2E68A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e68A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e68A01
2I9EA 3UQNA 1OABA 2J6XA 1YXYA 2E5BA 1SZEA 1TQXA 4LT9A 2Q8LA 2ZZ7A 4HIBA 4A29A 2I14A 3O6YX 3ZWSA 3H55A 3T40A 4X9SA 3NEVA 4DELA 3S5OA 4UNKA 3DXIA 1NFBA 1LBMA 4KFNA 4LS1A 4UMBA 5FI8A 1HFBA 5IM51 1F05A 1OHLA 3CEUA 3O07A 2ZA3A 3RK8A 5DY3A 5DELA 4RCXA 1QOPA 5HWNA 4CQAA 3TSDA 3OHIA 3ATZA 2QEZA 3CPRA 3DU0A 2NUWA 5D02A 4LS0A 3EX4A 1QR7A 4KFPA 3LTSA 3UZJA 2HTMA 3LM7A 2FLIA 2VFHA 3M7WA 4AVFA 3GKFA 3GXNA 1CW2A 4HPJA 5E0KA 2DZTA 4JYDA 1LOLA 2X30A 2ZZ6A 5D05A 3L9CA 2FB3A 4O15A 4ADSA 2QCLA 3P60A 4JICA 1EX5A 3STEA 5LNUA 2WQPA 4P61A 3S5ZA 3LTPA 4DEFA 3QFEA 5D09A 2ZTJA 2DU2A 4E38A 1FUYA 1H50A 3UD6A 3GKAA 2X1RA 1SZGA 1K02A 4IMCA 1QMLA 1EA0A 3E12A 1IXPA 4E2BA 4UNLA 3NQ7A 1C9DA 1Y0EA 3L21A 1KW1A 3W7LA 4XUGA 2QAPA 3TIMA 4WY0B 2QCEA 1OF6A 1DHPA 5D2XA 4RLIA 1HG3A 4UIOA 4BFAA 4FNRA 3UXAA 2ZRWA 3W1XA 1KTNA 2ISSA 4GBUA 3UZ5A 1LDCA 1R46A 4A3UA 3W1NA 1FDZA 2G95A 5KMYA 1SSGA 3MHGA 1H61A 3HPXA 1TRIA 1R2TA 1ZJIA 2J24A 2DP3A 1G7UA 5FEZA 1K3UA 3W7EA 3EB2A 1O95A 3Q58A 3SJ3A 2NZLA 4MOZA 4ZQCA 3B0UX 1PIIA 1B4EA 3PSWA 4ML9A 1W0MA 5HMSA 4UTLA 1EPXA 2R14A 4N9EA 4ADTA 2V81A 1RQEA 2TMDA 4MZ1A 2Y63A 1AMKA 3DKJA 8TIMA 1XKYA 3DGRA 5H91A 3NQMA 1Z41A 4O16A 3UY8A 3LHTA 1S5TA 3QJAA 1HL2A 1TMHA 1BTMA 5FF4A 2Y7FA 5AYYA 1DBTA 4O17A 1YADA 3DH7A 5CSRA 1KTBA 4OGZA 5BNKA 1W37A 5KZDA 4CCDA 5FESA 2DZXA 2ZBTA 1VHNA 2NXIA 4LRTA 1LCOA 4O19A 2BLEA 1Z48A 1RZMA 4EF9A 4UCGA 1QPNA 1P0KA 4DPPA 1VCFA 1KM5A 2EAWA 3LRLA 3TC7A 1KM1A 5AHFA 5K4XA 1EP3A 5G4WA 5D37A 2XN1A 2J27A 3LRMA 2O7SA 3QYQA 1X7FA 1XBVA 2QUUA 1XC4A 1OVDA 2IQTA 3ZWTA 4BR1A 3DFSA 4RXGA 3R89A 1ZCOA 3LHVA 4NVTA 1ZHAA 1QPRA 3O05A 5AFDA 4JIQA 3M5XA 4N2YA 5LNWA 1ME9A 4MJMA 1T8XA 1LOQA 1A5AA 4O28A 3G3DA 5CPLA 2Z6JA 5DBTA 1FX6A 1RQHA 1V5XA 5CPMA 1G4SA 3NXFA 3ANYA 4AHPA 3PF3A 4JYFA 4NNCA 3ABQA 3QQ0A 1OYCA 3BGJA 3T7VA 4PL1A 4PH6A 2EF9A 3E9AA 4DO4A 4BWLC 3GVGA 1JCNA 2A0NA 3A9IA 2BWGA 4NJGA 1F7BA 3CWNA 3SI9A 2VFGA 4O54A 4JTTA 1FXPA 1SZFA 1VYRA 1BWLA 2JKPA 4I7WA 4ZVJA 2WNQA 3QSTA 3NL5A 3W7CA 1XDMA 3CIWA 2GVJA 3W71A 2QJHA 1OX6A 3N34A 3LXCA 2BXVA 2RKXA 3R2GA 4O12A 4YWIA 4O1CA 4Y96A 3TQVA 1D3GA 4M7TA 4GE8A 3STGA 4TMCA 3CTLA 4IGHA 5F2LA 5G2IA 3IIOA 3P5ZA 3QW4B 4PEKA 5CG7A 4LUIA 1NSJA 3CB8A 5G5IA 4NXKA 4C1LA 5KZEA 1LP6A 1TPFA 1ZY9A 1O94A 1KFKA 1GPWA 5HR7A 1DOSA 1G69A 1YPIA 2B7NA 4H4IA 3LCFA 2E6DA 2VEPA 5CZSA 4OBTA 1TO3A 3M16A 4OWGA 3QZEA 4ICNA 5DCBA 3RF9A 1AW5A 2YGYA 3M6YA 3EX6A 4M6PA 2CZEA 1R47A 3LCXA 1E51A 3GAYA 4QQ3A 1TV8A 1UJPA 2WSRA 2Y61A 3R13A 1YXDA 3IIXA 4NX5A 1F73A 1YDOA 2RDTA 3O6CA 5DCEA 1UB3A 3BG9A 2VFFA 3HMJG 5K9XA 2FFCA 4O1AA 3T55A 2VEIA 1JJKA 2QUTA 2C16A 4BI6A 3N9SA 1G67A 2CLKA 4KKXA 5AOUA 4JTGA 4J9JA 4JYEA 4MUZA 2EPHA 1KFEA 3LV6A 2ZRUA 4JY8A 3K30A 3OEXA 1J4EA 1LLWA 2Q8ZA 4QJ1A 1GT8A 1NF7A 1EP1A 4O53A 2QDGA 1AL8A 1QO5A 3HB9A 3W1UA 3PBVA 1IIHA 3NVTA 5FF2A 3P7YA 4QNWA 1O5XA 3THQA 1QCWA 1SU5A 5BOOA 4FX6M 2NXGA 1PHQA 3EX1A 3MI3A 3G1YA 3TW6A 4GC4A 5C5YA 4HPXA 3W7IA 1ZENA 4LNYA 1MO0A 3HG2A 3MWAA 3GNNA 1PCKA 1QDSA 3DFQA 3WK1A 5IBXA 2W79A 3W07A 3MUXA 4UTKA 3W3OA 1H51A 1WBHA 1GQNA 3FFSA 5G2WA 4ZMGA 4GUIA 3N2XA 4U28A 2WSQA 2QCHA 3FYPA 3RMJA 3F1QA 3M9YA 3G1SA 4IWWA 2GQAA 3IIZA 1G4TA 3LCIA 3W85A 2CLHA 3G8RA 1VHCA 1VCGA 2V30A 1VRDA 1M5WA 4YCPA 1OYBA 5CSSA 1JUKA 1W5PA 5AC7A 2NUYA 3CIXA 4XKYB 3F4NA 1SSDA 3D0CA 2GUUA 4W9TA 4K7YA 4EOUA 4O10A 1OFDA 1N7KA 3GLCA 4ORIA 1YPFA 4MZYA 1H7NA 2Y7GA 3M41A 1HO4A 2PRMA 2VXNA 4LVBA 3G1HA 3GDMA 1Z42A 4LU0A 2DORA 2NXHA 4RK8A 1SW0A 2RHGA 4S2BA 3N9RA 1I45A 3S6DA 3HG4A 2A6NA 3CM4A 4AWTA 3BVJA 3C0JA 4IJBA 4MY9A 5HUPA 4TO8A 2ISVA 5F4WA 3GXTA 3NM3A 1G6CA 3LERA 4IX0A 1JULA 1LYXA 3ZFHA 3W1LA 1JCYA 2H8XA 3G0XA 2I1OA 3MBFA 3W7PA 4GUHA 2C1HA 1QNVA 3BV4A 3QMRA 4CQ9A 3NQCA 3E0IA 3TQKA 3R8RA 1W1ZA 4O13A 4OU1A 3PG9A 4ONVA 3LCHA 2Y70A 1RPXA 4AH7A 4RZ5A 3O1NA 1L6SA 3BG5A 3L0NA 3A5FA 4FNQA 1GEQA 1UUMA 4NJHA 3VCRA 3MBDA 1WYIA 4UFHA 4GFSA 2PURA 3UWYA 4I7UA 2X16A 4FHAA 5KINA 1TIMA 2G5WA 1D3HA 1TREA 3FOKA 3M0ZA 4LVDA 4R33A 5DBUA 3TSMA 4AAJA 1VGAA 3GX9A 5DXXA 1CI1A 5AHEA 1KTCA 1PL9A 2J88A 3L66A 3LDVA 3U2OA 1YDVA 3NDOA 3LXAA 1JVNA 3LV5A 1I2NA 3KVJA 3QW3A 4Z0SA 5K7JA 4MLJA 3OA3A 1IXNA 1KM4A 3USBA 2H6RA 2GQ9A 3GAKA 4AXKA 4Y9AA 4K6AA 2ZRXA 3WK0A 1QPQA 3STCA 5LGZA 3B06A 1GOXA 2P10A 3NZ1A 3TA6A 5HWMA 1EEPA 4XZ9A 5KTLA 1DV7A 2TSYA 2V5LA 3CU2A 4O18A 4CLMA 5C2XA 3CLMA 3W2KA 1RR2A 1TSIA 2H3DA 3HGJA 2PE4A 1W56A 5F4SA 2OCZA 1W3IA 1WAUA 3W7MA 4LV9A 3QSRA 4C1KA 1RD5A 5LNVA 3F03K 5FF7A 1PV8A 1SO5A 3BLFA 2A7NA 2YYUA 4JDBA 3TCEA 3KRSA 1KFBA 1A5BA 1LBFA 2B0MA 2CW6A 2HS8A 2H8ZA 3ZR4A 3G1FA 1TYGA 3LCGA 2Z2UA 4UTHA 1HTIA 4DXVA 2Y7EA 2CWNA 1KFCA 4TIMA 3OVPA 3UNDA 4WXYA 1JUBA 1IGSA 4FNUA 2ABAA 3MHUA 4UMAA 2A7RA 1SUXA 4IPJA 2JKEA 3BW4A 3RLVA 2ATMA 1TPEA 5D2TA 3DFOA 3PSVA 1H7PA 4X2RA 3B03A 1ONRA 2E77A 4RV8A 4AB4A 3VKJA 5DCDA 1OX5A 2HS6A 3W86A 3L5AA 3PG8A 3VE7A 4NU7A 4LVFA 4LTSA 1VS1A 3W7OA 