2E68A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e68A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e68A01
3H55A 3G1AA 4U28A 3QPYA 3SFKA 4XTIA 3TAOA 3OHIA 1X1OA 5AYZA 1XDMA 3W2MA 5HWNA 4HSOA 4TX9A 4O0ZA 4JTKA 5DLCA 3UWQA 3C61A 3B4UA 4JYDA 4OQVA 4Z08A 3G3DA 2WNNA 1YDOA 5AHEA 1GYLA 5LSMA 5CPMA 2E09A 2BLEA 1TQJA 4GXMA 7TIMA 3DGRA 1KA9F 3Q94A 3HBLA 3ZFHA 1VLIA 3QQ0A 5I3FA 3GAKA 4DF0A 3ZWSA 5F1VA 4N6EA 3W84A 1JULA 2YDAA 5LNSA 4AWUA 5LGZA 4WY0F 5AN7A 3TK7A 3SIZA 2RH9A 3I7RA 3KVLA 4UTIA 3TQKA 5AC6A 3LHTA 1RPXA 1XC4A 5HJLA 1G4TA 3I7SA 1XXXA 2PRHA 2C3ZA 3NXFA 1QMLA 4NNAA 4GFSA 3KVJA 5CZSA 1MSSA 4DPQA 3FOKA 3THAA 4YL2A 3IGSA 4ADSA 1Y0EA 3E0IA 1OFEA 3G8EA 4UNKA 4NUWA 2HS6A 3E12A 4Z1AA 2E6YA 3UY8A 3QH2A 1OG0A 3E49A 4O28A 4GUIA 1LRNA 5F2IA 1CW2A 3NOEA 5DN1A 4RZ5A 1FXPA 1GTEA 1OFDA 4O10A 4E2DA 3S5NA 1TPDA 2C1HA 3DFTA 4CNOA 4OHQA 1EIXA 3GAYA 4MZ1A 4WD0A 2AGKA 1SO3A 2A7NA 3LXAA 3BGJA 4LRSA 3GNNA 3PY2A 1RZMA 1SO5A 1OHLA 3HO8A 1OF6A 4O52A 1I2RA 3G0SA 3UPWA 5LNWA 3S9YA 3MJYA 1N8FA 1Q45A 3LLFA 3PB0A 4LU0A 1ZAJA 2NUYA 4JTHA 2ZRYA 3P8IA 3TW6A 1KM6A 3LOTA 3STEA 3DI1A 3P74A 3BLEA 1FWNA 4IMDA 4IX2A 2B7OA 3UYCA 1O60A 4N9BA 1BKSA 2CLFA 5HR7A 4L4LA 3M5ZA 1A53A 1QNVA 4LOCA 1QPRA 3G0UA 5D32A 2V2CA 4OV9A 3BLFA 3GK0A 1ALDA 3W72A 4QAIA 4PH6A 2YFNA 3LTPA 1M6JA 2V9DA 2CU0A 3HPXA 2JGYA 5DELA 1IF2A 3QM3A 3KVKA 3P81A 1PE1A 4IMGA 4FNQA 2Y63A 3L0KA 3B0VC 5D02A 3PUDA 3G1HA 4D2JA 1X6UA 1W1ZA 1TQXA 1KLZA 3G8RA 3MHUA 1K8XA 2B7NA 3EWUA 2A6LA 4FNPA 1JCXA 3W2KA 1R2RA 3YPIA 4OBTA 4FB7A 4BWLA 4HKPA 2X2GA 4FX6M 2ZZ6A 4LY8A 4GWEA 4JD4A 2YR1A 1XFBA 2O7SA 1RR2A 5H2ZA 3NA8A 4BFAA 3NL2A 4UTTA 3G1XA 2JK2A 5D2VA 1GT8A 3MYPA 4S2CA 1GZGA 2ISVA 4LVGA 3L2IA 5BMWA 3TJLA 5I3GA 4JS3A 2DP3A 2RDTA 4QM1A 3PVFA 3LHWA 2NUXA 4LC6A 3EXRA 1K7FA 3A21A 4MPQA 3GXNA 1G7UA 2ZTKA 4JTUA 3V75A 1B4KA 3E02A 3P7YA 4Y90A 1GYNA 4DBEA 2ZA1A 2OT0A 4WX2A 3UWUA 1AW5A 1OFPA 1GJPA 1CX9A 2QJGA 4XBSA 1SZEA 4UTWA 3M16A 1H51A 1T96A 1JVNA 3UQNA 1EEPA 1WOBA 3QZEA 3LTYA 2EGZA 4X9SA 1IGSA 1KTCA 2YW4A 3W7RA 4FF7A 3L5MA 4Z1BA 4BI5A 3SECA 1KFEA 1PVNA 4S1FA 3TFXA 1XBZA 3LHZA 1FXQA 1XUZA 3W1XA 2P0OA 3E9AA 1HG3A 5MHBA 2GJLA 4CQ8A 3MMTA 3W1RA 5FESA 3EEGA 2QEZA 3CLMA 3O6DA 5LNRA 1SO4A 3N9SA 5FF7A 1JCJA 1R2SA 2P10A 3LX9A 5G1TA 1FCBA 3W7NA 4JTJA 4JEQA 2C15A 3LDVA 2EPHA 4IXXA 4UTKA 1H1YA 2ZTJA 4A29A 1NEYA 1OF8A 1WXJA 4UMCA 1XM3A 3HOJA 4Z1CA 3LCIA 4O15A 3LTSA 4A22A 5K9DA 4J9JA 2NWSA 3DFQA 3VE7A 1W31A 2ZZ1A 2Y88A 3P61A 1LRQA 1KFLA 1LBLA 3BO9A 2DZSA 1QCWA 1O5XA 1JQXA 2RHGA 3U2OA 1YXYA 3BG5A 4JIPA 2GQ9A 2C13A 4GUJA 1S5VA 2CZFA 4MLRA 2NX3A 2OZ0A 1N7KA 3S0CA 3NL3A 5HMSA 2OJPA 4UMAA 3TXVA 3LV6A 1FWTA 4R53A 5CZTA 3EWWA 3NZRA 2VXNA 5AC8A 2RFGA 5LKYA 1HO1A 3W7QA 5FEZA 2HTMA 5C54A 3QYQA 3TKFA 2NWRA 1W56A 3EX4A 3B8DA 3PS7A 4HSNA 2ZDRA 3H53A 4IMEA 3VCRA 1TPC1 3T40A 4UUIA 4DF2A 1XI3A 2W6RA 3A23A 4H6KA 5HUOA 2Y61A 3OEXA 4E0CA 3G1DA 2H3BA 4W9TA 4TIMA 5HULA 3STCA 5I3HA 2C19A 5D2XA 4ZQMA 3W88A 1FCVA 2HMCA 3CM4A 4FHAA 2X1RA 3IGXA 4WXZA 3TC6A 4JDBA 1AG1O 3PG8A 4U4MA 1S5TA 1L6WA 3M9YA 2H90A 4WQ6A 3DHDA 2E5BA 2A85A 5D38A 3QMRA 3GXPA 1FBAA 2JKEA 2X1UA 3THQA 2YGYA 3IIZA 3L9CA 2GUUA 1IXOA 3P62A 1I45A 1JUKA 2QCDA 3G1SA 2TMDA 3UWWA 1O94A 3KHJA 3W7EA 2A2IA 1A5BA 1YPFA 2ZZ4A 3HPSA 4NJJA 2V8ZA 5LHFA 3DH7A 5EKYA 4I7VA 2FPVA 3W23A 3F4WA 3ANYA 4YCOA 1UUMA 4HPXA 1IXQA 2W0UA 1OFBA 1QOQA 4YWIA 2CZEA 3R13A 3DFNA 1V7YA 1M7OA 1SFJA 3BPWA 5DCBA 3QW3A 4IPIA 3IVUA 3W7IA 1YPIA 1G67A 3MI2A 3DFOA 2W79A 1AL8A 1U83A 2ZCGA 1VQTA 2NLIA 3L65A 4JR5A 2VOMA 2C16A 3KRUA 4EF8A 3O05A 3TX9A 2J9YA 3GDRA 3ABRA 2QJHA 1J4EA 4JICA 2WO5A 4O4VA 3S5ZA 5CGQA 1F05A 2ISSA 1H63A 3C4UA 1EP1A 3IIVA 3PBWA 5F4SA 4K7VA 1WA3A 3KFTA 4NJKA 2NV1A 4K37A 3NAVA 1FDZA 2V30A 4O0KA 1GG1A 1KM3A 2FIQA 1X1ZA 3NNTA 4AEOA 2D73A 2A6NA 4B5NA 1F2JA 1VGAA 4O1CA 1ZJIA 1X7FA 2YCEA 3BW3A 3O15A 1LLWA 3IIOA 3W7GA 3W87A 4NXSA 3W1QA 3C0JA 2G95A 3FIGA 5DXXA 1FX6A 2E6DA 2WSYA 1VYPX 4Q33A 1F6PA 2AAMA 1F7BA 1FQ0A 2R14A 4HIBA 1DKWA 5ABTA 5K4XA 3TMLA 2FJKA 3S5OA 4LV9A 4GBUA 1VLWA 1JUBA 4PFMA 1NF0A 4LVBA 1TV8A 4OT7A 4NX5A 1OFAA 3HF3A 1TPEA 3EX1A 1SFLA 3PSVA 1YXDA 2ATMA 1RQBA 3NPXA 1LCOA 3GVGA 4LTSA 5G1YA 4BI6A 2V5BA 1GPWA 1LOSA 1P1XA 1RD5A 3LCFA 5G2WA 4CCCA 4UTTC 4MIMA 5FF0A 4HNUA 4E38A 4O19A 4ORIA 4UFJA 3IIPA 4DQWA 1GVOA 2ZYFA 3EWXA 3S8HA 3GB6A 3EXTA 3NQ6A 3BARA 4XKYA 2GOUA 1D9EA 3N14A 3T4CA 5AYXA 4HNNA 3HG2A 3UXAA 3RU6A 3WJWA 4UCGA 1VS1A 2A7RA 4KFNA 1LRTA 4MJZA 2EHHA 1XBYA 4LUJA 4UTJA 4POCA 1QR7A 4BWLC 2VFHA 1GVSA 3NQDA 4JTGA 3W70A 1LZOA 3NDOA 1I2PA 4LS0A 1V5XA 3HGJA 3OG3A 3VE9A 4NNBA 3LBCA 3HMJG 3TSBA 3TCEA 4TR9A 2ZQ0A 1A50A 1JR1A 2KZHA 1SW0A 5D04C 1GG0A 1GWJA 4UTWC 4R34A 3G22A 1ICPA 3LCLA 5HUPA 4NZJA 5HNRA 3DXIA 1HL2A 2XFWA 3ZR4A 1I4NA 3LHUA 1G69A 4O14A 1YDVA 3CT7A 6TIMA 3LCHA 4AMAA 1JCLA 2H6RA 4NQ1A 2ZRXA 4CQAA 1WV2A 5HWMA 2WNZA 3EB2A 1VC4A 1N55A 2CW6A 3O63A 1K03A 3TFCA 1SQ7A 1TTQA 4ICNA 3EX6A 3CWNA 3U6WA 3CEPA 4M5PA 3KAOA 3W85A 5SWUA 2A5HA 1TO3A 1VHCA 4ZQNA 1MO0A 