR3A 3LEMA 1K12A 4I0AA 3RQ0A 4IE4A 2NN8A 2VOXA 4IEQA 5KXBA 3SISA 1FNYA 1NX9A 2AGSA 2DYCA 3OUJA 4M01A 2QBXA 5EYYA 3PMEA 4F7ZA 5E16A 5IVEA 4FI9A 4WVMA 4AI2A 1RUC2 1GWMA 2DVGA 1WMFA 3AC0A 4YLZA 4Q4V3 2J1UA 2UURA 1V70A 2VNVA 2X8KA 1DFQA 4PQ9A 2CGPA 1ST8A 2I07B 1AXYA 2XQXA 4NPMA 4DIQA 4HVQA 1W8ZA 1XNTA 3TNPB 4D69A 5LW9A 1YRZA 2YPJA 1ODNA 1UYPA 2ATFA 2YFUA 2VECA 3W58A 4FPJA 2VC9A 4HKWA 4UFMA 1R081 3UGFA 3B02A 5F6KA 5TSWA 3POGA 4K3UA 1KFUL 1MR5A 1UW8A 2D3PA 1H2MA 1WCQA 4TSVA 5D1IA 4NRPA 3KQ4B 1HQNA 4IE5A 3T4VA 1GFF2 3HQRA 4A3XA 4B29A 3H8OA 1KDMA 1B09A 1H6XA 2HWD3 3RJRA 4AQ6A 5CFCA 2DDUA 4C1XA 2DCTA 5HV0A 5HCFA 3ZLIA 2WT1A 3J8F3 3WQBA 4C8DA 5JOWA 3OGRA 3C7EA 1VAKA 2Z5WA 1CGPA 5FXZA 5FK8A 4BQ2A 3HT2A 1OHFA 4LKFA 4CUAA 3T30A 4KG8A 3VHRA 2VCMA 1US2A 4YWAA 1A6CA 5IATA 2B42B 2FMYA 4AZZA 2V4AA 3MI8A 1YIFA 2MPFA 5KBFA 4ZS2A 2BRTA 4ES8A 1G7YA 2P3YA 4IESA 1GP4A 4MHRA 1VRH1 2GAUA 3KWVA 1ZZ6A 4NHXA 2E7TA 5FMOS 1NQDA 2AH2A 3RNSA 3HEIA 2B9VA 4FPFA 1X9TA 4AWDA 5AFBA 2HYKA 4KG0A 4Q4X3 1DGWA 3IMNA 1WGPA 2E9QA 3WOGA 3K46A 3RZGA 4FXKB 3H1YA 3B00A 4U2AA 4EQVA 4FPKA 2EIEA 4EROA 1WMXA 3S5QA 4CEWB 1HKDA 2XL9A 2FCTA 2DCZA 1QDCA 1RUG2 1V6MA 4DO0A 4UW3A 5F7UA 5H9QA 2QQUA 1ENQA 2Q8OA 5FZ4A 1C1LA 3K3OA 2O1QA 3OD4A 4JRLA 1OD3A 2JG8A 1A78A 2QVSB 2XJPA 2BYVE 4UFIA 4YGBA 4KGQA 4BLIA 4W6YA 1DYKA 2OXBA 2PN5A 2XDVA 3NNLA 4XQDA 5GZDA 4ZXEA 5F2SA 5IT6A 2E7QA 3OYWB 1MEC2 4HSJA 2AACA 1ZZCA 2DVAA 4R9CA 1GANA 1FYUA 4Y24A 2ZGMA 3KVAA 5FY5A 3NVCA 1FPN3 2VQTA 3E6DA 5FYUA 4D3WA 1MS5A 4QKBA 1F35A 2HWC2 3PUAA 4D6SA 4P9LA 4Q4W3 1RITA 1FI2A 2UY9A 1J59A 5KC6A 1AHSA 3ZIXA 4P14A 1NKGA 3G6JB 1CAUA 4L97A 3MIDA 4C1WA 1CPNA 2RMU1 1VPHA 1T6BX 2CV6A 4OCTA 3WCSA 2XQRA 1DGLA 1QOOA 3THDA 2YFZA 1SQ4A 4LKSA 3FUQA 1O3SA 4NAMA 2VZQA 5DAPA 1IG3A 3WF0A 2JIJA 4CDXB 3ABZA 2ZMNA 4OZXA 2PLV3 4XXAA 2Y64A 1HXS3 2ZXQA 4QHZA 4MXWB 4V2WA 5BNNC 3S30A 1PGSA 1XJAA 2I2SA 4TN7A 3TN91 3VBOA 1ACCA 2P34A 4ZU5A 1QJX2 1IS5A 2VOVA 4ASMB 4BMBA 1F31A 1DIWA 3AZYA 3LIGA 2F17A 4UF0B 1I5PA 2WC2A 4ISRA 1CIWA 2WS92 5DUWA 4BU2A 4ISQA 5AC91 4PLOA 1MVEA 1K3IA 2Q8CA 4JTOA 3MLLA 5HPOA 5FZ3A 2WJSA 1REDA 5I0DA 1HRV3 2QFEA 5JSRA 2LTNA 2B7YA 4Z2AA 1W03A 2BZDA 1HIXA 4CYDA 5FY9A 1U12A 3OBAA 4YGEA 3O0VA 3FBMA 4NIAA 1MQTA 4LA2A 4NUBA 4Y5SA 1X50A 2VZVA 1EAH2 4N43C 5FMDA 2VO5A 2AYHA 4NR1A 5H9SA 4A42A 1XU1A 1NLQA 2Y6FA 3FC0A 4GWIA 3IDCB 3WY6A 2BWAA 2AREA 1NCQA 1QH6A 3ZFEA 4FXGB 5CFDA 4URAA 1W6NA 1ZBA2 4AVBA 2EF6A 5EP9A 1KD7A 2P2KA 1K5MA 5HCHA 2KD7A 5CEHA 1B35B 2FDHA 3BGAA 4Y22A 4WVMB 2BERA 1PVC1 4RGKA 3VDDA 2PQQA 1AJOA 3WVJA 1RUI3 2A6VA 1JYVA 3ZSMA 1Y3TA 2WZR1 2ZGRA 1AYM2 3LSEA 3ACIA 5FPZA 2RR13 1XNCA 5I0SA 5J98B 5FO8B 3KCXA 2D5HA 4GB32 3FHAA 4FT8A 2C6SA 4XXPA 5AVAA 2PHLA 4DXZA 4ASKA 1SBFA 3EB7A 3O1TA 3WF4A 2JEMA 4GH4B 4MGKE 1J3QA 1TMF1 4JDOA 4CEWC 2W1QA 4EN0A 1S0IA 5D8AA 2UWAA 4UT5A 2Y60A 1OPOA 2QZ3A 1EV12 2W52A 2ZX0A 4KWUA 3C2UA 5CFCB 2X5IB 1AR63 4LE4A 3N9QA 1RGSA 5FLHA 4AEJA 3LPGA 2A71A 2HWE3 3NV2A 3D8CA 1PO13 1JOBA 1KRIA 3N9NA 2JICA 3FLTA 5GLZA 5I0TA 4AGGA 1V6NA 4QD2A 1UIJA 2MHFA 1IOAA 2VU9A 2YXSA 3AP4A 5ACA2 2HWB3 3ILRA 3P3NA 1REEA 4IXLA 4XQ4A 2QQLA 2DV9A 1K45A 1RUD1 2YPDA 3OEBA 2VOKA 2W87A 3UKNA 1H8VA 4XOGA 3OBTA 1UOFA 4QXBA 1RVF2 4X6QB 5L9BA 3CLPA 4N7IA 2Q0AA 4P9IA 2A5ZA 2ZGLA 5EQUA 4K1ZA 1PIV1 2YBKA 4QDSA 1Q43A 1ASJ1 1ZRIA 1H8TA 1OLRA 3FLRA 1RUF1 1JYTA 1X82A 2R042 4G3YC 3BU7A 5L36A 1MS0A 1NE4A 4FP2A 2HWF1 1YNAA 2RS51 1EYBA 2ZJCA 3MW4A 5CKMA 2D6NA 2HJIA 3U4SA 1TZOA 3SH5A 1Q3EA 4Z92B 1GNHA 1RUJ3 2IFWA 3VKLA 1CVNA 3PUIA 1M06G 4XZUG 4CU7A 2NP0A 2IXLA 1QJY1 3ZYIB 5C9AC 2ZX3A 1GZCA 1GYKA 3U1XA 1N1VA 2HH9A 1JHNA 