2E68A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with dihydroorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e68A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e68A01
3N9SA 3GNDA 2YW3A 3W7MA 1ICPA 1JCLA 1TSIA 4Z0SA 3W7GA 4UTMA 4NNBA 1FWNA 1CW2A 1S3HA 4N2YA 1LOSA 5A5WA 4DBEA 3LHUA 2A4AA 4LW7A 4IMGA 3PWAA 3GKFA 4JTEA 5LSMA 4MJMA 1H7RA 3KVKA 3FIGA 1W56A 1HG3A 1KW1A 1LOLA 5DCDA 4LS0A 1QPNA 3NA8A 1YPIA 3GX9A 2QF7A 2DZUA 1GYLA 2RDUA 2DJLA 3GYEA 3TXZA 3EWXA 3KOFA 3LXBA 1IXPA 4W9TA 3S9YA 2YDAA 2YCEA 4OE7A 5G4EA 1PS9A 2C1HA 2QJGA 4GXMA 1H7OA 3C4UA 3PBVA 1A53A 3W2KA 1PE1A 1W5PA 1VPXA 4UNLA 2GPTA 2VEKA 4UNKA 1G6CA 1W3NA 3W88A 4ONVA 5HR6A 5C2XA 1YPFA 1DHPA 1SFJA 5D38A 5AYYA 2ISWA 4DF0A 3I65A 3NDOA 1IXOA 4CCDA 5LHEA 4X2RA 4ALDA 1DL3A 1XM3A 1TPUA 3M7WA 1WOBA 1WQ5A 3BW2A 3TH6A 4WY0A 3TMLA 1OX4B 4QIUA 1MEWA 1OG0A 4P2VA 3UY7A 2XFWA 3O05A 4G1KA 4AAJA 3CEUA 2FIQA 1QOPA 2NV1A 1H63A 5I3JA 3W83A 4P61A 2NWSA 4MFEA 1LRQA 3IIOA 4IQLA 4K39A 5FEZA 2VFFA 4HT3A 2R8WA 5H2ZA 1TPDA 5F4SA 1TV5A 3NQCA 4IJBA 3QF0A 3W7KA 3EXRA 1PCWA 1Y0EA 3L9CA 1Z42A 4JS3A 1A5SA 3IRDA 1N55A 3INPA 3LHVA 1QR7A 3N14A 3MBFA 1WXJA 3GR7A 4O15A 5G4WA 4A29A 1SUXA 4PC8A 3WK0A 1Z44A 3BGJA 3KVLA 3HG3A 1H50A 2R94A 2AQWA 1W1ZA 3JR2A 3RLVA 4PL2A 4FX7A 1D3HA 4FB7A 3ABRA 2P10A 4O19A 2CLKA 2VKZG 4GE8A 1ONRA 2QJHA 2YYUA 2R91A 4NNCA 1SZFA 2XN1A 1Q6QA 3I7RA 5CZJA 3O6YX 2VENA 1AK5A 3L21A 3UWUA 1VYPX 5KSWA 3TDFA 2VFHA 3W7JA 3NPXA 5BRBA 4UTIA 1DVJA 4JICA 3Q2DA 4AHQA 1VYRA 1VHCA 2A7NA 1XDLA 3L5MA 2IQTA 4KWVA 1TYGA 3PUDA 3TIMA 3L0GA 1TPEA 3T55A 2BXVA 4WY0F 3F1QA 3PUEA 2EHHA 5CG7A 2Y7GA 3C0JA 5C54A 3OBKA 1FQ0A 3ZWTA 2A0NA 1IXNA 3O8AA 4O18A 5AHMA 2QCGA 2QKFA 2ABBA 3M47A 