1OX4A 1WQ5A 1LROA 5D33A 1ICSA 4RZ6A 1FUYA 2R91A 3LM7A 2E6FA 1ME7A 3TXZA 2EKCA 3M1ZA 4K7YA 4UFIA 1Z41A 3MBFA 3C2EA 3PBYA 4N9EA 3NQ2A 2FLIA 1VR6A 2QKFA 3EWZA 3W7MA 5AHIA 5J5RA 1OYBA 5LHEA 1FWRA 3TA6A 2CLMA 2GQ8A 4ZL1A 2PURA 1BEUA 3DAQA 2QDGA 4JX4A 5KTLA 2E5DA 5KMYA 4PODA 1KLYA 1QO5A 5CSSA 3Q58A 3RFAA 4DF1A 1R47A 3MWAA 2ZZ5A 5CZ0A 4O17A 3GDTA 3M5XA 4IGHA 4BR1A 3TQVA 4FEZA 2GVLA 3HIJA 4G1KA 3S1WA 1SZGA 1NVMA 5BW6A 4MKNA 4JN6A 4M6PA 3NQ8A 4FNSA 4S2BA 4TMCA 4GUHA 3NQVA 1ADOA 1ME8A 1XKYA 4K8EA 4UNLA 3QEZA 4IQLA 5AHFA 5EPDA 5DXYA 1VYSX 1PIIA 3PULA 3QMSA 4P2VA 3IIXA 4MVAA 1P4CA 2BXVA 2NX9A 4LNYA 2WOQA 2Y7GA 5C6MA 1KM2A 2YYUA 1WBHA 3NGJA 1QDSA 3LRKA 3NYZA 1H1ZA 1Q6RA 4NVTA 1OYCA 3BVJA 3USBA 1K7EA 1TPVA 2V0TA 2H8XA 5EMUA 4QISA 4O16A 1H62A 4YLWA 3NR0A 2E6AA 1VCVA 1H7WA 1KFCA 3S1XA 1L6YA 1OFQA 4N02A 2WNQA 1O95A 3IV3A 1TJRA 2VFFA 5F2LA 3UZ5A 3L68A 1H7OA 2FQIA 3PR2A 3GNDA 4FO4A 5T26A 4DO5A 2R94A 4JTEA 3P5YA 5D2WA 2J9ZA 2BX7A 2FB3A 4IMFA 2UV8G 4MYAA 1XBVA 4FNUA 3M41A 4DBDA 4FNTA 2IQTA 2OCZA 2TRSA 5D03A 5D2YA 5IBXA 3STGA 4RZ4A 1GVQA 3KRZA 5K2ZA 2TSYA 2QUVA 3LI0A 4OGZA 3HGOA 1Z42A 1GEQA 3PAJA 4AF0A 4HHPA 3W76A 3B0PA 5FEPA 4AVFA 5HINA 5CPNA 1PHQA 2VELA 4JX6A 1QFEA 2YYTA 3H54A 4BI7A 3STFA 4HNVA 3W9ZA 4Z0JA 3TMQA 3W1NA 5I3KA 3GZ3A 4M7SA 1EUAA 1IIGA 1AMKA 2OMAA 2Q3OA 3HG3A 3FFSA 3O6YX 3TQ0A 1W3IA 2CLLA 5E93A 2JKAA 1H7NA 1G4PA 1PS9A 1TIMA 1PL9A 5TIMA 4QNEA 2NUWA 3SZ8A 3NL5A 1XDLA 5F1UA 1FCQA 2A1YA 4WUIA 1H7RA 1VRDA 1HTIA 3TNOA 3UXDA 1VPXA 3EX2A 4LS2A 1EA0A 5D09A 5AFDA 2XN2A 4MUZA 3FS2A 1D3GA 1BWKA 3GDLA 3LV5A 3W1LA 3QPZA 4DELA 4KKXA 3HB9A 1AW1A 5G2IA 4DO4A 1RQEA 1TREA 3ZS4A 3MP3A 2C6QA 1WBJA 5AHNA 8TIMA 2QJIA 5EYWA 3I7QA 3OVQA 4IOTA 3W1UA 3NPUA 1QPQA 4MY8A 4ADTA 1FCUA 5FI8A 4NNCA 3RMJA 2EF9A 3C2VA 3PBVA 1J2WA 4BF9A 2DU2A 3LI1A 4UR7A 3NQFA 4QSHA 4AB4A 2B4GA 1VHNA 1GVFA 5AB3A 1LTDA 1WOAA 1XCFA 4LS1A 3UY7A 2QUTA 3O1NA 1W5NA 3GDKA 3M5VA 3DHFA 4JXCA 1LOQA 3BK0A 2PCQA 3G24A 2J88A 1DVJA 1YTKA 1DBTA 1WX0A 4H4IA 4CCEA 4O18A 2Q3RA 3MO7A 2TYSA 2YX0A 3C2RA 3DENA 5IBXC 1TB3A 1OFOA 4UFKA 3GDMA 4NZFA 3L67A 3KVMA 5DBTA 1LP6A 4IUOA 3A9IA 4RLIA 1Z44A 2CLEA 3M43A 2CLHA 3PSWA 5FF4A 2Y6ZA 2HS8A 5K4ZA 1CI1A 2PRLA 4P61A 3SI9A 1U5JA 1MXSA 2QCGA 3IEBA 3A5VA 3TSDA 2OT1A 1W0MA 2V5LA 3MI3A 5G4EA 2ZA2A 2FDSA 2ZRVA 1HFBA 3LB0A 1OFRA 1K8ZA 3B05A 4XBKA 2Y70A 4JDYA 1W5PA 3P67A 4AXKA 4WOZA 3M44A 3B04A 3C6CA 3QC3A 2GVGA 3FKKA 4ZMGA 3N34A 1H50A 5D05A 3EKLA 3CB8A 2ZBTA 1MEWA 1G7VA 1VCGA 1FWSA 2V2DA 5FEXA 3OVRA 1ZAIA 1GOXA 4JYFA 4UIOA 2J6XA 3LXBA 3BG9A 4AWTA 1R30A 1IXPA 3A5FA 2QCFA 3QW4B 3W7PA 4Q32A 4Z1DA 1Z48A 3W73A 4XUGA 2ALDA 1VCFA 3F1QA 1OK4A 4AHPA 1JQVA 4O54A 2I14A 3PM6A 1SSGA 2A21A 5U7SA 3S1VA 4LW7A 3RLUA 1Q6QA 4QJ1A 1B4EA 2TPSA 1AW2A 5I3IA 3P8JA 1OJXA 4DPPA 2DZUA 4N9DA 5AOUA 2I1OA 3E96A 5LZLA 4O11A 3KXQA 4UMBA 2LLEA 1HO4A 3G18A 1YLVA 2G5WA 2JKPA 1J5TA 1TTIA 1RVGA 2VKZG 5CPOA 3TV8A 2GVJA 4UTHA 4K38A 1TSIA 4NU7A 3W75A 4HPJA 4UTLA 4NJIA 4TO8A 2FPTA 4GUFA 4CCDA 3MHGA 3GLCA 3OVPA 5E0KA 3SGUA 3CHVA 4RR4A 1IIHA 3GX9A 2QCMA 4MZ8A 4KWWA 3HQ1A 3W07A 2CLKA 1W5OA 1W54A 1QAPA 3ABOA 5F4WA 4EIVA 2Q8ZA 3GR7A 4UFHA 1LYXA 5FEWA 4IWWA 1TTJA 5CPLA 3TE9A 3NM3A 2E1DA 3VFLA 1PCWA 4XQ6A 2QUUA 3LBMA 3N2XA 4RXGA 1I2OA 3O8AA 4PL1A 4LUIA 3NZ1A 3W1PA 4HN4A 3NVTA 3UWYA 5L6UA 3GXTA 4FNRA 3CIWA 4WY0B 2J24A 3UWVA 1Q6OA 4TU1A 3FJ6A 3RF9A 1FDYA 2NXGA 3WFAA 3LCXA 1O4UA 2EAWA 3LRMA 4M7TA 2BSLA 3UPBA 4OV4A 4WXYA 5AHLA 1SZFA 4A2RA 1H7XA 1T0OA 1JCNA 3L0NA 4JX5A 3PUOA 5CZJA 2V82A 4NJHA 3R2GA 5GVJA 3DZ1A 2C0AA 4TMBA 4UC5A 2DZTA 3I68A 5DCEA 4K8HA 2FTPA 1E51A 3P80A 1YADA 4ADUA 1QPOA 4ONVA 2WSRA 5DY2A 3CQ0A 3FYOA 4C1KA 1MEHA 2ABAA 5AYYA 3P82A 2Z2UA 2VFGA 3MBDA 1KV5A 1EX5A 5F2MA 1TPWA 3MW7A 3W6YA 4LRTA 3T78A 1SSDA 2V81A 3U8GA 1DOSA 4FX7A 2ZFAA 5KINA 3WJZA 4A3UA 2ZZ2A 4JTFA 4XWUA 3T44A 4M6VA 3GR8A 1NSJA 3W7HA 3W86A 3HG4A 2CWNA 2OX1A 2HSAA 1KM1A 1LBFA 2Z1BA 3SGZA 3UD6A 3L5LA 4AAJA 1F74A 4MLJA 3NEVA 3G3MA 4FIQA 5TQLA 5DY3A 3WJXA 2AQWA 2QAPA 3TUUA 4PL2A 3S5YA 1F6KA 3S6DA 4IX0A 2VFEA 2VFIA 4MZYA 5DBUA 1P0NA 3FKRA 3SY5A 3QF0A 3EWYA 3W7CA 3NQ7A 3Q2DA 1PV8A 4UTMA 6ALDA 3TSMA 1K02A 3EXSA 5CKSA 4M19A 1TJPA 1MEIA 2DZVA 4PC8A 2F84A 4MOZA 1ZALA 4UFMA 3AO0A 3JR2A 5FF3A 3ZWTA 1JUEA 3JS3A 4O57A 2Y89A 3PUEA 2Y85A 4Z0SA 1A5CA 2Z6IA 4JTIA 4I7WA 2DJXA 3N3MA 4IJBA 1UBSA 3A22A 2R8WA 2DZPA 1C29A 3C8FA 3V1PA 5K3VA 2DZXA 3TJXA 3ABQA 3DU0A 5D37A 4Y9AA 1AK5A 1EB3A 4JYEA 5CSRA 3T7VA 2CLIA 4A21A 1H5YA 3DKJA 1DORA 3NPVA 3TC7A 1DHPA 3IVSA 3CIXA 3ATYA 1YDNA 3NQMA 2CLOA 2CZDA 3OIXA 5U4NA 3L21A 2RDWA 2NX1A 2VC6A 4WY0A 5F2GA 1P0KA 3QQ1A 2QCDB 3IGUA 4KFPA 4MFDA 3UNDA 5C2XA 3B06A 1TYGA 4IXHA 3LCWA 4AF0B 5J5DA 1DL3A 2ZA3A 2ZRZA 1UJPA 3K30A 4GE8A 1NAL1 3LLDA 3FYPA 3W7JA 3QRHA 3QSRA 2QCNA 5EA9A 3NQCA 3C2FA 1H60A 1W8SA 3GKFA 3VI2A 5G4WA 1TPH1 3M7WA 3W3OA 3LCGA 5K7JA 1TPUA 4CNNA 3TU9A 1ZY9A 3PG9A 2PC4A 4NT0A 1TCDA 1WYIA 1EP2A 1OK6A 4H3DA 4O50A 3L66A 1ZHAA 1DJNA 3G0XA 2QR6A 4Y96A 3P60A 3EWBX 2V2HA 2QF7A 2WV8A 3I65A 