4H2AA 3NJXA 1JW6A 2R0FA 1QOSA 2ZEWA 4XUNA 5EJ3A 2W95A 3D0SA 5FYYA 4OI4A 3TWIA 2D6OX 3GJBA 1CWPA 3IIIA 1RUC3 3KGZA 3AB0A 2RS32 3GCXA 1ULCA 1PO22 1D2QA 3MPBA 3DN7A 1C1FA 1X7NA 3I3EA 4CDWA 4QQHA 2WWSA 1AR81 3K4ZA 4PLNA 3C3VA 2JE8A 1B35C 5T55A 2BNMA 4FOYA 3C7OA 3UYJA 4COUA 3GF6A 4ORFA 3WW1A 5J48A 2WSUA 3VBOB 3UK9A 3N7LA 4QGLA 2K2SA 3LIHA 1IZ3A 2YDEA 5GLWA 4WV8A 4L11A 2Y8KA 3PUHA 1V9U1 3PUSA 5CVRA 3USSA 4UAPA 5FLIA 3MW3A 4BK4A 3VD4A 1H0BA 4GH4C 1UPSA 3C8XA 5E88A 1POV1 4XURA 2VUCA 4D8MA 1LULA 4L8QA 4JZRA 2OKXA 1QQP2 3VV1A 4HMZA 3F95A 3BOWA 1DZRA 3DECA 3OBRA 1MQTB 4V2VA 4Q4V1 2ZKNA 3D4KA 3NL1A 2XMLA 2WQZC 4CP9A 4OYUA 5CFCC 3MIFA 1W6MA 2X5IC 5T54A 4LORA 4UWDA 4JKLA 4NROA 1HN1A 1SACA 5GLUA 3N7KA 2VQUA 5EWSA 1NCQB 1QXPA 2JXAA 4FPCA 4MVTA 3MLJA 1W6NB 4QPIB 1COV1 3NKTA 4JHZA 1PZ7A 1K5MB 2IXKA 3AJYA 4OHVA 4R52A 2R16A 2VNGA 4CUGA 2VMCA 1XNAA 1S0BA 1GZWB 2Q1FA 4FQZA 1ULDA 1BMV2 4BOWA 2WBKA 4NHYA 1CJDA 3VBHA 1BK1A 5GLTA 1RUG3 5FZAA 1WLTA 2RVAA 3H3LA 5IHRA 3BPZA 4Y1YA 4CU6A 1YXWA 4CU9A 4D6RA 5LY1A 4N53A 2XJTA 5DG2A 3WG2A 1JYNA 4MGQA 5C4WA 1NQJA 1DZQA 3HMYA 4RL7A 5JAXA 1JZ4A 5C3SA 2YC4A 4FTSA 4YVSB 2FHRA 5FMCA 4WM7B 1MEC3 4NIIA 3ZPYA 1ZZ9A 2J1RA 5L73A 1LHWA 2CSGA 1BJQA 3J7NA 4MGSA 2YV8A 2JG8C 5HCAA 2PHDA 2VVEA 1PGW2 1Z78A 3T2TA 1E5SA 2BVVA 2OQ6A 4R9AA 1DGWX 5F5IA 2ZX1A 1CQ9A 5FP9A 3R4DB 3H8XA 1FNZA 1UY1A 1E57A 2D43A 2IZWA 2YZ4A 3KV6A 1G9FA 3NNJA 1U5ZA 4PHZA 2NLRA 3MO4A 5J37A 1OUSA 2W08A 2G9GA 1LOAA 2BQPA 3MV01 1R1A1 4L92A 3WT3A 4AGVA 2ZGQA 2AZ5A 3KHCA 3SCHA 4M3CB 1VBE1 2VQAA 3HNYM 5FRAA 2EICA 3O12A 4Q26A 2YG0A 1SCRA 2J1TA 4BB3A 3PIGA 1YQ5A 2UWBA 3U07A 1U0AA 1QJX3 3FX3A 4YFZA 5LRRA 4EZHA 3A7QA 4JV4A 1XNDA 4Z1VA 2WS93 4QX3A 4B8EA 4XUOA 1UYZA 1KITA 1H8TB 5T5PA 2D97A 1BXHA 1HRI1 4O9EA 2PQSA 1F4HA 2VCBA 3I2IA 5FP8A 3RYRA 3WDTA 4Q4W1 4ASLA 2BDRA 5A32A 5JI7A 3EJKA 4DY5A 4P5HA 3INAA 4D7TA 3ZX7A 4A7ZA 2HEVF 1NA1B 4NHLA 2ZEZA 3WDWA 1WCKA 4M3CE 1EAH3 4P9WA 1D4M1 1CAWB 2FDFA 2D3RA 3LOBA 2J1SA 5DABA 3P6BA 1XYOA 1CN1A 1CAXA 1GQHA 2VMGA 1ZX5A 4C0HA 5FOJB 1MQTC 1ODMA 2PLV1 1TG7A 2Y0OA 1ZBA3 4YVWB 3MEPA 3I2DA 3D0JA 4AI8A 3DKWA 2VNOA 2ORXA 3ON7A 4YG0A 5KWRA 1OA4A 5LRSA 4LBQD 4J1WA 4QX7A 3VGIA 3J26N 3TBDA 1GP5A 5FPUA 3ZFEC 1NCQC 3H8RA 3RG0A 5C3OA 5CFDC 4JGYA 5C70A 3AZWA 4LO8A 5C33A 3HAGA 3FHQA 4FPEA 1K5MC 3AKRA 5F9TA 3GALA 1AL21 2XXZA 4IEPA 1AYM3 2A6ZA 2G4IA 3KD4A 4YW1A 1FV2A 3RYPA 4DEQA 1FOD1 3RFRA 3VDDC 3KM5A 2OYZA 5KHHA 4YZ3A 2Z79A 2ZTNA 4QQLA 3E6BA 1IKQA 2CWMA 2FZ2A 1PM7A 4FPYA 2BFUL 3FJSA 3I59A 2R6QA 2W91A 1ENSA 1JZ3A 2UY8A 5IK7A 5FYVA 4MG2A 4LOSA 1J3RA 1S2BA 2P3JA 3VBFA 4CE8A 2RJ2A 3ZXKA 3MF9A 1EV13 3PVBB 4K9SA 4AEDA 1ND3A 3Q8FA 4MHUA 5DUXA 3M3OA 3OF1A 1LEMA 4P9GA 5D8AC 4FFGA 1PM4A 2RDQA 4IUGA 4Y5Z0 4AI9A 4YVSC 3U78A 4CCLA 3S7IA 1W8FA 1DYOA 1MS4A 1YQ8A 1Q8OA 1Y9QA 2WO2A 4MUVA 1Q5OA 5FZ8A 1RUI1 3ZMOA 1FMD1 3KCYA 2VZSA 4ZHNA 2K9ZA 4AYUA 1JZ8A 2RR11 3N7MA 4G4FA 1OLMA 2XHNA 5ACA3 1WCDJ 2J1EA 2WO1A 1AX0A 3SMHA 4XFAA 5K9YA 2W1UA 3KV5A 2J7MA 4HFSA 1V6JA 4Q4Y2 4C90A 3CJIB 1OH3A 4FQ4A 4E4SA 3DUIA 2XKPA 4QM9A 1N3PA 1RVF3 2VG9A 1UMZA 5H9RA 3ZSLA 4WVZA 1UL9A 3MIHA 1J1TA 3CBNA 2OUJA 5KR7A 1XRUA 4LBLA 2WAAA 4OUEA 4K21A 1BBT1 3MUY1 3AP6A 3W9AA 4DRRA 1XYNA 3RI9A 4NJ4A 5A3MA 1Q56A 2R043 4N53B 4EJRA 1O3TA 1SLLA 2AEZA 4K20A 4XDQA 4META 3DCQA 3T1MA 4ZS3A 5FYBA 2QDNA 3P1IA 1LTEA 5FPVA 1H8TC 1JXNA 4KU7A 3PU8A 3PNAA 1ENXA 2PHWA 3WP4A 4AQ2A 2IVIB 1DP0A 2B9UA 2C4XA 2HWB1 2LRPA 4NN0A 3WZ1A 3BU0A 2RE9A 4TZDA 2JENA 1UD1A 1NA1C 1U5XA 1MACA 3WNKA 5FUIA 1ALYA 4ZKTB 4XACA 1R092 3ME2A 1UNBA 3MV11 4YNIA 4BLJA 1TME1 3GGLA 1LOFC 1VBC1 2QQJA 3OEAA 4CSWA 2XJQA 3ASIA 