2E68A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e68A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e68A01
3W7OA 4R53A 3M1ZA 3W7CA 2WNZA 3RF9A 3S1WA 3LX9A 2VFDA 1G7UA 5HUPA 3MMTA 3DKJA 4OBTA 3TJLA 2HMCA 4DO6A 4QNWA 4RJEA 3BGGA 5E1QA 2PRLA 1P4CA 2X16A 1VCGA 1K7FA 3W7NA 3O16A 4JTHA 3GLCA 3IGUA 3I7RA 2F7FA 3MP4A 3NPXA 2DJLA 2VEMA 1TTPA 4FNSA 7TIMA 2J24A 3TAOA 3MWAA 4K6AA 3SSJA 3MI3A 5FF7A 2GQAA 1CI1A 5K7JA 3NL6A 2RDUA 1OX4A 1F7BA 3EWYA 4WY0F 3NVTA 5G2HA 4LY8A 1HTIA 3S5NA 4CNNA 3QW3A 2RH9A 2FPVA 3P67A 4UNKA 2QDHA 3LLDA 6TIMA 2Y85A 3UWUA 5D04C 4RLIA 2DJXA 3MYOA 2JKEA 1H1YA 3CQ0A 3WK2A 3LI0A 2I14A 3LRLA 1SO5A 3LTSA 1ZENA 3NYZA 4TMCA 1RQHA 2NUYA 2ZA2A 4ORMA 4TMBA 1SU5A 5FI8A 1D3GA 3VE9A 4XBSA 2EPHA 3O63A 2Z2UA 3P5YA 5D09A 4M5PA 5CG7A 3WK0A 1NSJA 3HOJA 3IIOA 4K36A 3GX9A 3W76A 3KX6A 5LHEA 3W3OA 3TQVA 2RFGA 3ZR4A 3JS3A 4HPXA 4EWND 3DBPA 2C18A 3LRKA 3PUOA 2O7SA 1H63A 2R8WA 3PUDA 3W1LA 1J5TA 1X8FA 3TXZA 4Z1CA 4N2YA 4X2RA 2NXIA 1I2NA 4BWLC 4IPJA 4PL1A 1LRTA 3TROA 4GE8A 1JR1A 4MKNA 1DOSA 1U83A 1W31A 1JUKA 2Y7EA 3T7VA 1I8JA 5MHBA 1L2UA 1QPOA 3NQ7A 1SZEA 1SW7A 3WJXA 1J4EA 3OA3A 1W5MA 1Q3NA 3SGZA 3CIXA 3NG3A 3ANYA 1H1ZA 3P60A 2XN1A 2V0TA 1L6SA 4MY9A 1OFDA 3DFOA 3IIXA 4DEFA 3CM4A 1M7PA 3A9IA 4IMDA 4EOUA 2B0MA 2WO5A 3LCGA 4E2DA 2Z1BA 4ALDA 2A1YA 1AK5A 3IGXA 3LB0A 1EWDA 1GJPA 4O14A 1W54A 2V2HA 4WUIA 3TV8A 3PB2A 1GVFA 5KTLA 5DBUA 3R12A 2D73A 5CPLA 1JCJA 3NL5A 3W7PA 2H3DA 2FJKA 1TREA 1LCOA 3STFA 3LCIA 3W74A 3PVFA 3L65A 2DORA 3CIWA 2ISSA 4O8RA 3PBYA 3STEA 1GVOA 4DQWA 1A50A 4MLJA 4K7YA 5DY2A 4Y6GA 3H54A 1EP3A 3LCFA 1SFLA 3GDTA 4JIQA 1S5VA 4OT7A 4OGZA 3M41A 4Z08A 3T44A 2CLKA 2QCEA 3FYPA 3MO7A 3PB0A 3FKRA 1EEPA 1NF7A 1FWRA 1TTIA 4AHQA 4FIQA 3W7QA 1VZWA 1KTCA 2E6YA 3TQ0A 4NX5A 2CLLA 3THQA 2ZZ7A 3P80A 3C56A 2DZSA 3ZWSA 1XL9A 4AXKA 4HSOA 4U4MA 4D2JA 2RDWA 5H91A 3QW4B 4HKPA 2WQPA 2QDGA 3TSDA 1DL3A 2Y7FA 3N73A 1JUEA 4KWVA 4O18A 4DPPA 3S1XA 4DELA 4K8EA 1V7YA 4N9EA 3OIXA 1H61A 1FDYA 2WOQA 3EXTA 3NPUA 4P61A 2QCCA 1Q6RA 3QYQA 5D38A 3QQ0A 2QAFA 4AVFA 3M9YA 1JCXA 1W5NA 1OX5A 4TO8A 5A8GA 1ME9A 1P1XA 1G4SA 5DY3A 4FNUA 2E6DA 2J88A 2OJPA 4O10A 5DBTA 1JRBA 1FCUA 4UMBA 5CZSA 1YLVA 4LVBA 2GPTA 2BXVA 4LT9A 3IIVA 1D3HA 3W2LA 1Z44A 2NZLA 3LLFA 3P7YA 3ABOA 3L9CA 1C9DA 3SFKA 2GVJA 3NPWA 5EL1A 3TSBA 5C6MA 1IXOA 3LBCA 3TNOA 2RHGA 5F4SA 1A53A 4JEQA 3EB2A 3NPVA 4FXRA 1LORA 4YMZA 2V81A 3W22A 2ZZ1A 1SZGA 2VELA 5DLCA 1F05A 2V30A 4JDBA 3W7LA 3G1FA 3KRSA 5TBOA 3S42A 1MSSA 5FF3A 3S1VA 3NAVA 4UTMA 2G95A 1XM3A 3MBDA 1T99A 2QJHA 3M47A 5CPNA 4A3UA 1PV8A 1FWWA 3GR8A 4RZ4A 3UXAA 2FDSA 4UFJA 3S5OA 2J9XA 3C6CA 4BF9A 3A22A 3H55A 5G1YA 4UTLA 3EKLA 5AHMA 2YYTA 1TJRA 3L5AA 1Q6OA 1YXCA 4NU7A 3PULA 5DXYA 3ATYA 1XUUA 3PUEA 3Q58A 1MEWA 4PL2A 2Y7DA 1BEUA 2QJIA 2H90A 3KRZA 5D05A 1SO4A 4IXHA 1SZFA 2EF9A 3LRMA 1YTDA 1T96A 3G1YA 4ZQRA 1WQ5A 3EEGA 4LRSA 3TKFA 2JK2A 3M5ZA 4TX9A 3R2GA 1FWNA 3GAYA 3GKFA 4FX6M 1T0OA 1TJPA 3F4NA 3E96A 3OVQA 4KWWA 1C29A 5T26A 1DJQA 4HNNA 3F1QA 3N34A 1R47A 1XBXA 4JYEA 1PL9A 3RK8A 3M44A 3QFEA 3O1NA 3BGJA 3W86A 1GEQA 1P5BA 5KZMA 1ICQA 1H7NA 2J6XA 4JTIA 5FESA 2W0UA 3P84A 3W88A 1VLIA 1BTMA 4OV9A 2ZA1A 4IMCA 3BW2A 3BLFA 3R13A 3GNDA 5G2WA 1GG0A 3OHIA 5G2IA 3W85A 5D2VA 3BW4A 1DJNA 5CPOA 1G4EA 4WXYA 1GYNA 1X6UA 1X7FA 4ZMGA 3C2RA 1KM4A 4NJHA 1Z42A 4JTEA 4UTUA 3DFNA 3UPWA 3W72A 2ZBTA 4MJZA 3SGUA 3MP3A 4WD0A 3BG5A 3STCA 4MYXA 3FJ6A 4A22A 3DZ1A 2X1RA 1FXPA 1FDJA 3WFAA 3W7EA 3KHJA 4JTFA 4O53A 1CW2A 3W70A 4QAIA 1OJXA 2YXGA 4C1KA 5FEWA 4IPIA 1PE1A 1HFBA 2X2GA 5D32A 1KFLA 2TRSA 4QM1A 4IMEA 4L4LA 4RCXA 4OQVA 1ICPA 4JN6A 2WSQA 5I3IA 5EY5A 3DENA 2XFWA 5CZJA 2H8ZA 1S5TA 4ADSA 3W7HA 1OABA 2OZ0A 5AHIA 2C0AA 3LCWA 3U6WA 3EXRA 2B4GA 1WBJA 3FFSA 4UCGA 5BOOA 4LV9A 3MBFA 4JYFA 4GXMA 4N9CA 1R2RA 1YDNA 4I7UA 1DKWA 3DGRA 2CLFA 3TK7A 5K4ZA 1L6YA 4Z0SA 4XTIA 1TPUA 4G1KA 3AJXA 2HTMA 1F76A 4LS1A 3IVTA 4JTKA 1YPIA 2JKPA 2QAPA 3IGSA 4IOTA 5AHLA 1FCQA 2QCHA 1T8XA 1I2OA 4FEZA 4LS0A 4DBDA 4O57A 2ZTJA 3I7QA 1P0KA 2YDAA 3KOFA 4UR8A 3SY5A 2H8XA 3CT7A 4JX4A 4M19A 3TSMA 4QITA 1HO4A 3QQ1A 4UR7A 3W1PA 3FKKA 1TTQA 2NX1A 2V8ZA 3PC0A 4AWUA 3B4UA 3DU0A 3HIJA 4ZQPA 4JTGA 4ZVJA 2VFGA 3GK0A 4JS3A 3TX9A 2C1HA 4M7TA 4FB7A 5HULA 3BPWA 3K30A 2B7OA 3WJWA 3TA6A 1ZAJA 2Q3OA 3RLUA 4O50A 5E93A 2A7RA 3DI1A 3N9RA 4PC8A 3W1QA 3SW6A 4KFPA 2PCQA 2VEPA 5D02A 4K39A 3GDKA 3NM1A 4O16A 5AFDA 2CLHA 4YL2A 1VR6A 1KTNA 1YXDA 3N2XA 5CZ0A 4POCA 1W1ZA 3HBLA 1LLWA 4O28A 3RMJA 1KM2A 2V5LA 4O1AA 4S2BA 2BWGA 2Z6JA 1MO0A 1GG1A 2WPBA 3E0IA 2V82A 4QSHA 4YCPA 3L67A 5D2XA 3KRUA 3G1VA 4AF0A 3TMQA 1KM5A 1OK6A 3S9YA 1K3UA 4NNCA 2E1DA 1LOLA 1YTKA 3MW7A 3HPXA 1H50A 3LHYA 2QUTA 4O13A 4X22A 3LDVA 4I7VA 3QSTA 4O17A 4CQ8A 4OU1A 1VJIA 1OFAA 1H62A 1ZJIA 3LTPA 4K7VA 3GR7A 2ZZ5A 3UY8A 1KM6A 3JR2A 1EB3A 1RVGA 3UWQA 5DCDA 4PEKA 4GWEA 1O60A 1Q6LA 2YFOA 3U8GA 4TIMA 1SW0A 4JIPA 4UFHA 2TYSA 2A7PA 1FXQA 4GUGA 1B4KA 1VS1A 3C61A 2ZZ6A 3GDRA 4FO4A 3UWVA 3N3MA 3N19B 1KM3A 1TTJA 3I7SA 2GQ9A 4FX7A 4IUOA 3STGA 4HPJA 5K9XA 