2GPTA 1EPXA 1VH7A 1GVRA 5G2HA 4N6FA 1KFBA 2ZZ3A 3W1MA 3G1VA 4WZHA 4K36A 3W7KA 3W7OA 3FEMA 1T99A 1S5WA 2Z0IA 4CNPA 2B7PA 3LHVA 4O1BA 5TBOA 1OX4B 1F76A 4NX0A 1OX6A 1K8YA 1B3OA 2ISWA 4IMCA 4WOQA 3HGRA 1T8XA 3CC1A 5KITA 3PWAA 3W2UA 2DZWA 2JBMA 5LGXA 3C52A 1JCMP 2QDHA 5LNUA 5EL1A 1EWDA 4I7UA 3LXCA 1NFBA 4PA8A 4AH7A 4EF9A 1TRIA 2YW3A 3W71A 4O53A 4UFLA 1YTDA 4OE7A 2CZ5A 4AHQA 3LHYA 5L9FA 1FDJA 5AHMA 5KZDA 2BZNA 4ZZ9A 1G4SA 3WJSA 5AC7A 3HPZA 4OWGA 1ZAHA 3NO5A 2G96A 1HUVA 1SW3A 2C14A 1LBMA 2B7QA 3DFPA 2A0NA 1OABA 4Y6GA 4GJ1A 1R2TA 4EOUA 3T55A 1VJIA 4JIQA 2X16A 4Y8FA 4K6AA 3KX6A 3W7LA 1TMHA 4E2BA 3BW4A 1M7PA 1KW1A 2ZRWA 1UB3A 4XZ9A 1OVDA 4AHOA 3W74A 4LWWA 5EBUA 4DXVA 3R89A 2VFDA 3O6CA 1SR9A 5C5YA 1X8FA 2C18A 1W5QA 1GQNA 1QPNA 5HWJA 3ATZA 5A5WA 4ZQCA 4CQ9A 4UTUA 5HQEA 1TRDA 1OYAA 3VKJA 5DCDA 4AWSA 5LNVA 2DORA 2ZRUA 3O07A 4UR8A 2VENA 3F03K 2H8ZA 3P5ZA 3W1AA 4N4QA 1PCKA 1ZFJA 3HJZA 1W5MA 2J27A 1ZENA 3QJAA 4MY9A 2WKJA 4O1DA 1G4EA 4WJEA 3M6YA 5H91A 1QO2A 2WQPA 1S3HA 4FXSA 4YMZA 1I8JA 4X22A 1LOLA 4X2RA 1QOPA 1R46A 2VEPA 3W22A 3MP4A 3N2MA 4QQ3A 3PBUA 4ZQOA 5BOOA 1KBIA 1A5SA 4N9CA 2QCCA 1W3NA 3EKZA 3WK3A 3WK2A 1KM0A 4LVDA 4LV4A 1KM5A 2GQAA 1YYAA 2PE4A 4UXDA 2F7FA 3O16A 1SUXA 3B0UX 3QSTA 3W2NA 4K39A 4PTNA 2WJZA 3QMTA 1ME9A 3FLUA 1EWEA 2NXHA 2YPIA 3R8RA 1LORA 2YSWA 3NQAA 3MUXA 1GTHA 4PCFA 4DEFA 1TPB1 2B0MA 1WDWA 4N2YA 3ELFA 2X1SA 4QNWA 1EP3A 2NV2A 4FXRA 1XBXA 2E5CA 4IPJA 4NJGA 3R12A 3AJXA 4N4PA 5BRBA 3S1UA 4JTSA 2Y62A 3RLVA 1M5WA 2E68A 4RK8A 1I2QA 4YXGA 3M5YA 1AL7A 1F73A 2QCEA 1VYRA 3W1TA 2VEIA 3NL6A 2VEMA 2Y7DA 3GYEA 1LLZA 4YCPA 2NZLA 3L5AA 1YXCA 3RNDA 3SSJA 4QIUA 3NG3A 5BMXA 3SJ3A 1RV8A 2FB2A 3MP5A 3TR2A 3BGGA 3C3NA 1KV8A 3W7DA 1JJKA 4EWND 1H61A 3TAKA 4ZVJA 4O4WA 5BNKA 1SO6A 3FA5A 2X1TA 4ML9A 1WAUA 3PC0A 1P5BA 2CFFA 3DBPA 4LC8A 2GJNA 3F4NA 1L6SA 1SPQA 1RQHA 4MJMA 1H7PA 5KZEA 3TH6A 4C1LA 3GKAA 3BLIA 4RJEA 1L9WA 3MHFA 1FWWA 3TDFA 3CU2A 4JGDA 2VEKA 4XTDA 4A2SA 5A8GA 3HG5A 4JNMA 2I9EA 5D2TA 2FFCA 4GNJA 3I6RA 3N19B 4I9AA 2XN0A 2BTMA 1PHWA 1C9DA 1F5ZA 3FJLA 4GC4A 3C2OA 3C56A 1EUNA 4CLMA 3BG3A 3KOFA 2O7QA 3MYOA 1UCWA 3LRLA 1XUUA 3KRSA 4NXKA 1W37A 3W83A 2NXIA 1NF7A 3SW6A 3G1YA 4HNTA 1UASA 1I2NA 2YFOA 4KFOA 4PEKA 2Z6JA 2H3DA 1SU5A 3DFSA 2E77A 1TV5A 3G1FA 3INPA 4RX0A 5I3JA 1DQWA 1L2UA 3LERA 2JGQA 4O8RA 3M47A 2X30A 1LM1A 4FIRA 1TV7A 4O12A 4ZQPA 1ML1A 1XL9A 2YXGA 2ZZ7A 3N73A 5C55A 2RKXA 4R33A 1JRBA 1KTBA 4ZQRA 4XKYB 1VZWA 5G5IA 3NM1A 2PRMA 3W2LA 3VNDA 3NPWA 4DO6A 1D3HA 1G6CA 1OX5A 3NQGA 2A7PA 2Q8LA 1QWGA 2Y7FA 3Q37A 5E1QA 4RKAA 2ABBA 4X3ZA 4JTLA 5F4XA 3TW7A 1BTMA 2QAFA 4KWVA 4QITA 1Q3NA 3JRKA 3CPRA 3BV4A 3IVTA 1TPFA 3TIMA 4GRSA 1ONRA 5K9XA 1KFJA 4RV8A 1SW7A 2QCLA 3BW2A 3A24A 5EY5A 4M6QA 2YZRA 3DI0A 2Y7EA 3N9RA 4RCXA 5KSWA 4JTTA 4MYXA 1ICQA 4LT9A 1KFKA 1MZHA 5FF2A 1DJQA 2ATSA 2RDUA 3PB2A 5HR6A 3CWOX 1K7XA 2WSQA 1SZNA 3NQEA 4HT3A 5D30A 4LVAA 1B9BA 3ABSA 3O06A 3R5EA 4MFEA 3TROA 5K9CA 1C8VA 4MY1A 1THFD 4L4MA 4R7JA 5IM51 1DV7A 2J9XA 1DQXA 2G97A 3L0GA 3WK1A 4BK9A 2WPBA 3CEUA 4O13A 4RXFA 3EX3A 1Q6LA 3MI6A 2A4AA 3PF3A 3P84A 3HGSA 2BWGA 4OU1A 1YTEA 2XN1A 1KM4A 1KTNA 1JCYA 1IXNA 3M0ZA 3WK0A 5CG7A 3QFEA 3IRDA 4Q4KA 4JY9A 3UWZA 1FY6A 4FX8A 2DJLA 3WJYA 2QCHA 3OBKA 3SR7A 1UUOA 3DKLA 3W2JA 3CTLA 1TTPA 3GIYA 1LDCA 4O1AA 4EVZA 2FPYA 3RK8A 3D0CA 4JY8A 1JRCA 3B03A 4ALDA 3LGEA 1W3TA 1O5KA 3UZJA 1BWLA 1KBJA 4GUGA 3OA3A 1ZNNA 1K3UA 2P1FA 4LVFA 4ORMA 1B57A 1ZCOA 5KZMA 1A5AA 3S42A
chains in the Genus database with same CATH superfamily
2QNEA 3G1AA 3WLMA 3SFKA 4XTIA 3TAOA 1VFLA 3KHDA 1XG3A 5AYZA 3AXXA 5E6YA 4IP7A 4L6HA 1KBKA 4JYDA 1K4HA 1HW6A 2VRQA 1GYLA 5LSMA 3CZJA 4YTTA 4LEFA 1CECA 1KA9F 3Q94A 3OJGA 4L80A 2ADAA 5F1VA 4AZ5A 1C7SA 3W84A 1JULA 5LGZA 3W02A 1PKYA 3GM8A 1O5RA 1TX2A 2E3ZA 4WY0F 4ZOCA 4H2HA 2RH9A 3NQBA 3EWCA 3LHTA 1QXLA 1EZ2A 1U22A 1C90A 4IZGA 2BOEX 1QMLA 1XYBA 3ZQ9A 4GFSA 4QEHA 1MSSA 1S39A 3VMOA 4PMXA 4UNKA 3G8EA 3CH9A 1QK0A 3UY8A 3W28A 5A2BA 4ATDA 1CLKA 3E49A 4GY0A 1V0NA 2OSXA 1U1UA 5F2IA 2XIIA 5DN1A 1A5MC 4E2OA 3ZLFA 3AMGA 3OG2A 5H8PA 4TX8A 4P7LA 4CNOA 1P6BA 4OHQA 4XZWA 4YN5A 4MZ1A 4AX7A 1EOKA 2UWFA 3ZM8A 1O1ZA 4MF4A 4WSKA 2G8ZA 5I23A 2A7NA 2FHFA 3LXAA 3GNNA 3PY2A 3HO8A 1OF6A 1LWJA 3LY0A 3WBYA 4LYQA 3VA8A 4S3AA 5FAJA 2G3FA 2QQ6A 5C7HA 1Q45A 4LU0A 2NUYA 4HJWA 4JTHA 3WDIA 1WZMA 4Y2WA 5DF0A 3STEA 1FHUA 4C7GA 3BLEA 3VKDA 1JPKA 4IX2A 4AY1A 3UYCA 3CAWA 2CLFA 3N2TA 3T08A 4OBSA 1L8PA 4IGNA 1A53A 3W53A 4PMOA 4LOCA 1QPRA 2O56A 3G0UA 4GX8A 3QTGA 3FY1A 3BLFA 1PZ0A 4PH6A 3LTPA 2VQTA 2OQLA 2GSEA 5EFFA 3RHGA 5E70A 3HPXA 2C79A 4HCHA 1Y5VA 6ENLA 1F9CA 3G1HA 4MWAD 4XVDA 4D2JA 1X6UA 3G8RA 2CHNA 3VCCA 3PAOA 4OBTA 4HKPA 1JPHA 3RAOA 2BV9A 4EACA 3H2CA 3LS9A 4GWEA 2MANA 2YR1A 1HP5A 4HZ8A 4DUWA 1XFBA 2O7SA 1UWUA 3AIWA 3WNOA 4UTTA 1JF5A 4ICCX 1UR4A 1GZGA 2ISVA 3KWXA 3TJLA 2G3NA 4CNTA 4JS3A 1N8WA 3CGTA 3EXRA 2JIWA 3M0HA 2OZ3A 3V75A 1ZPTA 2DVXA 2DSKA 4I9MA 1GW1A 1GYNA 4DBEA 4BA0A 1QW7A 2OT0A 4WX2A 3WLSA 4FLRA 3RDKA 2GSJA 1SR0A 4XG1A 1ITXA 