4R9BA 4AHZA 2CNAA 4BIOA 3ZR5A 5DMYA 3I2FA 5ABJB 1ZBE2 2RS33 4KQ7A 1PO23 4NIGA 4KL1A 1LHUA 3JD72 4LXLA 4NOTA 4HKLA 4KWKA 5LBBA 5I93A 1WLDA 4AG4A 5ISLA 1PGL1 1JU4A 2OPKA 4E4DX 2A1XA 3MPPG 1S2KA 4CEWA 1ZREA 3WXPA 5LA1A 2F4PA 3OB8A 3QCWA 4ES9A 3AZXA 4CDWC 4A2UA 1YQ2A 1QNWA 2XJRA 3A22A 3RVHA 2FDIA 4B1LA 3O1MA 5FPBA 1ND2A 3PIJA 1UXXX 2MEV1 5FYCA 1W90A 2A7AA 1LR5A 1RUJ1 5GLVA 2UWCA 1XSRA 2GC1A 1BVP1 2W1WA 5FYTA 2VMFA 3J7MA 5A32B 4F3JA 5BV6A 1EPZA 2YGLA 1QQP3 2VUJA 3VHOA 2XWBB 4P5YA 4ARYA 3V0BA 1X36A 1S0FA 4AVSA 4KI5M 3VBUB 2PHUA 2NPIA 4DPNA 1HQLA 2VY0A 5FZMA 5FYIA 1W9TA 3I97A 5FP4A 2EAAA 3OBZA 3SNMA 2OVUA 5IK8A 2CTVA 2DFBA 3TEYA 1YFYA 4B3NA 4L99A 1RXGA 4P9XA 2WO3A 3NV3A 5JZGB 5FKBA 2B5HA 3ALQA 4CDXA 2VM9A 2YC0A 5C3PA 1ZRFA 1YIPA 2LM3A 3LPFA 2D7FA 4TWTA 2Q8DA 3B94A 2JKXA 2XWJB 3S7EA 3VD9A 4QMAA 4XFBA 3IDBB 4JGYB 1DQ5A 2OQ7A 3BTAA 4PLMA 5A7QA 2VPVA 2QQKA 2GDFA 4B4RA 1GZTA 1OOPB 1W6PA 3A21A 2QQIA 1JU3A 2XR4A 3BALA 5GZFA 1X8EA 5IVCA 3KQRA 5D21A 2O0OA 5FZ0A 4LLFA 5FZOA 1HV0A 3QH6A 4XAEA 4HANA 1E5RA 2LW8A 3I59B 3M3EA 1DHKB 2C9KA 2GALA 3PVOA 5DZEA 5A7WB 1GOGA 2PTMA 3E5XA 3H7JA 4FPLA 4LHSA 3VBHC 4CP1A 1JUHA 2XLFA 5FYMA 1RB8G 1SDDB 4N53C 1VBA1 4AEDB 1ND3B 4LOTA 3DPRA 3O7OA 4UFLA 3WG4A 1VMFA 3MFAA 5A33B 1XNKA 5DDJ2 5FLJA 5C4WC 4J6GA 3W5MA 5FZLA 3W21A 4ZU7A 1X33A 2A3YA 4BM8A 5FY4A 1LECA 5LZ6A 3NO8A 1S55A 2RS12 3NRUA 1Y43B 4AW7A 3NKGA 1CX1A 1B35A 2GP5A 1QKQA 3AZZA 3PU3A 4IEUA 2X05A 1A3KA 1SG3A 4X8NA 2YBSA 1RHI1 3I3QA 2FDKA 4PDWA 2JG9B 1RUE1 1GLHA 2DVDA 1HLCA 1ZM1A 2DCYA 4FPGA 5KC5A 2H0BA 3N4MA 2CU5A 3IZOA 2XLGA 3JU9A 4RGAA 2ENRA 1L3JA 4LULA 4W50A 4W6XA 3M70A 4XILA 5ABJC 5I8YA 4P9JA 1XSQA 2C0ZA 2WFF2 5LATA 1X8MA 1KQRA 1UY4A 3KHBA 2ZKLA 4XF1A 4GH4A 1NY71 3WQ7A 1MEC1 1O5LA 4HSLA 3LE0A 3UKTA 4QDRA 3KVBA 3JCIA 4XHBA 4XPVA 5A6QA 4LBJA 5C8WA 1RMU1 1KFXL 1UO9A 5F32A 2D6MA 4XTMA 4UXAA 3JBG2 1RINA 2WAOA 2WLPA 2X5IA 3ZSJA 5FCCA 4BIFA 5HXMA 4CA9A 1H2KA 5B2GB 5BNPB 5EIYB 1EP0A 2D3SA 2DCKA 1OLME 4RGGA 4A45A 4FPHA 4QU1A 1PZ8A 5LB6A 4IV3A 1VBB2 4OMCA 4AI0A 5JIUA 4PI2A 4XFIA 2XBO2 4AL9A 4CRQA 2JDKA 1UYYA 1JYCA 4AVTA 2WNUB 3N9OA 2EIGA 5KHGA 1O91A 5I8SA 1LJ7A 1YEWA 2XB6C 3AP5A 3BIWE 1XB9A 1TEIA 3PJYA 5F5QA 4MLOA 4D7SA 3IIAA 3S0MA 3WEZA 1CIYA 3LSDA 3VBUC 4BCUA 1LOCA 2C5DA 2ARXA 2Y6JA 1L7LA 1W6OA 2ZEXA 3MHZA 2GMMA 3OPZA 4AHYA 4DXTA 4F83A 5DQ0A 1FT9A 3ZSKA 4URTA 2JE9A 4BQ1A 4AXOA 4JRAA 1WD3A 4YGCA 1VJ2A 3L9JT 3MW2A 1DQ6A 2WDBA 3ZO0B 4NWVA 5FREA 4COZA 1XE8A 1XC6A 3ZVXA 3KGLA 2G19A 1PMHX 5C8CB 1BEV2 1N47A 1YO8A 5KXCA 1DF0A 3T09A 1QHDA 4JGYC 1QJZA 1IGOA 1W9SA 2R072 4A3ZA 5F8PA 4R9DA 4NHKA 4YM1A 3ZDSA 2ZHLA 2ZGOA 2A6YA 1UU4A 1VAMA 4CCJA 4CVUA 4M0NA 2QE3A 2Q8EA 1ND2B 3RPQA 4IEOA 1QH7A 5C71A 4K8RB 4AAPA 5FZ7A 3W5NA 1RUH1 3I4IA 5FXVA 4YZ5A 3H50A 1QNYA 3J7HA 2XL7A 5FUPA 2A3WA 2ILMA 2BNOA 5CIRA 3ZYGA 1O59A 1W2TA 2ADEA 4LBQB 3W59A 4NAOA 4I02A 3E6CC 4R4ZA 3T08A 3VBFC 2ZX4A 4BE3A 3V0BB 3N9MA 1JH5A 4IGQA 3WCRA 3SITA 3JB8A 1ND3C 4AEDC 3VKNA 5L7OA 2CYFA 5A1AA 4LA3A 5JSOA 3WQ0A 2QTWB 5BUVA 1XU2A 1N1SA 1L7RA 4K7JA 3N36A 5DZFA 5A7OA 3SEEA 4PJYA 3TAYA 1F9KA 5CKQA 5BY5A 1S0GA 4P02B 4BA6A 1R082 5FZEA 1ULEA 4H14A 3NAPA 4IQPA 3FFZA 3WW2A 2LS6A 3UT0A 4RA0A 1Q8QA 4Q4Y3 1H4HA 1LODA 3IM0A 2VH9A 4XJZA 5J1XA 4Q8LA 1LOEA 4HZFA 3V56A 1PHMA 5L19A 2Y0IA 1GMMA 5FP3A 3ZYPA 2Q1MA 5F37A 4JX0A 4YFWA 3JQXA 4QPWA 2W1SA 1W6PB 3NMBA 2ZGNA 4LMFA 4TTGA 4XUTA 4D0QA 1P8JA 1HB2A 4MX3A 3ILNA 3ZSEA 3BTYA 1D0HA 4LHNA 3O1VA 1PNGA 5FAXA 2JDNA 5FZOB 5DUUA 2C24A 3POSA 2GN3A 1ZRDA 2PHXA 4UI9L 5C5UA 3HT1A 4CCKA 4M00A 2YROA 2FBEA 1YHFA 1VRH2 5F5AA 5FWJA 5ACA1 3DPRB 3RWNA 4OI0A 3OGVA 4DNYA 1UYXA 