3TW7A 5BOOA 2ZFAA 3W7PA 4FNUA 3UXAA 2YR1A 3ANYA 4M5PA 1LYXA 2Q3OA 1L6SA 4BI5A 5DBTA 1Q45A 5H91A 3B0UX 2GJNA 1GVQA 3W2NA 3S5YA 2YFNA 1XBZA 3VI2A 4CLMA 3GDLA 3G8RA 3ABQA 4EWND 3F4NA 2TMDA 2WSRA 3G0SA 3C6CA 2Y85A 3N2XA 1I8JA 1JRBA 1EUAA 1JQVA 1TRIA 3RF9A 4UC5A 3OHIA 3SSJA 3SJ3A 5K4XA 3OVQA 1OFEA 1AW1A 1GWJA 4IGHA 2FB3A 3PB2A 4KWWA 4UTTA 1KFLA 1EWDA 5DCBA 3SFKA 4LS1A 1EUNA 1ADOA 3BW4A 3G1AA 3DBPA 2C3ZA 4MZ8A 3TR2A 1EP3A 3M43A 2QDHA 1RQEA 2C13A 4MUZA 3QMTA 3CLMA 4LVBA 3BVJA 3W7NA 1ICQA 3NNTA 4UMCA 1LP6A 3UWZA 4OBTA 4JTSA 5LNRA 1OX6A 3GDMA 1RZMA 3NQ2A 4AHOA 2E6AA 1QPRA 3FJLA 3DHDA 4FX6M 2B4GA 4AWTA 1CX9A 3PC0A 4FXSA 1FWRA 4K38A 1F76A 5LGZA 1WBJA 1W3TA 2H8ZA 5F4XA 1TTJA 5AC6A 2JK2A 5LKYA 4UFHA 4E2DA 3SW6A 4BF9A 3TX9A 3W1MA 1BWKA 1OX4A 5HR7A 4QITA 3S1UA 4LUIA 3LI0A 5AN7A 4AHPA 3P8IA 1K03A 3FLUA 4GBUA 4GUGA 4YCOA 3FJ6A 1PV8A 5D2TA 3MYOA 3DZ1A 3W71A 1H51A 4A21A 1L2UA 3GXTA 2J9XA 3CWNA 4GWEA 4WZHA 4WXYA 3O06A 1XFBA 4NZFA 3NG3A 5FF2A 1KFEA 1RQHA 2J27A 4LNYA 1TMHA 1AW5A 2H3BA 1TPC1 4DELA 2FTPA 4XKYB 2P1FA 5D30A 3NQ8A 4CQ9A 4JTHA 5D2YA 1W5MA 4CCEA 4DF2A 4KKXA 5TBOA 3CB8A 3TAKA 2H3DA 3ABOA 3A24A 4IMCA 1XUZA 4AWUA 2WKJA 3C2VA 1OYBA 3RFAA 1HO4A 5DXXA 2VEMA 4TO8A 2VFGA 4I7VA 4I7WA 3S42A 3OIXA 3DFQA 3K30A 4A2RA 1TO3A 3BGGA 3BLEA 3STGA 2PC4A 3TAOA 5TQLA 2CLHA 4GUIA 1FXPA 5J5DA 1F7BA 4Y90A 1F05A 3P5YA 5EKYA 1EA0A 3N73A 2CZDA 1WV2A 1HTIA 4AEOA 3G1HA 4ADUA 3TXVA 5D02A 3T7VA 1HFBA 3NVTA 5IBXC 3NR0A 3QRHA 2J24A 4O10A 4O57A 3KFTA 4ORIA 1KFKA 1X6UA 2X16A 1VCVA 1DOSA 4XWUA 3BW3A 3G0XA 3NO5A 1QFEA 1FY6A 2QR6A 1D3GA 1G67A 3U6WA 3TSMA 3EEGA 2QCMA 2WNQA 1VGAA 5AHEA 5CZ0A 5EY5A 4YLWA 3JS3A 1C8VA 4MZ1A 2Y61A 7TIMA 1VQTA 1UUMA 1R2TA 3NQ7A 3PUOA 