1H51A 1T96A 3UQNA 1EEPA 3S47A 2F8QA 2EGZA 4X9SA 1PZ1A 3WNKA 2OGYA 2ISFA 2YW4A 3N18A 4QJ4B 2HXTA 5CJ5A 5CC5A 2CKSA 1JZ7A 3CV7A 1FXQA 3OW1A 1R0MA 5MHBA 2ZUVA 2D2OA 4C6EA 2FTWA 3N6HA 3EEGA 3T0CA 5HQMA 1J96A 3O6DA 5FF7A 4C7FA 2P10A 1WZKA 2WNWA 3ZT7A 4KWSA 5G1TA 1FCBA 3AYVA 4JTJA 4ERAA 4HHMA 2QPSA 1S46A 1UKQA 1QNQA 2PZNA 1GHRA 3T81A 4A29A 2NT1A 4MM1A 1NEYA 4UMCA 3U57A 1QI4A 5C9RA 3HOJA 4Z1CA 3LTSA 5K9DA 1S2VA 3WDJA 4G1NA 3DFQA 4J9JA 3VE7A 3CQIA 5AVHA 3P61A 1J01A 1YNPA 3GU9A 2DZSA 5AZ1A 1XIFA 4Z1YA 1EJWC 1E73M 2D2JA 4JIPA 2GQ9A 2ZWZA 4I9JA 2QIWA 3T2PA 1OZQA 5H6HA 5FEZA 3WD4A 3DC0A 2F2KA 4LAOA 3AZSA 2NWRA 2CHOA 4FA3A 1XQKA 2PWDA 3VCRA 3T40A 2P53A 4DF2A 2PTWA 3W6MA 2ZUUA 3ZLHA 3G1DA 1VFFA 4TIMA 3EPNA 3IJ8A 1BSLA 5XIAA 3STCA 5I3HA 4HMEA 3IAQA 2C19A 2QPXA 3W88A 2FYMA 4WLCA 3TC6A 3TLQA 3PG8A 4U4MA 1IWBA 1FWEC 1Q85A 3M9YA 2A85A 2V68A 1XYZA 2VUYA 2JKEA 3PJUA 3THQA 3A4WA 4XZIA 1JUKA 5AY7A 5HJXA 3S2MA 4XBJA 1CXFA 1O94A 3TYCA 3W7EA 2A2IA 3HPSA 1NQ6A 1TG7A 5EKYA 3V16A 2FPVA 3W23A 3ABXA 1MI3A 4LX4A 4YCOA 1UUMA 5AYBA 1IXQA 1GQLA 1MRQA 1OFBA 1QOQA 1GVYA 2CZEA 4A05A 1QNRA 3OLGA 1NOUA 2PDPA 3W7IA 1A3WA 2YOCA 4D6IA 5C0QA 4JR5A 1H0IA 5A69A 2C16A 1T8QA 2QHAA 2XM1A 3KRUA 5D8ZA 3ABRA 2QJHA 2WZEA 1LQAA 2D2GA 1OGSA 1XG4A 4GD0A 2JQXA 1RCQA 1F05A 1EP1A 3CAKA 2VC5A 4AUBA 1WDPA 4J3UA 3PBWA 4K7VA 1WA3A 1KRCC 1K6AA 3NAVA 4RNFA 3CB3A 3SBFA 1KM3A 4AEOA 3GXMA 4B5NA 4PGLA 4O1CA 1X7FA 3V5FA 1YDYA 4REQA 3IIOA 3W1QA 4PUWA 2YXXA 1T6MA 3TQPA 2FJUB 2ZUTA 3G1RA 1F7BA 2VJXA 4I5XA 1J0JA 4LNCA 4C6BA 3V35A 3H4XA 1QHOA 4E8CA 3IJQA 1UWRA 1TV8A 1QNOA 1HVXA 4NX5A 1OFAA 1W32A 1XRSA 3HF3A 2P8CA 1US0A 3P0XA 1JDCA 1YXDA 1AMYA 1FKWA 3VNKA 5FCZA 1LCOA 1ZSXA 3GVGA 2V3FA 1KCXA 2V5BA 3NJ3A 3SRDA 3MWCA 5EGRA 1RD5A 1ONXA 4J3XA 3LMZA 2G0WA 4U3CA 4HNUA 3HV9A 1HJSA 3F5JA 4UFJA 3TWAA 1GVOA 4DI8A 3I10A 4ML4A 3ES7A 2PSNA 2BY2A 3NQ6A 1UP2A 4QE5A 1NWUA 3TR9A 4XKYA 2GOUA 1D9EA 3N14A 4V27A 3OHMB 4JQ1A 5M17A 2A7RA 1LRTA 3CHDA 4K68A 4ZENA 2Y4SA 1HZYA 4BWLC 2VFHA 1Y5XA 3ITVA 2J75A 1LZOA 2BHUA 3RPMA 2VT0A 4OECA 2ACSA 1HJWA 1I2PA 1IT7A 1E15A 1KRBC 4JEJA 4PBEA 2I56A 3NZQA 5A6BD 3K4DA 4MWAE 1UZHA 4W89A 1GOQA 3SQMA 3HMJG 4GFIA 2ZWYA 3TSBA 3MMUA 1MNSA 2ZDSA 1BRLA 2VCAA 4GIYA 5BRPA 4LYKA 3STPA 2RAGA 4QS6A 2EKGA 3NDZA 5HUPA 4NZJA 5HNRA 2XVGA 3OYXA 3ZR4A 3N9KA 5BXSA 1G69A 3GTNA 3CT7A 3GTHA 1EO5A 3VKAA 5IXEA 5M1TA 2WANA 2ZRXA 1EOMA 4CQAA 3GIPA 5HWMA 4E4PA 1C3FA 1VC4A 1B30A 1N55A 2CW6A 3O63A 1K03A 1OCNA 2GFTA 3W4RA 1VFHA 1X7IA 4IGSA 4DHGA 5SWUA 1JFHA 5JUVA 1JXJA 5D33A 4RZ6A 2Y1HA 3EMQA 4Z2LA 2P88A 4UB9A 4DJDA 3IRSA 3TNBA 4WVXA 4EE9A 4ZE5A 3TA6A 2PBOA 2FFIA 4DWSB 2YBVA 1RP8A 2YL9A 3TYBA 1PBGA 1UR2A 4YYCA 4IJCA 2OTDA 1KLYA 1XYCA 3RFAA 4X63A 1CGWA 4NZCA 3MWAA 4O17A 2X0HA 3GDTA 4UCFA 1PDYA 3CXOA 4FEZA 4JAWA 4G1KA 3S1WA 1SZGA 3M0JA 4MKNA 3BLPX 4JN6A 4XV0A 3NQ8A 2DSUA 2CESA 1QI2A 1KXTA 1TWZA 1JG9A 2J8FA 4GUHA 3GNOA 1OY0A 3CWHA 1ADOA 1R5YA 5EPDA 1J12A 1VYSX 3PULA 3FGCB 4MKSA 2D0FA 4R7WA 2BXVA 4B4FA 4ES4A 1KKRA 4QDMA 1UH2A 2QUMA 3UZWA 2NSXA 1WBHA 3Q67A 2R24A 1QDSA 4AD1A 3PPHA 4NVTA 2OGJA 2H8XA 5EMUA 4QISA 3MV01 4HSHA 3NR0A 1NWTA 2E6AA 4W88A 5I00A 5JH1A 1B3WA 4ECLA 4A8RA 4PMVA 3GUWA 2D0GA 5MKGA 3L68A 4DZAA 1EL3A 1E9ZB 3T2OA 3P5YA 4Y7EA 3IK4A 2G37A 3BZGA 3SSZA 1FHLA 4FNUA 3M41A 4FR1A 4AIEA 3KBWA 4FNTA 1J9YA 5D2YA 3CMGA 4H04A 1GOWA 2OWWA 1GVQA 1E43A 2JF6A 3LI0A 4OGZA 4FZIA 4YVVA 1V3MA 2YDRA 4B5VA 1CDGA 5FEPA 4AVFA 5HINA 2HXUA 2BY0A 4D6EA 4Q3MA 4BI7A 4HU0A 4P8WA 3W9ZA 2XVKA 5I3KA 4PN2A 1A3XA 4GVIA 1RY8A 2OMAA 3B9DA 3HG3A 3QHOA 3AS3A 2CLLA 5E93A 1BLIA 4A3RA 2PUZA 1JI1A 5CEWA 1XGDA 4GO9A 2IPWA 3V36A 5A1AA 1GOMA 1XDLA 2UY3A 2A1YA 5HOSA 3MV11 1VRDA 3TNOA 1VPXA 2WVVA 4Q8VA 3M0MA 3BUVA 5FJIA 5D09A 4C5YA 3A4JA 3HTWA 3SRKA 2XN2A 2DEPA 4S39A 1CIUA 1FKXA 1D3GA 5CBJA 3UG8A 1AW1A 3OZYA 3N29A 2J25A 2C6QA 1IEIA 2QLYA 2Z1SA 3H7RA 1GQKA 1ISYA 5BXPA 1FCUA 4LUYA 2XSBA 1XH2A 1R3RA 3BCJA 3C2VA 4BF9A 2QJJA 2NVDA 3R79A 4H9UA 2B4GA 1W5NA 1VBGA 2VVSA 4U10A 1X1NA 4GYKA 1LOQA 2J88A 4R9OA 3VIGA 3PZUA 1C92A 4H4IA 4O18A 4KF1A 3MO7A 1XX1A 2YX0A 3DENA 5IBXC 4HA3A 1OFOA 1J5SA 4UFKA 3UGRA 2D24A 3CAVA 1HJUA 3GY1A 2DUXA 2CLEA 5LIUX 2X40A 3HV8A 4UR9A 4ACZA 5K4ZA 1CI1A 2PRLA 5DO8A 3MQTA 3SI9A 1X98A 3IEBA 3Q65A 1PO9A 1WPCA 3BWWA 2D22A 2ZRVA 2XZ7A 2IQ0A 1DWAM 2OLSA 2GJRA 1HL9A 1WO2A 1VP5A 4XD6A 1XIMA 3KEHA 3FKKA 2ZVRA 1G7VA 4NHVA 4HCDA 1FWSA 5FEXA 2OWXA 2PAJA 1ZAIA 4UIOA 2J6XA 3OBEA 3S3GA 4S3DA 1IXPA 2DUAA 3W7PA 4Q32A 3QZ6A 1Z48A 5FJOA 5T9BG 4O54A 5IFTA 4OKDA 2I14A 2YB1A 5U7SA 4LW7A 4Y9MA 3WY1A 4LAKA 1I9CB 3LNMA 1B4EA 5H1WA 4OTKA 1UHVA 1QOXA 4G5DA 2I1OA 3UF9A 4O11A 4UZUA 3IUIA 2G5WA 1RVGA 2VKZG 4F9JA 2AMXA 4AYGA 4JL2A 4UTLA 4NJIA 4CCDA 4LH8A 3FV9A 3E74A 3NVDA 3GLCA 4MPKA 3CHVA 1VAHA 4R5EA 1XLFA 1UC5A 3W07A 3VKCA 1A0DA 2HNEA 1EJTC 5EMYA 4GYFA 4IL2A 4AD5A 4KPLA 4EIVA 4O8AA 4XAGA 4URIA 1LYXA 1VFOA 1NY1A 5FEWA 5EB8A 4IWWA 3VK5A 2R1PA 1E6RA 3VGEA 3II1A 1CZ1A 1EO7A 1F4HA 3G5EA 4KEVA 1I2OA 3MMWA 3LSCA 4LUIA 4D6CA 2VR2A 