1A5CA 3P74A 4Z1DA 1EPXA 2Y88A 3VE7A 1SQ7A 2UV8G 1KFCA 1EUNA 4O12A 1K02A 2NWRA 5L9FA 2Z0IA 1UJPA 2W79A 4WXZA 3TFCA 2YGYA 4LV4A 1R2TA 3TDFA 2TMDA 4UFIA 4EVZA 3G1XA 1K8XA 4FXSA 3L2IA 2H6RA 4AMAA 3EX4A 4ZQCA 1F73A 3PSVA 4GUIA 4YLWA 4NNBA 3S6DA 1MZHA 5IM51 3LTYA 1K8YA 3I6RA 3NZRA 4LVDA 3W23A 5EPDA 3L0GA 4MZ8A 3KVMA 3G18A 4GUHA 1KFKA 1JQVA 1X1OA 3V1PA 4IMFA 1ME8A 1TB3A 3W1MA 3NGJA 1NAL1 3SJ3A 3C2FA 1AG1O 2VFIA 5F2IA 2JBMA 3L68A 3KVJA 2TPSA 2ZDRA 2V2DA 3W2UA 1W0MA 1RZMA 1K8ZA 4A2RA 4S1FA 1TRIA 4PTNA 1H51A 4WY0A 4UTKA 1AW2A 4XUGA 3IEBA 1TO3A 1R2SA 5G4EA 1G4TA 3MHGA 2OT0A 3QPZA 4JICA 4ZQOA 1OX6A 3BG3A 2QCLA 2Y62A 1OX4B 4OV4A 1EA0A 5EMUA 1DBTA 1BWLA 3LCHA 3NA8A 3O6YX 1F2JA 3TAKA 5BMWA 2Q8LA 4TU1A 3O6CA 1X1ZA 1KTBA 4O15A 2GVGA 3OVPA 4R33A 1QCWA 3EWUA 1QO2A 3FIGA 5HWMA 4MY1A 1SPQA 4WZHA 1JULA 4RXFA 3ATZA 4IX2A 1QDSA 2E5BA 3VI2A 1EIXA 1GVQA 3DFSA 3B03A 1WDWA 4Y9AA 1FY6A 4GBUA 3EKZA 3GNNA 2VEKA 3IVSA 3MUXA 2YR1A 4DF0A 3NQDA 3LHTA 1K03A 2A2IA 3LHWA 3EX2A 4CCDA 2QCMA 4LC6A 1YTEA 5LHFA 2ZRZA 3RNDA 5EYWA 4TR9A 4E38A 2YW3A 2A5HA 3L0KA 3EX6A 5CGQA 2P0OA 2Y61A 1TRDA 1JJKA 2QJGA 4GUFA 3USBA 4UXDA 3MI2A 1U5JA 2HS8A 3DI0A 3HMJG 3LHZA 1PCWA 2DU2A 1M5WA 3R8RA 5DCBA 1QMLA 3EWXA 1JUBA 2V5BA 3F03K 3CWOX 3ABRA 4HNUA 2RDTA 1P0NA 3Q37A 1LRQA 5AHNA 5KITA 1FUYA 3CPRA 3SR7A 3W2KA 2EAWA 4BK9A 1G7VA 5I3GA 3LCLA 1FCVA 2QR6A 2WSRA 3TXVA 5LNUA 3A5VA 2YSWA 5L6UA 5HR6A 4K37A 4NVTA 5TQLA 1TPB1 3G0SA 2QCFA 3M0ZA 1A5SA 3PBWA 2NX3A 4A2SA 4FF7A 4NZFA 3Q2DA 1PHWA 2OX1A 3EX1A 5DELA 4LUJA 3HGRA 3BARA 3UZJA 1G69A 3LV6A 2GJLA 3G8EA 4KFNA 1IIGA 3W7KA 1HL2A 4DF2A 2E5DA 4ZL1A 2P1FA 4ONVA 5HWNA 3C0JA 3TC7A 5AC8A 2ALDA 3M43A 3BLEA 1FQ0A 4XQ6A 3IVUA 3W1AA 3VNDA 3DAQA 4NXKA 3O07A 1XI3A 4E2BA 3E12A 5KZDA 2YPIA 4WX2A 2GOUA 2E68A 3THAA 3G1SA 4NZJA 4CNOA 4UNLA 4UMCA 1M6JA 3NQEA 2J9YA 3V75A 5D2TA 1QR7A 1NFBA 1TPFA 1O94A 5C2XA 4AAJA 1WAUA 1VPXA 3C2EA 1E51A 4KKXA 4DO4A 1IXQA 3W71A 1QAPA 3TC6A 3S5ZA 2KZHA 3W1TA 4MOZA 1VYRA 3QMTA 1OHLA 4XWUA 1AMKA 1JRCA 1IXNA 2WNNA 3HO8A 1ZAHA 2X30A 5CZTA 3NOEA 4JTSA 3NQCA 3W75A 3NNTA 5I3JA 4R34A 2VFEA 2VXNA 4Y90A 3B0VC 3GZ3A 1N7KA 5KMYA 4N9BA 1EUAA 1GT8A 1ME7A 3DKLA 5H2ZA 1WOBA 4PFMA 1QPQA 1AL7A 1OVDA 2A21A 5F4XA 2NLIA 3FA5A 3NQMA 4PCFA 3P81A 3IIPA 3ABQA 1H7WA 3CC1A 4HNVA 2QUUA 3LXBA 2YW4A 2NV1A 3G0XA 3ABSA 5LNRA 4IMGA 3NQAA 1Q6QA 2EHHA 1W8SA 2CFFA 4LNYA 4R7JA 1H7OA 3ZFHA 1WOAA 1FBAA 4XKYA 3GB6A 1F6PA 2Y6ZA 3CTLA 3NR0A 2DZTA 4ZQNA 5AN7A 4JDYA 3PG8A 3R5EA 5HMSA 5J5DA 3I68A 3GXPA 1AW1A 1SR9A 1QOPA 3G0UA 2VFHA 4MLRA 3PSWA 4B5NA 4JTUA 4X9SA 5BMXA 3W1XA 1TMHA 1OYBA 1Q45A 3W7RA 3QC3A 4A29A 3PF3A 2E6FA 1EX5A 1WBHA 1VHCA 5FF0A 3HG2A 2FPYA 3VCRA 5BNKA 1W3IA 1VHNA 2ZA3A 1OF6A 2DZPA 3I65A 1BKSA 1M7OA 2WNQA 3FS2A 3VKJA 1VYSX 1C8VA 1XBVA 2CZEA 2ZRYA 1PCKA 3GVGA 3PG9A 3AO0A 4O52A 3EWBX 5I3KA 3NDOA 3LI1A 5AHEA 3DH7A 5LKYA 3O06A 3OEXA 2NWSA 3NL2A 2ZZ4A 4C1LA 1GVSA 3LGEA 4LS2A 1B4EA 1SW3A 3OBKA 4O0ZA 1TPWA 1OFEA 3SIZA 1SO3A 2FLIA 2OCZA 4FIRA 3GAKA 4RR4A 3HJZA 1LROA 1YXYA 1BWKA 3NXFA 3TQKA 3UWWA 3P8IA 1TPH1 4I9AA 4LU0A 3UNDA 2ZRXA 4OWGA 4JD4A 4Z1BA 1OF8A 1PIIA 3DHDA 1PVNA 3QM3A 5K9DA 1XBYA 2BZNA 2Y63A 1KLYA 5HINA 1KV5A 2ZQ0A 2HSAA 1VQTA 3BO9A 2NXHA 4NX0A 3O6DA 3GDLA 4E0CA 3W7GA 4MJMA 3UWZA 3KVKA 4UTWA 1PHQA 3LM7A 3B05A 1MXSA 3TMLA 4O4WA 3BLIA 2CW6A 1EP2A 4ORIA 3GIYA 1THFD 3W84A 1H7RA 2J27A 4N9DA 3T78A 3A5FA 2CLOA 2AAMA 2C16A 2BX7A 4IGHA 1L6WA 1A5AA 1I2QA 5LGZA 2A4AA 1GOXA 1ZAIA 1KBIA 1H60A 1WXJA 2VKZG 1K7XA 3UPBA 1EP1A 1LBLA 4MZ1A 3N2MA 2NUXA 5EBUA 1SSDA 1FCBA 1CX9A 1W3TA 2JKAA 1LOQA 3T4CA 1B3OA 4M6PA 4ZZ9A 2XN2A 5ABTA 3ZWTA 1DORA 1R30A 3QJAA 4UMAA 4CCEA 4CNPA 3GYEA 3W2NA 3L5MA 2G97A 3JRKA 4HHPA 3UWYA 4NQ1A 3OVRA 3PAJA 1LBMA 1VLWA 3TFXA 1RQBA 3C2OA 5DN1A 1O4UA 2JGQA 6ALDA 2VENA 1OK4A 3MJYA 3UZ5A 2PE4A 5D33A 1WA3A 2FB3A 1IGSA 1KLZA 4UUIA 1TIMA 4QISA 4HN4A 5HQEA 3P5ZA 4NXSA 3M5YA 3SI9A 3E02A 4LVAA 2ZCGA 2CZ5A 4N4QA 2BTMA 1G6CA 2QCNA 2ZTKA 5GVJA 1TCDA 3S8HA 2R14A 3B0PA 3M5XA 1WYIA 3TH6A 1HG3A 3E9AA 1RR2A 2DZXA 2GVLA 1ICSA 3MYPA 4N6FA 2H3BA 3IIZA 5AYYA 1TPEA 4GFSA 1XKYA 1IXPA 2ABAA 2EKCA 4K8HA 4Z0JA 4M6QA 1H7PA 2ZRUA 1F5ZA 3M7WA 1GZGA 3EWZA 1S5WA 3PR2A 4PH6A 3M6YA 3B8DA 5AC7A 1B9BA 2LLEA 4JY8A 4N4PA 3TU9A 1LDCA 1UBSA 5C5YA 4IX0A 1N55A 1KFBA 3W73A 1JCNA 3DFTA 1Y0EA 5KSWA 1QWGA 2C6QA 4EF8A 3HB9A 1YDVA 3L66A 2O7QA 1D9EA 4JNMA 1QPRA 1LTDA 2V9DA 4H6KA 1GPWA 3W7JA 3G3MA 1ZFJA 2CZFA 3BG9A 4IJBA 3MHUA 3QF0A 3E49A 1O5XA 3PBVA 5C55A 5AC6A 2BLEA 1DVJA 4UC5A 2OT1A 2IQTA 1TPDA 3BVJA 5AYZA 1OFOA 5A5WA 4O1DA 4DPQA 3DFQA 3TR2A 1I2PA 1KW1A 3YPIA 2NV2A 3G3DA 3P8JA 3WJSA 1R46A 1RPXA 3DXIA 3QEZA 1FWSA 3N14A 1SUXA 4PA8A 1F74A 4LTSA 4U28A 4UTWC 3QRHA 3C52A 5F1UA 1NEYA 1O95A 3L21A 5F2GA 3QZEA 3C2VA 1G67A 1UUMA 1OFRA 2A6NA 4MFDA 3NO5A 1XCFA 4AF0B 2R94A 3UQNA 4GJ1A 1LBFA 1TPC1 2DZWA 4CQ9A 4M6VA 3QMRA 4W9TA 3NM3A 5TIMA 3HG4A 3MP5A 1KV8A 5IBXA 3C8FA 1ONRA 2DZUA 2PRHA 1QO5A 4Q4KA 1KFEA 3VFLA 3R89A 4L4MA 1ZNNA 3CHVA 3FOKA 2Y7GA 2ZFAA 1FDZA 3PM6A 4AHPA 2PURA 