2B7QA 1YXDA 2B0MA 2ZZ7A 3TMQA 5ABTA 2GJLA 1Q3NA 4K37A 5MHBA 1N8FA 1KM6A 5FI8A 5E93A 2Y6ZA 2PCQA 5LHFA 1GVRA 1R46A 2OT1A 3M6YA 3M5VA 3W7DA 3QEZA 2I1OA 3PBWA 3HG5A 2ZRYA 3SIZA 2Z6IA 3SY5A 4LS2A 2ZTJA 3IGSA 3R5EA 3TA6A 1M6JA 1SSDA 3TV8A 1QAPA 4K7YA 2CZEA 1BTMA 2GOUA 3WK1A 2ZZ4A 3MI2A 2X1RA 3NL2A 2Y62A 1KLZA 2ZCGA 5F1VA 3UWYA 1P0KA 3IIVA 3PG8A 4LT9A 1XBVA 4WD0A 5FEXA 4CNPA 1H7PA 3TFXA 1ZCOA 1A5BA 2FLIA 2YZRA 3BLIA 4FX8A 4KFNA 3EWUA 3T44A 4XBKA 3G22A 5G1YA 3S1XA 3WK3A 1I2NA 3HMJG 1I2OA 4RJEA 4IMFA 3NPUA 2QJIA 4XTDA 3DFPA 2A7PA 3A23A 3WJYA 3NQAA 3S5OA 1SZGA 4O1AA 1K7XA 2PRHA 1K7FA 2QUVA 5D2VA 4B5NA 2QCHA 3CEPA 3C56A 3TSBA 2NWRA 1K8ZA 5K2ZA 3TC7A 3TJLA 4BFAA 1BWLA 5AC8A 4RLIA 4Y9AA 1KFJA 1RR2A 3NZ1A 4JX6A 1IF2A 3E9AA 3DKLA 3QQ0A 4JIQA 4XKYA 1M7OA 4O0ZA 4ORMA 5U7SA 1OFAA 4DF1A 4UR8A 3MI3A 1UBSA 5AOUA 4ZQNA 1YDOA 4NJGA 4TMCA 4IPJA 1X1ZA 3KVMA 3UY8A 5CPMA 1FCUA 3F03K 2BSLA 3O63A 5HWNA 1Z48A 4IXHA 2ZRUA 3LM7A 1LRTA 2VFDA 1GVSA 1DORA 3KRZA 3QMSA 1AW2A 3HBLA 2C16A 3NEVA 3WK2A 3N9RA 2WNNA 1TTIA 3B0PA 3PF3A 3L67A 2H8XA 4ADSA 4UTJA 2CW6A 2Z6JA 4JD4A 1GJPA 2NX1A 2ZZ3A 4O50A 3W1TA 1AG1O 1KM4A 1S5VA 4H3DA 1SW7A 1FBAA 3NL6A 4XQ6A 1OF8A 4CNOA 3WFAA 3H53A 2ZRZA 2W79A 4UCGA 3GB6A 3UZ5A 6ALDA 4CCCA 4O4VA 1I2QA 3TROA 3BG5A 1O5KA 1W0MA 3LI1A 4Z08A 5KITA 5DLCA 3FEMA 2YGYA 1LOQA 3W86A 3QW4B 4LV4A 1IIHA 4JX4A 1B9BA 1OHLA 3W23A 1VJIA 3NPWA 3B03A 1SZEA 2RH9A 4GRSA 3S6DA 3IGXA 3G1VA 2VELA 4U4MA 2QAPA 4C1LA 3W07A 2CLLA 3TNOA 1JJKA 1X8FA 4DBDA 4UFIA 3W7QA 2QCNA 3VE7A 1HUVA 5AB3A 4KFOA 5HUPA 2D73A 2Q3RA 1FX6A 1HO1A 3L65A 4GFSA 5D05A 3PAJA 3RMJA 4RX0A 4N9EA 3ZS4A 1M5WA 3TKFA 5G2HA 1G4SA 3NL5A 5HULA 1J5TA 3GDKA 3UPBA 1MEIA 3EWWA 3CC1A 1TRDA 3EWBX 3LCGA 