3NZ1A 1PTAA 1K9EA 4HN4A 3GXTA 3BL3A 1UD5A 4HN8A 4C6FA 3B8IA 1XLMA 3L2MA 1O4UA 2EAWA 3PUGA 4U5IA 2BSLA 1JYVA 4WXYA 3EDKA 1IZKA 2G41A 3QLDA 4L4PA 2UY4A 4A2RA 1H7XA 1T0OA 3CL6A 1H2JA 4LBUA 4IG2B 4NJHA 3R2GA 2OG9A 2VHLA 4GZEA 4FLSA 5DCEA 3O3RA 3WDPP 2FTPA 1UUQA 3KTSA 3VM5A 4ADUA 5HMFA 4AC1X 1UQZA 1YNQA 3JZEA 2VCBA 4PUJA 1L6GA 3FYOA 8A3HA 1W1YA 4GXWA 1LL4A 4LRTA 3W6YA 3T78A 1NU5A 3AFBA 1EJSC 3U8GA 1DOSA 3AXMA 3O6AA 1DWFM 1W9BM 4JTFA 3T44A 3REQA 4C6KA 3QV8A 1S3TC 5AYIA 2OX1A 3GVVA 2CKRA 3FNDA 1UIPA 2PD5A 1LBFA 2Z1BA 2PTXA 3W29A 3VCNA 3D46A 4AAJA 4US5D 1UKTA 2TODA 3NEVA 2WQDA 4REQB 4FIQA 3RM9A 3GE7A 2FZ9A 5I0DA 4CU7A 4PL2A 3WH5A 3RX3A 2FHCA 2PMQA 4MZYA 3PBGA 5DBUA 3Q2DA 4UTMA 1DXEA 1K02A 1V02E 3RXZA 2PDYA 4H01A 2WZMA 3JU2A 5IDIA 4MOZA 2J7HA 1JUEA 1G94A 3JS3A 1W3KA 4IFKB 1X39A 2Y89A 4Z0SA 2Z6IA 3I3EA 1XGZA 1ZRQA 2DJXA 3W25A 3N3TA 2Y8UA 4IJBA 3U0HA 1CXEA 3BQ5A 5FJUA 1C29A 2VGGA 4GABA 3OYZA 3ABQA 4S3CA 4JYEA 2AGTA 3CBWA 1MUMA 1DORA 1H3GA 1E3ZA 3CIXA 3PWIA 3ATYA 2CZDA 3L21A 4PTDA 1P0KA 2WZIA 1F3EA 3IGUA 3B06A 2ACQA 4QS5A 4ZA0A 3T8QA 4AF0B 1DL3A 2ZA3A 2ZRZA 1UJPA 4KRZA 3TWBA 1E5JA 4QCEA 3KL0A 3VNMA 1NAL1 3FYPA 2QCNA 3AROA 3GHRA 3NQCA 1W8SA 3LZ5A 2YCKX 1A5UA 5G4WA 5LIWX 3W3OA 5CXPA 5A2CA 3PG9A 5HMDA 5BCAA 3ABZA 3L66A 1GORA 4C6CA 2OWCA 1FWAC 3MUY1 1J0IA 1XPYA 4Q8OA 3QOKA 2PDKA 3WUGA 3M0YA 1WKDA 3I65A 1E1FA 4LANA 5TD4A 1KFBA 2PC8A 3MSYA 5A8MA 1YIXA 1US2A 1W91A 3FEMA 3GS6A 3KDNA 4PRRA 3KWSA 4CNPA 4FXFA 5TBOA 9CGTA 1W1TA 1OX6A 1K8YA 4WOQA 4AEFA 2PDUA 3RR4A 1T8XA 3TYUA 4RE4A 5KITA 3ZJ6A 1FWDC 2DZWA 5LGXA 5EL1A 2HNHA 3SCRA 1EWDA 4S3BA 4I7UA 5GPRA 2VDIA 4EF9A 1TRIA 3GH7A 1UZ1A 3DDMA 3RX2A 1O12A 2CZ5A 3O2LA 3VIOA 3M46A 2BZNA 4ZZ9A 2BASA 4DZ5A 3DERA 1DXFA 1UH4A 1RAKA 1ZAHA 3NO5A 4CNSA 2G96A 3USZA 2C14A 2A0NA 1OABA 1ITQA 3CQHA 1BXNA 2XH0A 1IV8A 3T55A 3WF2A 1UWSA 3Q45A 4JIQA 2FDMA 3SCPA 4DAIA 4Y8FA 3KX6A 4H41A 1Q6CA 2GK1B 5I78A 4E2BA 3S9IA 3BW4A 1QNPA 2FGZA 4GIAA 2VC9A 4J3TA 2ZRWA 4E8GA 4LWWA 4LF1A 1HP4A 4DXVA 2VFDA 1UR9A 1QW9A 2PDIA 3MKKA 1TWDA 1GQIA 2CEQA 4DNHA 1JZ2A 4ZQCA 3MKVA 3KP0A 3VKJA 3WLPA 5DCDA 2EXOA 3H2NA 3R8GA 2H8ZA 3P5ZA 3GC5A 4N4QA 1PCKA 1ZFJA 1W5MA 2J27A 2WKJA 4XD5A 4O1DA 3EMZA 1OM0A 4D1JA 2DSWA 4G6CA 4MNLA 1DIOA 4NZ3A 3U2ZA 4LGXA 4ROQA 4QQ3A 1EHAA 1A5SA 4LY4A 3UXKA 2CZVA 2GQAA 1YYAA 4DIAA 1MZRA 5CQ1A 3WSUA 2FKPA 3V4BA 1VEMA 3W2NA 3WQCA 4PTNA 3QMTA 1DWGM 3O0KA 3DX5A 3T0TA 4R9XA 1JYNA 1VBUA 1LORA 4PMJA 2YSWA 1M53A 3MUXA 3M7SA 4DEFA 2Z1XA 1RA0A 1J10A 2X1SA 4KCVA 4OIFA 1PWLA 2E25A 4H7VA 2E5CA 3VILA 3AJXA 2EG8A 3RUBL 4Q6XA 3ZJ7A 1M5WA 2GDUA 1JPMA 4YXGA 4JFUA 1AL7A 3U7VA 4CD4A 1F73A 2WCAA 3LUTA 2QCEA 5CC6A 5IFPA 3W1TA 2POZA 2VEIA 1TZZA 2IKIA 3P2VA 5C71A 1KO0A 2KX9A 5E9AA 4QIUA 3NG3A 5BMXA 3SJ3A 1RV8A 2FB2A 1A47A 1Q6DA 2D1ZA 3VDGA 3BOXA 1P1MA 2OO6A 1SJCA 4D6DA 2FMNA 4ZXLA 4HYRA 1R7OA 2EO7A 4O1FA 2AL2B 3DBPA 4UZSA 3ZMRA 3GBEA 2IS7A 1HKJA 6REQA 4GQBA 1FWWA 3QTPA 3W82A 4C1NB 4AG0A 3SCWA 5A8GA 3HG5A 3T0BA 3I6RA 4HU8A 2WZHA 4I9AA 4RW5A 1F5ZA 3FJLA 2E8YA 3AHVA 5T9CE 2VUNA 3LRLA 1GKRA 4QXIA 3RCNA 2NXIA 1NF7A 4KFOA 3FHAA 1ZBCA 2H3DA 1RALA 1JYXA 1TV5A 5A6MA 2WCSA 4HA0A 4PULA 3VUPA 4LJ3A 3M47A 3KCLA 2X30A 4PSPA 4FIRA 2AL1A 1JI2A 4O12A 4IPLA 1PIGA 1XL9A 3VD5A 3N73A 2RKXA 3UU0A 1OC5A 3ALGA 1E6NA 2INEA 2HCVA 1V03A 2IXVA 1V0MA 3VNDA 1D3HA 1OX5A 1LF1A 3CHEA 4LXFA 3B8SA 4B90A 4X3ZA 4JTLA 1WDRA 4KWVA 4JL1A 3URNA 3JRKA 1CCWB 1TPFA 1BQCA 1Q66A 1ONRA 4G7EA 1CGUA 4RV8A 3AIBA 3RR1A 3M0XA 1GVIA 2OEMA 4XSLA 1PX3A 5J8LA 3M64A 1GGOA 3A24A 3N9RA 1NDYA 4RCXA 4MYXA 1ICQA 4LT9A 5A8PA 1DJQA 2RDUA 1UWTA 3GVWA 1K7XA 2OSYA 3WQWA 2VO5A 5JQ9A 5D30A 4LVAA 5A8QA 1B9BA 3BZJA 3TROA 5K9CA 1E1EA 1THFD 4L4MA 4IQDA 4H19A 2RUSA 2IKJA 3WK1A 2WC4A 3PJTA 2W61A 1V6VA 4LYRA 4RXFA 4WGXA 1Q6LA 2A4AA 3HGSA 4OU1A 1KM4A 3LEPA 2EQDA 4JZ5A 3M0ZA 3WK0A 3QFEA 4M51A 1NWSA 4TVCA 4M1RA 2QCHA 3LQLA 3OBKA 3SUVA 2EG6A 5H8MA 2VP8A 3K13A 2V69A 1ISVA 1RBAA 3D0CA 1JNEA 3BE7A 1DXIA 5C9WA 4IL0A 3UZJA 4H6RA 4QQUA 3OA3A 1A49A 2P1FA 4LVFA 5ABGA 3T8LA 1KR0A 4WCJA 1A5AA 3E2VA 2KAUC 4S38A 3A47A 4U28A 4DN1A 3DESA 1LT8A 4HSOA 1LG2A 3B4UA 1WZLA 4Z08A 5A8NA 2CHRA 5DMNA 3UR7A 5AHEA 3ZSTA 3AYSA 1VEOA 4D71A 2XWEA 1EZWA 2F6XA 4CVWA 4GXMA 7TIMA 4UQ9A 3B3DA 3ZFHA 1VLIA 3GAKA 3ZOAA 3E2SA 4XZNX 4AWUA 2OLAA 4GOAA 4GZJA 4PMYA 1DJXA 3QBUA 1VKFA 3TK7A 1QW8A 4FF5A 3ZJ8A 2RGMA 3KVLA 4UTIA 5AC6A 1W8GA 2Z27A 2Z26A 1G4TA 3SM0A 1ONEA 3I7SA 1XXXA 4HJFA 2C3ZA 2HDJA 1Z9AA 5I2UA 5M2FX 4DWSD 3KVJA 3KOWA 4OOZA 3F2BA 1B31A 4C1NA 4DPQA 3FOKA 1BF2A 1Y0EA 3E0IA 4Z1AA 3SFWA 3QH2A 1OG0A 1OD8A 4O28A 3T07A 1CW2A 5IOBA 3GG1A 4RZ5A 1OFDA 1G9HA 3EA3A 1VRXA 2O9PA 3W00A 4YYFA 1CGYA 3BAYA 1ADSA 1EIXA 3AHTA 4ERGA 3OBAA 4W8LA 1W3LA 3WQDA 7PTDA 2O4MA 3WBEA 3AS0A 4LRSA 4J40A 4I8YA 3WQPA 3WQ4A 1UD4A 1SYTA 4O52A 4CNUA 1UA3A 1ZU8A 1GOOA 2OU4A 1ONWA 2DSZA 1X6LA 3LLFA 3A4AA 4DLMA 2ZUMA 4UQAA 3LOTA 1CB7B 1NFGA 3WLIA 3L7RA 3N25A 1E6XM 1BVNP 3KW3A 3B97A 5CGMA 1FWNA 1Z6KA 3OB8A 4U5KA 3DEQA 4AZGA 2WWDA 1WAWA 4HZ6A 1BKSA 