3YPIA 5HR6A 1G7VA 4M19A 5BMXA 2CLFA 3G1VA 3T78A 3SZ8A 3S5NA 3BGGA 5TIMA 2VFIA 2QCDA 2QKFA 5T26A 1H62A 3KVKA 1W8SA 3LRKA 1ICQA 4H6KA 3C2RA 5EY5A 2X1UA 1O4UA 3KXQA 3RU6A 2JKAA 1H7RA 2EGZA 3MYPA 3N14A 2QCMA 1SZNA 3W2NA 2E6AA 3NQVA 5HJLA 4CQ8A 4GWEA 3S1VA 3SFKA 3WFAA 5KSWA 3M1ZA 1H63A 4LC6A 4YCOA 5C54A 2JGYA 1F6KA 2WV8A 3WK3A 1LORA 5EBUA 3W83A 2NX3A 4UXDA 2VFDA 2GVGA 3GDLA 3R12A 3EWBX 1RQBA 3TC6A 3TR2A 1J2WA 2GJLA 4K8EA 4FIRA 3MI6A 4JX5A 1BWKA 4M6QA 2R8WA 3B04A 1YTKA 2A2IA 4X3ZA 2VENA 1JCXA 3TKFA 3NGJA 3UYCA 3TSBA 1EWEA 1XUZA 1JRCA 4YMZA 3G22A 5ABTA 1MXSA 1FCUA 3V1PA 1ZALA 2TPSA 3TMQA 1WOAA 5DY2A 1LBLA 3EXTA 4BI5A 2VFEA 2PRHA 3L0KA 1OFRA 2BSLA 2NLIA 1EUNA 3KRZA 4ZZ9A 2CLOA 3EX2A 3C8FA 3LHUA 3UWVA 1C29A 3GIYA 3O16A 1XCFA 3MP4A 1SFJA 3Q2DA 4FO4A 3PVFA 2Y88A 4B5NA 1FWTA 4MPQA 4OQVA 1XL9A 2ZCGA 4KWWA 4ZQRA 1LM1A 5DXYA 1ML1A 1KM3A 3HGRA 3OVQA 3LHZA 4WOQA 1X8FA 4A2SA 1OX4B 1QWGA 3LLDA 3W2LA 6TIMA 1OFOA 2GPTA 4A2RA 4TU1A 1TRDA 3KVMA 4JTEA 3FYOA 4LS2A 3NQAA 4GUGA 1GJPA 4MFDA 3NQ6A 2ZTKA 3C2EA 4JXCA 3W1TA 3HO8A 2F7FA 4MLRA 3EXSA 3O63A 4NJIA 1GZGA 2FQIA 4MY8A 2V8ZA 1X6UA 3W74A 3C2OA 4GRSA 1TPC1 4EVZA 2RDWA 3BO9A 2CLLA 3G3MA 3GDKA 1SPQA 3S8HA 4JTJA 4O50A 5AYXA 2HSAA 3O06A 2WKJA 3O6DA 1VPXA 2X1TA 3PB2A 2QDHA 4O14A 3W87A 1F6PA 3NZRA 5AHMA 3PUDA 1X1OA 3W76A 1TTJA 2A21A 4JIPA 3DFNA 1SW7A 2OX1A 3C61A 1IXOA 4AHOA 3S5YA 2CZFA 3NQ8A 3EXRA 2ZQ0A 2Z1BA 2ZRYA 4WZHA 4P2VA 4JTFA 4LWWA 2P1FA 1TQJA 2G96A 3S1WA 4LRSA 1NVMA 1YTEA 3HPZA 4DF0A 1R2SA 4NXSA 1DJQA 4LY8A 1H1YA 4Z1AA 5TQLA 3S0CA 5D32A 5CPNA 2HMCA 1R30A 2YFOA 1FQ0A 3W84A 4UC5A 3F4WA 4Z0JA 1W3NA 4CNNA 4A21A 2OJPA 2E1DA 1QO2A 5D04C 1AK5A 3QMSA 3M5ZA 3HF3A 3UWUA 2C15A 4N9BA 3O8AA 5BW6A 3HGSA 3SY5A 2A6LA 4MFEA 1XBYA 3G1DA 1LRNA 4IX2A 3WJXA 5IBXC 4WY0F 3IIVA 3LBCA 3SGZA 4A22A 3LXBA 4FIQA 5AN7A 1VJIA 4Q4KA 1KFJA 1WBJA 4HSOA 1A53A 3UWWA 3DI1A 1I2RA 2Y7DA 1K8XA 2QR6A 2V2CA 4EIVA 3TUUA 2B7OA 3W2JA 2BTMA 4MZ8A 3TFCA 5LNRA 4POCA 5U7SA 2AGKA 2RH9A 4LC8A 3SGUA 1LRQA 4Y8FA 1Q6RA 2WPBA 3WJWA 1C8VA 2YYTA 1UASA 4BI7A 3UWZA 2WSYA 4RJEA 3EWUA 3H53A 1FCBA 3VNDA 2BX7A 2J9ZA 2VC6A 4FB7A 2E5DA 5EA9A 2FPTA 3NR0A 5K3VA 4Q33A 3TNOA 1TB3A 5J5RA 4HHPA 1IIGA 4K38A 3IVTA 1TPVA 3G8EA 3IEBA 4K7VA 4K37A 1LOSA 4EF8A 3MMTA 5CZTA 1TJRA 3I7QA 2DJLA 4QITA 3W1AA 1W5MA 4PC8A 2YFNA 1F2JA 2WNZA 5EL1A 4FX8A 3NQGA 5D2YA 2PCQA 1KM6A 1ICPA 3W2UA 4JD4A 4WJEA 1GG1A 1F74A 4JTLA 1XBXA 2F84A 1EB3A 3NPUA 6ALDA 3DHDA 2YSWA 4RKAA 2WO5A 3P74A 4FF7A 1KM0A 3IIPA 3SECA 1I2OA 3GXPA 1SR9A 4FNPA 4HNTA 3DAQA 3EWZA 3WJZA 3KHJA 3NPXA 4BK9A 1FCVA 5CKSA 5U4NA 2FJKA 3W72A 1K03A 1D9EA 3L68A 2ABBA 3U8GA 4OE7A 3MP5A 2C14A 2G97A 1W5OA 1DORA 5K9CA 3G0SA 5I3HA 2DZPA 3NPVA 4UTIA 2V2HA 1JCLA 3W2MA 3A23A 4HKPA 1ZFJA 2PRLA 4RXFA 2X1SA 3QEZA 3DBPA 3MW7A 3TV8A 5FEPA 4AWSA 5MHBA 3OVRA 5D33A 3I68A 1KFLA 2KZHA 3DKLA 5TBOA 2ZYFA 3HG3A 1ZAIA 4TX9A 4FXRA 4BF9A 5A8GA 1PE1A 3NL2A 1VR6A 2Z0IA 5BRBA 5AYZA 3TAOA 5CGQA 1TTIA 3W6YA 1P1XA 1DVJA 2OT1A 1AW1A 4NJKA 3IGUA 1M6JA 3LBMA 2ZRZA 5D2WA 1VCVA 1HO1A 1ZAJA 4N02A 2XN2A 1TPWA 1IXQA 4FX7A 1EWDA 5LNSA 3W7HA 3I65A 2D73A 1PCWA 1OK4A 3KOFA 2V0TA 3B0VC 5KZMA 4S2CA 3W1RA 1V7YA 3ZS4A 2YDAA 1L6WA 3CHVA 2WNNA 4WOZA 4NZFA 5L9FA 1TTQA 3ELFA 2QF7A 2GQ8A 4RX0A 3G1XA 4XBKA 4Z1CA 3WJYA 4KFOA 3N73A 2GJNA 4Y90A 5E1QA 5D2VA 1VYSX 2QCGA 4S1FA 5DLCA 3PBYA 3C3NA 3CWOX 2C13A 4GXMA 4N6EA 3NM1A 4JTKA 3S42A 1H7OA 1XM3A 3NPWA 2UV8G 4XBSA 1A5CA 3QPZA 1KV5A 3B8DA 2E68A 1YDNA 3RLUA 4HN4A 3MP3A 3L2IA 4U4MA 3V75A 3C52A 1FWNA 1JUEA 5L6UA 1TJPA 3E49A 1FBAA 3DZ1A 3FA5A 2C6QA 3TQ0A 3KX6A 4UFKA 3W88A 3S9YA 2V9DA 4JN6A 1ALDA 3W7JA 3KFTA 4Y6GA 1KM2A 3NYZA 4LW7A 3P81A 4KWVA 2VEMA 5CPOA 2RDUA 2XFWA 3PC0A 4JTSA 3UPBA 3LTYA 3FIGA 4FXSA 3L5MA 4UR7A 2GOUA 4DBDA 3AO0A 4PA8A 2DZVA 3H54A 2EHHA 1WXJA 3MYOA 4CNOA 3C6CA 3OBKA 1L9WA 5CZJA 1H60A 3A21A 3MJYA 5EMUA 3BG3A 4QISA 1EP2A 3QQ1A 4ZQPA 4NZJA 2QCFA 2DZWA 4AHQA 2NV1A 4LVAA 2QCNA 4AF0A 3GR8A 3P67A 1H7WA 3TAKA 3UPWA 1OG0A 2QJIA 2CLMA 5LSMA 3G1AA 4NNBA 2A85A 1WDWA 3GDTA 2FIQA 3FKRA 4MY1A 5AC8A 1OYAA 3TH6A 1LROA 5AHNA 1ZNNA 2BZNA 4JEQA 4E0CA 3LI1A 1JQVA 1GVSA 4QNEA 2V82A 1P0NA 4N9CA 4I9AA 3A22A 3TK7A 1HUVA 1MSSA 1YXCA 2Z6IA 5FEWA 3SW6A 2QCDB 4DO6A 3P84A 3IGXA 4IMDA 3W70A 2ZRVA 4N9DA 5AHLA 3UY7A 2JK2A 3L65A 4RZ6A 3TMLA 2H3BA 3LOTA 3W22A 4K8HA 2ISWA 1AL7A 3PUEA 4NJJA 4I7VA 1OJXA 3IVUA 2VOMA 3RFAA 2B4GA 1UBSA 5A5WA 3BARA 2P0OA 4H3DA 4XWUA 2OT0A 3MHFA 5F2MA 1GVRA 4R53A 1UCWA 3E96A 4OT7A 3W7RA 3NNTA 3W7NA 4Z08A 4EWND 3C4UA 1WX0A 3HQ1A 2NV2A 3KVLA 2OZ0A 1OFQA 4GJ1A 5C6MA 3G24A 4AMAA 3CQ0A 1BEUA 2YCEA 4UTUA 3N2MA 4O57A 3PBUA 5G1YA 4PCFA 3MO7A 3VI2A 5KITA 5LGXA 1OFBA 5I3GA 5FF0A 4HSNA 2YW4A 3W9ZA 3EKLA 3Q37A 1SFLA 1QOQA 3BPWA 1K8ZA 3PWAA 1SO4A 2EKCA 3ABOA 3LHYA 1MEIA 3GB6A 2QCCA 4FNTA 1PHWA 1FWWA 4UR8A 1B3OA 3LLFA 3NQDA 3KRUA 4NX0A 4UFMA 3T44A 3HG5A 4UUIA 4AWUA 4IMEA 4CCEA 2C3ZA 4O52A 2A4AA 4UTWA 1IF2A 1X1ZA 4RZ4A 1SW3A 4OV4A 2WOQA 3RNDA 3C2VA 5LKYA 2DZSA 4QIUA 4CNPA 4DBEA 1Z44A 2R94A 3M47A 4XKYA 