1H62A 2VFIA 3G1SA 5SWUA 2GVGA 4DPPA 5LNVA 2BTMA 5E0KA 3UPWA 2A85A 1LLWA 1LBMA 3EX1A 1J2WA 2V2DA 1XI3A 5FF4A 1T96A 4A3UA 3QYQA 2KZHA 3EX6A 1O60A 1OK4A 1GG0A 1K8YA 3B4UA 3QJAA 4CNNA 4CQAA 4GUFA 2JGYA 2DORA 2CLEA 3I7QA 2Z0IA 3S1VA 3BARA 1TREA 3O16A 4JTGA 3M44A 4AVFA 2YXGA 2ZZ5A 1ME8A 1VR6A 1P5BA 1GT8A 4JTJA 2TPSA 4Y8FA 3CM4A 1WOAA 4UMAA 1LROA 1QO2A 2ZA3A 5D33A 3LLFA 2EKCA 1W3IA 4JDBA 3BO9A 3HG2A 5IBXA 4JR5A 4O8RA 1P0NA 4O53A 4UUIA 2E6YA 3LTSA 1OFDA 3GVGA 3E0IA 2ZYFA 1OYAA 2EGZA 4O28A 3FA5A 3EKZA 5I3HA 3STCA 5K4ZA 4H4IA 2ABAA 4N9BA 1XDMA 2WNZA 5I3FA 4UFMA 1FDZA 4JY8A 2B7OA 2A6NA 1TPWA 4Z1BA 1EX5A 4M6QA 3NYZA 1YXYA 1H7XA 4J9JA 3MW7A 4LY8A 2G5WA 3Q37A 4WJEA 4MIMA 4LU0A 1FWTA 1LRNA 1KM3A 2F7FA 4RK8A 5FEWA 1O95A 4GNJA 3QW3A 4BI7A 3LCIA 3I68A 1U5JA 1YLVA 1QCWA 5AC7A 1L9WA 3HO8A 3FYOA 1R30A 3QPZA 3R2GA 4R53A 4DO4A 5L6UA 1N7KA 1KV5A 1XUUA 2EPHA 1ZHAA 1H7NA 1W37A 4JTFA 3NOEA 1QWGA 3N34A 1TJPA 1THFD 4UTKA 3M5YA 1VZWA 5J5RA 3QM3A 3MO7A 1GQNA 5KINA 3MP3A 3LRMA 3TE9A 1T8XA 4GJ1A 2JBMA 2W6RA 1AL8A 2DZPA 2DZSA 2E6DA 3FYPA 3R13A 4MLRA 4K7VA 1XCFA 4LVDA 1YDVA 3A22A 2CLIA 3CIXA 2QCLA 4NU7A 4XUGA 1JUEA 3L5AA 2V2CA 5LGXA 4YCPA 1LORA 2ZTKA 2TRSA 1H7WA 3OVPA 4GC4A 1T99A 1UJPA 5K7JA 2WSYA 2G97A 3LXCA 5FEPA 3MHGA 4A22A 3W7EA 5D04C 3LDVA 2E77A 1TQXA 3HIJA 1KFBA 3GLCA 3GXNA 4LVGA 1UUOA 4WOZA 2ZA2A 2I14A 2FPTA 1H1ZA 3ZFHA 4LV9A 1SO3A 3W3OA 5CZSA 3W85A 1NF0A 1VCFA 2TYSA 1Q6OA 1UB3A 3MJYA 4Z1AA 4X3ZA 1LZOA 3EXTA 3W84A 2V2HA 1VC4A 5FF3A 1YTKA 3VKJA 2X2GA 3OG3A 3QH2A 2WOQA 2C19A 3T40A 4ZQMA 4NX5A 3IIZA 3NQEA 4AF0B 3I7SA 1FCQA 3CT7A 3O6CA 2HS8A 4CQ8A 3A5FA 3O6DA 2VEIA 1PHQA 5C6MA 3QQ1A 1QMLA 3PG9A 1DV7A 2BWGA 5I3IA 3QFEA 1ZENA 5F2MA 5HJLA 3W7LA 