5HR7A 2VWTA 3M5ZA 5D32A 2V2CA 1O1HA 2V63A 1TV4A 2YKKA 3W72A 1M6JA 2BMBA 4X61A 3FXGA 2CU0A 3PFMA 3R8HA 3UJ2A 5DELA 3P81A 3CUHA 4IMGA 2ZUSA 5D02A 3SB0A 4AZBA 4QGCA 1WNOA 3LLXA 3VNZA 1KLZA 3CV6A 3MHUA 4WSHA 5I3DA 1AD4A 3VIPA 1HGWA 2B7NA 3EWUA 2A6LA 3AHXA 2W62A 3W2KA 2C0HA 3THDA 1R2RA 1IWAA 3VKKA 4FX6M 2ZZ6A 4LY8A 1RPKA 4RPPA 3RCYA 3UW6A 4JD4A 3FAXA 1JEZA 1JDDA 4RE0A 3NA8A 2W67A 3SDOA 3NL2A 3WH9A 1JGMA 4GHRA 2BP1A 2VNCA 4LVGA 1IT8A 5TAOA 4P7QA 5I3GA 3PVFA 3LHWA 4JCLA 3AICA 4LC6A 4AD4A 4IIEA 4MPQA 1O6IA 2PU1A 1W9VA 2ZTKA 4MNJA 2VGIA 3LU2A 1C8QA 4W8BA 3E02A 4Y90A 5ECUA 2DY3A 2QT3A 1AW5A 1GJPA 2QJGA 4XBSA 1GQJA 1PB0A 1LUCA 4GINA 4QJ5B 1TE6A 1WOBA 3CV1A 2ZICA 1IGSA 3W7RA 1Y8BA 2GL5A 4QFUA 4TQTA 3RN6A 4Z1BA 3SECA 3RO6A 1F8IA 2P8BA 4S1FA 3C86A 1AD1A 3E9AA 4IUGA 1XYMA 3ZIZA 4JTRA 2GJLA 4CQ8A 3W1RA 2BB0A 2QEZA 5LNRA 3N9SA 1JCJA 3LX9A 4PUNA 4RUBA 3ARZA 5D9NA 2WAGA 1KWKA 4XAFA 3RCMA 2C15A 3KS6A 4IXXA 4A3QA 4XO7A 4W8AA 3U9IA 1J0ZA 2QMKA 1V51A 4O15A 4A22A 1EJVC 2NWSA 3BMXA 5A6LA 1W31A 1QCWA 1O5XA 5BU9A 2RHGA 1EX1A 2WHJA 4MLRA 3SUTA 2OZ0A 2BG5A 2RGLA 3S0CA 4UMAA 3LV6A 3BURA 4R53A 1RLCL 5CZTA 1ZJAA 2V67A 5LKYA 5EMKA 3VM7A 1MFUA 2HTMA 2DH3A 3QYQA 3E0VA 3EX4A 1MQRA 3B8DA 1R6WA 2H9AA 1BXCA 4HSNA 2ZDRA 4KEUA 1PUDA 1TPC1 1ZL1A 4H6KA 4E0CA 4C60A 2H3BA 2YA2A 4W9TA 3VTRA 1PYMA 5HULA 2GJXA 1P0EA 1RHCA 4MADA 1MUWA 5D2XA 1FCVA 2HMCA 1WP6A 3CM4A 4XAZA 1AG1O 2NVAA 2WJEA 1L6WA 2H90A 4WQ6A 3ES8A 3DHDA 3N2BA 4YVXA 2VL4A 2DPEA 3QMRA 1E4NA 1FBAA 2X1UA 2VZSA 4LUSB 3HU7A 9XIAA 1IXOA 3P62A 1EF2A 1I45A 4AC7C 1ZJHA 2QCDA 3G1SA 1E0UA 4HU4A 2TMDA 3MY9A 3KHJA 3H24A 1J0KA 4NJJA 2V8ZA 2PDGA 1W9PA 3EOEA 3F4WA 3HFYA 4X9YA 3ANYA 4HPXA 5DRCA 3WMSA 4NF7A 3VUSA 1V7YA 4V2XA 1I6NA 3BPWA 3UFYA 3DYOA 4JQAA 4AMCA 1XLHA 4AZCB 5TF0A 4IPIA 1G67A 1DE6A 3DFOA 2W79A 1AL8A 3GYCA 3PZNA 3WF1A 1NM9A 2J9YA 3GDRA 4Z2GA 1A0EA 1J4EA 1AH0A 4GKTA 2WO5A 4O4VA 1GHSA 1G0CA 1UPPA 2GWGA 7ENLA 3B9NA 4QEEA 1XCXA 1CXIA 2DUZA 3XINA 1WCGA 4W87A 4LB3A 4K37A 1FDZA 3B9AA 3BXWA 3K4WA 4H8HA 2UY5A 2WW5A 3AI0A 3ZYZA 2VVNA 2A6NA 3EDDA 3U48A 4XZLX 4KIEA 1ZJIA 4Y9NA 3ISIX 1MDLA 3BW3A 1NH6A 4YHGA 3KL3A 3W7GA 4XIAA 2G95A 1TIWA 1S2UA 4D1IA 1E9LA 2WSYA 4Q33A 1F6PA 2R14A 2OQYA 4A35A 2OZ8A 5ABTA 3DC8A 3CK5A 1A5OC 4OT7A 4NI3A 3EX1A 1SFLA 1NELA 3L4TA 4GZ7A 4ZB0A 4PUMA 1RQBA 3T6CA 5G1YA 1US3A 3BAWA 4YPJA 4BI6A 3C2YA 1GPWA 3WZ0E 1LOSA 4KESA 4J3VA 1BYCA 4E38A 1AJ2A 3VOGA 3Q4DA 3IIPA 3QKZA 2ZYFA 3EWXA 2OYLA 2X0SA 3KOYA 4H6QA 4Z2JA 5B7YA 3AS1A 3KRBA 2Y5EA 3RU6A 3WJWA 3A12A 1Q2SA 4KFNA 3VGGA 1PEZA 3R1ZA 4DBUA 3QR1A 4P7RA 4LB4A 3IACA 2HVOA 4XVEA 3NQDA 3MC5A 4PUEA 4U2YA 2VEGA 3LZ3A 2F6KA 3BGAA 4EKJA 4MAVA 3IJ6A 3HGJA 3CO4A 3OG3A 3LBCA 1T41A 2PDHA 3TCEA 4TR9A 3GZAA 2NLYA 1XLBA 2Q02A 1YBQA 1SW0A 5D04C 1GG0A 2PBGA 1GWJA 1EC9A 4AZ7A 1TJ2A 4KEZA 1Z32X 4L1XA 3DXIA 2XFWA 3LHUA 4O14A 4H9ZA 4AX6A 3LCHA 4AMAA 4Z17A 3GSMA 2I5GA 4EPKA 2WNZA 2PWHA 1W17A 1SMDA 3EX6A 5DT5A 3U6WA 2PI6A 4EPDC 1VF8A 3POHA 2A5HA 1TO3A 1MO0A 3VMNA 4AY8A 4B16A 3E3HA 1ICSA 5E0CA 4M3PA 3RPTA 1BQGA 3TXZA 2J7CA 2EKCA 4K7YA 4ZSTA 2P5NA 3C2EA 2Z24A 3PBYA 3NQ2A 1VR6A 3T4WA 5EU9A 1P7TB 2QKFA 3EWZA 5AHIA 1OYBA 5LHEA 1FWRA 3ALFA 3QY7A 5BOEA 2PURA 3AOFA 2BGQA 1BEUA 4A8IA 4GY1A 2SFPA 2E5DA 3SAZA 5BXTA 2C7FA 5KMYA 2FMOA 4EXAA 1V6UA 4CD5A 2UBPC 2ZZ5A 4ZO9A 3QXBA 4XAPA 4IGHA 3TQVA 1W3HA 3ONCA 4O0QA 2Z2BA 1NVMA 5BW6A 3RJXA 3AYTA 4Q8PA 4R88A 4TMCA 5A8OA 3CHFA 2YCJA 1ME8A 1HL8A 1QJWA 2DIJA 4K8EA 2PEVA 4IP4A 3QMSA 1RA5A 1P4CA 4L9XA 2HPIA 4IM4A 2BFGA 5C6MA 4U3AA 2YYUA 3URAA 4EK7A 4JTCA 3LRKA 1Q6RA 1OYCA 1E4LA 1K7EA 1TPVA 2V0TA 4O16A 4PMDA 1H62A 3WENA 2OYMA 4N02A 1OFQA 4GO8A 3IV3A 4FAMA 1TJRA 1ENUA 1H7OA 4OJYA 4FO4A 5HATA 5T26A 3MO4A 2J9ZA 2W63A 3NEHA 1TA3A 4IMFA 2NSOA 1YKWA 3RGTA 2GYIA 2IQTA 1KKOA 5IBXA 4E8DA 2J66A 2Z25A 3KDOA 1GJWA 2A79A 3KRZA 3V5CA 4IPNB 2VC7A 3S46A 2TSYA 3UWEA 1WUFA 1Q6EA 3HGOA 1TJ0A 3PAJA 4M56A 4HHPA 3W76A 3B0PA 3WLHA 3TONA 1JZ8A 4QLLA 2VELA 1LT7A 3NO3A 4JX6A 1QFEA 3ARQA 7REQA 4D6GA 2VR5A 3A3XA 1XF0A 2D3LA 2OX4A 2OEJA 3WLOA 4UOZA 4YTUA 3N4EA 1AMKA 4OVXA 3FFSA 3TQ0A 1JF6A 2PTZA 3DG7A 1H7NA 3GTIA 3N1AA 1PS9A 1TIMA 5TIMA 2WZTA 5BOFA 3WUEA 2V5CA 2E67A 2ZVIA 2NUWA 5CSUA 4B91A 5HXMA 1DIEA 1SVDA 1S5MA 4B2DD 5XIMA 5IHSA 1LQ0A 3UXDA 1PSCA 4PMQA 3EX2A 4IPPA 4MUZA 1BWKA 3NIYA 3LV5A 4BQ4A 2OVLA 1S2WA 3QPZA 4DELA 2Q01A 4KKXA 1V02A 1J8VA 2YL8A 4F0SA 3ENLA 2BXYA 4A8LA 1TREA 5CPQA 3PANA 1LWHA 4NASA 1EKOA 2QJIA 5EYWA 3I7QA 3GNXA 3OVQA 1QPQA 4MY8A 4DO7A 3S2LA 5FI8A 3KBNA 4JFTA 2FZDA 3RMJA 2VZUA 1J2WA 2AKZA 1HX0A 2DU2A 3LI1A 4UR7A 3NQFA 4QSHA 4AB4A 1KRMA 1M3UA 1VHNA 1LTDA 1XCFA 3UY7A 2QUTA 3CS2A 4PCTA 3DHFA 3AIRA 3KE0A 1Q7QA 3BK0A 1D8WA 2PCQA 4L61A 1DBTA 2VR4A 2Z2AA 2Q3RA 3SCQA 1GJUA 4KWOA 5GJMA 2DDXA 4ZEPA 4QCFA 3GDMA 1HKVA 2XPKA 1KRAC 5JVLA 3L67A 4JNYA 4OFCA 4J1OA 1V6XA 4IUOA 3FW6A 4RLIA 4BHYA 1Z44A 1HJQA 3KTCA 3TYDA 2YLAA 5FF4A 1UKOA 2HS8A 5D9OA 1BVZA 3QGVA 4P61A 3ARTA 1U5JA 3WF0A 3AS2A 4KMQA 1AZ2A 3A5VA 2OT1A 3CZ8A 1TV3A 1ZS2A 