1YQCA 3SC7X 4BQ3A 1AYN1 1LEDA 1R093 3HVDA 5BXXA 4QPIA 5DAXA 3H0OA 5F5CA 4BQYA 4LBNA 3NJVA 1AF9A 4QGMA 5DXDA 3WNXA 5LWBA 1DDLA 2WNUC 4J25A 1W0OA 3VD7A 5BYNA 1RIRA 3ZN5A 3FMGA 4HETA 3ZXAC 1ZBE3 4DMIA 1GZWA 2YYOA 1R64A 4Y4YA 5LK5A 5FDBA 1S0EA 3SKJE 2GU9A 2ARCA 3JD73 4PDWB 5GZEA 5SV5A 5KXEA 1S0DA 1UU6A 2PA7A 4H3WA 2WN3A 4ATEA 1ZRCA 3WD5A 4Q0QA 4XJWA 1IPKA 4SLIA 5JOYA 1DGRN 4HN0A 3DGTA 4YRDA 3AMMA 3AMNA 1ZZBA 1C8M2 5APAA 4OUMA 1AXKA 4CCMA 4Q8KA 5CKNA 4CXXA 3RZJA 2E7AA 1W2AX 4ZZ8A 1I6XA 4QX8A 1UY3A 2E33A 1GNYA 2ZGPA 1NOVA 1SFYA 2A73B 4HPKA 4WM7A 1UY0A 4YVSA 5EHDA 3H8UA 3IWZA 4YG3A 4L9BA 4LIUA 1XE0A 2QQOA 2PYTA 3WLUA 1ND2C 5DAVA 3SXWA 1LHVA 3SLIA 1C3HA 2R7EB 1WCUA 1OT5A 4MOAA 2PAKA 1UMIA 4HXCA 1DBNA 3D5OA 4IV3B 3ORJA 1NUKA 5K4LA 2B45X 5E89A 2ZZQA 4YW3A 4RHV1 3FZ3A 2HYXA 4UBGA 4XCBA 2BBVA 5IAXA 3TN92 1C4RA 2WLQA 3HBZA 3WP5A 4EN9B 5A1FA 5FP7A 2R062 2NMNA 4NMIA 4M3CA 1W6OB 2I74A 4CDUA 1A8MA 2XJVA 2XUMA 5H9PA 5AC92 3V0AB 2CHHA 2YU1A 3QH7A 5G05L 4B4QA 4CP2A 5FMBA 2AC1A 2ZHKA 1SEFA 5C6CA 5FPAA 2CAVA 4C0BA 1AZDA 1LB2A 4XF0A 2HEYF 5IJRA 1NZIA 3M8LA 4BDVB 3DV8A 4CDXC 3C7HA 3ZFGB 4I2OA 1Z7S1 5DUVA 4UW5A 1QJFA 2JDMA 2P5BA 1GSLA 5FXXA 5JOXA 4CXYA 5A3OA 4O61A 3ZXLA 5FY8A 5ERLA 3CMGA 2VZRA 1WD4A 4CZSA 1SCSA 4S2GA 4XC9A 4YYOA 5JWPA 1PNFA 1SPPB 4IL7A 1NA1A 4GWNA 4GMP0 4UFKA 4QKFA 1V6OA 5F39A 4LHKA 2J42A 4CUBA 1LOFA 1CAWA 3GJAA 4BQ5A 3KF5A 2CY6A 4L2NA 5GJ6A 5DDJ3 1N1TA 1OUXA 1PVC2 1VAVA 2XJSA 3P3PA 3HBKA 1OFNA 2BV4A 3IN9A 3WNLA 4YVWA 5I0UA 1J84A 2WZR2 2RS13 3DPRC 3GYDA 1T2XA 1BMV1 5L7OB 3VZJA 3T4HB 3HPNA 2WNOA 3H1WA 3HQUA 4LK7A 3RMXA 5CG8A 4ZU4A 3ZMNA 4PQQA 1QDOA 2D6LX 2G9ZA 3FUOA 1JYXA 4YZ4A 4K1YA 3VZLA 3WNMA 5K8SA 3SEPA 1TMF2 4DRVA 4AFBA 5B4NA 3NAPB 3ZXJA 4BISA 1UXZA 3LA3A 1LGCA 3M3IA 1GKBA 3RZZA 3ZN4A 1VRBA 2WFF3 4PDWC 4Y5TA 3HR9A 2YU2A 1XYPA 3NSTA 4RFRB 3ZDVA 4O9GA 1HN0A 5EJZB 2ZAHA 4IEZA 1PX3A 2HKXA 3AXEA 3B01A 3AXDA 5FMOL 4DZGA 2VZUA 3G7DA 3PTYA 4MZUA 4RQPA 3BI3A 1OQDA 3HIFA 1PGW1 4Q0UA 3BKZA 4JAAA 4GKXA 4GZ9A 5JCTA 2P1BA 3T0AA 3JBG3 4WZFA 1FXZA 1DU3D 2RJKA 4XJAA 1GWKA 2VUDA 4QX2A 3AYCA 3VN4A 4IDZA 3PLQA 2IUWA 2J1VA 4QU2A 1VP6A 2PHTA 1VBB3 3EBRA 3DYMA 2XBO3 1HJFA 5LEJA 2EXJA 4QM8A 4YW5A 4XFGA 4DFSA 3MIBA 5K7PA 1YFWA 1JI6A 3CEWA 1H9PA 4JQTA 2RG4A 3CJXA 3I2GA 3POEA 1TNRA 2YHJA 4LK6A 1OA2A 1SLBA 4IV3C 4AEMA 4D7YA 4XF3A 2Z69A 2JB4A 3M1HA 4J1XA 2QQNA 3WV6A 2JJ6A 1PIV2 1I9RA 1WMEA 2DF7A 4EWEA 1OXCA 3CJIA 3AP9A 1ASJ2 4M0HA 1RUF2 1LESA 1QOTA 1UZ0A 1WW5A 3JB4C 1CESA 5FZKA 5IVJA 3RZMA 4OQ9A 4OI1A 3BODA 4BYYA 2HWF2 1BEV3 2HWD1 2ZAAA 2RS52 2VBBA 2WKKA 5T52A 4LPLA 1UY2A 1AR72 2GC3A 4IV1B 3J8F1 4KH9A 5FPLA 1I1EA 2R073 4AGRA 2UU8A 2P3KA 3KT1A 4XMAA 3ZFGC 3WINE 5FPXA 2F6BA 5C3QA 5FZ6A 2EXHA 1G9AA 4LBMA 4XIKA 1D0GA 4OHWA 3R6SA 5A70A 4HPKB 3ZYRA 3M4FA 2C26A 4NVPA 4GIQA 1LOGA 4XF4A 4O7XA 4HVOA 4P9YA 4LIVA 3OUHA 5I0RA 4KGGA 3PTRB 4NE9A 3H9AA 1SLIA 2CL2A 2XPJA 2HWC3 4QB6A 4YW4A 2R49A 4QXHA 1AR82 4Q4X1 2OIIA 2RM22 4QT6A 3I2HA 3D82A 1C8NA 3AYEA 3R4SA 4RD7A 3ROUA 5ABJA 4DQAA 2PHFA 4EYUA 1O8PA 5JOZA 3IDAA 1RL3A 1RJ7A 1R083 3LZZA 2Y38A 1MZ5A 3DEMA 4KBBA 3Q9OA 4Y1ZA 5L7OC 4BQ4A 1XBFA 2FQPA 2WA3A 4WVWA 4BMEA 3BIEA 4CDUB 3RSJA 1V9U2 2ZX2A 4AQSA 1C28A 3E1F1 4XMIA 2DBIA 4GD4A 4HL0A 4M3CF 3OCPA 2JDZA 2ZOEB 4LHLA 5T5OA 4H55A 3NAPC 3ECQA 4PI0A 1IS3A 2P17A 2VAUA 4XAAA 4Y20B 2OT7A 5FZHA 5T50A 3R4UA 1FPN1 1W04A 3VLBB 2GZWA 3H1MA 2BU9A 1MS3A 4Z8BA 2IXIA 2TBVA 3EXUA 3OD0A 4RR3B 3E97A 3LA2A 3T2QA 2DVFA 1RUNA 2DTWA 4N90A 2JKBA 2VUAA 1UZVA 3T2OA 3WF1A 3OGJA 2VVFA 4WM8B 3RGBA 3VBUA 1COV2 1ONAA 3OTFA 5FY1A 1VRH3 1YYNA 2VCAA 3U4XA 1BZWA 2VTXJ 4S2HA 1UCXA 2J1AA 