1EIXA 1XUUA 4YL2A 5LHEA 5F2IA 3DENA 3W7GA 4O0ZA 2VEKA 3B4UA 1LZOA 1PS9A 3NQFA 1GWJA 3PM6A 2Y85A 1ICSA 3M5VA 4QSHA 1OF8A 2DZUA 3JS3A 4PTNA 3PS7A 1TV7A 1KBIA 1B57A 3BK0A 2E5CA 4UFLA 4ZQNA 1XBZA 3LI0A 2YW3A 4CCCA 4JDYA 1SQ7A 2J9YA 3LB0A 5FEXA 4IUOA 3OIXA 1QFEA 1UUOA 1THFD 4WQ6A 3NQEA 2NWSA 1DL3A 2TRSA 1L2UA 3SSJA 4JX4A 5BMWA 4ADUA 4IMGA 1TPB1 3P8IA 3S1UA 2ZFAA 4AF0B 5HWJA 4Z1DA 3GDRA 1SO3A 3PULA 3LX9A 2C19A 3TXVA 3NL3A 4UTTA 4M5PA 4NUWA 3PB0A 1XXXA 1MEHA 4LOCA 3UWQA 1W31A 3N3MA 1P4CA 1FXQA 1JQXA 5I3FA 5D30A 5F2GA 1NF0A 5D38A 1LTDA 1WA3A 5I3JA 4R34A 2QAFA 1M7PA 3EWWA 2PC4A 4YXGA 5G1TA 2X2GA 4HT3A 3VFLA 4LV4A 1GVFA 1NAL1 3NL6A 4JY9A 5HUOA 2Y6ZA 4ZQOA 3NAVA 1KBJA 5AC6A 1W5NA 4ZL1A 2B7PA 1VC4A 1T96A 1YYAA 3NO5A 1FCQA 1JRBA 1TPUA 5GVJA 1U83A 2ZA1A 1MEWA 2B7QA 2A5HA 3I6RA 4RR4A 4PODA 1J5TA 3PAJA 1K7EA 5F1VA 1KV8A 2RFGA 4TR9A 3DFTA 3SIZA 1LRTA 1Q6LA 3N19B 3FKKA 1DKWA 2FPYA 4XQ6A 5SWUA 4HNUA 5E93A 1I8JA 3FS2A 5J5DA 1Q6QA 1T99A 1Q45A 1JR1A 1F5ZA 2JBMA 1DJNA 1O60A 4NT0A 2CFFA 1I4NA 4E2DA 1A5SA 4QM1A 2AAMA 2CLEA 1OK6A 4NNAA 1AW2A 1VZWA 2YXGA 3TXZA 4FEZA 3TE9A 4JGDA 1FWSA 4XTIA 3CT7A 1GTHA 3AJXA 5G2HA 1TPH1 5EYWA 3I7RA 3NG3A 4WY0A 1W54A 1ME7A 5I3KA 1TCDA 3I7SA 3GZ3A 1XI3A 1W3TA 3BLEA 1KLZA 3TDFA 3HPSA 3GNDA 2ZZ3A 2QUVA 4MJZA 2J9XA 4UFIA 3DFPA 1A50A 1OFAA 1OFEA 4K39A 2YR1A 1L6YA 4L4LA 2YX0A 2CU0A 4G1KA 2LLEA 2Q3OA 4N4QA 4X22A 2R91A 1K7FA 1FDYA 1U5JA 1LLZA 4AEOA 1ZAHA 4MYAA 2C18A 2W6RA 4IMFA 5K2ZA 3QH2A 4PL2A 1W5QA 5HNRA 1GG0A 4D2JA 3QC3A 4ALDA 4QAIA 3QRHA 3WJSA 4L4MA 1S5WA 1DQXA 1GYLA 1WQ5A 3OG3A 4DQWA 2WJZA 3W1QA 4N4PA 1XDLA 4JNMA 3BLIA 3P62A 4JTHA 2W0UA 2A1YA 5CZ0A 2V5BA 2VKZG 4O1BA 3EWXA 2GVLA 2NX1A 4O11A 4O8RA 3G18A 3ATYA 4UFJA 1NEYA 4UMCA 5HQEA 2YPIA 4O0KA 4O1DA 2XN0A 2AQWA 3W1MA 4WX2A 4DF1A 3JR2A 3M5YA 5DN1A 3ABRA 5FF3A 1H7XA 2FB2A 4JS3A 4OV9A 1TTPA 2ZZ2A 1AG1O 1JCJA 1TV5A 3SR7A 2ZA2A 1ADOA 2CZDA 5LZLA 5I3IA 4OHQA 2ATSA 3W7QA 1B9BA 1P5BA 2YZRA 1G4EA 1ME8A 2H90A 4M7SA 5H2ZA 1FWRA 4ZQMA 4JX6A 5AB3A 3C56A 4TMBA 1B4KA 3LCLA 2OMAA 1R2RA 2E6YA 1FY6A 2FPVA 1VQTA 5LHFA 4GUJA 3JRKA 4WUIA 4MVAA 3L67A 3NOEA 3QF0A 1SO6A 3B05A 3M43A 4IPIA 3TW7A 4Z1BA 3ABSA 4ORMA 3IV3A 3FEMA 4JTIA 3S1XA 3FJLA 1WOBA 2DJXA 3P5YA 1PVNA 3VE9A 1RV8A 3THAA 1KLYA 4GUFA 4XTDA 4YLWA 1GTEA 1VYPX 4HNVA 1T0OA 3B0PA 3M44A 4IXHA 1H1ZA 4BWLA 4UTTC 4JTUA 1GYNA 2Y62A 5HULA 2NWRA 3LGEA 1WV2A 2FTPA 3LCWA 3P8JA 3O15A 7TIMA 3TJLA 3BW3A 2ZDRA 3W7DA 1I2PA 4PFMA 4WXZA 5AHIA 3MI2A 2NUXA 2ZZ5A 4O4WA 1VLIA 3W23A 4UTMA 4JR5A 2ZZ1A 2E09A 3EEGA 4IOTA 1KA9F 3W1PA 1EUAA 3HIJA 4HNNA 4MYXA 5C55A 3A5VA 3L0GA 5HINA 3QMTA 4N6FA 1VH7A 1CX9A 2CLIA 4IQLA 4WD0A 4LUJA 4MIMA 1OX4A 4LVGA 5EKYA 3INPA 3A24A 1RVGA 1QAPA 3GYEA 1YLVA 3PR2A 2CZ5A 3FJ6A 3IVSA 1F76A 3W73A 4O4VA 2O7QA 3QM3A 3R5EA 3WK2A 3HBLA 3L5LA 3LHWA 3STFA 2FDSA 3FLUA 2TYSA 3CC1A 2E6FA 4K36A 2C0AA 3PUOA 3T4CA 1DQWA 4IXXA 1OFPA 3TFXA 3W75A 4NQ1A 1O5KA 3BW2A 5G4EA 3P61A 3CEPA 3DHFA 2Q3RA 3EX3A 4M6VA 1I2QA 2V2DA 4MKNA 1N55A 2QJGA 4Q32A 3P80A 3W7KA 1FDJA 3U6WA 5EPDA 1K8YA 3TX9A 3EKZA 5K9DA 3PY2A 1QPOA 1G4PA 3HOJA 1N8FA 3QPYA 5F1UA 5D03A 3TROA 3E02A 3IGSA 1S3HA 5K4ZA 4R7JA 1MZHA 3IRDA 3KAOA 1K7XA 3UXDA 1VLWA 4UTWC 1TPDA 3NA8A 1GVOA 1YTDA 3TU9A 2ZZ4A 3G0UA 4UTJA 2A7PA 3HJZA 1Q6OA 1M7OA 3EWYA 3HGOA 1JCMP 4GNJA 3TJXA 3GR7A 1GVQA 4DO5A 1H5YA 4FNSA 3P82A 4DF2A 5F4XA 1Q3NA 2NX9A 2Y89A 3NQ2A 2JGQA 1XFBA 2VELA 2ALDA 3Q94A 4DPQA 3DI0A 1BKSA 3PBWA 3C2FA 1S5VA 3GK0A
chains in the Genus database with same CATH superfamily
3TTOA 2J6XA 4B3ZA 3EOSA 1EDQA 1ESWA 2Q8LA 3WLTA 1C92A 4EE9A 3QV6A 2BOFX 2F6XA 1UKTA 4XAZA 3PTKA 4UNKA 3RJXA 4WJXA 1GQIA 1LBMA 2ZOXA 7TAAA 4WKAA 1NP0A 2VWTA 4S38A 1HVXA 1AUSL 4E5TA 3RK8A 1U33A 3VDGA 5HWNA 4Y9PA 4DAIA 1FKXA 1HJQA 2QUNA 3SN4A 2F2KA 3AHTA 3DU0A 4PTDA 1J5SA 4IZGA 1XH1A 2ZWYA 1QR7A 3UZJA 2QW5A 2HTMA 3M7WA 3GKFA 4DYKA 1UWUA 5E0KA 1TZ7A 3MPGA 1S38A 1LOLA 4RUBA 1V4YA 2EJAA 4K3ZA 4UWMA 1DEDA 4F0KA 2XUCA 4O15A 4AD0A 4HHHA 1EX5A 2XTKA 4M6UA 1AVAA 4DEFA 2J8FA 1EJWC 1SZGA 3E12A 1GHRA 4UNLA 1C9DA 5CLWA 4LEQA 1PZ0A 3W7LA 2QAPA 4XZBA 1AJZA 4WY0B 1ITCA 1J12A 3CZLA 3QFWA 4GXPA 4RLIA 2AL2B 3OO2A 4UIOA 3MCMA 1ECEA 3KOZA 3UZ5A 1VB9A 2PWFA 3W1NA 1DJWA 1W17A 5KMYA 3RYSA 1W2PA 1SSGA 1DXIA 4B91A 2V3GA 3HPXA 5FEZA 4E6MA 5IHSA 1PSCA 1WXZA 5AKQA 4ZA0A 1CCWB 1P0BA 4C6KA 1RXOB 4HHMA 5HMSA 1EX1A 4GI4A 1XFCA 2R14A 4O0QA 3RRAA 2X2YA 3LNPA 1HNYA 2J74A 1RQEA 5A8NA 2X7VA 2TMDA 2Y63A 5REQB 3OZPA 1ONWA 4PBFA 3ZT7A 5H91A 3XIMA 3LHTA 1AODA 3QJAA 1TMHA 1BTMA 1TUXA 5FF4A 4EX4A 1J0IA 3R58A 2E4TA 4LNCA 1G01A 1XCXA 4JQ1A 5CSRA 1KTBA 5A8MA 5BNKA 3VOIA 2D23A 2DZXA 2ZBTA 4DWSB 2WMIB 1LCOA 4O19A 2FTYA 3ARUA 4WDTA 1QPNA 4DPPA 2VUYA 1VCFA 2Z28A 4ZXLA 1EXBA 1GEHA 2VUNA 5G4WA 3K4DA 3TZNA 2XN1A 4CCZA 3QGKC 2O7SA 1XBVA 4GY7A 3T0TA 6TAAA 2HE5A 3L2MA 5A6AA 4PTVA 2IQTA 3DFSA 3R89A 2J7CA 3L4YA 4W87A 1XLAA 4NVTA 5PTDA 3O05A 4J3TA 1DJGA 2OODA 3M5XA 4D6IA 2Q01A 2XFFA 2XSAA 3SCQA 3G3DA 3AS0A 1A3XA 3PZIA 1FX6A 1EBHA 3KS5A 2WM0A 3NXFA 1WKYA 