2FDSA 4JTQA 4IIGA 3UA4A 2WJDA 1TMQA 6TAAA 2Y70A 1W5PA 1XQLA 4JIHA 1XRVA 3NDYA 3B04A 2Z7GA 1DYSA 1L2QA 2GVGA 2A3EA 1H50A 1Z69A 5D05A 5A3HA 2ZBTA 3E38A 1VCGA 4CUCA 2ZOXA 3OVRA 2VZTA 4AD3A 3LXBA 5REQA 4GVFA 1VENA 3QY8A 1R30A 3A5FA 3H4WA 4Z1DA 1UBPC 3FSUA 3W73A 4PUKA 3RMEA 4XUGA 1OADA 4AHPA 2HISA 3TZNA 1CENA 1SSGA 2A21A 4Y8EA 2C91A 4QJ1A 1AW2A 5I3IA 1YW1A 4YTRA 3P8JA 4DPPA 1TKKA 5FJJA 5AZ0A 4N9DA 3E96A 3KBMA 5FIPA 3KCOA 4AIUA 3SQSA 3NO1A 1V3IA 1TSIA 3W75A 2ZC8A 1Q2RA 2PDLA 2CBUA 1MNZA 4J3SA 3VNIA 3OVPA 5E0KA 3RM4A 2BXZA 1A80A 1W1VA 1W54A 3F7JA 3QN3A 3TYEA 4O1EA 3VIFA 1K77A 1XLKA 3EOUA 3U4AA 3BCDA 1TTJA 1EDQA 1UZ4A 1B3ZA 5BWFA 3TE9A 3VFLA 1BFNA 1PCWA 3BANA 4XQ6A 2WC7A 3H2EA 3TEVA 4AD2A 4MGGA 2R1MA 3GTFA 2F2HA 3W1PA 3E5BA 4FNRA 2J24A 1FWJC 3EMCA 4TU1A 3RF9A 1FDYA 2NXGA 4DJED 1XIIA 3LRMA 4M7TA 3V0UA 3IV8A 2VX4A 1E0XA 1XIJA 4LUTB 3U4FA 4GI4A 5C9XA 1QI3A 3TLLA 3AMDA 2XFYA 1O5QA 3DZ1A 2C0AA 4TMBA 3ME3A 3W26A 1E51A 1KB3A 1K9DA 4AQLA 1V6YA 1KGWA 2PTDA 3GUGA 4S3FA 5DY2A 1CGVA 1XSIA 2ABAA 2Z2UA 1QI0A 4OOUA 1KV5A 3ZVHA 2BOFX 1EX5A 3H2FA 5F2MA 1TPWA 4W4QA 1HT6A 3V1HA 4OZOA 5AVNA 2YXOA 2WYSA 4K1GA 2ZFAA 3MTWA 1XICA 4WDWA 3GR8A 1NSJA 3F2CA 3W86A 3HG4A 2CBIA 2CWNA 1RK5A 4IISA 1JYWA 1J18A 3SCNA 3TN5A 4Y9PA 2OOGA 4I3GA 5M5DA 1ISXA 3S4TA 3OU8A 1ODZA 2XVNA 4A4AA 5HJYA 4A8NA 1ELSA 5TQLA 3WQGA 1B5TA 4AXNA 3S5YA 1F6KA 4IX0A 3QVQA 3WLQA 2VFIA 1P0NA 3W7CA 1PV8A 3TSMA 5CKSA 4M19A 1YMYA 4W84A 3LBOA 4AW7A 4S23A 3I4KA 3CZGA 3ZWTA 3CV2A 1GKQA 1YE4A 2VWSA 1T40A 2Y85A 1RH9A 1A5CA 4JTIA 1MDRA 1NDWA 4H7ZA 4DUXA 4C7DA 2EJ1A 1UKSA 1IZCA 3RPDA 2R8WA 4GI9A 1W9DM 3EPMA 3TJXA 5JH2A 1G01A 1EB3A 5CSRA 2CLIA 3WQ8A 1O66A 1FH7A 1TVPA 3TC7A 5M3WA 1DHPA 3E6EA 2O9RA 4HOXA 1JGIA 2XSXA 1YDNA 1MUCA 3R10A 4PBGA 2AOSA 1RCOB 2CLOA 4DX3A 3U2EA 5F2GA 5LA0A 3QQ1A 4TUFA 3EDFA 5I07A 3UNDA 3WNMA 1WXYA 4IXHA 3LCWA 5J5DA 2Q6ZA 2ASHA 4GKLA 1X96A 1WDDA 3HJEA 4I6KA 1UP0A 2ZXQA 3LLDA 3CL7A 3QRHA 2G3MA 3VFCA 2JF7A 3A3WA 3C2FA 1H60A 3GKFA 3GNPA 3R25A 2UY2A 4DI9A 4CKQA 1TPH1 3M7WA 3GHSA 3LCGA 4M0XA 2JFEX 1V7AA 3BLDA 1U33A 3TU9A 4E6MA 2IQDA 3GBDA 1RUSA 1WYIA 1EP2A 3PJWA 1OK6A 4O50A 4CN6A 2DQXA 1E1CA 5I03A 3CPUA 2CNCA 3AMCA 2QF7A 2VOTA 2HE8A 2WV8A 3POCA 1VH7A 4NRSA 3IAPA 3N04A 1DJGA 3W7KA 3W7OA 2BS9A 1T99A 4PSRA 2Z0IA 4ZCWA 2B7PA 3VD7A 3TTYA 1W1A1 5BROA 2ZX5A 3H12A 4IMCA 2DVUA 5BZAA 1M9HA 3CJPA 4HGXA 3TOPA 4D9PA 3C0LA 4KCUA 2QDHA 5LNUA 1V93A 3K8MA 4KBXA 3TP4A 2C1IA 4YVPA 4M80A 1EGVA 3VOCA 4O53A 3HFTA 4OE7A 2NVCA 3LHYA 1FDJA 3N4FA 5KZDA 1RJQA 3NZPA 4TVDA 3SIMA 4MAZA 4OWGA 4XISA 1VFTA 1HUVA 3TJ4A 4RNJA 4Y6GA 4V33A 3L4YA 4RE3A 1VJIA 3V3WA 2X16A 4K6AA 3VD9A 3B8TA 4FI4A 1TMHA 2J8GA 1OCJA 1JZ6A 1NQKA 3FDKA 1UB3A 4X0NA 3R89A 4GH3A 3O6CA 1SR9A 3K5XA 4QG6A 1FA2A 3MA8A 3I4EA 1GQNA 1QPNA 5A5WA 5CC7A 2XGZA 3MCOA 1D7KA 3BQ6A 3IGHX 3TTQA 2YB4A 3WQ5A 4CQ9A 5HQEA 4NL1A 2CBJA 3UGVA 4UR8A 2VENA 4H8NA 4ACYA 2WMHA 3CQKA 1G4EA 1Y7VA 3M6YA 1YQ2A 2QJMA 4FXSA 3SEPA 1S1PA 4X22A 3AWOA 1E56A 1QI5A 2VEPA 4FK9A 3W22A 2GGGA 2ZADA 3AC0A 1MW1A 3EKZA 1CT5A 2VZOA 4B3ZA 4HPHA 1A5LC 3A3HA 4K39A 2WJZA 1BPLB 1ME9A 1LJYA 3FLUA 4AZHA 5CBIA 3R8RA 2V3GA 3MVTA 5JBDA 3NQAA 3JUGA 1GTHA 1A0CA 4PCFA 2W3ZA 4P7NA 2OB3A 3VZZA 2B0MA 4N2YA 2Z1VA 4QNWA 2V3DA 4FR6A 3UXIA 1QASA 4FXRA 1XBXA 4IPJA 3CUXA 4V15A 3SN0A 5D9MA 4MTVA 3GG7A 3N4AA 3FVDA 3LN3A 4Z2IA 3L23A 2Y62A 2E68A 4B4HA 4QAWA 4C6NA 3THCA 1VYRA 3C8NA 4HNLA 2YCIX 3GYEA 3PTMA 1UYQA 2NZLA 3L5AA 2ONEA 1CLXA 2B81A 3BLKA 4PR4A 4BF7A 3PZOA 3TR2A 3C3NA 1L0PA 2W4XA 1FHDA 1OIMA 4O4WA 1SO6A 3ID7A 5I5RA 2X8RA 2X1TA 1UC4A 1UA7A 3B8WA 4JTAA 1P5BA 1DJZA 1UH3A 4N0RA 2GJNA 1L6SA 4EP8C 1RQHA 4PMZA 1H7PA 3TH6A 3VIKA 4C1LA 3GKAA 3BLIA 1HJXA 4H8UA 1VJSA 1KR1A 2C8NA 2VEKA 3BAJA 4XTDA 4E4UA 4E2VA 1K8CA 2I9EA 4GNJA 2Y8VA 2BTMA 1E0WA 1VEPA 3BJSA 4NAEA 3C2OA 4PE8A 3C56A 1EUNA 4CLMA 4I6VA 1UCWA 1XIHA 3VC5A 3ERPA 3COTA 4NXKA 1W37A 3KBSA 3U7BA 4W7VA 3G1YA 4HNTA 4IIBA 2GJPA 4PCSA 4PEKA 2Z6JA 2E77A 4S3KA 4BCEA 5GJPA 1PKNA 4BJHA 1F3WA 1L2UA 3BCFA 3LERA 4HP5A 3PFRA 1LM1A 4WDTA 3SRHA 1WKYA 4JOMA 1ISZA 1EJRC 1JRBA 2WK2A 1VZWA 4DVOA 2PRMA 3W2LA 4DO6A 3NPWA 1G6CA 2Q8LA 3MZNA 1QWGA 4HYWA 4UQBA 5JBFA 2J74A 5F4XA 1BTMA 2QAFA 4JIIX 3BV4A 2V5DA 3M0LA 5K9XA 3URQA 3FK4A 2QCLA 3TTEA 2BOGX 4NILA 5ABEA 5EY5A 1XGEA 5GQBA 1EFZA 2VX6A 2DW7A 3DI0A 1TUFA 1LL6A 5KSWA 1B3VA 1H41A 4JTTA 1E5NA 3W0KA 1BHGA 3IJDA 4I5UA 4P8VA 5FF2A 2ZIDA 4JKKA 1GW9A 2ATSA 3LENA 4XAYA 3VKBA 3NQEA 4HT3A 4HTBA 2WC3A 3O06A 4B5SA 2DGAA 1C8VA 4MY1A 3T0AA 4HK6A 4UNIA 5IM51 5EMJA 1DQXA 1AQMA 3GXDA 3G6LA 2WPBA 4LF2A 4IHCA 3CEUA 1DWIM 3EX3A 1NP2A 2JIEA 4ZODA 4YNGA 3KUMA 1KTNA 1JD9A 1IXNA 7ODCA 1Q4NX 4JY9A 1RJRA 1FY6A 2WHLA 2DJLA 3UCDA 1SJAA 3L4XA 1UUOA 3DKLA 3W2JA 3CTLA 1TTPA 1LDCA 4O1AA 3FHQA 3M6DA 2QMJA 3B03A 1XHGA 2IXUA 1W1B1 4GUGA 2MUCA 4EPBC 2AL2A 3VZXA 1XSJA 1ZNNA 1V77A 3WDRA 1GVEA 1B57A 4JN7A 1DIDA 1F61A 4HMNA 1HKMA 3QPYA 5A2AA 1XDMA 1A4LA 3W2MA 1SFTA 4ZOEA 4TX9A 3WX7A 1LWIA 4O0ZA 5DLCA 3C61A 2YJQA 4OQVA 5AC4A 3G3DA 2WNNA 