3TSDA 3LHZA 4AMAA 1OFRA 1XC4A 3HB9A 4LUJA 4EF9A 1FCBA 1SR9A 3W87A 4HPJA 3OVRA 1SU5A 2OMAA 2B7NA 5D32A 2VC6A 4DQWA 3FFSA 3VE9A 3W76A 1RPXA 2B7PA 4PCFA 4UTLA 5F2GA 2PRMA 1I2RA 2GVLA 3KXQA 3G18A 3WJWA 4HNUA 3NL3A 1IGSA 2GQ8A 4R34A 4O11A 5CPLA 2C14A 3PS7A 1KM2A 1VCGA 1A50A 3PBUA 2FPVA 2A21A 4JTLA 3P80A 4QNWA 5D2XA 2CLFA 1UCWA 1PCKA 3EB2A 4O4WA 4E38A 4LVAA 3LV6A 5HWJA 1LBLA 3DGRA 3P60A 2AGKA 5KTLA 1G69A 5AFDA 4M7TA 1JCMP 3W7RA 3WJXA 2J6XA 2JKPA 1F5ZA 4FNPA 3O15A 3V1PA 1JR1A 2PE4A 3GAKA 1TPVA 3FS2A 2NZLA 4RKAA 4HIBA 4MZYA 5EYWA 3W70A 4TU1A 5FESA 4LC6A 3CTLA 2YW4A 3LERA 4MFDA 4FNRA 1OX5A 2ZZ1A 4N4PA 1TV8A 3R8RA 4FIRA 3BLFA 1SO5A 5HINA 3LOTA 4JTTA 5CSRA 4FEZA 2FFCA 1JCNA 1FXQA 4DPQA 1KTBA 4MLJA 2Y63A 3DI1A 4WOQA 5CZTA 1YADA 1H1YA 1LLZA 3P74A 3IEBA 2NXGA 1OF6A 3MYPA 1TPFA 2CWNA 4RR4A 2FB2A 3TK7A 3PULA 3CIWA 3G1DA 4JNMA 1TCDA 2V9DA 3CPRA 2A7RA 4O13A 2V5LA 1O5XA 4YWIA 3C8FA 3PBYA 1AMKA 3LLDA 4ZMGA 3S8HA 1DJQA 1DQWA 3P8JA 2FJKA 4KFPA 4H6KA 1TIMA 2DZWA 1NEYA 5G1TA 2QUUA 3LB0A 4UFKA 1GPWA 3L5LA 3L0NA 4Q33A 1YTEA 5KMYA 2GUUA 5EL1A 2A6LA 4X22A 4I9AA 1S5TA 3W72A 5C5YA 4HNTA 1FDJA 4IX0A 3U8GA 3NQGA 2ZA1A 4S1FA 2BLEA 3W1XA 3DXIA 4POCA 5AYXA 3C2RA 3EKLA 3LHWA 1MEHA 3M1ZA 1KM0A 2J9YA 4O52A 3W7IA 4LRTA 4E2BA 2A5HA 3GKAA 2NX3A 4HPXA 4RXFA 4S2CA 2FDSA 4IX2A 1YYAA 3DFOA 1XBXA 4AF0A 4UXDA 3HG4A 4JYDA 1EIXA 4O14A 5DY3A 1FWSA 1R2SA 4XZ9A 1R2RA 1OABA 3WJZA 5D09A 3SECA 3S1WA 3LBCA 3S5ZA 3D0CA 4QM1A 1I4NA 3Q58A 2A2IA 4TR9A 1WDWA 4PODA 5DN1A 2DZTA 2O7QA 3IGUA 3UWQA 2AAMA 3G1XA 1A5AA 1JCJA 3GZ3A 3PSWA 3IIXA 4FF7A 3KAOA 1V5XA 3BPWA 2DU2A 3GK0A 5K9CA 3UWVA 1DKWA 2RFGA 3R89A 4JX5A 3B04A 4BK9A 1K02A 1OJXA 3TFCA 1TPB1 1X7FA 2FQIA 1G4PA 1JCXA 1SW3A 2P0OA 