4QAWA 5DZGA 5EXOA 2W2IA 1SLTA 3Q8BA 1UOGA 5JZGA 1OQ1A 1HXS1 2VZ3A 3ZXGA 3LA7A 4I3PA 1G8WA 4XIOA 5D2AA 3V65A 3WG3A 3WP6A 4A7YA 4EN6B 4QKDA 1BVVA 1IPSA 1JN2P 5BPXA 2H6BA 3VZOA 3K4DA 2WINB 3M7AA 4IEWA 5F3CA 1F5JA 1H4GA 2BJSA 2R1DA 5FO9B 5KHKA 5A3TA 3I3MA 3T3YA 4QPIC 4PF1A 3TB0A 4NPLA 5JXIA 3CO2A 3ZN6A 1IS4A 1WUVA 2WYSA 4DINB 1OOPA 1HRV1 1UZWA 2VZOA 3K4AA 2ZHNA 5LK7B 1JYWA 1Q8SA 2RDSA 2RDRA 4UW6A 1APNA 4GB33 4ZONA 4IE0A 1C8M3 2JDPA 4RYDA 2ZHMA 2RJLA 3OG2A 2QQVA 3GM8A 3OPWA 2KXLA 5EJ1B 5F2WA 5A7WA 2W0XA 4FAGA 3ACGA 3AP7A 3O5SA 4RQPB 4NIDA 1GUIA 4M4RA 1K42A 1FAYA 3R0RA 1AUYA 1YLLA 3AJZA 1XPWA 1KEXA 5A33A 3WHTA 1R091 3POFA 1AJKA 5CBLA 4ZZ5A 3BVCA 2JDYA 4LLOA 3T1LA 2IXJA 1QMJA 2NZ9A 1NCRB 2DWRA 4WM7C 2D6KA 1R1A2 5FIXA 4LITA 1O3QA 2WNVA 5FZGA 3N7JA 3S5AA 3FBYA 1T6GC 1VBE2 1WCSA 3BPSA 1OQEA 1PVXA 4FCAA 4YW7A 1W0NA 3WDUA 3TN93
chains in the Genus database with same CATH topology
4OHYA 3VBSA 1PZ9A 2JG9A 5F1RA 2R063 4EWAA 3GHMA 1LRHA 2XGXA 3RMYA 3WDYA 3D6EA 4XFHA 1YWKA 4PBPA 2N7GA 5AC93 1W0PA 5GZGA 2ARBA 4YARA 4WZCA 1J58A 1HRI2 3J9SA 2GN7A 5HBAA 2B39A 4E27A 4CDUC 3JZVA 1XNBA 5FQ0A 1AR61 1REFA 4JC1A 5KXDA 1D4M2 4YM0A 5A3LA 1DQ2A 3L2HA 4N7UA 4Q1RA 2OA2A 2HWE1 3MGUA 3GBWA 2ZA9A 1PO11 5BNPA 2FMDA 1RJ8A 4IERA 4EV0A 5SV8A 5IK5A 3CNAA 4BWOA 2LALA 4JDNA 2WNUA 4Z82A 2VGDA 1PVC3 1Q8PA 4XETA 3CF6E 5HI0A 1DGRA 1VBD2 1AL22 2BVBA 2WZR3 3AYAA 4NWWA 1FOD2 3E5UA 2SBAA 1MZ6A 1WW6A 5BNOB 2OW4A 4YVWC 2WFPA 1LU2A 5JSPA 1CONA 4CEYB 1C57A 3AKPA 5C8CA 4TYSA 5GM0A 1GQGA 1I3HA 1OSGA 2A3XA 2WNEA 2VW2A 4HK8A 2AUYA 4OFGA 4NHMA 4Z2WA 4G9SB 4XF9A 2QUOA 3M2MA 3AMPA 3A4UA 4IEVA 2BTVC 4AHXA 3VKMA 4FBFA 1F2NA 4V1PA 1RUI2 1FMD2 4YM3A 3WW3A 3QACA 4OLLA 4LBQA 2DVBA 3SHRA 4RQPC 1WLWA 4CP0A 1CR7A 1LOBA 3GZTB 1RUC1 2ZACA 4U36A 4Y26A 4ITCA 4AE2A 2DCJA 1J1LA 3AMQA 4W6WA 5CA6A 1HDKA 2VW1A 3N3HA 5JDBA 4MGYE 1DZTA 4BHPA 1FATA 1PIV3 4GALA 5AVPA 5J36A 4I30A 1ASJ3 3USUA 1BBT2 1RUF3 3AFKA 1YI9A 1S0JA 2NQYA 2QCSB 2OUHA 3J4UH 3WW4A 3ZN6B 3BOPA 1QXJA 2HWF3 4HBNA 3CJIC 4OVEA 3ZXDA 1O4ZA 3EHKA 3APBA 1QJU2 1AR73 4LT5A 2HWB2 1VBB1 2W39A 4W65A 2ZMLA 3LKJA 1AR92 3ST7A 3N35A 2GSYA 1O7FA 1TME2 2XH6A 1VBC2 4LUKA 3LB9A 1LCLA 1R1ZA 1Q8VA 1TQ5A 1VB4A 4Y1VA 2IXHA 3MLKA 1PGL2 1AR83 1SFNA 2E53A 4AK3A 2RM23 2WNVB 4DB5A 1CPMA 1RC6A 4YZ2A 5AFEA 1URXA 2QZ2A 4QXKA 3NW4A 4K40A 4DY3A 5E8AA 3VBSB 4KU8A 1RUG1 3GBGA 4CDQA 1S0CA 4YG6A 2D6PA 2R071 2MEV2 2EAKA 2ZZJA 4K6BA 5BNOC 4FOWA 4Z07A 1G86A 5JIAA 4I09A 4I0WB 4KNCA 4B7KA 1POV3 4CEYC 3KSCA 3AZVA 3U0ZA 2WL1A 3B69A 1POV0 1YCIA 3KMHA 1UX6A 3H3ZA 5FQ0B 2DUQA 1HW5A 4F8AA 5BNNB 2HWC1 5JPNB 1UZYA 2EALA 4COYA 2GC0A 2R30A 1COV3 2A6WA 2JE7A 1GZ9A 4H7MA 3DL3A 1CAVB 1YI7A 5CU1A 4AVVA 3H7YA 4XZPA 3BB6A 3HQXA 4N43B 1I5ZA 3V0AA 1YFUA 1QJX1 1ULGA 4XE9A 3ES1A 5JZGC 4I0BA 3NV4A 4ONUA 1VR3A 2WS91 3ILFA 4MXVA 4Y1UA 1NZCA 2E63A 5FBZA 1KS4A 2ZGKA 3ZFGA 4OHXA 4Q27A 1HX6A 1WLCA 3AM2A 2A6XA 3IDEA 3MF6A 1AX1A 4R8HA 1VBA2 4FAHA 2E51A 1U5IA 3VZKA 1GR3A 1F8VA 1EAH1 1OOPC 1OKQA 4JGZA 4E4ZA 3VL9A 1VB2A 2ZGSA 2BPA2 2DUPA 1QGLA 1UF2C 1ZBA1 2VQ0A 3SH3A 4QQPA 4LBKA 4XW3A 3VBRB 4AQTA 4FSJA 1RHI2 4FP3A 1R1A3 1RUE2 1H2NA 5J96B 5JI9A 2IFRA 1MS1A 5FTTC 1VBE3 4I3GA 1XXNA 4PCRA 2VW0A 1AYM1 4C91A 4DS0A 4AVAA 1JUIA 2YUEA 3I7DA 2YGMA 3B9IA 1V6IA 3ELNA 3IPVB 4YZ1A 1NY72 2WNVC 1VALA 4GB31 4UBHA 4MV2A 3UV9A 2VMHA 1C8M1 4Y1XA 1RMU2 1V00A 3NV1A 3USUB 3VBSC 1SBDA 4FOVA 3TRSB 1HRI3 2JG9C 1PMIA 3V64A 1EV11 2B8MA 4JVAA 4ZXKA 3SCFA 3VHNA 3IT8A 2PAEA 4COWA 4JTNA 3A0NA 5J7MA 1ZVFA 4INDA 3X29B 1D4M3 4HLTA 1O3RA 3RDIA 4MGZE 5JR7B 1OI6A 3RI8A 4OHZA 5IUQA 3LOIA 1O5UA 2D44A 4SBVA 4S2DA 1OMIA 2ZPXA 1TE1B 