1ALDA 1MEHA 2PC4A 5AB3A 1ML1A 3UD6A 1LM1A 3G24A 5HUOA 2B7PA 1UB3A 4BI5A 1VCFA 3TW6A 1TYGA 1XXXA 1GWJA 4CCCA 4JX5A 2C14A 3LBMA 2XN0A 2Y70A 4XZ9A 2E6AA 3NZ1A 2NXGA 4O0KA 5LSMA 1ADOA 2OMAA 8TIMA 1LLZA 2X1TA 4ZQMA 2C3ZA 2YFNA 4ML9A 4AWTA 1G4PA 4WJEA 4UFKA 3HGOA 4BFAA 3LOTA 1VC4A 4NJKA 4UIOA 1WX0A 5F2MA 1W3NA 4PODA 2I1OA 1VCVA 4I7WA 1JQXA 4GC4A 2X1UA 3ELFA 3O15A 3KAOA 3NEVA 4N6EA 1DQXA 2G5WA 3NQ6A 3C4UA 3HGJA 4IQLA 1IIHA 4JX6A 4RX0A 3HG5A 4NNAA 4FX8A 4ADTA 3QMSA 2ISWA 5FF4A 3B06A 3HGSA 4JXCA 2WKJA 1YPFA 2JGYA 3H53A 3WK1A 4WOZA 5AOUA 4Q32A 1LRNA 4P2VA 2B7NA 3DFPA 4S2CA 2BSLA 2RKXA 5LZLA 4GNJA 1IF2A 4MZYA 2PRMA 3W7DA 2QEZA 3L0NA 5AYXA 3W1NA 1QNVA 2NUWA 3TJXA 1YDOA 2TSYA 4JY9A 4XBKA 1QFEA 4MUZA 2C15A 2YX0A 2WV8A 2A7NA 4FNQA 3S0CA 5LNWA 1LOSA 4DBEA 3GDMA 3RLVA 4LC8A 3QPYA 3W7MA 1PS9A 3A23A 2CWNA 5G1TA 4JTLA 4O4VA 4RK8A 2W6RA 4QIUA 1ZY9A 1XFBA 4K38A 1XDLA 3QH2A 4RXGA 4HNTA 4O11A 1GYLA 1W56A 2FPTA 4N02A 1ZHAA 2V2CA 4LVFA 3W9ZA 4KFOA 4DF1A 4M7SA 1L9WA 4Y8FA 2ZRVA 1JCMP 3L5LA 4WY0B 5BW6A 4Y96A 2CLMA 5K3VA 4O54A 3S5YA 5SWUA 5LGXA 3BW3A 2HS6A 3FEMA 4X3ZA 1KBJA 1K7EA 4WOQA 1DV7A 3TW7A 5FF2A 5FEPA 2CLIA 3EXSA 3G1HA 1GVRA 5AHFA 5IBXC 1B57A 1EWEA 2ZRWA 4LUIA 3B0UX 4FNTA 1QPNA 4CQAA 1HO1A 1JCYA 1ZCOA 4UTTA 2EGZA 1OYAA 5EA9A 2FTPA 3LV5A 3BV4A 4AWSA 1OFQA 3PS7A 2QF7A 4O1BA 4O19A 5HNRA 4JR5A 1SO6A 2A85A 2QCGA 3A24A 3ZS4A 2DP3A 3UYCA 1KM1A 1OYCA 4BI6A 2GUUA 3NQGA 3EX3A 2F84A 3W2JA 4YWIA 4BI7A 3KFTA 3CU2A 5HJLA 5LNVA 2YCEA 5FEXA 1KFJA 4LOCA 5CKSA 3INPA 2GJNA 4XTDA 4RZ6A 5G5IA 4HSNA 2VEIA 2X1SA 5K4XA 1N8FA 4BR1A 5F1VA 2WJZA 2FB2A 2A6LA 5CPMA 5K9CA 3RU6A 3Q94A 3KXQA 5U4NA 3LXAA 5E0KA 2NX9A 3W6YA 4JTJA 3D0CA 4OE7A 4Q33A 1V5XA 3CWNA 3HF3A 4LWWA 4UFMA 1Z48A 3P61A 1AW5A 1FX6A 3N9SA 3P62A 3P82A 2G96A 3C3NA 4HT3A 2VFFA 4UTJA 3GXNA 5I3FA 4FNRA 4YCOA 5KINA 3LXCA 4YXGA 2P10A 1TV8A 3CB8A 4NT0A 4NJGA 1OFPA 5LNSA 1UCWA 4NJJA 4ADUA 1H7XA 1TPVA 2YZRA 5CSRA 1MEIA 1LZOA 3NQFA 4AH7A 4QJ1A 3G1DA 2A0NA 1HUVA 2ABBA 4ICNA 3PWAA 1TV5A 1WV2A 1Z41A 3SZ8A 2C13A 3KVLA 4EIVA 3BK0A 3G8RA 1GTHA 5DXXA 5F4WA 5CSSA 2QUVA 1NVMA 4GRSA 4RV8A 2CZDA 2I9EA 5I3HA 4OHQA 3NQ2A 4IWWA 1W5PA 3HPZA 2QCDA 1XDMA 3UY7A 4MIMA 4Z1AA 3PBUA 4MPQA 4LRTA 3W87A 3LHVA 2CLEA 4JYDA 3B04A 3A21A 3EWWA 1ZALA 2VC6A 3TE9A 4GUJA 1VRDA 1KA9F 5DCEA 1JCLA 2B7QA 2Z6IA 3T40A 3W2MA 2ZYFA 4EF9A 3MI6A 4LVGA 4NUWA 1W37A 1UASA 1A5BA 1VH7A 4H4IA 5D30A 1F6KA 2CU0A 2R91A 5K2ZA 3G1AA 4H3DA 3W1UA 3MHFA 3IV3A 2ISVA 1YADA 4WQ6A 3PY2A 1XC4A 1TQJA 1XUZA 3HPSA 1SSGA 4MYAA 1SFJA 2E77A 4UTTC 1W5QA 3CEPA 1AL8A 1UUOA 5HR7A 3FJLA 4AEOA 4MY8A 5D03A 1GQNA 4RKAA 2FIQA 2ATSA 2E09A 3FYOA 4QNEA 3S1UA 2YYUA 1YYAA 4DO5A 5C54A 3NQ8A 2WSYA 3M16A 3WK3A 2FQIA 1I45A 4LW7A 3W07A 1RD5A 4IXXA 3TUUA 4XKYB 3GKAA 3LCXA 3G22A 3LHUA 3HG3A 5D2WA 3HQ1A 3F4WA 3NL3A 1O5KA 3WJYA 3DHFA 3UXDA 4DXVA 3W83A 3FLUA 2FFCA 3M5VA 3NQVA 4A21A 2J9ZA 1TQXA 4AB4A 4CLMA 2AGKA 1LYXA 2ATMA 4BWLA 1XBZA 1H5YA 5HWJA 3TCEA 1I4NA 5G4WA 1JVNA 3CLMA 1RQEA 1KM0A 2Y89A 4UFLA 3SECA 2E5CA 2QKFA 5F2LA 5FEZA 1TV7A 1DHPA 5D37A 2C19A 5KZEA 3O05A 2QCDB 3IRDA 3GXTA 4J9JA 4UTIA 4AHOA 3T55A 1SZNA 5D2YA 4RZ5A 4MVAA 1FWTA 2ZZ3A 4JGDA 5J5RA 4QQ3A 1W5OA 4UTHA 2Q3RA 1LP6A 1RV8A 1NF0A 3W1RA 2VOMA 4FNPA 3U2OA 4JTTA 1J2WA 4O1CA 1I2RA 2AQWA 4HIBA 2ZZ2A 4MFEA 3W7IA 3O8AA 3LERA 3OG3A 1VYPX 1QOQA 1DQWA 2Q8ZA 5EKYA 3TIMA 3CEUA 2DZVA 4NJIA 5BRBA 1OFBA 2GQ8A 1TSIA 5U7SA 1OG0A 3RFAA 3WJZA 3QSRA 1VGAA 4FHAA 1GTEA 1S3HA
chains in the Genus database with same CATH superfamily
4RE3A 4R53A 2X0HA 3W7CA 4E8GA 3VVGA 3LX9A 1BG9A 1G7UA 5HUPA 3BXWA 2HMCA 4RJEA 1Q13A 4P8WA 4XD6A 4V28A 2GFTA 1VCGA 1K7FA 1TWWA 3QKZA 3O16A 2QHAA 3GLCA 3IGUA 1YW1A 4XO7A 4EPBC 1JYVA 3NPXA 4GZ7A 2QLYA 4FNSA 1W3KA 2J24A 3A3WA 3R7MA 4K6AA 1I1WA 1UR3M 4FLSA 1PXGA 3MI3A 1CI1A 1MRQA 2RDUA 3VC5A 4U31A 3O3RA 3TWBA 1J9YA 4LY8A 4Q4QA 3E2QA 4CNNA 3QW3A 7CGTA 2IPGA 1EDQA 1JF5A 2QDHA 6TIMA 3UWUA 2DJXA 3MYOA 4XAZA 2JKEA 3CQ0A 4L1GA 2XIOA 3LI0A 2OOGA 1NELA 2RJHA 1NDVA 4HP5A 3SRDA 2ZA2A 2OKTA 1SU5A 4W87A 3R94A 1D3GA 1FOBA 3VE9A 1UP3A 2O55A 3P5YA 5D09A 4JAWA 4M5PA 1QNRA 1UOKA 1NSJA 4K8GA 5CBIA 3LLXA 4GG9A 2VVSA 4QLKA 1FWAC 3ARPA 3UZZA 2NT1A 4IQEA 5LHEA 3W3OA 2C18A 2DQXA 3PZIA 3VNIA 4Z1CA 3VIOA 2DT2A 2GSEA 1M9HA 3UBPC 2E0PA 2FH6A 4CEXC 4CD5A 2NXIA 2XH7A 1TUXA 2FTYA 4PL1A 3ARSA 4M1BA 3VIKA 1DOSA 1U83A 3VOCA 1AZ1A 3NZGA 5MHBA 4US6A 5JIWA 2PP3A 1L2UA 1QPOA 3AU6A 1SZEA 1SW7A 4W8AA 4ZOEA 3WJXA 1EKOA 3ZT7A 1J4EA 3C0SA 1Q3NA 3CIXA 4EK7A 3ANYA 3N4EA 5C8BB 2FHCA 2D0FA 3P60A 2EPNA 5A3HA 2AKMA 1OFDA 3PN8A 2XZ7A 1C7TA 4PUEA 3CM4A 1ZJAA 4REQA 3BICA 4ZE4A 4ALDA 1W1IE 3BLDA 1HJSA 3SO7A 4O14A 3LY0A 1XLGA 1ECEA 2WWCA 5DBUA 3R12A 1HJWA 1CGTA 5CJNA 1KCLA 3TA9A 2F38A 1WDPA 3V16A 3LCIA 3QHMA 2DORA 3N13A 3TP4A 3N25A 3STEA 1GVOA 4PUNA 4HCHA 2FVKA 1CXFA 1VBRA 1BG4A 4MNLA 3N15A 3LCFA 2Q6ZA 4MNKA 4DZIA 1S5VA 4OT7A 3VIFA 3PTDA 4H7ZA 1P43A 2GGGA 3FKRA 1BWVA 3IAQA 1HT6A 1IZCA 4PZVA 4HMEA 4FIQA 3W7QA 1KTCA 1BQGA 5HNUA 1R5YA 2KAUC 1DJXA 2DZSA 