2E9MA 3BGJA 2XFRA 3T7VA 3TA9A 2RUSA 4PH6A 3EPNA 3R8HA 1HZYA 1HJSA 2VDHA 3FDKA 1E0XA 4XVDA 1QW7A 2JKPA 4I7WA 3T81A 3QSTA 4PMJA 1XDMA 3CIWA 3HV8A 3W71A 4H6QA 3N34A 4O12A 2PSNA 2WCAA 5XIAA 3TQVA 1D3GA 1QUMA 4M7TA 3B8IA 4DWSD 3RILA 1SFTA 3BMXA 5G2IA 3IIOA 4ILSA 4PEKA 3CASA 5A6MA 5G5IA 4FLSA 1WDPA 3ERPA 1DJYA 1O94A 3RR1A 3CHEA 4DWSC 1L8PA 5HR7A 4GIAA 1DOSA 3KP1A 3BSGA 1G69A 3K8KA 2B7NA 1YNYA 3DCPA 2XZ9A 3EB4A 2CETA 2CIPA 2J7EA 3M16A 2GSJA 3RF9A 4MNKA 3WBYA 1JPKA 1EO7A 5DT7A 1R3TA 2X7WA 4G9PA 2GJXB 3WH7A 3F2BA 4GH1A 3SFWA 4MSSA 1UR1A 1TV8A 1UMLA 3M7SA 2PBOA 4DXXA 2H9AA 5BWFA 1P0DA 1E9IA 3D6NA 3EB3A 5A8PA 5D8WA 4NAFB 4IFKB 2VFFA 1Y5XA 4GVIA 4NRSA 3VVGA 4HN8A 1TX2A 2QUTA 5C2CA 4LCRA 3WL0A 4ZOCA 3N9SA 1F3EA 4QQUA 1G67A 1ZBKA 2VZVA 2PGRA 4J3VA 4L6DA 4B5TA 5JH2A 4JYEA 4F66A 5CZKA 2FZDA 3RMEA 2ZRUA 4QR6A 3OEXA 1J4EA 2J8TA 2OO0A 3LD5A 4QJ1A 4UNIA 4M1RA 1UC5A 3KBMA 3CZEA 2ASHA 2OLSA 4C6BA 3H70A 1S39A 5MKGA 3DG3A 1V6UA 3NVTA 4PRTA 1IEVA 3THQA 1QCWA 3CQHA 1CT5A 4ZFMA 1BF6A 1PHQA 4F79A 4KWOA 3EX1A 4QDPA 4IFKA 1E43A 4W7UA 4YTRA 1PCKA 4GYJA 3GNNA 5BOEA 2GUYA 2X0HA 5IBXA 3W07A 3MUXA 3N9KA 1H51A 5CH9A 3FFSA 2CHRA 4ZMGA 4JKKA 1GOWA 2J47A 3N2XA 4C6QA 2QHAA 2PP0A 5I06A 4EXBA 1QI2A 2QT3A 3M9YA 4R9OA 5CBBA 1WAWA 3FNDA 4HOXA 4IIBA 1H09A 1VHCA 2V30A 1M5WA 3BJFA 4U10A 5CSSA 1W5PA 3E1F1 4YTUA 3EBVA 5AC7A 4MWAC 5CLTA 2PGWA 4XKYB 4TX6A 4AIOA 1ZCCA 1Z7AA 4Q8QA 4IFRA 4K7YA 3MKVA 4O10A 1N7KA 1MW1A 3SUSA 1K9TA 4ORIA 3K5XA 4OIFA 1ODZA 2Y7GA 1EC8A 3M41A 4NYYA 2XH4A 1Z42A 1Q7ZA 2DORA 3AYRA 4S2BA 5XIMA 1BHGA 1I45A 3KUMA 2A6NA 3CM4A 1CPUA 2ISVA 5F4WA 3LERA 4D8LA 3UFYA 3VTRA 7REQB 3FSUA 2YA1A 3ZFHA 1BRLB 2H8XA 3G0XA 2I1OA 3TZFA 3W7PA 3COTA 1V7AA 4NILA 4GUHA 4GVFA 4CQ9A 3E0IA 4P5UA 4KESA 2CBJA 5IDIA 1S1RA 4OU1A 1RJRA 4EKJA 1X38A 2CBVA 3LCHA 4AD2A 4AH7A 4LF2A 2J7HA 3BG5A 5I02A 4FNQA 4HU8A 4H9UA 3UWYA 1A0CA 1V6XA 5A1AA 2X09A 5A6JA 1JG9A 2V6AA 3WBAA 2OB3A 2DVXA 1W9BM 3FXYA 3AIRA 2ZX8A 1EIBA 5DXXA 1W1VA 1KTCA 4Z2HA 3L66A 3LDVA 3URBA 2HEJA 2CWXA 3LXAA 1U30A 1IXNA 1US2A 4AXKA 4GQRA 4FXFA 1W8GA 3BAKA 5LGZA 5EMJA 3UXKA 1SJCA 3CU2A 2F6UA 4R3UA 4CLMA 1KCZA 5C2XA 2HRWA 1XRTA 1VJSA 5EFFA 2WSKA 4OKDA 2H3DA 4Q8PA 3WD4A 3VZYA 3WD3A 3AJ7A 1RAKA 3E5PA 1KFBA 1M41A 2B0MA 3O2LA 2HS8A 1EJTC 1QI3A 4DJDD 3G1FA 3II1A 2WC4A 3RX4A 2RGMA 1W1PA 4HYRA 1TWZA 4E2OA 2PDXA 4WXYA 1JUBA 1IGSA 5BXSA 2YJQA 2A7RA 1L2QA 3UZYA 3MT1A 3UZZA 1C8QA 1EC7A 2AQOA 1ISWA 4X2RA 3B03A 2E77A 1ZP3A 3LLXA 3AS1A 4JBRA 1R85A 1PB0A 5CBIA 4G56A 1OX5A 1H2JA 1MWOA 3W86A 3VE7A 1VS1A 1PJ9A 2WVVA 3G1VA 2PTYA 3SZ8A 5TIMA 2DZBA 4G7FA 2QCDA 2QKFA 3KVKA 3LRKA 1ICQA 2X1UA 1JAKA 1O4UA 3GXIA 1XH0A 2JKAA 3MYPA 3N14A 3UW6A 1SZNA 1I75A 2FZ9A 4V15A 3I4KA 3KOWA 4CQ8A 2VZUA 3SFKA 3WFAA 4IQJA 4MB5A 3GFZA 1BVZA 1XIFA 3ARWA 4LC6A 4YCOA 3T2OA 1X1NA 4HU3A 4U3AA 3W83A 4IPPA 1XLLA 4RDWA 2P3ZA 4PMUA 4C6FA 2WCGA 2QVNA 3GDLA 3OOQA 2GJLA 1DQUA 4TOQA 1V51A 5ABEA 4DJED 2NQZA 3M0MA 3DIPA 2A2IA 5E9XA 4AWEA 4S39A 4GABA 3NGJA 4ROPA 2ONEA 1SYTA 4XD4A 3UYCA 1Q7MA 3TSBA 4KCVA 4Q8NA 1UZ1A 3G22A 3FY1A 2FGLA 5AVHA 2W67A 1D8CA 4JN7A 1GOIA 4L56A 2WK2A 4EK7A 3SCTA 3L0KA 1RY0A 4GG9A 1QK0A 1OFRA 3ZSSA 1WE5A 2ZVRA 2W9MA 1C3FA 1YEYA 4NI8A 3R79A 1NOUA 3VX0A 2UZ9A 2GGHA 5C8BB 1C29A 4H8VA 4C7GA 1XIJA 3B97A 3OBAA 4MJ4A 1SFJA 3CMFA 4OQVA 3CNYA 1XL9A 4M81A 1MQPA 2ZCGA 3GXDA 4HZ7A 1F9CA 1X8FA 3GVWA 1PYMA 4A2SA 2WHMA 1JDFA 3LMZA 3W2LA 1OFOA 3QBUA 1TRDA 3KVMA 1U1HA 4A4AA 4JTEA 1GJPA 4EAMA 5CEWA 1WZMA 4AVNA 3HV9A 4TV6A 2FQIA 4FR6A 4C6NA 1M7XA 4AY7A 3ARTA 1SPQA 3URQA 3S8HA 5HPCA 2NQ9A 3UU0A 3CMJA 3EOLA 3O6DA 1L0PA 3JW7A 4O14A 2VURA 3PUDA 5JQ9A 3W76A 2A21A 4S3BA 4JIPA 1SW7A 2XINA 4BY3A 1TZZA 3C61A 1ITXA 1OB0A 3NQ8A 2I5IA 2GUBA 3KCOA 4P2VA 3R6IA 4KEZA 4K8GA 5DT5A 2CXGA 1UA3A 4HBKA 3S1WA 2OZ3A 4KERA 1QNSA 3AIQA 4C6EA 3VOCA 4DF0A 1Q6CA 3GIPA 2BASA 2DEPA 4JTDA 1I0DA 4JHMA 1Y65A 4Z1AA 1XQLA 2VEFA 4L6HA 1BXCA 1FQ0A 1HQTA 3W84A 4M0XA 4UC5A 4CNSA 1T41A 1QO2A 2E1DA 1AK5A 3LNMA 3QMSA 4NI3A 2BHYA 3WYZA 3M5ZA 5IDZA 2VGIA 4FP1A 1XBYA 4S3KA 5E5CA 1LRNA 4IX2A 2AMXA 2GL5A 4XISA 3IIVA 5A6LA 5AN7A 1VJIA 1ZRQA 1U2YA 4Q8UA 4JQ3A 4HHLA 1WBJA 4HSOA 3DI1A 2OLHA 1I2RA 1E40A 2QR6A 1B3VA 4EIVA 2B7OA 1MDRA 2BTMA 4V2XA 4MZ8A 5LNRA 4A8NA 4Q3MA 4QDMA 1E5NA 4LC8A 1H3GA 1KC7A 3WJWA 2YYTA 4NKCA 4BI7A 4RJEA 2Q71A 5ABGA 1NDVA 2QVHA 1XISA 4GACA 4CD8A 3KTCA 1FWIC 4B4FA 5J5RA 1IIGA 4K38A 3K4WA 5I77A 3WY1A 4MB3A 3QV8A 1LOSA 3MMTA 3T09A 2KAUC 3I7QA 4QITA 1W5MA 1ONXA 4PC8A 4AUBA 3WFLA 4AD4A 1E9YB 1KGUA 5FJTA 3NQGA 4BCEA 2VOTA 1VD6A 1ICPA 4LAMA 4JD4A 2IKIA 1T5AA 4LAKA 1JZ6A 1IT7A 1XLKA 4FPSA 3GDBA 1EB3A 3NPUA 3DHDA 4EWJA 2RJGA 2WXDM 2IKHA 3SECA 2BOGX 3WJZA 3EWZA 3WMSA 1J93A 1DE5A 1EDGA 4B5WA 5CAKA 5M1TA 5CKSA 4C5ZA 1RA0A 3PANA 3W72A 3HZ3A 1HGWA 2QIIA 4ATLA 3SCSA 4A8RA 4QE4A 2YKKA 3PZQA 4BQ2A 1R87A 5G4HC 3OB8A 2V2HA 1JCLA 1V79A 3UXIA 2OQYA 2PRLA 2VT0A 2X1SA 3DBPA 3MW7A 4NL1A 4PMDA 4K1WA 5D33A 3I68A 3VOJA 3DYOA 3KBJA 1TV4A 4YIWA 2ZYFA 3HG3A 1ZAIA 2XH2A 4FXRA 4S3AA 4I8YA 3NL2A 