3I8TA 5E1RA 4HVRA 3KS7A 1AL0G 2NM1A 2R061 3E5QA 3K51A 5JLVA 2GNBA 5BNPC 1BQPA 4COVA 3HD8B 3WQ1A 1VBD3 2D5FA 1AL23 1RVF1 2WQ4A 1JOJA 4FTEA 1FOD3 2XJUA 3I54A 3UL2A 4XBLA 2D40A 3NWKA 4B4PA 4Q0PA 5DG1A 3S6PA 5C9AB 3UJQA 4CDQB 2XVGA 5LEKA 3GNEA 3KLSA 2R041 3WP3A 5JMCA 5F6LB 2Q4SA 1RUH2 4PIZA 4IV1A 3WHUA 1IPJA 4Q29A 4E2QA 5C8CC 1QF3A 1HV1A 4X6RB 3MIGA 5FOBB 4XBNA 1GV9A 2Z42A 2Z2SB 5KHIA 4GXLA 2OZJA 4RS5A 1FMD3 1UKRA 1VLNA 2RMU2 4NO4A 1OFSA 2Y26A 3O0WA 2SLIA 1IQAA 1QWRA 1YJLA 4WBBA 3RJ2X 3QBQA 4MH0E 1H9WA 2RS31 3THPA 2BUKA 1PO21 3AYDA 3ACLA 2XHKA 4LR4A 3MDPA 3VBRC 1OA3A 2E6VA 2UYAA 3FWEA 3M3CA 3ATGA 4KWLA 1DQ1A 1MZFA 5CNAA 2Q1ZB 3AKTA 4Q0VA 2UYBA 1BBT3 4FOQA 2XLAA 2WA4A 3OGGA 4Y20A 2XG3A 3OJBA 4LBOA 1QQP1 1QJU3 1MS8A 3TNQA 4KWJA 4RR3A 5EV7A 1BYHA 1YJKA 2BFUS 4GMP3 4LNVA 1AR93 4JGZB 1AYN2 2KM2A 4WM8A 3VKFC 1G9CA 2QJVA 5GKAC 1TME3 2IC1A 1VBC3 1WA4A 2C9AA 2ET7A 4AEKA 1O4YA 1NLSA 4RFT0 5JPMB 4XJUA 4GKYA 2QDRA 5EZWA 4AFAA 5JVVA 4UW4A 1NXD1 2JG8B 4GQ7A 2DU0A 5GZCA 3ZXFA 4QX5A 5BNQA 1AR71 1ZYBA 3K48A 2HEWF 5FO7B 2VXRA 3JQWA 2MEV3 2EA7A 4E2GA 5T5LA 2O8OA 3AX4A 4CDQC 3AKSA 1DLLA 2IWGB 3UJOA 3TOJA 2Q5TA 2DFCA 1SLAA 4EWDA 1CAUB 4XJ8A 5EFUA 1C5IA 2PHRA 3S0MA 1EPWA 3TYJA 2V09A 4RHV2 1VIWB 2RM21 2D93A 2ZGTA 2EVXA 1NCRA 1N1YA 2CAUA 4EN7B 3VL8A 2B46X 4YW2A 1RUD2 4XYXA 4HKOA 1SDWA 2GH2A 4BH9A 5GALA 4LTAA 1N3OA 1PK6A 4PIXA 1OLQA 3IBMA 4N9HA 2BNNA 4QPGA 1OPMA 2PELA 2G9FA 1Z7S2 3M3QA 3MIEA 4LO5B 3AFGA 2VULA 3A0KA 3H3UA 5EYXA 1XE7A 2BGCA 3VUOA 1IKPA 1Z0HA 3O14A 4PBOA 2PAMA 4YSFA 3FFQA 2ETEA 3GZAA 4LO6B 1H1MA 1YUDA 2H6CA 3ZFEB 2P37A 3ENRA 1LHNA 1VBA3 5CFDB 4OUSA 5HCBA 1DQ0A 1QU0A 1ZZ7A 1H2LA 5CB7A 1G9DA 1BKZA 3B93A 1QJY2 1UAIA 5K0UA 3WDVA 2VVDA 2R1BA 4Y22B 4X8PA 3VDDB 2DURA 1V6KA 3LGRA 3MYXA 4RS5B 3U11A 4CTEA 4QPYA 4JGZC 2V73A 1F5FA 2EXIA 4GULA 1WBLA 1ZRRA 2K0GA 3WUCA 2XPJA 2RHPA 1RHI3 2IXCA 3ZFFA 3O0XA 3KB5A 1W2UA 3PVNA 3R05A 4A7KA 1RUE3 3WUDA 2WIIB 3PJQA 1ZNPA 1H1IA 2GH8A 5BNOA 5D8AB 3WR0A 4CEYA 1JBCA 2LUWA 3EQEA 1AXZA 3ETQA 1RMU3 3FE5A 2XKOA 3B3QE 1MS9A 4MSVA 4OULA 2X53S 4HN1A 3FLPA 2VNRA 3PVEA 1UIKA 1W39A 3WX5A 1CX4A 4AFMA 1M4WA 2MNGA 2R32A 4Q4V2 4QQ2A 2TNFA 1SLCA 3FHIB 2DTYA 1WBFA 1H30A 4LUMA 1MZEA 2ZBJA 1WW4A 2R0HA 3URFA 1AX2A 1NE6A 1DQ4A 2D98A 1NG0A 1S1AA 4IEXA 2H0VA 4XTPA 4Q4Y1 2Q30A 4K8FA 1JTZX 1CD3G 2O8QA 1LENA 2OZ6A 5I8TA 3AK0A 2HWD2 2EXKA 1JYIA 3QOPA 2CGOA 4AVCA 4XHXA 2ERFA 3J8F2 2QQPA 2V5YA 4Q0SA 4Q2FA 4QGNA 4BZ4A 3KT7A 3POYA 3CU7A 1V6LA 1O4TA 1RUH3 3POWA 4FO9A 3ZIWA 1LGBA 1W6QA 3MICA 3PMSA 2TEPA 4GWMA 5FFOC 3GHNA 2ZMKA 2CGNA 2GMEA 4IV1C 5I91A 1KS5A 4Q4X2 4IEYA 2CWSA 1IHMA 4CDWB 4Q1PA 1VBD1 2RMU3 3KZ4C 1KJLA 5CADA 3JUUA 3DF0A 3BCWA 1SMVA 3B9CA 1ZBE1 4RS5C 3JD71 1NYWA 2FZ1A 2P3IA 2QNKA 3IKWA 3SH4A 3MFCA 3OY8A 1ZA4A 4HT1T 1PK6B 3VZNA 4AI1A 4XBQA 4QPGB 2AR6A 1FX5A 3VZMA 1J3PA 1FPN2 4JCKA 4OI2A 4YGDA 4Q4W2 4S2FA 3WG1A 2I45A 3KCCA 4MGIE 2KA3A 1ENRA 1QXRA 1W6MB 4NPRA 4RSUA 3UKVA 1LKNA 1SBEA 1GBGA 2WT2A 1N3QA 2W68A 5BNNA 4YM2A 2JX9A 1GICA 2ZS6B 3LWCA 1BCXA 1XQNA 4E2SA 1WMDA 1KDKA 5K0UB 1AYN3 2GMPA 2PLV2 1HQWA 1NXMA 1HXS2 1DYPA 3ZYJB 4H7LA 4RR3C 3SCGA 2ZCWA 1YFXA 4LEJA 3VHPA 4AHWA 1CAVA 1U5YA 2X29A 2ES3A 4WM8C 3ZFFB 3AKQA 4FTBA 2JECA 3VBHB 4QHBA 4N43A 5J3UA 1HRV2 2TUNA 2A70A 2XVLA 1UKGA 5C4WB 3ES4A 4QQOA 3VKOA 5KHJA 2GNDA 1QJU1 2NYYA 3NJZA 1TMF3 4D94A 2GNTA 4PF5A 3CL1A 4XJ9A 4GMP1 2DUOA 1AR91 4AF9A 1ULFA 2C1FA 3AMHA 4AFCA 1D2SA 4XFCA 1AVBA 1D4VB 1H1AA 4XQWA 5CG9A 4HK9A 5IK4A 1G6NA 4FPOB 1GNZA 4AFDA 2YY1A 4B7EA 5DDJ1 4MYEA 4WVVA 1A8DA 4RHV3 3VBRA 2RS11 1QY4A 2AENA 2RR12 5J09A 1IS6A 1RUD3 3LCPA 4FVVA 1KJRA 2GNMA 1UN1A 3GZUC 