3ZWSA 4HSOA 4U4MA 4D2JA 2XIIA 3TSDA 2OSXA 4HU4A 1DL3A 3S5SA 1Y5VA 3N73A 2YXOA 1LL4A 4KEUA 3CL8A 4K8EA 4N9EA 3F4CA 2VD8A 3DX5A 3EXTA 3NPUA 5EGRA 2GZXA 2QAFA 1W5NA 5A8GA 2I5GA 1R85A 1XIFA 1RSCA 5DY3A 4FNUA 4AVNA 4R7WA 3HU7A 4O10A 1FCUA 2BXVA 4LT9A 5EMYA 1D3HA 1Z44A 3P7YA 3ABOA 1O1ZA 1PX8A 5C6MA 3DG3A 1V77A 4XO6A 2E7FA 2J8FA 2OEJA 3WNKA 1HX0A 3TNOA 4F0LA 1OGGA 4JL2A 4G9PA 3AICA 5C9ZA 4I9JA 3SBFA 5DLCA 4AISA 3W00A 1LQ0A 4CN6A 4JDBA 3E2SA 3WBYA 3KRSA 2F2HA 6PTDA 3AHTA 3R0KA 1XCWA 3MANA 1L2QA 5FF3A 3XINA 4NKCA 3DCPA 3RUBL 2W4XA 3GHRA 1FWWA 2VNCA 3AC0A 2FDSA 3S4TA 2R1NA 4LFYA 3A22A 5AZ1A 5G1YA 1XLEA 4UTLA 1O7AA 3EKLA 2YL6A 2CKSA 3MO4A 4DAFA 3UETA 3PUEA 5E70A 3I6TA 4PL2A 2QJJA 3EPOA 1BEUA 3A4XA 3SN0A 2QULA 1BVWA 3KRZA 5HQMA 1SO4A 2VRQA 2EF9A 1DIDA 2TAAA 3N2OA 4CNTA 1XLJA 5AC5A 3AMGA 4JN8A 8CGTA 2QV5A 3MUCA 5EFDA 4WCJA 4WGHA 2PD5A 4U33A 4DJDD 3RMEA 2WM1A 2Z24A 3E96A 4KWWA 5T26A 1ZJHA 1DJQA 4HNNA 2WCGA 1XBXA 3T05A 1PL9A 3FK4A 3QFEA 3O1NA 3BGJA 1GEQA 1P5BA 1W3JA 3E0LA 1US3A 1JCTA 4WIWA 3KTCA 5FESA 3VNMA 1UKOA 4QG6A 4OV9A 4DO7A 2GK1B 5DQPA 3BW2A 4X2PA 3QOKA 3R13A 3LPPA 4W8BA 3GNDA 3UP8A 5I02A 3H2AA 1GYNA 4EP8C 2IW0A 2J25A 4B5UA 4NJHA 1W9UA 1XLDA 1QJWA 3BWWA 1GKPA 4CU6A 4A22A 4A3YA 4CNSA 3KHJA 4LYQA 5JH2A 4L80A 4H41A 5FEWA 5FA5A 1POJA 1SR0A 2X2GA 5D32A 3FY1A 4ERAA 3GVVA 4IMEA 2HROA 4LAMA 2YLAA 1SFTA 4CVWA 4EE9A 1ICPA 5I3IA 2WSQA 1QOXA 4NF7A 3MMWA 5CZJA 4YVXA 2H8ZA 4PRTA 4ADSA 4QP0A 3WL1A 3C8NA 3ZJKA 3T9PA 5CPQA 3LCWA 2B4GA 3FFSA 3WQOA 4RNHA 3SUWA 4UCGA 2O56A 2NVCA 3G1RA 5T9CE 3AWNA 4N9CA 1R2RA 3DGRA 2CLFA 3GS6A 3TK7A 2IQ0A 2R1MA 2X05A 3B3DA 1L6YA 4Z0SA 3AXIA 2XHYA 4H6EA 1S1RA 2O9RA 1W6TA 1DWJM 3OODA 4LS1A 5IHSA 1GONA 4JTKA 1YPIA 2QAPA 4DJDC 5A6MA 5AHLA 2YCLA 1T8XA 1V02E 4FEZA 1QI3A 4O57A 3AHZA 5FJOA 2J75A 1ZP4A 3GTIA 3W4RA 3SY5A 3TSMA 1RJRA 3PC0A 4AWUA 1VENA 3DU0A 1Q6EA 3HIJA 2WB5A 4JTGA 8XIAA 1OD0A 1FKWA 3O7UA 1JGIA 3KBMA 3L4ZA 3NTYA 2E25A 3JW7A 2B7OA 1NOWA 2Q3OA 4O50A 5E93A 3H4GA 4H9YA 2WANA 1AA1B 1SVDA 2WQDA 3SW6A 3PUGA 3DOPA 3QQWA 2VEPA 5D02A 1EYEA 3GDKA 3ZXWA 3NM1A 1KTNA 1VEMA 4POCA 1LLWA 4O28A 3RMJA 5CPSA 5G1MA 2V5LA 4O1AA 3DYPA 3PZ9A 3MV01 1KRAC 4UOJA 4GINA 4S2BA 2BWGA 2Z6JA 4LEFA 2WPBA 2OYLA 3UFYA 4KT2A 4C6PA 5D2XA 3KRUA 1VBUA 4GH3A 2VUNA 3ITVA 2WAGA 1H4PA 1LOLA 4TVUA 1TV4A 2XYLA 3HPXA 4DVOA 3NURA 1QATA 1ODUA 4V1XA 4ROQA 1IT7A 1D3CA 3VNYA 5LA0A 4PUJA 1ZJIA 1RA5A 3SCOA 3GR7A 4AMCA 1PTAA 3HN3A 1O12A 5DCDA 5BCAA 2YFOA 4NL1A 4FXJA 1R7AA 3A3HA 3KBWA 1SW0A 4UFHA 3QLDA 4GUGA 4ZB0A 1B4KA 4IG2B 1B9ZA 3KOXA 3SQSA 4FO4A 1TZ7A 3N19B 3TVAA 5F7UA 1KM3A 3I7SA 3PBGA 4ACZA 4FX7A 1V6UA 1YDYA 5D9MA 3P74A 4D8ZA 3B0XA 3HA1A 4LUTB 4QS5A 3HV8A 3DYOA 6CGTA 2J7BA 2OO6A 3MUZ1 3H2OA 2XDFA 4UQCA 5L9FA 2R24A 4AIBA 2Z0IA 4GYKA 1J5SA 1XKJA 2C8NA 4XD3A 4EVZA 3G1XA 3U4FA 1K8XA 1TWDA 1MDRA 3P6LA 2BNJA 2H6RA 2Z1VA 1YX1A 2PU1A 1F73A 2BFGA 3PSVA 3WX7A 4TV5A 4KPLA 3S2LA 3NZRA 1GZJA 4HNOA 3N4AA 5EPDA 1EJXC 4Q8TA 3G18A 4GUHA 4AZ7A 3V18A 1KFKA 1IEWA 2Z2BA 4IMFA 1HQTA 2NT0A 3NGJA 4RL3A 1S2CA 4IFRA 4Z2HA 2DSKA 2QPXA 1NY1A 2TPSA 2Y0FA 2ZDRA 1CYGA 3MS8A 2V2DA 4Z2LA 5E9XA 5LIXX 1R3WA 4S1FA 1UC4A 1J0YA 2E9BA 1HKKA 1XFCA 3OZYA 4V27A 2P76A 4C1NB 2GWNA 3T2QA 3BG3A 2QCLA 2Y62A 2J7CA 3SCUA 2QUNA 5EMUA 1K77A 1BXCA 1JNDA 4LF2A 3O6YX 1F2JA 5BMWA 2AL2A 2CETA 2EJ1A 2WBKA 3H2MA 3B9NA 4LB4A 2IUZA 1SPQA 4WZHA 1R38A 2PWUA 5DMLA 1JULA 3N17A 1M53A 4H19A 4QJ4B 4IX2A 3TNBA 4DWDA 1FWDC 3NQDA 3VKAA 4W8LA 1XG3A 4J28A 2ZRZA 2PDXA 1BXNA 1XRSA 2A5HA 3T0DA 4HA3A 3WH7A 1LL6A 2QVHA 5D9OA 5H6HA 1HKJA 3AXMA 3CUFA 3DI0A 3HMJG 2DUAA 4GIAA 3R8RA 5D8ZA 1XLAA 2YL5A 2RDTA 1P0NA 1ENUA 1LRQA 5KITA 4G7FA 1GKQA 1ZLPA 3CPRA 4DJFA 1EOMA 2EAWA 3VXGA 1FCVA 2WSRA 3KL3A 4BY3A 3BLPX 1TA3B 2VZSA 5FL0A 1X39A 1A5SA 3PBWA 2DZAA 1BYBA 3QY7A 4XZWA 1DJZA 3AAMA 4TV6A 2OX1A 4Z2IA 3S47A 1REQA 1I1XA 1IIGA 4X0NA 3W7KA 3OQEA 5HK4A 4DF2A 1XYFA 2P1FA 3R43A 4MB3A 4GQ0A 3M43A 1TWIA 3VNDA 4XAGA 3DAQA 3M7SA 4NXKA 3WELA 4X60A 4C6LA 3WQCA 3E12A 1P7TA 2E68A 1UD3A 3V75A 1O94A 3GYCA 3H24A 1VPXA 2PGFA 4KKXA 3PPGA 3UG4A 5C9WA 5FAGA 5I24A 4S3AA 3GG8A 3GNRA 3VIGA 1XD1A 1J11A 4MOZA 3ZO9A 1OHLA 4DUOA 2D2GA 4DYJA 1F61A 3LSCA 3MMDA 3W24A 3NNTA 3GTHA 4FOKA 4AW7A 1TR9A 5DX7A 1PIGA 3AS1A 1GT8A 3DKLA 4TUFA 3N6HA 5H2ZA 3ITTA 5F4XA 3NQMA 3IIPA 3ABQA 3DFHA 1AQHA 4XUYA 1F3TA 3LXBA 2DW6A 2YW4A 3G0XA 2J7HA 3OTRA 2WVSA 1W8SA 4EANA 1H7OA 1WOAA 1L8PA 3OGRA 1F6PA 1NWSA 3CMFA 1S5MA 1A0DA 2GUBA 4ZQNA 5AN7A 4E3TA 3NGFA 3R5EA 4J3TA 5J5DA 4D6JA 4LF1A 5I07A 3M64A 1AW1A 5EB8A 1JDAA 1QOPA 3LQGA 3PSWA 3WQGA 5RUBA 3POHA 3O2LA 4PB4A 4X9SA 1TMHA 4D6CA 3DYMA 3QC3A 2OB3A 5A6BA 3B8TA 3HG2A 1AUSL 3VCRA 3WFZA 1B3ZA 2ZA3A 3I65A 3E0WA 3VM5A 5BRPA 4DB7A 1PCKA 3AO0A 5H8MA 1NOUA 1S2AA 1KBLA 3ITCA 4L9XA 3SAZA 2FZ8A 3NL2A 1VFSA 2ZZ4A 4HOXA 3DHPA 3W28A 3VILA 4C1LA 2FGZA 1PYFA 3GNOA 2DT3A 1E1EA 1SW3A 2PODA 5BWAA 1OFEA 9RUBA 1SO3A 2YBTA 4GJIA 5ABEA 4DHGA 4C6NA 3WF2A 1BWKA 2G0WA 2V3DA 3SQLA 4X9YA 2ZUNA 3L4VA 1YNYA 3DESA 1PVNA 4I9MA 1JXJA 1EF2A 