1VR6A 1FHLA 3VCCA 1TTIA 4JKMA 1K9EA 3WL1A 5EGRA 4MWAE 1QHPA 2IQDA 3BICA 4FX7A 3VC5A 1EWDA 5LNSA 2VX6A 2D73A 4LPCA 5KZMA 4S2CA 3W1RA 1LG2A 4GKLA 3CHVA 3UZXA 4CQBA 1TTQA 3UP8A 3BC9A 2GQ8A 1GORA 3G1XA 3QY7A 3EDDA 5E1QA 2UY4A 5D2VA 1ZS2A 2INZA 2IUZA 4S1FA 1C9WA 4RL3A 2REQB 3C3NA 1US3A 3T6CA 5A8OA 4GXMA 1FH9A 3NM1A 5CSUA 1H7OA 1XM3A 4W8AA 4Y9NA 2UV8G 3KRBA 3B9EA 3AYVA 1OY0A 4HN4A 1XGZA 1YDYA 3U0HA 1B3XA 1JUEA 1JF6A 1NOWA 3RPMA 3N11A 5L6UA 5FL1A 4H9XA 2C6QA 3TQ0A 4UFKA 3I4EA 1A5OC 1ALDA 3KFTA 1J6PA 1SM9A 2Z7KA 3NYZA 2YBUA 4IP4A 2PP1A 5CPOA 4LX4A 2G41A 2RDUA 5DMMA 4U5IA 2HPMA 2PTDA 2GGJA 3UPBA 3U2ZA 3FIGA 3RLHA 1VFLA 2X1IA 3AO0A 2DZVA 3TYUA 4GY0A 3D3FA 4J2PA 4KF1A 5CZJA 3A21A 3L7RA 2QIWA 1EP2A 3CXOA 1FVPA 5DRIA 1IV8A 3NTYA 3FJNA 4KT2A 1W1IE 2QCNA 3KL3A 1RD6A 3AFBA 2QJIA 4F9JA 3POHA 3FKRA 5HK4A 2FVMA 1LROA 4UQDA 1PTDA 3BWWA 2HVMA 2Y2WA 4BA0A 1JQVA 5B7YA 5B7ZA 2CEQA 2X05A 4KRZA 1P0NA 4DJDA 1HUVA 1MSSA 1YXCA 3LM3A 5FEWA 4QRNA 3NURA 1XSKA 4DO6A 4UTFA 4N9DA 5AHLA 3J7HA 3L65A 4RZ6A 4NJJA 1AL7A 3IUIA 5E0FA 3TTQA 1J96A 2AGTA 4WEVX 3MHFA 3CH0A 3CZGA 1W3JA 1SMAA 3W7RA 3UA4A 1PPIA 2DQXA 4IL0A 1HGYA 5MKGB 3HQ1A 3VKBA 3R10A 4GJ1A 1R0MA 3CL6A 5C6MA 3F5LA 4I5RA 3S6OA 4AMAA 3ANUA 1V6TA 1A80A 4O57A 4PCFA 1EGVA 3VI2A 3V7PA 5ECVA 5I3GA 4XIAA 3QTGA 5KEZA 3HTWA 3MVTA 3GD6A 3Q37A 5I79A 1SFLA 1BLIA 4K2SA 4KIRA 1MUMA 3PWAA 3ABOA 3LHYA 4AZ6A 2J77A 2QCCA 4FNTA 1OBAA 1FWWA 1B3OA 2G37A 1BQCA 2W3ZA 3KRUA 4NX0A 4UUIA 4AWUA 3H8AA 1YW1A 3CYJA 2WOQA 3RNDA 3C2VA 5LKYA 4JTRA 2DZSA 6REQA 2QXWA 1LLOA 2BY1A 3M47A 4XKYA 4AVOA 1VIWA 5LHEA 1CBGA 4US6A 5F2IA 1YKWA 3ONCA 4FOUA 2Z4GA 1PS9A 1GWJA 3AXHA 3H7VA 4QSHA 3JS3A 3HPFA 1HKIA 1Y7VA 1B57A 3BK0A 1CLXA 1P6CA 2D24A 3RPDA 2ZUUA 4ZQNA 2YW3A 4CCCA 5HPOA 1SQ7A 3LB0A 4GI6A 4L1GA 1TWWA 4DJFC 1QFEA 2JE8A 4B5XA 3K13A 2NWSA 3CB3A 2CCRA 1NDYA 1DL3A 2TRSA 1A5MC 1L2UA 4ADUA 4GZJA 3AICA 1AH0A 2ZFAA 4QE5A 1SO3A 2C19A 3N4FA 3NL3A 3T0DA 4EPKA 4UTTA 4CU6A 3MJMA 4M29A 3PB0A 1V02A 4WHBA 1W31A 1P4CA 3GUWA 3BLDA 3OGSA 5I3FA 4UOQA 5F2GA 1WA3A 2QAFA 1JIBA 3VFLA 1PIFA 4HJWA 4LV4A 1B3WA 2H9AB 1GVFA 2D0HA 2WW5A 4ZE5A 3OYXA 3OW1A 2OEJA 3TTSA 4Z2LA 3IGHX 3SGGA 4A35A 3LGGA 4MKVA 2R1MA 2B7PA 4AEEA 1RLDA 1YYAA 3NO5A 2QQ6A 1FCQA 1JRBA 4J3UA 4QCFA 1TPUA 1VFHA 2CYGA 4JNZA 2IPWA 1CZ1A 1MEWA 2WMIA 2YL8A 1JYXA 4V27A 3I6RA 3PAJA 1K7EA 1E1CA 2BVYA 3RGTA 3K46A 1DKWA 1A5UA 5E93A 3FS2A 4IP7A 1Q6QA 1T99A 1Q45A 3MV01 2PDUA 4GCXA 1JR1A 1R9XA 4AD3A 2JBMA 1DJNA 2FTWA 4WJ8A 2BXYA 3N17A 3C0SA 1RY8A 2J62A 3DN5A 2W62A 2E28A 2DZAA 3WF2A 4TX8A 3LSBA 3V4BA 1QPKA 4NNAA 1VFFA 1AW2A 1VZWA 3TYCA 4XAFA 1JZ5A 3TXZA 3SDOA 3TE9A 2OSWA 4JGDA 2IXUA 5G2HA 1DWIM 1OC7A 4OJYA 4WY0A 1ME7A 1YE6A 3A6OA 5I3KA 1TCDA 3I7SA 3GZ3A 2IMRA 1XI3A 3BLEA 3LENA 2ZZ3A 3ZT5A 3IUDA 4MJZA 3DFPA 4FMVA 1OFAA 3TWAA 2A3EA 3OTRA 2E8YA 2DVUA 4L4LA 4L9ZA 2CU0A 4GI8A 4IFOA 4IJCA 4G1KA 4GO8A 4F2UA 3LPPA 2Q3OA 1QOXA 4N4QA 4X22A 3VNYA 3OLGA 3MDUA 1RBLA 1FDYA 4W8LA 1XH2A 2YA2A 2YDSA 2C18A 3VK5A 1KB3A 2B31A 1W5QA 5M3WA 1S5NA 2CNCA 4ALDA 5EMYA 1QNQA 3AALA 4L4MA 1DIKA 3MTWA 1GYLA 3BAIA 4ZOAA 1NY1A 3RU8X 2CBIA 2WJZA 1MFVA 3AXXA 4JTHA 3BANA 2WWDA 2GVLA 2DIKA 2V63A 3VIGA 1FKWA 3G18A 5XINA 3MO4A 3QY6A 1ZPTA 1IE7C 2WANA 3KBVA 4CD7A 5FF3A 2FB2A 2ZZ2A 1JCJA 1A47A 3AWOA 7REQA 3ALFA 1XG3A 1G4EA 2VC5A 2FH8A 2CC0A 1UYQA 4ZQMA 2C8NA 2UBPC 5AB3A 3C56A 3ME3A 1B4KA 3FA3A 1YX1A 2OMAA 1R2RA 4PMOA 4U3CA 5JMUA 3S4TA 4GUJA 1NQKA 3QHMA 2WM1A 3L67A 3NOEA 3AMDA 1SO6A 4PMVA 3UR2A 1Q6DA 3WLOA 4WKHA 1VF8A 3AIBA 3SRKA 1WB0A 3GZAA 4LBRA 3VE9A 5I09A 5CCZA 4MUPA 4S3FA 5JIWA 1RV8A 2QJJA 3SB0A 4HMEA 5I07A 1GTEA 2I56A 3P2VA 3VNIA 5AYBA 3B0PA 2W27A 2QMJA 2VX5A 4IPLA 3FCPA 4JNYA 2PWHA 1XYLA 5HULA 1XJBA 2NWRA 3RM4A 4NY2A 3O15A 3AIVA 3TJLA 4Q8VA 3BW3A 1I2PA 3HN3A 4JZ5A 2NUXA 3LPGA 6XIMA 1AA1B 4O4WA 2YCLB 4JR5A 3CZJA 3UETA 1KA9F 1EUAA 1YBQB 4GO9A 4MYXA 5C55A 3A5VA 3BJTA 5HINA 4IG2B 4QAWA 3WQ8A 1UQZA 3WQPA 3GU9A 1CX9A 4Y2WA 1JXKA 3SO7A 2JEQA 4URIA 5EKYA 1R7AA 4DM2A 3FGCB 3OLDA 3AHXA 4W88A 2O92A 2E3ZA 1KGXA 4E8DA 3FLUA 3PZNA 4K36A 5AVNA 1DQWA 2WLZA 3TFXA 1O5KA 3DYMA 3UGRA 5G4EA 5EB8A 3CEPA 3DHFA 3CUGA 1I2QA 4MKNA 4DB7A 5CAHA 3U6WA 3KS6A 5BWAA 3LZ5A 1P7TA 2CHOA 4BQ4A 3OPSA 2Z25A 3HOJA 1EKOA 4LGXA 4HD5A 1DE6A 4NZ1A 2J4GA 4ZODA 3E02A 5K4ZA 4R7JA 3CS2A 3ITTA 2Q09A 4ACZB 1K7XA 1UC4A 2WVVB 2P53A 4I6KA 2QV4A 1YTDA 2PDCA 2PZ0A 2VRQA 3TU9A 4F2TA 2A7PA 1Q6OA 1M7OA 3EWYA 3WEMA 1BG9A 3CL8A 2O9PA 1JCMP 5AC4A 4Y8EA 1H5YA 1DP0A 1ZJBA 1U1JA 2EJ1A 4BQ5A 1JD9A 2VELA 3GC5A 2ACQA 1S5VA 2ZXDA 1OABA 4GNKB 1SZEA 2R1LA 4IF2A 3NCOA 4YJ5A 1C8YA 3VIHA 2I14A 4QEHA 3O6YX 1VBGA 3H55A 3ZWSA 4X9SA 3W24A 3NEVA 5A94A 4HMNA 1NFBA 4KFNA 5FI8A 1F05A 4KGLA 4A8LA 3GTIA 1YNQA 4AZGA 2ZA3A 2ZIDA 4LB4A 1BAGA 5DY3A 4W7WA 5FSEC 4ZGYA 3FJ4A 5FAJA 2QEZA 1UROA 3BLKA 3ITXA 3CO8A 4IL2A 2OQHA 2JFEX 3LM7A 2FLIA 2VFHA 1XG4A 2BG5A 1FWCC 4XSLA 2DZTA 3TJIA 2ZZ6A 3T9PA 2FB3A 3WLRA 3STEA 3OVGA 4P61A 4H8NA 3B8WA 3QFEA 4GQ0A 2ZTJA 1H50A 3UD6A 2X1RA 3SCUA 1K02A 1QMLA 4E2BA 