3OA3A 4JDYA 1VRDA 5FF7A 1KLYA 3DENA 4EVZA 1WX0A 3PSVA 2E09A 4XTIA 2X30A 1MO0A 5G5IA 4IWWA 3V75A 4K6AA 4NVTA 4NJHA 4HKPA 3W9ZA 5DBUA 4LOCA 5F2LA 4NQ1A 2X1UA 3C2EA 2BZNA 5BMWA 6TIMA 1XKYA 1J4EA 2Q8LA 3ZR4A 2NX9A 3EX4A 3AO0A 3W1LA 4MOZA 4ML9A 4JTIA 4JXCA 1F2JA 1EB3A 3W74A 4FHAA 4M6PA 2WSQA 2O7SA 4NZJA 2Y7DA 3B05A 2Z2UA 3W2UA 4N9CA 3W7OA 1YDNA 2VEPA 1VLIA 2JKAA 3IVTA 3N2MA 1W8SA 4NX0A 3W1NA 2CLOA 4Q4KA 3NAVA 3P84A 1ZJIA 1ZNNA 4WUIA 1KA9F 1JVNA 2TSYA 5AHIA 1O94A 3HGRA 2OT0A 3LX9A 1H5YA 4ZQOA 1GVFA 1F6KA 1G7UA 2ZZ6A 1PIIA 2R14A 1K3UA 5F1UA 2H6RA 2CZFA 4EF8A 4OT7A 1UASA 2ATMA 4O1CA 5HWMA 4JGDA 1ALDA 1K8XA 1IIGA 1WAUA 5U4NA 3MP5A 1ICSA 3IVSA 4NJJA 2HTMA 3PR2A 4O0KA 3E49A 2WO5A 3USBA 3UD6A 1QO5A 3KX6A 4OHQA 5F4WA 1G7VA 3LCHA 3T78A 2RDTA 3LXAA 3C2FA 3NQFA 4TX9A 2WQPA 1H60A 1B4EA 3NGJA 2QCEA 3C2OA 3W7CA 3I6RA 1FUYA 5FF0A 1WBHA 4L4MA 1C9DA 5HUOA 2ALDA 4MKNA 5D03A 4PA8A 3A5VA 3R12A 3LCWA 1VH7A 4RCXA 4UR7A 4S2BA 3G8EA 1TV7A 4X9SA 1XXXA 4IUOA 1K7EA 1I45A 2Q8ZA 2XN2A 1RVGA 4YL2A 3G1YA 1QNVA 4IXXA 4UFJA 2V82A 1GOXA 3VFLA 3LRKA 5EPDA 4IMDA 3BG3A 2PRLA 4JYFA 4PTNA 1CI1A 1LCOA 2OCZA 3LHTA 1LM1A 1W5OA 2JKEA 1KTCA 1T0OA 2BX7A 2V0TA 2HSAA 4IPIA 4NNAA 4NUWA 3E96A 1JUBA 2QCDB 1SFLA 2E5DA 3FOKA 3RNDA 1Q6RA 1ZY9A 4R7JA 4K36A 3MI6A 1PVNA 3TW6A 4NXKA 4RXGA 4QNEA 4LWWA 2F84A 4N9DA 1MZHA 3HGSA 2RHGA 5CKSA 3O1NA 3W22A 1GEQA 3SGUA 2PURA 3RK8A 3T4CA 1L6YA 4N02A 3ZWSA 2RKXA 1GVOA 3LCXA 3UXDA 3EXSA 3EX2A 4JY9A 4FNQA 2ISVA 2OJPA 3QSTA 4R33A 3UQNA 2LLEA 1KFCA 4YXGA 4MYXA 4HNNA 2E5BA 2E6FA 1SO6A 1EEPA 2Z1BA 3G1FA 4BWLC 2FPYA 3MUXA 3STFA 1JULA 3M16A 4ZQRA 3NQDA 2DZXA 3BK0A 4FO4A 3P7YA 4NT0A 2V81A 5L9FA 1QOQA 1F73A 3GDRA 3M9YA 4HN4A 4Y6GA 4QISA 4I7UA 