5HINA 4KWOA 4C60A 1GK8A 4NX0A 1E0UA 3O6DA 4E0CA 1XGZA 2OYMA 2I5QA 1XINA 3UWZA 1V79A 4J7RA 3LM7A 1X1NA 3VCNA 1MXSA 5CC7A 1JZ3A 3BLIA 4Q7IA 4OUIA 4L56A 2VCCA 4E2OA 2J27A 2EPOA 4N9DA 1JFHA 2C16A 4YHEA 4C6DA 4IGHA 2EJAA 3CT2A 4RDWA 4HCLA 2VX7A 5BOFA 1OT1A 1OADA 1K7XA 1SFSA 4MZ1A 4L1XA 3M0MA 3I3EA 5CSUA 1B3OA 2JFEX 4ZZ9A 2XVGA 3MZNA 5ABTA 3ZWTA 4CCEA 4CNPA 1PWLA 4Z17A 2UY3A 3RILA 1MQPA 3KZPA 3L5MA 3GDBA 4PMNA 3JRKA 3EA2A 2XM1A 3ARTA 2VENA 3ZJ6A 3MJYA 2Y4SA 3ARRA 1N8WA 2FB3A 5DRCA 4IGNA 4UUIA 4C6CA 4A3QA 4OFCA 4Q8MA 3E02A 4HZ6A 3WF4A 2CZ5A 2BTMA 4RV3A 4FOJA 3USZA 1HZYA 5FCZA 3GVWA 3M5XA 3U4AA 1WYIA 4BQ3A 3E9AA 1ICSA 3TTQA 3SDOA 5AYYA 4D9PA 1XP3A 3FDKA 4HN8A 3GBEA 5LA1A 4K8HA 4Z0JA 4LANA 2VP8A 2ZRUA 3M7WA 1OCNA 1E15A 4PH6A 3ZSTA 3B8DA 2DEPA 1B9BA 4XSMA 2LLEA 3TU9A 1UBSA 3B8UA 1B5TA 3BCJA 3LPGA 3DFTA 1CLXA 2PDMA 2FMOA 3L66A 5HANA 1D9EA 4JNMA 2A3LA 1LTDA 2R82A 4F4RA 1OD8A 3HFTA 5I79A 1GPWA 2BY1A 3BG9A 3MUY1 4PMDA 4KWSA 1KXTA 2FJUB 3TYAA 2JIEA 4M29A 2IQTA 1TPDA 2CXGA 5A5WA 3S2NA 1OFOA 5CSYA 1MUCA 1R9XA 3G3DA 1R46A 4PA8A 5I06A 2VDHA 1WXYA 5F1UA 1UKQA 2IMRA 1ELSA 1O95A 1V3HA 4M1RA 3QZEA 4PMYA 3QLLA 4Z2JA 1DIKA 1OFRA 1S2UA 2G3FA 1MRAA 1ZBKA 2WM0A 3RM9A 2HDJA 2D3LA 4GJ1A 3N12A 3CO8A 1UHVA 2RDXA 5TIMA 2CERA 3MP5A 2GDUA 1KCKA 3W53A 5KEZA 1QO5A 3W01A 1T6MA 3A9BA 4FOUA 1V93A 4QEHA 1DP0A 3ITOA 4KEVA 4AHPA 2PURA 1ALDA 3WKZA 1MEHA 2Z26A 3UD6A 1LM1A 1AQFA 3G24A 3UA3A 4DY1A 1FKXA 1UB3A 3VKDA 4BI5A 1VCFA 1ZZMA 3EDFA 4CCCA 3WBAA 4AWEA 4F2TA 2C14A 3LBMA 2XN0A 5FOOA 2E6AA 2YDSA 3NSMA 4Y9NA 4JNYA 1ADOA 2YFNA 5FACA 1OCQA 4AWTA 2WZIA 2ESCA 3LOTA 5F2MA 1XLCA 3ALGA 1W3NA 2I1OA 2R9RA 5BXPA 1JQXA 4JTQA 3ELFA 3O15A 3NEVA 3TJ4A 3ZLHA 4AZBA 1LF1A 3BUVA 3HGJA 4RX0A 4PUKA 2VDGA 3HGSA 1YPFA 3H53A 4WOZA 4Q32A 4ZB2A 4J5NA 4C7GA 2VO5A 1VAHA 3T2PA 1ONWA 2AL1A 2OVLA 2PRMA 3W7DA 4QS6A 4FXFA 3L0NA 4LX4A 3R1ZA 3WQ4A 3D3AA 4QGCA 2FZDA 3TJXA 3S3GA 3QPEA 4LSBA 1OC6A 1V02A 1QFEA 2BS9A 2C15A 2YX0A 2P3EA 2A7NA 5LNWA 1T7LA 4DBEA 2RGLA 3EOOA 4LC8A 4IIEA 3QPYA 3W7MA 2CWNA 5G1TA 4CGTA 2DUZA 7REQB 1F4HA 2I16A 1J79A 4QIUA 1ZY9A 1XFBA 1UD4A 2VMFA 4H01A 1W56A 3RGTA 2DSZA 1DJYA 1ZHAA 1KO0A 2YDRA 3W9ZA 4KFOA 2Z1KA 4DF1A 4ACYA 2ZX6A 3SCNA 4MJ2A 4H8HA 4WY0B 3E1F1 1EBHA 2CLMA 1M7XA 2GK1A 5GJNA 3EZ4A 4ERIA 1A5KC 4X3ZA 1KBJA 4HZMA 1DV7A 2CLIA 2POZA 3G1HA 3K1GA 5IBXC 3CASA 4GY7A 4FNTA 4C90A 3U7BA 2W62A 3WLPA 4UTTA 2EGZA 3SCVA 1N8IA 2ODOA 2VWSA 1JYWA 1DJWA 4F0RA 1Q7ZA 3T08A 4O19A 4NZ4A 1US0A 1RUSA 4B15A 1KNWA 4DN1A 1A47A 3GHTA 3NQGA 4I90A 4TQTA 1IZKA 4BI7A 3N2CA 3CAQA 2GOKA 4ASTA 1Z69A 1VKFA 4XTDA 5FJJA 3WQ6A 3RX2A 5CC5A 4HSNA 5C9UA 3N2TA 4BR1A 5K9CA 2WJZA 3BAJA 1VBJA 3V36A 5E0KA 2W61A 2WHLA 4UQ9A 3JZEA 4HMDA 4OE7A 3D3FA 2PMQA 4IPLA 3PJTA 1HVQA 4GACA 3P82A 2HJPA 3WDPP 4WDXA 4GI6A 3GXNA 1FA2A 4W7WA 3SY8A 3UVIA 4K1WA 4YXGA 1WXZA 3CB8A 4NT0A 1OFPA 1ADSA 4YU1A 1IWAA 4D1JA 1H7XA 2YZRA 1MEIA 4ICMA 4WJ8A 2PP0A 1TCMA 3NQFA 3GE7A 3RCMA 3G1DA 1WCGA 4ICNA 1FH8A 3PWAA 1TE1A 4GQBA 3KBJA 2P8BA 2QDDA 1O68A 2C13A 3F4VA 3KVLA 4EIVA 3G8RA 1GTHA 1Y8BA 4GQQA 3I4EA 3DFYA 1E0VA 4GYFA 3PAOA 4RV8A 2CZDA 2I9EA 4L4OA 1I0BA 2FZ9A 3CTTA 4H00A 1NWUA 1XDMA 5BROA 4GI8A 2O92A 4ZENA 5C2GA 3GXIA 1B3VA 3GSMA 2VX5A 3NXLA 4DBWA 3A21A 1ZALA 2P53A 1Q6FA 1LJYA 1KA9F 1R3QA 5DCEA 1YNPA 1Q5MA 2B7QA 2YZ5A 1A0EA 2Z6IA 2PB1A 3THUA 3KLLA 4F8XA 4NUWA 3GG0A 1UASA 1A5BA 4MWAB 3VMNA 2CU0A 1EQCA 3G1AA 3OO2A 3ABZA 1Q65A 1YADA 1ZU8A 3PY2A 4W88A 1UH2A 2CIPA 4DLFA 1Z32X 1W17A 4QJ5B 1YMYA 4J3VA 1VFHA 4UTFA 2QGYA 3CEPA 3FJLA 2D24A 3GG1A 4WDUA 5D03A 1NM9A 1JPKA 1UUQA 4B4HA 4RKAA 5MF5A 4H2HA 2ZOXA 3FVDA 3B40A 3S1UA 3IACA 5C54A 1OWQA 3NQ8A 2WJDA 1XRTA 3OW1A 2DH2A 1RP8A 1KWKA 3M0VA 1X97A 3VD9A 3WQFA 3LCXA 3LHUA 4AXNA 5FL1A 3E3HA 3UA4A 4U2ZA 3CMGA 1O5KA 3VOJA 1Z9AA 3DHFA 3Q67A 1IV8A 3OHMB 3OZPA 3ITYA 1TQXA 4LUTA 4CLMA 2AGKA 4HOWA 5HWJA 1T41A 3SCSA 3CS2A 3CLMA 3UR7A 1KM0A 4LBSA 3GNXA 3SECA 4CQDA 5XIAA 3V0TA 3AHVA 4AIUA 5FEZA 5JU6A 5KZEA 1FTXA 4AHOA 3WUEA 1B3WA 1PKNA 5D2YA 2XIJA 5G4HC 1KKOA 3AXXA 4JGDA 2DPEA 4KEMA 3TTSA 1MW2A 5REQB 4N42A 1RV8A 1OGBA 3W1RA 1WDDA 1Y5WA 4FNPA 4DWSD 5FAJA 3ICJA 1DYSA 2AQWA 2G3NA 2BY2A 4MFEA 3TEVA 6ENLA 1BVNP 3OG3A 1QOQA 2HE5A 3LMYA 3COTA 3MKCA 4NJIA 5BRBA 3BQ6A 5HMFA 1OG0A 2FDMA 1UZDA 1VGAA 2WNZA 4GK8A 4LYKA 1E6NA 3MMTA 1GPFA 3GFXA 3TJLA 3F4DA 4OBTA 1B54A 4FP1A 2BVWA 5E1QA 2PRLA 3OP2A 4MWAE 1AVAA 1PUDA 3RPMA 1VEOA 3WLRA 2WSKA 4Q8QA 1GZ1A 4U3CA 2F7FA 1NJJA 2DJLA 2VEMA 1TTPA 1XHGA 7TIMA 4C1NA 3TAOA 3MWAA 4LAZA 3HV9A 1E4LA 5CEWA 5FF7A 2GQAA 1GORA 3U0HA 5K7JA 4Q7NA 4WY0F 1KCZA 4M8UA 2I9UA 4RNIA 3VNLA 2QS8A 3CQIA 1HTIA 1H49A 5I3DA 1QHZA 4BQ4A 1C8QA 3LLDA 4JFSA 2Y85A 3WZ0E 4BEQA 4RLIA 1H1YA 4Q8UA 1CENA 1DJIA 3UJEA 3REQB 3LRLA 1SO5A 4KMQA 4XD5A 4ORMA 5IDIA 1M03A 1KQYA 3N11A 5CG7A 3WK0A 3AYRA 2IPJA 2DUXA 3GXFA 3IIOA 4K36A 3EBVA 5FJPA 3KX6A 4WHBA 1PPIA 2V5KA 4X63A 4L1WA 3DBPA 3W25A 4U10A 1CTNA 2D2OA 2HZGA 4YYFA 1OB0A 1UMYA 2R8WA 3PUDA 3W1LA 2O9TA 3N04A 1B3XA 4N2YA 1XLIA 4AQLA 1JZ5A 4DWSC 