1QASA 3BLLA 3NQ7A 1E3XA 1BWVA 1V3MA 5EMLA 1KW1A 2PDFA 4JN8A 3D46A 3TIMA 2XVPA 2GSEA 1OF6A 4F0RA 5DMNA 2ZRWA 3W1XA 1KTNA 1Q6GA 2ISSA 4GBUA 4DUVA 4P7QA 4F0SA 1Y5WA 4FA3A 1FDZA 2G95A 3E38A 1RVKA 2ISFA 3MHGA 5LXEA 1H61A 1ZJIA 3S3GA 4ENLA 3VD9A 2D20A 4MOZA 4KW2A 1E1FA 2TODA 1V3HA 2QUMA 4ML9A 1E4IA 1TV2A 4OFCA 4QG8A 4UTLA 1YNPA 3WSUA 3H23A 3N13A 1EJSC 1AMKA 2G3IA 1XKYA 1KBKA 4QBXA 1RP8A 1DJIA 4MNJA 5JU6A 2PCEA 4BF7A 3N04A 4WDWA 1Z41A 4O16A 1NDZA 2OVLA 1J10A 5D9PA 1S5TA 2Y7FA 2DSVA 4CD6A 4MJ2A 3USZA 1DBTA 3JU2A 3ZLHA 4BKNA 1ISXA 2YDQA 1W37A 3AXMA 3UERA 4LRTA 3ZR5A 4UCGA 1P0KA 3WF4A 4TTUA 3NIYA 1V03A 1KM5A 2FFIA 1OWQA 1KM1A 3CL7A 3LRMA 1X7FA 3IJ6A 3U4AA 2VCBA 5FOOA 2QUUA 3IS4A 3AS2A 1TVPA 2C79A 2Z1VA 1CGYA 3OU8A 2XIJA 3LHVA 3FGCA 1ZHAA 1QPRA 3VDBA 1LOQA 4GIYA 4G1NA 1A5AA 5CPLA 4NSBA 5I3DA 4GX8A 2FGZA 1HVQA 4OOZA 3BLPX 4GBDA 2ACUA 4JYFA 1UKSA 4PL1A 2EF9A 2YLLA 2BWGA 4NJGA 3WUEA 4O54A 5AC5A 3GH5A 2P0IA 4JTTA 2WAGA 3VDCA 4ZVJA 2WNQA 3I10A 1QW9A 3FAXA 3NL5A 2GVJA 4PUKA 1VFMA 3BOLA 1OX6A 1YHTA 3LXCA 2BXVA 2RKXA 3R2GA 4YWIA 4O1CA 4V1YA 2BY2A 1EZWA 1UH2A 4MDOA 4GE8A 4TMCA 3CTLA 4H8UA 1W1B1 5F2LA 2X41A 3QW4B 3URNA 4ZFCA 3CTTA 5CG7A 4MPKA 1WO2A 3CB8A 1UUQA 3DG7A 4LUSA 3RX3A 2GWNA 1TPFA 3WMCA 4UQAA 1K70A 1GPWA 4RPPA 1UR2A 3LCFA 5A3HA 2E6DA 4J3ZA 3NWRA 2OTDA 4B5SA 4OWGA 3KE0A 5DCBA 1B2YA 4H8HA 3OGVA 3QR3A 2YGYA 3B4YA 4NAEA 3U48A 3CH9A 3STPA 4M6PA 1J0HA 1B5TA 1HL8A 4NIRA 2R9RA 3GAYA 4WGHA 1J6OA 4K68A 4PUMA 1JPIA 1UJPA 5J04A 1V0KA 1GOKA 4PCNA 3THCA 2CPUA 3IIXA 3RDKA 4L64A 5BYWA 1OC5A 3FN9A 3CZ8A 1UB3A 5K9XA 2VO5A 4O1AA 2VEIA 1Q4NX 1AMYA 3VKDA 1VBRA 1JZ4A 1F4AA 3E6EA 5D9NA 4J9JA 4ZTXA 1S2VA 2PGFA 3LV6A 4DUWA 3K30A 1E1CB 2OWXA 3ES8A 4QCEA 1LLWA 1NF7A 3EWDA 1EP1A 2QDGA 4XVEA 1S3TC 4H9TA 3W1UA 3PBVA 3KWXA 5GNZA 3P7YA 1QHZA 2Y5JA 1SU5A 1VBUA 5BOOA 3UJEA 2NXGA 1JEZA 5JH1A 3CHDA 3TW6A 3L12A 4BS0A 4FALA 1MO0A 3DFQA 2V67A 4NZ4A 1GHSA 4FSAA 3KOXA 2HPIA 2OPJA 3E0FA 4GUIA 4AZCB 3TN4A 3WQEA 3UR5A 1W2VA 4KCTA 2BFGA 3G1SA 1G4TA 4ZO9A 2D2OA 2WMHA 3G8RA 4EXQA 1EC9A 1I0BA 4AXNA 1BYAA 2PLCA 1JPHA 3F4NA 1XLFA 4W9TA 2OG9A 2J79A 3GLCA 1YPFA 3VNZA 3GHRA 1ADSA 1HO4A 3DG6A 1CGWA 1O1HA 1HKMA 1V0LA 4S3EA 2RHGA 2PODA 2WMJA 2BXZA 3DECA 3S6DA 4YVXA 1OGSA 3BVJA 4IJBA 4TO8A 1G6CA 3VIIA 3NUKA 4DJEA 3S2NA 3BV4A 3QMRA 3NQCA 1WKDA 2J8GA 4Y9MA 2F9RA 2BV9A 4ONVA 4RE2A 1KQZA 4EPDC 4XBJA 1RPXA 1WKFA 1UD2A 3O1NA 1UKQA 8XIAA 3KDOA 4CU8A 1GEQA 1BQGA 3GNOA 4IP5A 4DUXA 4IIFA 1DIEA 1UH3A 3R1ZA 5KINA 2VR2A 4JAWA 2HK1A 1D3HA 3FOKA 4R33A 2PA6A 2OX4A 1LQAA 4AAJA 4XB3A 4C90A 1XIEA 1X6LA 3SAZA 3IPWA 4A3YA 1R3RA 1PL9A 1D8WA 1YDVA 3NDOA 4CN6A 3NVDA 1JVNA 3I3DA 1I2NA 3THDA 4AD5A 3KVJA 3QW3A 3VO0A 4MLJA 2WZHA 3OA3A 2VJXA 1E73M 1D2KA 4UQCA 1RBOB 2H6RA 3V35A 2ZRXA 3WK0A 3GNPA 4XZLX 3IAPA 2P10A 3N1AA 2EG7A 3CV7A 5HWMA 1EEPA 2VGGA 2WVSA 3M0LA 3A3HA 3WLPA 3CK5A 2DV0A 1TJ2A 2YDRA 1RR2A 1VFOA 3AMLA 1XLEA 3HGJA 5F4SA 1W56A 1DXEA 1ECQA 2XPKA 4LV9A 1GQJA 1RD5A 3GTXA 1P0EA 3MSGA 2XIIA 5HOSA 5E6YA 4DAFA 1POKA 1SO5A 3V5CA 3KP0A 2YYUA 4KEVA 4JDBA 3Q67A 4JFVA 1A5BA 1WUEA 1XLMA 1QXLA 3L2LA 1TYGA 3LCGA 4UTHA 4DXVA 4J27A 3FHAA 3GBDA 5D4YA 3MHUA 1MW2A 4IPJA 3P93A 3M4HA 2ATMA 1XRSA 3AIWA 4F4RA 5D2TA 1CXEA 3DFOA 3PSVA 1H7PA 4N0RA 1ONRA 1UZDA 2WJEA 1FFRA 3TVAA 4RV8A 1WDRA 3E0LA 1MUWA 3SUUA 3HU7A 3NFUA 2HS6A 1GPFA 1RALA 2VC7A 1G7VA 4M19A 3WG6A 3S5NA 1ZTVA 3BGGA 3ARZA 3ITCA 2PWVA 2EPNA 6PTDA 2EPMX 1H62A 4JCLA 1W8SA 1VEOA 1J01A 4DY1A 3C2RA 4MG4A 1G5AA 2R1KA 2Z1KA 4ZBCA 1AQMA 2OSXA 4HA1A 3RU6A 1H7RA 2EGZA 3RPTA 1BKHA 1CYGA 2QCMA 3CUIA 3IAQA 5E09A 3W2NA 3NQVA 3UGVA 2GZXA 2G4JA 4FF5A 2AOSA 2EKGA 4PULA 1FWFC 1H63A 1PUDA 3O7UA 1F6KA 4OVXA 3FEQA 5BCAA 3WK3A 3N6HA 1D7FA 2VFDA 1MNZA 2GVGA 4WVXA 1RQBA 4K8EA 3S2LA 3TYBA 4JX5A 3MV11 1PEZA 2WVUA 4KEMA 1ELSA 1ZSXA 1YTKA 3OZMA 2PLMA 3TKFA 1WUFA 1KCLA 1MXSA 1FCUA 2WJDA 2P5NA 4XO7A 4IPNB 3TMQA 1WOAA 1VENA 4F3HA 5C7VA 1OSEA 4BI5A 2VFEA 3M0HA 1TA3A 4CN1A 2BSLA 1BG4A 3KRZA 2CLOA 1EJVC 3V1HA 2ZX7A 3C8FA 2IXVA 3QHNA 1XCFA 3V3WA 5DEZA 4G7EA 2GJRA 3MP4A 5A6KA 4FO4A 2PAJA 2VRKA 4BQ3A 4ZQRA 4LAZA 1ML1A 1KM3A 5DXYA 4WOQA 3TYZA 1OX4B 1QWGA 3LLDA 4DI9A 3H4GA 2GPTA 4A2RA 4XD3A 2YBTA 1MDLA 4LS2A 1WDSA 1B3YA 3BH4A 3VYLA 4GUGA 1JCTA 3VMNA 5D9MA 1I60A 2WVTA 3C2EA 3FDGA 3GY1A 2F7FA 5KZ6A 3T05A 4J40A 1QBBA 1DWFM 1GZGA 1VEMA 1FWBC 2V8ZA 3W74A 4INFA 2UY3A 3C2OA 2WWCA 1TPC1 3BO9A 2CLLA 2EQDA 4ACYA 1UIOA 4JTJA 5AYXA 4KQNA 4A3HA 3PJTA 4BF5A 3PP7A 3PB2A 2QDHA 4F2BA 1F6PA 5AHMA 1DIDA 2OZ8A 1H0IA 1TTJA 1CGVA 4L80A 1SJAA 2ZX9A 3GFXA 4AHOA 1EHAA 4QG9A 2WMKA 2ZQ0A 2Z1BA 2ZRYA 2PU1A 2XHYA 1XS2A 4HCHA 1XSIA 4JTFA 2P1FA 4MAZA 3S0CA 1GW9A 2ON3A 5D32A 5CPNA 1PZ3A 1X39A 2ACSA 4Z0JA 3ARYA 3ITVA 4NRRA 5EMMA 4N9BA 3TQPA 5BW6A 1OCBA 1TVNA 4MFEA 3TJ4A 3G1DA 3ZO9A 2DVTA 3SCOA 4PBGA 1BGGA 4WY0F 1B9ZA 4A22A 4FR1A 1E1EA 4GZIA 1KFJA 5JBEA 1RK5A 3NDYA 3ABXA 3WEOA 3I6EA 4Q8OA 3SRHA 3TUUA 3W2JA 3PZTA 4JFTA 2PDMA 1E6XM 2AGKA 4Y8FA 1Q6RA 4LYPA 1C8VA 1F6YA 3EWUA 3H53A 2OQLA 2J9ZA 1MI3A 