5G2IA 3A21A 4O17A 2DJXA 3KHJA 4OQVA 1WYIA 3BG9A 1KBJA 4ZQCA 1W5NA 4M7SA 3W2JA 3N19B 1F6PA 3LTYA 3CQ0A 1B57A 3IVUA 4UTHA 5LNWA 2V30A 3HJZA 2NLIA 4QSHA 4QAIA 1Q6LA 3N3MA 3E12A 4M19A 5LNSA 3L2IA 1OFQA 4ZQPA 2NV2A 4PL1A 2JGQA 3IV3A 1MXSA 3WJSA 4MY8A 3DKJA 3MMTA 4JTUA 3RU6A 3LBMA 3G3MA 3P62A 4FIQA 1DBTA 1SW0A 2W0UA 3EWZA 4E0CA 4A2SA 3NXFA 2H90A 1EP1A 3B0VC 4AH7A 1JQXA 2Y70A 2YYTA 1ML1A 5BW6A 2NUXA 3M41A 2OZ0A 1SO4A 3DAQA 4JEQA 2VXNA 1ZALA 5T26A 5KZMA 2J88A 3QPYA 5EA9A 3L68A 4ICNA 3NPVA 3MHFA 2WPBA 5LZLA 1NVMA 5F2IA 3B06A 1TQJA 3HPXA 3KVJA 3CWOX 4BI6A 3IIPA 2G95A 4RZ4A 1V7YA 2E1DA 5CPNA 5DY2A 3MHUA 2Y7FA 2UV8G 1RQBA 3W73A 4RV8A 4LRSA 4UMBA 3TC6A 3H55A 2C0AA 4MY1A 4PEKA 3A9IA 3M5XA 3LV5A 1ZAJA 3P61A 2E68A 5AHLA 4UTUA 3W1QA 2DZVA 3HGOA 4UTWC 4O12A 3KRSA 1B3OA 2GQAA 3UZJA 4JN6A 1NFBA 2I9EA 5AHFA 1OFPA 3TCEA 2EF9A 4ZL1A 4WQ6A 3P67A 3P5ZA 4O54A 4Z0JA 3LCLA 3ATYA 3YPIA 1M7PA 1TPH1 5K9DA 5CPOA 4L4LA 3B8DA 3NQMA 5TIMA 1NSJA 3HQ1A 1JRCA 2WV8A 3NZRA 4LC8A 1DQXA 5A8GA 2NUWA 2QCDA 4OV9A 4O1DA 1R47A 3OEXA 5HQEA 2C6QA 3W2MA 3P81A 3GAYA 1KM5A 3L66A 3HPZA 5IM51 1W54A 2C15A 1VLWA 1RV8A 1YTDA 5KZDA 3C3NA 2QEZA 1OYCA 5HMSA 3NM1A 4GUHA 4DO6A 3KRUA 4NJIA 4FNTA 5AYZA 1BEUA 2Y7EA 5I3GA 2OX1A 4WX2A 1U83A 4MYAA 1H61A 2NXIA 3LRLA 2QCCA 3AJXA 5DXYA 1LBFA 3QZEA 3S5NA 1PHWA 3M5ZA 4MY9A 5I3KA 3W6YA 2GQ9A 3GDTA 5K3VA 2Y88A 3LTPA 5CGQA 3HPSA 1EPXA 2ZQ0A 1OK6A 2G96A 2YFOA 1QPOA 2CU0A 2HS6A 1YXCA 3W1AA 4HSNA 3GIYA 3O07A 4BR1A 1ME9A 1GZGA 1E51A 1S5WA 3W75A 1OVDA 4C1KA 3JRKA 5D37A 1TTPA 2X1TA 3QMRA 4GUJA 5KZEA 1A5CA 4DEFA 3BV4A 4RZ6A 2YX0A 4RZ5A 3TQ0A 4DXVA 4OV4A 3LGEA 5D2WA 1GTEA 3HOJA 1AL7A 4M6VA 1QPQA 1C29A 4N6FA 3LCFA 2QAFA 3QC3A 4D2JA 3HGJA 1ZFJA 3TU9A 