1FP9A 4X2RA 4IPJA 3PPCA 1LRTA 3TROA 4GE8A 9XIAA 1W31A 1JUKA 2Y7EA 3KTSA 1V7AA 3AIUA 4ZGYA 3QOMA 2YDQA 3VGBA 2Z2AA 4DUXA 3HQPA 4KRUA 1J0HA 3ABXA 3CHCA 1R0MA 2BV9A 3VDAA 1TA3A 3NG3A 4G56A 4IP5A 3UESA 3ZLFA 2V0TA 3WMBA 3UT0A 3BLKA 3ERPA 3MY9A 3W6LA 4MY9A 5CGMA 4PMOA 4DEFA 1M7PA 3A9IA 4MGGA 4EOUA 2J8TA 1AH4A 3LCGA 3LUTA 2Z27A 2Z1BA 2A1YA 1WZAA 5I03A 4HYVA 1EWDA 3B9EA 1KFWA 1P0DA 4WUIA 3OU8A 4B2DA 3JU2A 1GVFA 5KTLA 1Z3NA 4Q22A 5CPLA 1A5NC 3NL5A 4V33A 2FJKA 1NTHA 1TREA 4P7QA 2HVNA 3W74A 4BF5A 4QFUA 5A6TC 5DANA 5DY2A 2EPKX 4Y6GA 1EP3A 5GPRA 1SFLA 2IKGA 4ENLA 3VUPA 2Z1SA 2YB4A 3EAUA 4FZIA 4OGZA 1FWHC 3M41A 4A6GA 2BVYA 4Z08A 4DI9A 4IIBA 3T44A 5EMMA 3FYPA 4UZUA 3WF1A 1POKA 3PB0A 1TTIA 2V5JA 2DT1A 2GSHA 1YPXA 4J35A 1F4AA 3SSZA 3UCQA 4NX5A 2CLLA 3NO3A 4QJ3B 1MNSA 4UR9A 1XL9A 4AXKA 4W5ZA 1Q6CA 5H91A 4B9YA 2WQPA 2QDGA 1F3EA 3FW6A 1E0TA 3A64A 1JUEA 1OC7A 1S2TA 3S1XA 1V7YA 4IGSA 3OIXA 1EJWC 3OLEA 1FDYA 2WOQA 4RE2A 3SCPA 2PTYA 7PTDA 1ZP3A 3QYQA 3WMLA 4B5XA 2R1KA 3M9YA 5MKGB 2A3AA 1ME9A 3M0LA 2J88A 1VFOA 1O5QA 3NEHA 3GU2A 5DBTA 2BHUA 4UMBA 5E6ZA 2OLHA 1CEOA 1E9YB 3W2LA 4G7EB 1WO2A 4OBSA 2W66A 5EL1A 3UERA 3H4WA 3H2FA 4AIEA 4PMRA 4QRNA 3VCCA 2ZIDA 1I6NA 4A4AA 1GOMA 4JEQA 2ASHA 3EB2A 1KKRA 2VC9A 4YMZA 2V81A 4RNFA 2ZZ1A 4PMJA 1SZGA 2VELA 1F05A 1XPYA 5D9PA 4GC3A 4K2SA 3GUWA 3VZXA 3W26A 4Y9PA 2C79A 1E0WA 2RUSA 2HPMA 2GDQA 3UXKA 3TYCA 2OLSA 3AUOA 4YN5A 4BF9A 1H3GA 2CCRA 1PKMA 1R3VA 1J10A 2PAJA 1XSKA 4MHBA 1FWGC 1UKSA 2YYTA 3CHEA 1XIJA 5DXYA 3UR2A 1XUUA 1MEWA 4HYWA 2Y7DA 2QJIA 3AI0A 3SUSA 3GHUA 3BAIA 4IXHA 1SZFA 4UB9A 2DGAA 1YTDA 3LRMA 4HTYA 1DJGA 4DJEA 4HPGA 1WQ5A 3EEGA 4HNCA 2MANA 4BCEA 2CC0A 3CAWA 1NIUA 4XSLA 2VZTA 3KDNA 1T0OA 1K6AA 1B31A 4E2VA 3GC5A 3N34A 1UR1A 2AQVA 1DIEA 3M44A 1SJCA 5EU9A 3GRIA 1ICQA 1XLLA 2J6XA 2XH2A 4NI8A 4F48A 2FMNA 3H2NA 2ZA1A 1UQZA 4I5XA 5G2WA 1WPCA 1AJ2A 3VGHA 1DJNA 5CPOA 2ZDSA 1G4EA 1X6UA 3CUJA 3S1GA 4ZMGA 1MYRA 1JAKA 3MUIA 4H7VA 3CZJA 3DFNA 3UPWA 3W72A 3RU8X 4EWJA 3SGUA 2X2YA 3MP3A 3U2CA 3BG5A 3STCA 4MYXA 4C6MA 4KRZA 1U33A 1FDJA 3ZMRA 3WFAA 3W7EA 4GNVA 4O53A 3ISIX 1Y7VA 2V3GA 2YXGA 1W9VA 1RHCA 3B8SA 4C1KA 6REQB 1G94A 1ZBWA 1CPUA 2TRSA 4QM1A 3VFCA 3P3BA 4RCXA 1Q8AA 5EY5A 1RD6A 3DENA 1ZCCA 3LD5A 4JIEA 1ZTVA 2I57A 4QAWA 1PZ2A 3UR8A 1OABA 2OZ0A 4LAOA 4UOQA 2AGTA 3VOHA 2F6KA 3S2MA 4QG8A 4GLEA 3IAPA 4LV9A 2FVMA 3A47A 4JYFA 1MUMA 4GXMA 1UC5A 2ACRA 4I6VA 1VIWA 4XIMA 4BF7A 5K4ZA 2YA0A 1K4HA 1MDLA 4XTIA 4G1KA 2HTMA 2WZTA 4LY4A 1F76A 2XISA 3IGSA 1ZGDA 2J74A 3LGGA 2QCHA 4LS0A 2ZTJA 3OGSA 2YDAA 3KOFA 4UR8A 3VGFA 2H8XA 3CT7A 1LUCA 1HO4A 2VOTA 1TTQA 1I60A 1JNEA 3OYXA 4GKTA 1MXGA 3K5XA 4ZVJA 2VFGA 3GK0A 3KBNA 3TX9A 1OM0A 4US5A 2C1HA 4ZE5A 5FSEC 1LLOA 1VFLA 2VCAA 1YKWA 3WJWA 1ZAJA 5A6AA 2JQXA 4OIFA 3LMZA 4AFYA 3DI1A 4RUBA 4ZOAA 2OQYA 3MSYA 1C91A 4JFWA 3C86A 1XDJA 3AYTA 4O16A 4EPEC 2PLMA 1YXDA 3WLQA 3CNYA 2HXUA 3HBLA 4A3HA 2Q01A 1XSIA 5T8GA 4YCPA 5EFFA 3R11A 5H1WA 4GCXA 1OK6A 2J4GA 4NNCA 4PCPA 1CDGA 3SIMA 1W2PA 3BCDA 3GUGA 4O13A 1TG7A 3CUZA 1ONEA 3UJRA 3IK4A 2EEXA 4OU1A 1OFAA 3SUUA 2Z7KA 4EXQA 1RVGA 2EG8A 4OKDA 4PEKA 2PDKA 4GWEA 1Q6LA 1C8YA 5JXQA 1FXQA 3LZ5A 1IR1A 2BOEX 3GXDA 2YCLB 2YXXA 2AMGA 5EMLA 1FWEC 1Q8JA 3OLIA 3UWVA 4ROPA 5K9XA 1A5CA 2NV9A 1EPXA 3ZLGA 1SQ7A 2UV8G 4GVGA 3H7VA 4R7OA 1QUMA 3TYUA 1XLHA 5GQBA 1EUNA 1S1PA 3PANA 4O12A 2GUYA 4H9XA 3EB3A 4MKVA 2OKOA 3MKVA 1NQKA 4H6QA 4KERA 4L61A 3KOWA 3CPGA 4WXZA 3P0XA 5BYWA 1D8CA 4LV4A 1UWRA 1X7IA 4UFIA 1K1DA 4P8UA 7ODCA 3IJ6A 1HW6A 1FHLA 1W1B1 2IKJA 4Q7BA 3L2IA 4AMAA 3E0FA 3EX4A 3CGTA 3FVMA 4FI4A 1DE5A 4GUIA 3S6DA 5IM51 4WJXA 3EOEA 2WKGA 4MZ8A 2Z1XA 1GEHA 1RBOB 4FR6A 7REQA 1OGSA 1X1OA 4S3EA 3WNOA 1UWUA 4L9ZA 1QRQA 1QI5A 5CLWA 1WDRA 3C2FA 5F2IA 2JBMA 3GO2A 4H04A 3KVJA 2ALRA 1VJZA 4C6FA 2BP1A 3U5UA 4HBKA 4A2RA 1XIHA 1XLBA 1KBKA 1H51A 4WY0A 5ECUA 3VK5A 1AW2A 2G3MA 3IWPA 3HM7A 3M07A 1G4TA 3MHGA 2OT0A 4JICA 2WVVB 2EQDA 1OX6A 1EC8A 4G2DA 3PTKA 4C5ZA 3L23A 1R3SA 1BWLA 3NA8A 3OYZA 1CGXA 4TU1A 1X1ZA 3AXKA 1KTBA 1UWTA 4O15A 3GXMA 2ZUSA 2FZNA 1QCWA 1I0DA 1IWBA 2UBPC 3EWUA 4HPNA 3FIGA 4MY1A 1PBGA 4UNIA 2CESA 3WDJA 2E5BA 2EO7A 4J2PA 3B03A 1WDWA 3IVSA 2XIMA 2GL5A 2YR1A 3DGBA 3GU9A 4DF0A 5FIPA 3LHTA 1QW8A 1K03A 3EX2A 3OIHA 2QCMA 4LC6A 4KQNA 5EYWA 3CB3A 5IFPA 3L0KA 5CGQA 1TRDA 2QJGA 4GUFA 3TYDA 3QYSA 2HS8A 3MA8A 3N29A 5BU6A 3FXGA 4H6RA 2CITA 1VEPA 2XVPA 1QMLA 1JUBA 3F03K 3CWOX 3ABRA 3L2LA 4NAFB 5AHNA 3Q37A 1FUYA 4AY7A 3CAVA 3GC4A 4PB3A 4MNMA 2JF6A 3TXVA 3UGVA 2Q71A 4W86A 4LGXA 5CBBA 1WDQA 4CN1A 4K37A 1XISA 2PTDA 4WEVX 4PE8A 4AEFA 7TAAA 3APGA 1BD0A 2WC4A 1SYTA 4A2SA 4MTVA 3I6EA 2WXDM 5DELA 4LUJA 5JMUA 3UZJA 1G69A 2GJLA 4KFNA 1HL2A 3CV1A 4ZL1A 4J40A 1XX1A 5HWNA 4DJFD 3TC7A 2ALDA 1GQLA 3O07A 1XI3A 2E9MA 3GTFA 3T2OA 1Q4WA 1XWYA 2BY0A 4ZOBA 3PTMA 4WLCA 4JFTA 1Z89A 3RITA 4HK6A 2GJXB 2VGGA 4MNJA 1M6JA 2I56A 5ECVA 3C2EA 4DO4A 1E51A 1HJUA 2FVLA 1US2A 5KETA 2XPKA 4MWAA 4IZGA 1DXEA 4XWUA 2WNNA 4XAYA 5LIYX 4Z1YA 1J96A 1CGYA 3HO8A 1ZAHA 2X30A 1DPMA 1EJRC 4OOUA 