3HWJA 4I01A 3QD6A 2ZABA 5T3NA 2ZGUA 1NCRC 4XFFA 1DG6A 3IPVA 3LAGA 3OYWA 2WFF1 2XVKA 3U10A 1RUOA 2PFWA 1Z7S3 3MZHA 4PIYA 1AR62 2VOWA 3ZXEA 3HN1A 1OD5A 3EO6A 1PK6C 5T5JA 2YMZA 4JDMA 2HWE2 3WDXA 5CAZA 5HXVA 1CJPA 2WSVA 4QPGC 1PO12 3JBG1 1EY2A 2JD4A 2RS53 4EN8B 1ZZ8A 2DU1A 2A75A 1CAXB 1KXGA 2BW8A 3RYKA 3RS6A 1W6QB 2VMIA 4ATFA 4IETA 2XBO1 4N9IA 3RRDA 1LGNA 1QJY3 1NLRA 4MXWA 1UU5A 4JQRA 1LHOA 3L2YA 2QKDA 2ET1A 1UPIA 3THTA 3B5LB 1TNFA 5K0UC 4XEZA 1FV3A 1C5HA 4BPZA 1WW7A 4DOUA 2NMOA 2WT0A 4LO7A 1RTVA 1Y7BA 1LU1A 4TLFA 1BEV1 3ZFFC 3GBFA 3OY8B 3QLQA 4LE3A 4GA9A 5C9AA 4R4XA 3VBFB 3KT4A 4LO4B 1MVQA 2BEOA 2BWCA 2GC2A 2WZPP 3PHMA 4AI3A 1V9U3 3B7MA 1RUJ2 1G9BA 1UZZA 4I0AA 3RQ0A 2NN8A 2VOXA 4IEQA 5KXBA 3SISA 1FNYA 2AGSA 2DYCA 4M01A 4F7ZA 5EYYA 3PMEA 5E16A 4WVMA 4AI2A 1RUC2 2DVGA 1WMFA 4YLZA 4Q4V3 2UURA 1V70A 2X8KA 1DFQA 4PQ9A 2CGPA 2I07B 1AXYA 4HVQA 3TNPB 4D69A 1YRZA 2YPJA 2ATFA 2VECA 3W58A 4FPJA 4HKWA 1R081 3B02A 5F6KA 5TSWA 4K3UA 1KFUL 1MR5A 1UW8A 2D3PA 1H2MA 4TSVA 5D1IA 1HQNA 1GFF2 4A3XA 4B29A 1KDMA 1B09A 2HWD3 3RJRA 4AQ6A 5CFCA 4C1XA 2DCTA 5HCFA 2WT1A 3J8F3 5JOWA 1VAKA 2Z5WA 1CGPA 3HT2A 1OHFA 4KG8A 3VHRA 1A6CA 2B42B 2FMYA 3MI8A 1YIFA 2MPFA 5KBFA 4ES8A 1G7YA 4IESA 1VRH1 2GAUA 1ZZ6A 2E7TA 5FMOS 1NQDA 2AH2A 3RNSA 4FPFA 4AWDA 5AFBA 2HYKA 4KG0A 4Q4X3 1DGWA 3IMNA 1WGPA 2E9QA 3WOGA 4FXKB 3H1YA 3B00A 4U2AA 4FPKA 4EROA 4CEWB 1HKDA 2XL9A 2DCZA 1QDCA 1RUG2 1V6MA 4UW3A 5H9QA 1ENQA 2Q8OA 1C1LA 2O1QA 3OD4A 4JRLA 2JG8A 1A78A 2QVSB 2XJPA 2BYVE 4YGBA 4KGQA 4BLIA 4W6YA 1DYKA 2PN5A 5GZDA 4XQDA 5IT6A 2E7QA 3OYWB 1MEC2 4HSJA 1ZZCA 2DVAA 4R9CA 1GANA 1FYUA 4Y24A 2ZGMA 3NVCA 1FPN3 3E6DA 4D3WA 1MS5A 2HWC2 4P9LA 4Q4W3 1RITA 1FI2A 2UY9A 1J59A 5KC6A 1AHSA 3ZIXA 4P14A 3G6JB 1CAUA 4L97A 3MIDA 4C1WA 1CPNA 2RMU1 2CV6A 3WCSA 1DGLA 1QOOA 1SQ4A 3FUQA 1O3SA 4CDXB 2ZMNA 4OZXA 2PLV3 4XXAA 1HXS3 4MXWB 5BNNC 3S30A 1PGSA 2I2SA 3TN91 3VBOA 2P34A 4ZU5A 1QJX2 1IS5A 2VOVA 4ASMB 4BMBA 1F31A 1DIWA 3AZYA 5DUWA 4ISRA 2WC2A 5AC91 1CIWA 2WS92 4ISQA 4PLOA 1MVEA 4JTOA 3MLLA 2WJSA 1REDA 1HRV3 2QFEA 5JSRA 2LTNA 2B7YA 1HIXA 4CYDA 1U12A 4YGEA 3O0VA 3FBMA 1MQTA 4LA2A 1X50A 1EAH2 4N43C 2AYHA 4NR1A 5H9SA 1XU1A 3FC0A 3IDCB 3WY6A 2BWAA 2AREA 1NCQA 1QH6A 3ZFEA 4FXGB 5CFDA 1W6NA 1ZBA2 2EF6A 1KD7A 2P2KA 1K5MA 1B35B 4Y22A 4WVMB 3VDDA 1PVC1 2PQQA 1AJOA 3WVJA 1RUI3 2A6VA 3ZSMA 1Y3TA 2WZR1 2ZGRA 1AYM2 3LSEA 5FPZA 2RR13 1XNCA 5I0SA 5J98B 5FO8B 3KCXA 2D5HA 4GB32 4FT8A 4XXPA 5AVAA 2PHLA 4DXZA 1SBFA 2JEMA 4GH4B 4MGKE 1J3QA 1TMF1 4JDOA 4CEWC 4EN0A 1S0IA 5D8AA 2UWAA 1OPOA 2QZ3A 1EV12 2W52A 2ZX0A 3C2UA 5CFCB 2X5IB 1AR63 4LE4A 1RGSA 5FLHA 4AEJA 2A71A 2HWE3 3NV2A 3D8CA 1PO13 1KRIA 2JICA 3FLTA 5GLZA 5I0TA 4AGGA 1V6NA 4QD2A 1UIJA 2MHFA 1IOAA 2VU9A 2YXSA 3AP4A 5ACA2 2HWB3 3ILRA 3P3NA 1REEA 4IXLA 4XQ4A 2DV9A 1RUD1 3UKNA 2VOKA 1H8VA 4XOGA 3OBTA 1RVF2 4X6QB 3CLPA 4N7IA 2Q0AA 4P9IA 2A5ZA 2ZGLA 4K1ZA 1PIV1 1Q43A 1ASJ1 1H8TA 1OLRA 3FLRA 1RUF1 1X82A 2R042 4G3YC 3BU7A 5L36A 1MS0A 1NE4A 4FP2A 2HWF1 1YNAA 2RS51 1EYBA 2ZJCA 3MW4A 2D6NA 2HJIA 3SH5A 1Q3EA 4Z92B 1GNHA 1RUJ3 2IFWA 3VKLA 1CVNA 1M06G 2NP0A 2IXLA 1QJY1 3ZYIB 5C9AC 2ZX3A 1GZCA 1GYKA 1N1VA 1JHNA 4AVBA 1JW6A 2R0FA 1QOSA 5EJ3A 4E9KA 3D0SA 3TWIA 4OI4A 2D6OX 1RUC3 3KGZA 3AB0A 2RS32 1ULCA 1PO22 1D2QA 3MPBA 3DN7A 1C1FA 1X7NA 4CDWA 4QQHA 2WWSA 1AR81 4PLNA 3C3VA 1B35C 5T55A 2BNMA 4FOYA 4COUA 3GF6A 4ORFA 3WW1A 5J48A 2WSUA 3VBOB 3UK9A 3N7LA 4QGLA 2K2SA 1IZ3A 2YDEA 5GLWA 4WV8A 4L11A 1V9U1 5CVRA 3USSA 5FLIA 3MW3A 1H0BA 4GH4C 1UPSA 5E88A 1POV1 1LULA 4L8QA 1QQP2 3VV1A 4HMZA 3BOWA 1DZRA 3OBRA 1MQTB 4Q4V1 2ZKNA 3D4KA 3NL1A 2WQZC 5CFCC 3MIFA 1W6MA 2X5IC 5T54A 