2RJHA 1YDOA 1S5NA 4R7OA 1QHZA 2ANUA 2BLEA 1TQJA 3DGRA 3EOOA 3HBLA 3QQ0A 4LAUA 3ZWSA 5A6TC 3EB4A 4N6EA 1P6WA 2YDAA 1M65A 5LNSA 1FP8A 3VVGA 2PWUA 4L56A 3P3BA 5AN7A 3SIZA 1H1NA 3BLLA 3TQKA 3GFYA 4D8LA 2FZMA 1XC4A 3WIJA 2XFFA 3L4ZA 4NNAA 3ARRA 5AC5A 3ZZ1A 4U2ZA 2P76A 1EH9A 3R11A 3IGSA 4GIEA 3OTRA 3WDHA 3CT2A 3EA2A 4WIWA 1XRFA 2HS6A 4M24A 2D3NA 3SURA 1TVLA 4XK2A 2E6YA 3F2DA 2BHZA 4W7UA 1FHVA 1FH9A 1K9TA 4KH2A 5FJRA 1U1JA 4GUIA 3NOEA 7TAAA 1FXPA 3CL8A 4O10A 2FVKA 3S5NA 1TPDA 2C1HA 4H7CA 3QGAC 1YRRA 3GAYA 2AGKA 1BSIA 1SO3A 1UP3A 4PRWA 3BGJA 4RZBA 4JFVA 1BWVA 4F40A 1OHLA 4H9YA 1YEYA 5E09A 3AYRA 5LNWA 3RO8A 4KGJA 3PWGA 2VZVA 2R1LA 3MS8A 4IFRA 1NDZA 3CMJA 3DOPA 3DFHA 1ZBWA 1BYAA 4G56A 3P8IA 1FH8A 5EMMA 4P8XA 1J2BA 5IHRA 3DI1A 3P74A 1VFUA 3R7MA 4UTFA 1VBJA 3GG8A 1O68A 1RLDA 2ALRA 4TV6A 2WVTA 2B7OA 4UOQA 2Z1KA 2GWNA 1IR1A 1O60A 1DIKA 2D23A 4R3UA 3ZSSA 1DJIA 4HMCA 1QNVA 5M03A 5GJNA 1IE7C 4C90A 2VURA 4NI8A 3ZXWA 1JAEA 2W9MA 4QR6A 1DJHA 2V9DA 2EPLX 1IF2A 1BTCA 1M7XA 1AJ0A 4FNQA 4US5A 3B0VC 3PUDA 4R85A 3GR4A 4IF2A 3N17A 3N2OA 1IQ8A 1W1ZA 4FNPA 1XLLA 4D8ZA 3KL5A 3CTTA 2BODX 1P7TA 1UD6A 1V79A 3ARWA 3UG3A 4FB7A 1DHKA 4BWLA 4L64A 3KZPA 1RBLA 4ZE4A 2Z4GA 4S3EA 1RR2A 5H2ZA 2F9RA 4BFAA 5D2VA 4C6MA 4S2CA 3L2IA 1BYDA 1DTNA 1FWFC 2DP3A 4QM1A 1JIBA 3GNRA 1K7FA 4TXEA 2GUBA 1AFSA 4GNKB 2O0TA 1G7UA 1V0KA 4JTUA 2ZXAA 2DT2A 3P7YA 3WLLA 3RX4A 2CXGA 1Z3NA 1PKLA 3UWUA 2X41A 1CX9A 2OKOA 3AJ7A 5CBBA 5HNNA 3M16A 1IEWA 3OZOA 4IQEA 4AVOA 1EYEA 1XSKA 1KQYA 3B0XA 4GK8A 1Z7AA 1B90A 2J13A 1U5HA 1PVNA 3TFXA 1XBZA 3LHZA 4CD8A 3GH5A 2VRKA 1HG3A 3WKZA 1W2PA 1L8NA 5FESA 3GIQA 3OIHA 3CLMA 2XUCA 1PTDA 1TWIA 3UJSA 4JEQA 3KLLA 3WD0A 2EPHA 4UTKA 3MU7A 2E28A 1OC6A 4J3ZA 2ZTJA 4NKCA 5C2GA 5A94A 1WXJA 1XJBA 3LCIA 3B8VA 2ZZ1A 3WD1A 4DBWA 3BO9A 1FOBA 1JQXA 1KXVA 4MWAC 3I6TA 3U2OA 1YXYA 3BG5A 1Q8AA 1SJDA 1S5VA 1N7KA 2OJPA 3TXVA 1E6ZA 1FWTA 3EWWA 3NZRA 5H8UA 4WF7A 1HO1A 3W7QA 4XO6A 5C54A 2BDQA 3TKFA 4CQCA 4HZ7A 4QE1A 5CPTA 4XD4A 4LSBA 4UUIA 4DWDA 1XI3A 3UERA 3A23A 4UQDA 5HUOA 2Y61A 2VCCA 4FMVA 2DW6A 4GA8A 4ZQMA 3CUJA 2YCLA 2X1RA 4JDBA 5FL0A 1Q6GA 1GONA 3MKCA 2HQAA 1Z89A 1KQZA 2E5BA 2G50A 2XVLA 5D38A 2HBVA 2YGYA 4JBRA 2QVHA 4RV3A 4GQRA 2GUUA 2GDVA 2QIIA 3OOQA 4B15A 1GZ1A 1GOKA 4LUTA 4AZIA 2X7VA 3UJFA 4PRTA 3UWWA 3K46A 4PMNA 2AKMA 3CHCA 3LQGA 2XSAA 1RBOB 4I7VA 5BWAA 2CBVA 4LCSA 1N82A 4YWIA 3VGHA 4JPGA 1MVYA 3DFNA 3T0DA 1M7OA 7A3HA 3WEZA 4PCNA 2PLKA 1CXLA 5CH9A 2PFHA 4B3LA 4B5UA 3VU2A 1YPIA 1GUVA 2P0IA 2ZCGA 2NLIA 2PCEA 6XIAA 3TN3A 3L4WA 4EF8A 4DXXA 1KCKA 2BVTA 2GOKA 1WDSA 1QWKA 5CGQA 2O55A 2ISSA 1H63A 3C4UA 3IIVA 4TTGA 2REQA 2IKHA 4AISA 4M81A 1JDFA 3BJFA 2HE5A 2OYKA 4NJKA 2XZ9A 5ENLA 2XIQA 1XWYA 2VDGA 5E9XA 1GNXA 1F8MA 2D73A 3QY6A 1VGAA 4WHBA 3BH4A 2YCEA 1S38A 3O15A 2DT0A 2CXEA 3WLNA 5LXXA 3W87A 4NXSA 3SUUA 4CCZA 3FX4A 1W9XA 3BICA 5DXXA 2CWXA 3TYAA 4AU0A 5C8BB 1VYPX 1IEXA 3EEZA 3TMLA 1S1RA 2FJKA 1EA9C 3S5OA 2PDFA 4LV9A 3QHNA 1BGGA 1JUBA 1TPEA 4F66A 2X09A 1ESWA 2XM2A 4LTSA 3T9PA 1X6NA 3H4GA 6XIMA 4B92A 2V5KA 3MDUA 3IS4A 3AALA 4E4FA 5G2WA 3LCFA 4UTTC 4MIMA 4KGLA 3AUOA 4ORIA 4CEUC 5LA1A 3S8HA 4TTUA 2QW5A 4WJXA 3GB6A 3QQWA 3EXTA 1M03A 1FWBC 3BARA 3T4CA 5AYXA 3HG2A 3UXAA 1Q65A 4C6LA 3WN6A 2E40A 3MSDA 2EHHA 1VD6A 3ONBA 1XBYA 4H9VA 4LUJA 1KCLA 3LMYA 1QR7A 1AH3A 2R9RA 1GVSA 4JTGA 3H7VA 3W70A 2JALA 3AXIA 3WBAA 1GEHA 3NDOA 4K1WA 4BEQA 4F2UA 3AISA 3DBNA 3VE9A 4NNBA 4DBSA 4M6UA 2ZQ0A 3TCSA 1A50A 4GVGA 2KZHA 3LPFA 4ATLA 4UTWC 4R34A 2GJXB 3G22A 1ITUA 3SY1A 1ICPA 1HL2A 1I4NA 4DJDC 1EXPA 1YDVA 6TIMA 2PF8A 1JCLA 2OZTA 1E4IA 1EC7A 2OPJA 1WV2A 1V3LA 3WLJA 4Q22A 4PMRA 1M1BA 4WSJA 4QRNA 4Q4SA 4CU8A 3PN8A 2PLMA 1TTQA 3ZT5A 2ZKMX 4IIFA 4HMDA 3CEPA 4M5PA 3KAOA 2I9UA 3W85A 3AMLA 5DMMA 1VHCA 3UR8A 2PWVA 1WQ5A 3EA1A 1XKJA 2HZGA 1FUYA 2R91A 3LM7A 2EPKX 4DZHA 4QLJA 2E6FA 3M1ZA 3ICJA 4NRRA 4UFIA 3MBFA 4F48A 1W1PA 3W7MA 3ECQA 5J5RA 1E71M 2CLMA 1VFMA 4ZL1A 1QATA 3PP7A 4DNMA 1LUCB 1KBBA 2BGSA 3LG3A 3H7UA 4D6JA 2QDGA 4EANA 1E6SM 3OP2A 3RIKA 4Q7BA 4PODA 1QO5A 1KD0A 3DYPA 1VBHA 3VDBA 1R47A 3LPOA 5CZ0A 2Q71A 2QYGA 3M5XA 4BR1A 3W6LA 2GVLA 3SCTA 3MUCA 1RSCA 4M6PA 4KIRA 4F9DA 3QHMA 3E2QA 4S2BA 2PODA 3NQVA 1W1IE 2VEFA 3CYVA 4Q4OA 1XKYA 3QEZA 4IQLA 5AHFA 4C5ZA 1PPIA 4MDOA 1PIIA 4J28A 4QDWA 3UT0A 4P2VA 3V18A 4MVAA 3VMPA 4GPNA 2NX9A 2P3ZA 4LNYA 3WEMA 1UZDA 4LYPA 2WOQA 2Y7GA 1TUXA 1P0BA 3DN5A 5JBEA 3NYZA 1H1ZA 1TA3B 4H2CA 3BVJA 3USBA 1PTGA 3HA1A 2XIJA 1X97A 4YLWA 3S1XA 1KFCA 4EXQA 5FJPA 1XLGA 4WK9A 4QG9A 2XYLA 2VFFA 5F2LA 4U33A 1TWSA 5RUBA 3NCOA 3UZ5A 2POTA 2R94A 4JTEA 2FB3A 2ON3A 1Q7ZA 1HJVA 4XB3A 1XBVA 3QOMA 4NY2A 2TRSA 4GJJA 3VIIA 3GFXA 5DEZA 3UCCA 2QULA 3L4VA 5K2ZA 2YBUA 1HQTA 4JKMA 2NQJA 1Z42A 2NQ9A 4HA4A 1GEQA 4AF0A 4ILSA 4XZBA 3M07A 3QV7A 1EC8A 4QLKA 1D7FA 3D6NA 3JZUA 4MNMA 5HQLA 3STFA 1B54A 4MWAB 4Z0JA 3W1NA 4LPCA 4M7SA 1EUAA 1IIGA 1W9UA 2Q3OA 1KC7A 4MG4A 1VJZA 4BS0A 1G4PA 1E70M 3EGJA 3DUGA 3UR2A 1FFQA 3SZ8A 5EMLA 1TX0A 4P7OA 2XH7A 1H7RA 3WD2A 3MB9A 4LS2A 1EA0A 4Q8WA 1XW8A