5CZTA 4JTSA 4JTAA 4D1IA 4LB3A 5I3JA 2PDLA 2VFEA 3ALFA 4Y90A 3GZ3A 4H8VA 1EUAA 2CBJA 5ABGA 2QDEA 1WOBA 2UY2A 1BHGA 4JN7A 3ZVHA 2VR5A 1CWYA 3P81A 4CU8A 1B0IA 4DIAA 2YCIX 3K8MA 4S3FA 3TR9A 4HNVA 3B8IA 2NV1A 5GJPA 1YRRA 3CO4A 1PZ1A 1AH0A 4L6DA 1Q6QA 3F2CA 4LNYA 3GVRA 4MSSA 3PTQA 4JL1A 4R7JA 2HRWA 3GB6A 3WQ5A 1TMQA 1UZ4A 4Q8WA 4Q8VA 5CCZA 4JDYA 4GMEA 3PG8A 3LM3A 2IKIA 1JF6A 4NY2A 3S83A 3GIPA 1SR9A 3JVAA 4HQVA 2ZKMX 3CH9A 3G0UA 4MLRA 2WLYA 4Q4SA 1A3HA 4JTUA 3V4BA 2CXEA 1Z6KA 3VOGA 3W7RA 4DJFC 5IOBA 4WDWA 3ITGA 3LPOA 1K4GA 2YLLA 2E40A 5BNKA 3WCZA 3VX1A 1VHNA 1OF6A 2QXWA 1BKSA 1P7TB 3FS2A 3VKJA 1C8VA 1UMLA 1LWIA 1XBVA 3WENA 4FF5A 3GVGA 2W9MA 3QR1A 2QJNA 5REQA 2HE8A 2CNCA 3AFBA 3FX4A 3KBSA 3BQ5A 1FWFC 5AHEA 3DH7A 5LKYA 1KBBA 4Q6JA 4V2XA 3S2CA 5HJXA 3LGEA 2QVNA 4F0KA 1XYAA 3OBKA 5A6BD 2FLIA 2OCZA 2OZ3A 4FIRA 3CV2A 2OO0A 3S2JA 2HCVA 3HJZA 3IPWA 1LQ2A 1YXYA 2D69A 3NXFA 1TJ0A 1MFVA 2ZUUA 2OXNA 2VQTA 3E74A 4DLMA 4OWGA 4JD4A 1HKIA 4Z1BA 1QTWA 1R87A 1TUFA 2Y63A 1KLYA 2HSAA 2O0TA 3FHQA 2A79A 3TYEA 3UVAA 1CB2A 2WHJA 4MJMA 3GU1A 4UOZA 2W92A 1UD2A 4DUWA 4PSPA 3KVKA 3THDA 1HIZA 1G1YA 1HL9A 4UZSA 3M0YA 1RK5A 2PTZA 4ORIA 4A8RA 4ML4A 1QW9A 3MPGA 4JIHA 1THFD 1PDYA 4HPHA 3T78A 4V15A 2CLOA 4D6GA 2IPFA 1XF0A 1ISVA 2CBUA 1L6WA 1A5AA 1RJQA 3REQA 3EGJA 4XISA 5LGZA 3SQMA 5M03A 4I9TA 2VC5A 1ZAIA 4FA3A 3AS0A 3UPBA 1J2BA 1CX9A 2JKAA 4JEJA 4I5RA 3GW0A 1QHOA 4XG1A 4YVPA 3W2NA 2OTDA 3MTWA 1LG1A 2G97A 4HHPA 4UQAA 3KHDA 1XYLA 4GI4A 1VLWA 3KP0A 5DN1A 1O4UA 2XSXA 4FMVA 3QHNA 3AZRA 2PE4A 5D33A 3AHYA 1GHSA 4YTRA 1IGSA 1KLZA 5HQEA 3P5ZA 3M5YA 3SI9A 3WLJA 3KBVA 4PUUA 2ZTKA 1YBQB 5GVJA 3A4WA 1TCDA 2VEFA 2R14A 1HG3A 1RR2A 2DZXA 5CAHA 3MYPA 4N6FA 4C6IA 5PTDA 2H3BA 1TPEA 3PWGA 3NWRA 4IIHA 1EJVC 4I3GA 1TVPA 4KETA 3RM4A 3RRXA 4G8TA 3BC9A 2BHZA 2BXZA 5A6KA 1H7PA 3GQYA 2J47A 3PR2A 1GW9A 1OCBA 3PZGA 1EZ2A 4A8NA 5AC7A 4MB4A 3WD2A 3DBNA 1LDCA 5C5YA 1GOIA 2XH0A 3IJDA 4IX0A 1JCNA 1Y0EA 5KSWA 1U1JA 1YQ2A 1QWGA 3K4DA 4EF8A 3NYDA 3HB9A 4AD5A 5JQ9A 2O7QA 4CD8A 4H9MA 3BOLA 1CB7B 1QBAA 4GNKB 1IR2A 3W7JA 3G3MA 1V6VA 1ZFJA 1M04A 4LAUA 2Y5SA 1EOKA 2VJXA 3S46A 3HJEA 3VABA 1S38A 3OLGA 4FLOA 1JYXA 2BLEA 1DVJA 1UOZA 1XH1A 5AKQA 3AALA 3MDWA 5AYZA 4O1DA 3T1GA 3DFQA 1KW1A 3ZQ9A 2C1GA 2NV2A 3WJSA 1XPGA 3N14A 1F74A 2HPIA 4LTSA 3QC0A 3VD5A 3QRHA 2ACQA 1NEYA 3L21A 3NDYA 1PX3A 1SJDA 3C2VA 3BSMA 4B5VA 1G67A 3A4JA 2A6NA 4MFDA 3ES8A 4AF0B 2R94A 1J0KA 1V4YA 4BKNA 2DZWA 1TPC1 2D23A 5GNZA 4M6VA 3QMRA 3HG4A 1KV8A 1UZHA 2DZUA 4H1ZA 4Q4KA 3VFLA 3R89A 3VKKA 4GVHA 4L4MA 1ZNNA 4B91A 1FDZA 2XSAA 3ME3A 5MKGA 4KW2A 1W9BM 1OT2A 5AB3A 1ML1A 4W7VA 5HUOA 2B7PA 4C5YA 3WD0A 3KWSA 3TW6A 3DDMA 4G7EA 5C9RA 2VYOA 4XZ9A 1V6WA 1DTUA 1X8CA 2NXGA 5BOEA 5LSMA 3CMJA 4JQ1A 4DBSA 8TIMA 4GZIA 2X1TA 4ZQMA 4ML9A 4D71A 2Y1HA 1G4PA 4WJEA 5HPOA 4UIOA 3ZR6A 2P0IA 3NUKA 3KE0A 3IARA 1DQXA 3NQ6A 1XIIA 4IQLA 1IIHA 4KF1A 3BJTA 3QMSA 5FF4A 2J77A 3M0HA 5LIKX 2ZWZA 1J6PA 1RBLA 3WK1A 9CGTA 4P7RA 1LRNA 3ZT6A 4QSFA 4B9ZA 3BMVA 2RKXA 4WKAA 2ZUMA 3BJSA 1IF2A 4MZYA 2GGHA 1OIFA 5I2UA 3AIRA 2Y8VA 2WK2A 2BY3A 1QNVA 4J3ZA 3WQPA 1WAWA 5CQ1A 1YDOA 3OZMA 1A4LA 4XBKA 1ITQA 4MUZA 3FV9A 3WLNA 1TKKA 1LOSA 3GDMA 3SRFA 3W38A 1ZPTA 2PBGA 3WLHA 5AZ0A 3RPTA 4RK8A 4W84A 5TNVA 3PZMA 3RG6A 4K38A 4HNTA 1FFQA 2HBVA 4YWSA 2V2CA 4ES4A 1W1PA 3UPMA 1ODZA 3AMDA 2D0HA 1A5MC 1L9WA 3VD3A 1JCMP 5DFAA 5BW6A 3OB8A 4JQ3A 1EXPA 4Y96A 3WO8A 1ZBVA 4O54A 5XINA 1WP6A 3CQKA 3TWAA 2GVYA 3DC8A 1MZRA 2E8YA 1J18A 5JBEA 3IJLA 3SCTA 5CH9A 3RCYA 1E9ZB 1S46A 3TW7A 5FF2A 5FEPA 3BLLA 3P14A 1EWEA 4LUIA 1C92A 1HO1A 3CH0A 2G37A 2INEA 2VVNA 2WMFA 2CPUA 1OFQA 3E2RA 2QF7A 5HNRA 4D8LA 3WG6A 1SO6A 2WZHA 2A85A 5AVNA 3A24A 3ZS4A 2DP3A 2PZNA 6REQA 1KM1A 3CZLA 3XIMA 3UXIA 2GUUA 4Q4MA 5HJLA 3OBEA 4KRTA 2YCEA 1EZWA 2BASA 5CKSA 3INPA 2PI6A 5G5IA 1SZRA 1UD6A 4AD4A 2X1SA 4TOQA 1N8FA 4XV0A 2WHMA 3O9NA 3CQHA 2FFIA 1XYBA 3KXQA 3CZGA 5H8PA 1H0GA 4WSHA 2AMXA 2NX9A 2BMBA 3FAXA 1R9ZA 1F9CA 1AH3A 1QWKA 2IXUA 4JTJA 5A69A 1EHNA 1XIEA 1Z48A 3N9SA 3C3NA 4HT3A 1TV3A 4AY1A 4UTJA 3TW9A 1F6YA 3CV7A 4FNRA 4YCOA 1FWJC 2ZE0A 5KINA 3OA5A 6TAAA 3LXCA 4GY1A 5LIUX 4NRSA 4NJGA 5JBFA 2AAAA 3GWQA 4QJ1A 2VQUA 3WQVA 1DWHM 3SZ8A 4A8IA 3W82A 5DXXA 1BYCA 1CXLA 1NVMA 4K68A 1RJPA 3UGRA 5I3HA 2QCDA 1IWPA 3UY7A 4GVFA 2G50A 1HNYA 3B9AA 4HYRA 4MPQA 3OLDA 3W87A 3E2VA 2CLEA 2QYGA 4JYDA 5LA2A 4ATLA 2VC6A 1HJVA 1XGDA 2GYIA 1QNQA 4DXKA 1JCLA 4BEUA 4GKLA 4IH3A 4LVGA 1W37A 1VH7A 1F6KA 1JL8A 1O1HA 4ZODA 4FALA 3W1UA 3IV3A 3ZSSA 4WQ6A 2EG7A 1XC4A 1XUZA 1SSGA 2REQA 4L4PA 4UTTC 4LCSA 2ON3A 3CL7A 1HXJA 1UUOA 2JEQA 1RCOB 1JIBA 3CWHA 2P5NA 1E6ZA 4UWMA 4D6FA 3FYOA 4QNEA 3UG5A 4DO5A 4P7LA 3UZYA 4M51A 1JPHA 3WK3A 2J13A 2FQIA 4C6EA 2PWGA 4JPGA 1RD5A 2ZXBA 4FK9A 4IXXA 2EPMX 3TUUA 4XKYB 3G22A 3HG3A 4E6MA 3KS5A 1A5OC 3CUIA 2VEGA 1EGZA 1UWIA 2PP1A 3W83A 5M2FX 3T42A 3WH5A 2PEVA 4BWLA 1W9DM 2PDJA 4I6KA 1RCQA 1JVNA 3AMLA 3ARYA 2VZUA 1MMFA 1BRLB 4JCMA 1RQEA 1J01A 4UFLA 3U7VA 4U2YA 4JFVA 4F2BA 1TV7A 1DHPA 1QNSA 2DDXA 4PTVA 3LQLA 3QVQA 