1SACA 5GLUA 3N7KA 5EWSA 1NCQB 1QXPA 2JXAA 4FPCA 4MVTA 3MLJA 1W6NB 4QPIB 1COV1 3NKTA 1PZ7A 1K5MB 2IXKA 3AJYA 4OHVA 4R52A 2R16A 2VNGA 1S0BA 1GZWB 4FQZA 1ULDA 1BMV2 4BOWA 1CJDA 3VBHA 1BK1A 5GLTA 1RUG3 1WLTA 3BPZA 4Y1YA 1YXWA 4N53A 2XJTA 5DG2A 3WG2A 5C4WA 1NQJA 1DZQA 3HMYA 4RL7A 5JAXA 4FTSA 4YVSB 2FHRA 3ZPYA 4WM7B 1MEC3 1ZZ9A 5L73A 1LHWA 1BJQA 2YV8A 2JG8C 5HCAA 2PHDA 2VVEA 1PGW2 1Z78A 3T2TA 2BVVA 4R9AA 1DGWX 2ZX1A 1CQ9A 3R4DB 1FNZA 1E57A 2D43A 2IZWA 2YZ4A 1G9FA 1U5ZA 2NLRA 5J37A 2W08A 2G9GA 1LOAA 2BQPA 1R1A1 4L92A 3WT3A 2ZGQA 2AZ5A 3SCHA 4M3CB 1VBE1 2VQAA 5FRAA 3O12A 4Q26A 1SCRA 2UWBA 3U07A 1U0AA 1QJX3 3FX3A 4YFZA 5LRRA 4JV4A 1XNDA 4Z1VA 2WS93 4B8EA 1KITA 1H8TB 5T5PA 2D97A 1BXHA 1HRI1 4O9EA 3RYRA 3VBOC 3WDTA 4Q4W1 4ASLA 5A32A 5JI7A 3EJKA 4DY5A 4P5HA 3INAA 4D7TA 3ZX7A 4A7ZA 2HEVF 1NA1B 4NHLA 3WDWA 1WCKA 4M3CE 1EAH3 4P9WA 1D4M1 1CAWB 2D3RA 3LOBA 1XYOA 1CN1A 1CAXA 1GQHA 2VMGA 1ZX5A 4C0HA 5FOJB 1MQTC 2PLV1 2Y0OA 1ZBA3 4YVWB 3MEPA 3I2DA 3D0JA 4AI8A 3DKWA 2VNOA 4YG0A 5KWRA 1OA4A 5LRSA 4LBQD 4J1WA 3VGIA 3J26N 3TBDA 3ZFEC 1NCQC 3RG0A 5CFDC 4JGYA 3AZWA 4LO8A 5C33A 3HAGA 4FPEA 1K5MC 3AKRA 5F9TA 3GALA 1AL21 4IEPA 4YW1A 1AYM3 2A6ZA 2G4IA 3KD4A 3RYPA 1FV2A 1FOD1 3VDDC 3KM5A 2OYZA 5KHHA 4YZ3A 2Z79A 2ZTNA 4QQLA 3E6BA 1IKQA 2CWMA 2FZ2A 1PM7A 4FPYA 2BFUL 3FJSA 3I59A 2R6QA 1ENSA 2UY8A 5IK7A 1J3RA 1S2BA 2P3JA 3VBFA 3ZXKA 3MF9A 1EV13 3PVBB 4K9SA 4AEDA 1ND3A 5DUXA 3M3OA 3OF1A 1LEMA 4P9GA 5D8AC 4Y5Z0 4YVSC 3S7IA 1MS4A 1Q8OA 1Y9QA 4MUVA 1Q5OA 3ZMOA 1RUI1 1FMD1 3KCYA 2K9ZA 4AYUA 2RR11 3N7MA 4G4FA 5ACA3 1WCDJ 3SMHA 5K9YA 1AX0A 4XFAA 4HFSA 1V6JA 4Q4Y2 4C90A 3CJIB 4FQ4A 4E4SA 3DUIA 2XKPA 4QM9A 1N3PA 1RVF3 2VG9A 1UMZA 5H9RA 3ZSLA 4WVZA 1UL9A 3MIHA 1J1TA 2OUJA 1XRUA 4LBLA 4K21A 1BBT1 3W9AA 3AP6A 4DRRA 1XYNA 3RI9A 5A3MA 1Q56A 2R043 4N53B 4EJRA 1O3TA 1SLLA 4K20A 4XDQA 4META 3T1MA 2QDNA 1LTEA 1H8TC 1JXNA 4KU7A 3PNAA 1ENXA 2PHWA 3WP4A 4AQ2A 2B9UA 4NN0A 2HWB1 3WZ1A 2RE9A 4TZDA 2JENA 1UD1A 1NA1C 1U5XA 1MACA 1ALYA 4ZKTB 1R092 3ME2A 4YNIA 4BLJA 1TME1 1LOFC 1VBC1 2XJQA 3ASIA 4R9BA 4AHZA 2CNAA 4BIOA 5ABJB 1ZBE2 2RS33 4KQ7A 1PO23 4KL1A 1LHUA 3JD72 4NOTA 4HKLA 4KWKA 5I93A 1PGL1 1WLDA 4AG4A 2OPKA 4E4DX 3MPPG 4CEWA 1S2KA 1ZREA 3WXPA 2F4PA 3QCWA 4ES9A 3AZXA 4CDWC 4A2UA 1QNWA 2XJRA 1ND2A 2MEV1 2A7AA 1LR5A 1RUJ1 5GLVA 2UWCA 2GC1A 1BVP1 5A32B 4F3JA 5BV6A 1EPZA 2YGLA 1QQP3 2VUJA 3VHOA 2XWBB 3V0BA 1X36A 1S0FA 4AVSA 3VBUB 2PHUA 2NPIA 4DPNA 1HQLA 2VY0A 2EAAA 3SNMA 2OVUA 5IK8A 2CTVA 2DFBA 1YFYA 4B3NA 4L99A 5JZGB 4P9XA 3NV3A 2B5HA 3ALQA 4CDXA 2YC0A 1ZRFA 1YIPA 2LM3A 2D7FA 4TWTA 3B94A 3S7EA 2XWJB 4QMAA 4XFBA 3IDBB 4JGYB 1DQ5A 3BTAA 4PLMA 2VPVA 2GDFA 4B4RA 1OOPB 3BALA 1W6PA 5GZFA 1X8EA 3KQRA 2O0OA 4LLFA 1HV0A 3QH6A 4HANA 3I59B 3M3EA 1DHKB 3PVOA 2GALA 5DZEA 2PTMA 3E5XA 3H7JA 4FPLA 4CP1A 3VBHC 1JUHA 2XLFA 1RB8G 4N53C 1VBA1 4AEDB 1ND3B 3WG4A 3DPRA 3O7OA 5A33B 3MFAA 1XNKA 5DDJ2 5FLJA 5C4WC 4J6GA 4ZU7A 1X33A 2A3YA 4BM8A 1LECA 3NO8A 1S55A 2RS12 4AW7A 1Y43B 3NKGA 1B35A 1QKQA 3AZZA 4IEUA 1A3KA 4X8NA 1RHI1 4PDWA 2JG9B 1RUE1 1GLHA 2DVDA 1HLCA 1ZM1A 2DCYA 4FPGA 5KC5A 2H0BA 3N4MA 2XLGA 3JU9A 4RGAA 2ENRA 1L3JA 4LULA 4W6XA 4XILA 3M70A 5ABJC 5I8YA 4P9JA 2WFF2 2C0ZA 1X8MA 1KQRA 4XF1A 2ZKLA 4GH4A 1NY71 3WQ7A 1MEC1 1O5LA 4HSLA 3UKTA 3JCIA 4XHBA 4XPVA 5C8WA 4LBJA 1RMU1 1KFXL 2D6MA 4XTMA 4UXAA 3JBG2 1RINA 2WLPA 2X5IA 3ZSJA 5FCCA 4BIFA 5B2GB 1H2KA 5BNPB 1EP0A 2D3SA 2DCKA 4RGGA 4FPHA 1PZ8A 4IV3A 1VBB2 4AI0A 5JIUA 4XFIA 2XBO2 4CRQA 1JYCA 4AVTA 2WNUB 5KHGA 2EIGA 1O91A 5I8SA 1LJ7A 2XB6C 3AP5A 3BIWE 5F5QA 1TEIA 3PJYA 4D7SA 4MLOA 3IIAA 3LSDA 3VBUC 4BCUA 1LOCA 2C5DA 2ARXA 1W6OA 3OPZA