4FB7A 2E5DA 1OM0A 3EA3A 5K3VA 3GTFA 2WKGA 4Q33A 3KL5A 1MQRA 4HHPA 4HB7A 1BYCA 4K7VA 4K37A 5CZTA 4HOZA 5CC3A 5GJNA 2D22A 4B2DA 3S5SA 2YFNA 4D8AA 5EL1A 4FX8A 3I6TA 5D2YA 1DJXA 5JVLA 2ZADA 1B30A 4MGGA 3W02A 1YIXA 4M3PA 4P7RA 1RP9A 1F74A 2F84A 1T8QA 4JTLA 1WKEA 4I9JA 2G50A 1KM0A 3IIPA 1I2OA 4P7LA 2J7DA 3GFYA 2J6VA 3DAQA 1R86A 4W84A 4AFYA 3MU7A 3AISA 5U4NA 4DIAA 1Q6EA 3BSHA 4KWSA 3M0XA 5ABHA 3FX4A 1OCQA 2YCKX 4OE7A 3U8GA 4PB4A 3MP5A 6A3HA 3DFHA 1W5OA 1MZRA 5K9CA 5FAGA 2DZPA 1Q2RA 2XIMA 4AZIA 1VP5A 8A3HA 5H8UA 3NOYA 4HKPA 4L5ZA 3VINA 5BRQA 4RXFA 1Z9AA 2NSXA 3QEZA 4DLFA 5FEPA 3OVRA 2WMFA 7A3HA 4DJFD 5TBOA 4NAEB 5A8GA 4GOAA 1Q6FA 1LT7A 2GSHA 5BRBA 5AYZA 4W7VA 4LSBA 1P1XA 1OT2A 3IJLA 1AW1A 3OP2A 4NJKA 2WB5A 4RNIA 1Q4WA 1XIMA 4BEQA 2XN2A 3IJ8A 3I65A 2XGBA 1QW8A 3KOFA 3B0VC 5H1WA 1UWRA 4XSMA 5FJPA 2YDAA 3QKEA 3WH8A 3IACA 2BVTA 5L9FA 1FFQA 2QF7A 4RX0A 3ECQA 4XBKA 1WDQA 2PTXA 4JQ4A 4G5DA 4KFOA 2GJNA 1NH6A 2EO7A 2Z26A 3GC2A 2Z2BA 4P7OA 2QCGA 2WHJA 1J0YA 1XIDA 5DLCA 1KR0A 3CWOX 2C13A 4JTKA 3S42A 3NPWA 4XBSA 3TCSA 2V38A 2E68A 3MP3A 3V75A 3C52A 2ZUMA 1C8XA 3E49A 3B9AA 3W88A 4D9PA 4MB4A 4M24A 2Z24A 3FYYA 3W7JA 2YXOA 4DNMA 3N4AA 3E2VA 4LW7A 3P81A 3U9IA 1XINA 1BSLA 1N2VA 2XFWA 4JTSA 2OLAA 4FXSA 2AMGA 4IMAA 3L5MA 4UR7A 4DBDA 5CQ1A 1YRRA 3FXGA 5I5RA 2V5JA 3AU2A 1L9WA 3BGAA 4HOWA 1DWHM 4BEUA 2E0PA 5BOFA 4Z2GA 5EMUA 1XLBA 3ARXA 2QCFA 5JBDA 3PUGA 5HXMA 4LVAA 5TD4A 1JFHA 4AF0A 4PCTA 3GR8A 4F8XA 3UR8A 4M8UA 3ORWA 4NZ3A 3H21A 3UPWA 5HNUA 4H04A 4D8ZA 4B5UA 1KO0A 2A85A 3NGFA 1OYAA 3TH6A 2BZNA 4E0CA 3LI1A 1FP9A 2V82A 3P6LA 1HKJA 3A22A 3TK7A 2Y4SA 2QCDB 3GHSA 4EANA 1QJWA 1JDDA 1NIUA 3W70A 3NO1A 2ZRVA 3UY7A 1A0EA 3TMLA 3LOTA 3R0KA 1LT8A 2REQA 3GIQA 1TE1A 3PUEA 2I17A 1OJXA 1NWUA 2VOMA 2B4GA 5A5WA 2JF6A 3BARA 2VQTA 2P0OA 1LJYA 4DJDC 4XWUA 3EMZA 3HMCA 3QPEA 1GVRA 1O66A 1OZMA 3RJYA 3E96A 3WDRA 4Z08A 3C4UA 1T7LA 3BQ5A 1TZ9A 4HYWA 3NQBA 1KRCC 3V18A 1GOQA 3CQ0A 1NFPA 3G5EA 2QPSA 4UTUA 3N2MA 2R24A 4B3LA 4X63A 3PBUA 4KRUA 5B80A 2CHNA 4Z2KA 1OFBA 4YHGA 1KRAC 4HSNA 3M64A 4H1ZA 1UR4A 3EKLA 3E74A 3CAKA 1DHKA 1WPCA 3TONA 2NQHA 3GB6A 1PHWA 1LUCA 3L4XA 4R88A 4EPBC 1UKOA 1UA7A 3SN0A 3HG5A 2A4AA 3LQLA 2ZXQA 1M53A 3H12A 1NU5A 1SW3A 3O3RA 5BXTA 5FJOA 1GK8A 4H00A 4QIUA 4CNPA 1OEPA 2R94A 4Y7EA 1EIXA 2DT3A 4YL2A 1EF2A 3DENA 4W86A 4O0ZA 5C9WA 4Q6XA 3WZ0E 5I78A 1GYMA 2BGSA 3SUTA 4IT1A 4PTNA 1RK6A 3PS7A 4HGXA 3RM8A 2J7BA 2VDIA 4B15A 1XBZA 3LI0A 2Y1HA 2VZSA 3HPAA 3UJFA 1UUOA 4K1GA 4WQ6A 7CGTA 1Z6KA 3V0UA 3ZJ8A 5BMWA 4X61A 3W53A 4IMGA 1T40A 4PN2A 1BRLA 4Z1DA 3LX9A 3KL0A 3DYPA 4ZE4A 5H6HA 1H41A 3TN6A 4NUWA 1XXXA 3KBSA 3OZOA 4A6GA 5D30A 1LTDA 2WHLA 3WQWA 3BMVA 1G94A 1KKRA 1M7PA 2PC4A 3K8LA 4HT3A 1UMYA 4MAVA 3BJSA 4HNOA 2XIQA 3NL6A 1XYCA 2ZE0A 3ZR6A 2GDUA 1W91A 3NAVA 3OODA 3RCYA 1G9HA 1MW0A 4GI9A 3UCDA 5BROA 4J4KA 1SR0A 1T96A 1Q2SA 1ISVA 2I5QA 1EBGA 1U83A 4PGLA 4H19A 1Z8AA 3CGTA 5GNYA 1E4LA 4PODA 4WCJA 3VM5A 1J5TA 1KV8A 3T1GA 3SIZA 5CXPA 5JIPA 1LRTA 3VMPA 4O8AA 3FKKA 2KX9A 4HNUA 3T0CA 5LIKX 3WLNA 2XISA 2W66A 4U33A 5FJIA 3GW0A 2CFFA 3DBNA 4J3WA 4E2DA 1E9ZB 1A5SA 4RDVA 4QM1A 2AAMA 2OSYA 5G1MA 2CLEA 4YTTA 1OK6A 5E70A 2YXGA 3U4FA 4RE3A 4HA0A 1GTHA 3AJXA 1KD0A 1W54A 2EEXA 3TDFA 1NOFA 4HNCA 4GHRA 1GCYA 4Q4OA 4QROA 3VGGA 3NZQA 1A50A 1OFEA 3MSDA 2YR1A 2WLYA 3QGVA 1L6YA 1O5QA 3N12A 4I9TA 2YX0A 4ATDA 2DSUA 3ARSA 3A3XA 2R91A 5T9CE 3BZJA 4AIBA 4AEOA 1EL3A 4IMFA 5K2ZA 3KBNA 1LL6A 5HNRA 3AUJA 1GG0A 2JQXA 3M0IA 3QRHA 4ASTA 5FJUA 2VYOA 1IZJA 2DIEA 3WJSA 2OU4A 4AX6A 1WQ5A 3OG3A 1EHNA 2OKOA 2PDQA 1Z3NA 4E2VA 3WD2A 4N4PA 2BY3A 3CZKA 2A1YA 2I5GA 4XZWA 5CZ0A 2DDXA 2Z27A 4O1BA 2NX1A 2VP8A 4O11A 3UJSA 3VFCA 1JZ8A 3PNUA 3CQKA 2VDGA 4Q8MA 3H22A 1UG6A 3OIHA 3BZGA 3W1MA 4WX2A 4DF1A 3M5YA 3L4TA 1PBGA 1H7XA 4XZIA 1TTPA 3SR7A 2ZA2A 3NSXA 2CZDA 4GPNA 5LZLA 4WSKA 5ECUA 4F0HA 4W93A 5I3IA 4OHQA 3W7QA 3WDIA 4DO7A 4I90A 5HQMA 3KZPA 4F9DA 5H2ZA 3VIKA 3EYPA 1XIBA 3FHQA 3LCLA 1QVBA 4I8DA 2E6YA 1VQTA 3JRKA 1R3WA 4OZOA 2RGLA 4KIEA 3H2NA 3MMWA 3B05A 3GG7A 4IPIA 3TW7A 4Z1BA 1AQHA 3ABSA 3FJLA 1WOBA 3P5YA 1HP5A 1PVNA 5HANA 1KLYA 4GUFA 4XTDA 2G0WA 1Q65A 3W81A 3IWPA 4GFIA 3M0VA 3BL3A 3ARVA 4UTTC 3WNOA 2PWUA 3P0WA 3MVIA 2XWEA 4AZBA 3LGEA 1WV2A 3P8JA 1ITUA 1VJZA 2WZIA 3KTXA 4RE4A 7TIMA 5HNTA 1F4HA 1TVLA 3MI2A 1JNDA 2ZZ5A 2IPGA 1ISYA 2HISA 4GY1A 4UTMA 4IOTA 4KH2A 1QATA 3L0GA 1G0CA 3AC0A 1TKKA 3GXFA 4CQDA 2HBXA 4HTYA 3XISA 2CLIA 4MIMA 2BODX 4LY4A 4AY8A 3DFYA 3EWCA 1PXGA 5HJYA 2XWDA 3FJ6A 3IVSA 5I00A 1XCWA 3W73A 4JKLA 2O7QA 1TWIA 3HBLA 1VFUA 3AWNA 2WQDA 4F40A 1UR8A 2E6FA 2Z1XA 3WQOA 4D6EA 2QDDA 4P8VA 3A4XA 2D0FA 4PBEA 3BW2A 2Q3RA 2FJUB 2V2DA 2WPGA 1N55A 2BHUA 3GVQA 2CZVA 1UWQA 2E9LA 1N8IA 3F7JA 5TAOA 4YVVA 1QPOA 3UG4A 1G4PA 4DYEA 1F3TA 3VNMA 3PWIA 1R3YA 1S3HA 1MZHA 2G8ZA 3KAOA 3AUOA 1NJJA 5REQA 2D3NA 2BVWA 4FI4A 4UTJA 3PZGA 1TIWA 3AZTA 3PPCA 3CIVA 3WO8A 3HGOA 3GR7A 1DTNA 1GVQA 4FNSA 3ITYA 4NF7A 2NX9A 2Y89A 3RCMA 3APGA 4DPQA 2ALDA 1XDJA 3DI0A 1UW9A 4XAGA 4OTKA 3AHZA 3GK0A 2XM1A 2V3FA 2PDNA 