4J9JA 2VC7A 3E0VA 1FWTA 2DFAA 3WD3A 1AJZA 4UTHA 1LP6A 3U2OA 4JTTA 4GO9A 3K8LA 1J2WA 1J0IA 1DQWA 3KUMA 1W1A1 1UQYA 3AMKA 3WJZA 3DERA 2P8CA 1GTEA 3IRSA 3N6JA 3RF9A 2VFDA 4HJFA 2E28A 2CEQA 3DKJA 1R9YA 1XQLA 3DEQA 3L12A 2IKHA 1QT1A 5JUVA 3N18A 3VX0A 1P4CA 2X16A 4NZ5A 2NSXA 3W7NA 3MP4A 4H9VA 3GD6A 4HU0A 2QV4A 4AC7C 2WVVA 2NVDA 1KGWA 2WBGA 2ZUWA 1XS2A 1SJAA 3TOYA 3NVTA 5G2HA 2RH9A 2FPVA 3P67A 1HP4A 3E5PA 1ISYA 3II1A 3MCMA 4GPNA 2F2KA 2I14A 4LJ3A 2E3ZA 3AZSA 3NYZA 4CD6A 2YA2A 4TMCA 2NUYA 4ICCX 4TMBA 5FI8A 2ANUA 1RCXB 4XBSA 3K46A 2EPHA 1W3LA 1K70A 3HOJA 2QT3A 3QGAC 5BRQA 1V6YA 3ZJ8A 3ZR4A 4HPXA 4EWND 3UJSA 4AX6A 3LRKA 4NZCA 3RXZA 3NCOA 2O7SA 1H63A 3L4TA 3TXZA 4S3DA 2ADAA 1UROA 2AQOA 3IANA 5ABFB 1PWMA 3KP1A 3WLSA 2OWXA 2OELA 3WLLA 1XIBA 1C7SA 2ZE3A 4GZJA 3T81A 5LXEA 1I8JA 4IPPA 3CUGA 1A80A 1JZ8A 4NAFA 2ZICA 3VKCA 4MJ4A 3SURA 1YIXA 3NQ7A 3WH8A 2G3JA 1U30A 4GYPA 3WNPA 1UG6A 3SGZA 3AWOA 4PCSA 3WMSA 1CLVA 2BG5A 3B8WA 1H1ZA 2XN1A 4HA0A 1L6SA 1LT8A 4GH1A 4S3JA 1EFZA 3IIXA 4KESA 4A8LA 3H7UA 4IMDA 3VDGA 2NQZA 1PAMA 4E2DA 3B4YA 1E5JA 3IGXA 3KCOA 4QCFA 1HKMA 4GO8A 1GCYA 1W54A 2V2HA 3PB2A 2D73A 1PKYA 5D4YA 1GQJA 2WCAA 1EJUC 1LCOA 2W3ZA 3STFA 1E4IA 3PVFA 4O8RA 4DQWA 4MLJA 3AMCA 2OPJA 2YB1A 2I17A 4R9XA 1ZSXA 2GJXA 1AZ2A 3IJIA 4S3GA 2QCEA 1EEPA 1W9XA 1FWRA 4AD1A 4B2DD 1FP8A 3VU2A 1VZWA 4KBXA 3THQA 2ZZ7A 1QPKA 3NOYA 2WYSA 1RBAA 3P80A 4QDWA 3O0KA 3AS2A 4CQCA 3RX3A 3QW4B 4HKPA 5A2AA 1V0MA 2Y7FA 4KWVA 4O18A 1OZMA 4DPPA 4EPKA 2PUZA 3TN5A 3TZFA 3KS6A 2DIKA 3IK2A 3PNZA 3VDHA 2QCCA 1NARA 1P6BA 5D38A 3QQ0A 1OX5A 2BHYA 2NSOA 1P1XA 1FH9A 2D2JA 2VX4A 4B3ZA 1GOWA 1UA7A 5AY7A 3WLKX 1YLVA 3M0XA 1W32A 2O4MA 4XZLX 2NZLA 4FR1A 4OBRA 1AODA 1C9DA 3SFKA 3FA3A 1D7FA 2GVJA 3TSBA 4UQDA 3R0DA 3AXHA 2WZMA 3GZAA 1IXOA 3PBMA 2RHGA 5F4SA 2PS2A 1A53A 4M80A 1E6PA 1VPQA 4Y7EA 3G6MA 3NPVA 4FXRA 5B7ZA 1LORA 1F8MA 3W22A 4U5IA 1ZUAX 1TZ9A 3PZUA 4ZTXA 2V30A 3W7LA 3FSUA 3W27A 5TBOA 1MSSA 3BV7A 3NAVA 3EA1A 4UTMA 1XM3A 3M47A 1PV8A 3GR8A 2Y5JA 3H55A 3LBOA 3OPSA 4JBRA 4MF4A 3BAYA 3WBWA 1TJRA 1Q6OA 1YXCA 4NU7A 3ATYA 3Q58A 2PGWA 2H90A 5D05A 5CAKA 3BOFA 3G1YA 3WNNA 4LRSA 3TKFA 2PFHA 1WKEA 2JK2A 3M5ZA 4TX9A 1JDCA 3R2GA 1Q6DA 1FWNA 3GAYA 3EYPA 5BZAA 2Q02A 3OVQA 3MVIA 1TWZA 3XISA 5IFTA 2J8GA 1WDSA 3T0AA 4URIA 4JYEA 1MWOA 4BA0A 1UWAA 2DSVA 4GQRA 3W81A 1BF2A 4CD7A 3WLIA 3RAOA 5KZMA 3SGGA 1H7NA 1VJSA 4QQUA 5HNNA 1VLIA 5HA7A 4IMCA 3BLFA 3VIJA 1E9IA 4DJED 5G2IA 3GC2A 2PGRA 5DEZA 3W85A 3BW4A 2DZBA 4ATWA 2ZADA 4WXYA 4AZ5A 3OQ8A 3A4AA 4BJHA 2FYMA 4XK2A 1KM4A 1TZZA 1CT5A 1K6WA 1Z42A 3W02A 4LCRA 2ZBTA 4KGLA 4MJZA 1FWBC 3NFUA 3OJGA 4WD0A 2ICSA 1XYMA 1F8IA 2X1RA 4CN4A 2RGMA 4JTFA 1CW2A 4QROA 1OJXA 4Q6XA 1LQAA 1NFPA 1H09A 1HFBA 1N2VA 1K9FA 3TTEA 1S3HA 4OQVA 1FRBA 3QV9A 8RUCA 1P6CA 1Q63A 1P48A 3S9IA 1IT0A 2C1IA 1JDFA 5TD4A 4IFKB 1E5NA 4YIWA 3W7HA 3EOSA 3DG6A 4JKKA 1VB9A 3U6WA 3EXRA 3PPFA 4HZ7A 1WBJA 1I75A 5BOOA 1KD0A 1UBPC 1YBQA 1P1MA 3MBFA 4DM1A 1YDNA 3SB0A 4I7UA 1DKWA 5EMJA 3ONCA 3D47A 4AD0A 4YTSA 2E4TA 5H8UA 1HJQA 1J8VA 3AJXA 2BGNE 2ZX7A 3IVTA 4R85A 3ES7A 3ZVIA 1FCQA 1EC7A 1HF6A 4DBDA 5JIPA 1KXHA 3I7QA 1P0KA 4M19A 4P8VA 3QQ1A 3ARWA 2NX1A 2V8ZA 4DM2A 2A3EA 4ZQPA 3ZJ7A 2XWDA 4DJEC 3WEMA 1F07A 4FB7A 1VFUA 2J78A 4PBFA 1KRCC 2VD9A 2A7RA 2HK0A 2GJRA 4Q4OA 2HNEA 3T4WA 4FAMA 3RYSA 1BKHA 5AFDA 3WBXA 3N2XA 5CZ0A 4G6CA 3SJNA 2CHRA 1GG1A 4US5D 2J7GA 2W91A 3ANVA 3G1VA 4AF0A 4AZHA 3S9YA 1GUVA 3CBWA 3LHYA 3W6MA 4MG4A 2AOSA 3QTPA 3LDVA 3LK6A 3DG7A 1QU4A 1CNVA 4I7VA 4O17A 4CQ8A 1E6RA 3BSHA 3CHFA 2G3IA 1H62A 1XIMA 3LTPA 4K7VA 2ZZ5A 3UY8A 3CJPA 3JR2A 4WF7A 2YCKX 4KCWA 1O60A 4TIMA 3GY1A 2G41A 2A7PA 2VL4A 1GHRA 2W67A 3AIQA 1WKFA 1VS1A 2OR2A 4WKFA 1IEIA 3VNKA 1E43A 4X0VA 1PB0A 1CXKA 1L6FA 1LUCB 4AYGA 3STGA 4IUOA 4HPJA 1CXHA 3VE7A 2FGLA 4EXAA 2YJQA 3EDKA 4IP7A 1K02A 2NWRA 4CU7A 4BS0A 4K1GA 3WNMA 6XIAA 1UJPA 2XFFA 3VPLA 2YGYA 4U3AA 1Q85A 3KCLA 3TDFA 2TMDA 1EXBA 1C3FA 5HXMA 3V1HA 4FXSA 1V03A 3UXLA 4ZQCA 4PN2A 5IHRA 3WY1A 2ZC1A 1DEDA 2X09A 1MZHA 3LTYA 1K8YA 5HPCA 3I6RA 2PDWA 2ACSA 4LVDA 3KVMA 1X38A 1IHIA 2VGBA 2ZXAA 1JQVA 5FJRA 1W3HA 1XIGA 1ME8A 1TB3A 3W1MA 3SJ3A 1AG1O 2YA1A 2OQLA 3L68A 5CG0A 3WD4A 2OWCA 1PZ0A 3W2UA 1K8ZA 4PTNA 4AD2A 4UTKA 3PZQA 4RPPA 1ITXA 3VC6A 1DTNA 1R2SA 2BGSA 5JBDA 4U5KA 7XIMA 1IGWA 3QPZA 1OX4B 1IEQA 1EA0A 1WKDA 4IISA 2ZX5A 3LCHA 3TAKA 1DIOA 2Q8LA 3L4UA 2GVGA 5CC6A 4LH8A 4AX7A 2WCSA 1TIWA 1QO2A 3U2ZA 3V5CA 5HWMA 3BDKA 1QVBA 4RXFA 2V5DA 3BZJA 3VI2A 1EIXA 5CXPA 5IXEA 4S38A 1FY6A 2DVUA 4GBUA 3EKZA 3FYYA 2VEKA 3RDKA 3VINA 3WMCA 2A2IA 4CCDA 4TX8A 1ISZA 2ZXQA 3ARZA 4E38A 2YW3A 1HGWA 1QI2A 1OSEA 4HU8A 1KRMA 2Y61A 3G2GA 1C9WA 4IGMA 4F3HA 3USBA 3F5JA 1U5JA 1PCWA 4F0SA 2CBVA 2DU2A 2PCEA 3IUDA 5GJMA 5DCBA 3EWXA 2V5BA 4WSKA 4HNUA 3OGVA 5I3GA 5LNUA 3A5VA 1UD5A 3HPAA 2OFJA 5HR6A 5EBAA 5TQLA 3H22A 3L4YA 3PPHA 1TPB1 1J0ZA 3G0SA 2QCFA 3TN3A 4NYUA 5HMDA 3P2VA 3H2EA 2NX3A 5KZ6A 2A3BA 4JNZA 3RJYA 1K8CA 4XX6A 4GQGA 1PHWA 3EX1A 3HGRA 3BARA 4BZYA 6A3HA 2FHFA 4MDOA 3DECA 4ONVA 3VM7A