3Q45A 4PRWA 1F3WA 1B0IA 2VVNA 3N2CA 1XYAA 1R3QA 3T40A 5DX7A 4DELA 3S5OA 3S47A 2BGQA 3DXIA 4UMBA 2PDJA 3ZXWA 1O5RA 1F3XA 1UPPA 3O07A 3XINA 2PDGA 1X8CA 1A0DA 2YL6A 1QOPA 3TSDA 4CEUC 1HL9A 3PZOA 1KXVA 3ATZA 3HA1A 3CPRA 2GK1A 2W91A 4LS0A 5HBFA 4DLMA 1JDCA 4AVFA 3GXNA 4JEJA 4D6CA 4F48A 2QJMA 2X30A 2VCCA 1U5HA 3L9CA 1M68A 2QCLA 4JICA 2GVYA 1MRQA 3LTPA 1EO5A 1UIPA 2DU2A 4E38A 4LAUA 1US0A 1HJXA 1EA0A 1TA3B 1HJUA 2GGGA 2PDBA 1GGOA 1JI2A 5CGMA 3L21A 3N3TA 3BDKA 1EOMA 1E4MM 3QKZA 3IV8A 3O6AA 2QCEA 4XKMA 2IW0A 3TOPA 2XGZA 4FNRA 3UXAA 4F0LA 4HPHA 4GLEA 2IKGA 2NSOA 1R46A 1UH4A 2OGJA 3C5QA 1UD4A 1PZ2A 1TRIA 1R2TA 3WQFA 2WBGA 3EB2A 3BCJA 3PPGA 2A3AA 3Q58A 4XIMA 3SJ3A 2NZLA 4ZQCA 4P8XA 3B0UX 2XYLA 3SIMA 3W27A 1B4EA 3G6LA 3WDHA 4NHVA 2ZE3A 1W0MA 3WNMA 4ZCWA 3AQUA 4R7WA 2FVKA 4ADTA 2IQ0A 1POJA 4ICMA 3QLLA 2A3HA 1E5JA 1K8CA 3T2QA 3C3UA 3AZRA 3DKJA 4CQCA 5E0CA 2BB0A 2DT0A 3DGRA 4US5D 2DSKA 4LBSA 3G2GA 1TMLA 3AXIA 3UY8A 2FH6A 1HL2A 3ID7A 5AYYA 4O17A 1C7TA 1YADA 2ZKMX 3SUVA 3DOPA 4CCDA 1VHNA 2NXIA 1LG1A 2BLEA 1RZMA 4FAMA 1JD7A 3RCNA 2HDJA 1NARA 3LRLA 3TC7A 5IXEA 5AHFA 1EP3A 2J27A 3QYQA 1FHVA 1A4LA 1A3HA 3DHUA 4A3RA 1OVDA 2PWDA 4BR1A 4JFWA 4RXGA 2YL9A 2GK1B 3M6DA 1KFWA 4IGSA 3GW3A 2PDYA 2FZMA 1IQ8A 3F4VA 4HA4A 1CB2A 1SMDA 1J79A 3WX7A 4O28A 1E6PA 4L4PA 1KRBC 1RQHA 1GKRA 5CPMA 1G4SA 4AHPA 3ANYA 4PMRA 3VM7A 3WLIA 4DZHA 5M5DA 1GVEA 4DO4A 3WBEA 3GVGA 3CHCA 1JCNA 2A0NA 3A9IA 4ZEPA 1F7BA 1W9VA 1UR0A 3CWNA 3SI9A 2VFGA 1K6WA 3UZWA 2VCAA 1QI0A 1SZFA 1VYRA 1BWLA 5I6SA 1CEOA 3W7CA 5C70A 2HXTA 5EU9A 1XD0A 2D1ZA 5HJXA 4H9ZA 3STGA 3OHMB 4XD5A 1XLDA 3C8NA 3P5ZA 4IIHA 1GNXA 1NQ6A 4LUIA 5AECA 5E6ZA 2OFJA 3AMGA 1MYRA 3EA2A 2POZA 1VEPA 4WF7A 3TC3A 1KFKA 4LYRA 1BD0A 2PDKA 3PK7A 1YPIA 4P7NA 5C9ZA 3VNJA 2PWGA 3R0DA 3VGFA 1M7JA 5CZSA 4OBTA 1TO3A 1VPYA 3QZEA 1TX0A 4IH3A 1PDZA 3UBPC 3RIKA 3EX6A 2A79A 1R47A 2C7FA 3EOUA 1OCNA 1C7SA 3WN6A 4WIWA 3EAUA 1UOZA 2Y61A 3R13A 3REQA 1I1XA 3SSZA 1IWBA 1JAEA 1DJZA 4GIEA 1YDOA 4JQ2A 2R6OA 2RDTA 1S1PA 3O6CA 5DCEA 4AZHA 1BXBA 3HMJG 4PSPA 4L4OA 4HZ6A 4B16A 1JJKA 2C16A 1TUFA 4BI6A 2L5HA 3LGDA 1XYZA 3W82A 5A6BA 2E40A 4KKXA 2VL4A 5AOUA 4I3GA 5M17A 4MUZA 4GMEA 2EPHA 1KFEA 4JY8A 3ISIX 3EMQA 4O1EA 1S2TA 3DERA 4O53A 3WMLA 3OA5A 4C1NB 1LQ2A 4ML4A 2VX7A 3MI3A 3K1DA 2TAAA 5C5YA 1UWIA 3OZYA 4HPXA 2ZXAA 1ZENA 4X9YA 4LNYA 3B0YA 3HG2A 4Q7IA 1P6BA 3JZEA 1JGMA 2W79A 4UTKA 2POTA 3UWEA 3B8SA 1GQNA 4GC3A 8RUCA 2PBGA 1UD5A 1RPKA 3MUCA 1RA5A 4U28A 2WSQA 4FS9A 2QCHA 1UOKA 1ZJHA 3FYPA 3RMJA 3OG2A 2GQAA 3IIZA 3LCIA 3W85A 3LN3A 1VCGA 1VRDA 2YBVA 1X7IA 3UR7A 4YCPA 1OYBA 1JUKA 1GJUA 2D2HA 3CIXA 1NDWA 1SSDA 3MZNA 3VZZA 4NYUA 4OBRA 4EOUA 2I16A 3B9NA 1VRXA 3KLKA 3DX5A 4MZYA 1WZKA 2GJPA 1CTNA 2VXNA 4GD0A 4LVBA 3GDMA 3TR9A 2HV5A 4LU0A 2NXHA 4DM1A 3N9RA 2FDMA 1YPXA 4AWTA 5HUPA 1UP3A 2O55A 3GXTA 3NM3A 3GG1A 2QLYA 1J9YA 3W1LA 1JCYA 4MWAD 1QNVA 4IHCA 2BBFA 1BTCA 3OLEA 1W1ZA 3GM8A 5CC6A 4TVDA 4O13A 3PG9A 3U5YA 1L6SA 3POCA 4YHEA 3A5FA 3LUTA 4NJHA 3VCRA 1WYIA 2QYGA 4HNLA 4UFHA 2XH0A 4GFSA 1V77A 4LCSA 2X16A 4FHAA 4A3QA 2CITA 1KXQA 5TNVA 1V02E 1HW6A 1TREA 1JPMA 3TSMA 3UG5A 3W0KA 3GX9A 2WKLA 1E71M 3KM8A 1UJQA 4Q4QA 3QQWA 2PC8A 3CUJA 2MANA 3U2OA 4LBUA 2WJFA 2DGAA 3SUWA 1R5YA 3LV5A 4ROQA 4Z0SA 1XC6A 5K7JA 3QZ6A 2DUZA 2GQ9A 3GAKA 4ZB2A 4H6EA 3MUY1 3EZ4A 4PB5A 3IJ9A 3OLIA 4E8CA 3B06A 4GQGA 3NZ1A 3IK2A 3TA6A 2TSYA 4DXKA 3PJUA 4O18A 1TWSA 4N7QA 2PF8A 1TSIA 1XPGA 4IG2A 3N6QA 2PE4A 2OCZA 1W3IA 3W7MA 1CXLA 2V5DA 3QSRA 4C1KA 3LK6A 4DBSA 3F03K 4JFUA 3GR4A 3BLFA 3KRSA 4GK8A 2FGBA 2Z2UA 3P14A 3BQ6A 2Y7EA 4WGXA 4TIMA 3OVPA 3E5BA 3UNDA 4FNUA 3RR4A 4UMAA 3NZPA 1J18A 1SUXA 2WMGA 2JKEA 4NZCA 3BW4A 3WQVA 2PMQA 3VD4A 2P50A 3IUHA 3MWCA 2OYLA 1TPEA 1K77A 3LSCA 5CBJA 4I5UA 3M46A 5EBAA 1S2WA 4AB4A 3VKJA 2PEVA 5DCDA 3PFRA 4PUWA 5LA0A 3PG8A 4NU7A 3ZJ7A 4LVFA 4XZHA 4M82A 3WEZA 3W7OA 1M03A 2V3EA 3BCDA 3YPIA 5HR6A 3VABA 2PP3A 5BMXA 2E25A 4DVOA 3T78A 3N29A 4LYKA 2RDXA 4REQA 4H6KA 5EY5A 1RHCA 3KXQA 3R4IA 2EG6A 5IHRA 3GTHA 2G3JA 2E6AA 5GQBA 3ARPA 2O4MA 4GZ7A 2ICSA 3SQLA 2WCSA 4GWEA 2VGFA 2NW0A 5KSWA 5C54A 5C2GA 2WV8A 3WH6A 4S23A 1J0ZA 4QTGA 4UXDA 3LEPA 3DC0A 1NWRA 1REQA 3R12A 3EWBX 4YS1A 3WLQA 1J2WA 3QVQA 5FJJA 3FSTA 3WUFA 4FIRA 3MI6A 3QV9A 4M6QA 2R8WA 3N2TA 1HIZA 1JCXA 3H6OA 2GLKA 2WNWA 2Y8UA 1OIMA 1EWEA 1ODUA 1JRCA 1XUZA 4YMZA 3RUBL 1RSCA 2VWSA 1SGJA 4ZENA 4ERGA 2J78A 5DY2A 1OD0A 2BNJA 3SCWA 1EUNA 4ZZ9A 3WH9A 3V36A 1S2UA 3LHUA 6REQB 3GIYA 1HKVA 2C71A 4UQ9A 1XV8A 3Q2DA 5LIUX 3MSYA 3PVFA 2Y88A 1FWTA 4MPQA 4YTSA 2MUCA 5CC7A 1BSIA 1LM1A 5BXRA 3W6LA 4QLKA 3TLQA 1LWHA 3CPUA 2FZNA 1TJ0A 1AQFA 2VD8A 2PDPA 3CV6A 1R9ZA 5I7GA 1WNOA 4Q4RA 3NQAA 4GKTA 3NQ6A 5IFTA 2ZTKA 1FHDA 1ZBCA 4XV0A 4MLRA 1XQKA 1A5KC 3O63A 4GQQA 5I2UA 4HU4A 4HA3A 4DI8A 4GRSA 3WLLA 4EVZA 4S3CA 1K1DA 2ALRA 4O50A 3OGRA 4JFSA 2WKJA 1VPXA 2DH2A 1XRFA 2X1TA 3MUZ1 4FK9A 4IIEA 2VTFA 4QLJA 1X97A 3V5FA 1XLGA 3DFNA 2OX1A 3S5YA 4UB9A 4TQTA 4E4FA 3N15A 2NT1A 4LWWA 1A5NC 4UZUA 1REQB 1YTEA 3GWQA 3VPLA 3UT0A 3WLSA 1R2SA