4MPQA 1QDSA 5DCEA 1GYNA 2QDGA 3W1PA 3G3DA 2DP3A 1NF7A 1LDCA 1KTNA 1NAL1 4K8EA 4QJ1A 4TMBA 2E5CA 4AXKA 4MJZA 1B4KA 3UWWA 4EIVA 3LHYA 5C55A 4U28A 1P4CA 2NXHA 3SI9A 3TQKA 1GG1A 3H54A 5E1QA 2QCFA 5LNUA 1EWEA 1OFOA 4QQ3A 1P1XA 5DELA 3EX3A 2ZZ2A 4BWLA 3HF3A 3PY2A 4Z1DA 4MVAA 1FDYA 1XBYA 2NUYA 4JIPA 1PL9A 4XBSA 1X1OA 4JTKA 1MSSA 3FKKA 1JUKA 5G2WA 3VCRA 2YPIA 3ABSA 1SZNA 1W31A 5EMUA 5GVJA 2ZRXA 3W7HA 1DJNA 2C18A 8TIMA 3Q94A 3MBDA 1VYSX 4HNVA 1FCVA 3P82A 4UIOA 4ZZ9A 4LTSA 2ZDRA 3VNDA 4ADTA 1L6WA 1SPQA 3NQ6A 2VOMA 3G24A 3SR7A 1VS1A 4IMEA 2ZBTA 4FNSA 4HSOA 5AHNA 1ZAIA 5BMXA 2QUTA 1Z41A 1W5QA 4TIMA 4FXRA 3MP4A 3F4WA 3C61A 1OFBA 2HMCA 3ELFA 3SGZA 1VHNA 4WY0B 1LTDA 3QSRA 3MWAA 4PH6A 3M0ZA 1G4TA 1ME7A 1I2PA 3DFSA 1XL9A 2CFFA 3NQVA 3TQVA 2V8ZA 4PFMA 1FWWA 4O16A 3ATZA 2A1YA 5K9XA 1ZAHA 3E02A 3PM6A 2V5BA 2GVJA 4AWSA 1RD5A 1IXQA 5EBUA 2EAWA 1TTQA 2ATSA 1HL2A 5BNKA 2YSWA 1SSGA 1O4UA 1SQ7A 4JYEA 3W1UA 3GNNA 3S0CA 4UTTC 1JCYA 2XN0A 3W2LA 5CSSA 3UYCA 1BKSA 2ZRVA 4OU1A 1KV8A 3G0UA 3PB0A 3FKRA 4N4QA 3SZ8A 2WJZA 2X1SA 3W1RA 4OGZA 5HNRA 3THAA 2CLMA 3U2OA 2RDWA 2ZRWA 4Q32A 4OWGA 4IOTA 2J9ZA 3DHFA 3RLUA 4EOUA 1TJRA 3CU2A 4YMZA 1G4EA 3DU0A 3TJXA 3EWYA 1WA3A 3THQA 4WXZA 3CHVA 4UTWA 3NM3A 1TB3A 1D9EA 3GXPA 3L0KA 2VFEA 2ISSA 2Y89A 4K8HA 3DI0A 4HHPA 1KBIA 1EP2A 4Z1CA 4AB4A 4UFLA 3GR8A 3C52A 4N6EA 3UNDA 4DO5A 3TUUA 4ZVJA 3DFTA 4LVFA 1KM1A 1F74A 4O1BA 3PVFA 3DFNA 3DH7A 4Y96A 3STEA 4NXSA 4NJKA 1GTHA 2CZ5A
chains in the Genus database with same CATH superfamily
2WM0A 4GGBA 2VX7A 5FAJA 4Z0SA 4NNBA 1TWDA 4C6CA 5ECVA 2BVWA 3VD9A 2A4AA 4LW7A 4IMGA 3PWAA 3L23A 2XIIA 1JDAA 4CUCA 4RZBA 2B31A 3QOKA 3C0SA 1KW1A 2NLYA 2O9TA 3GX9A 4ZOBA 3WQFA 1GYLA 3KOFA 2QJGA 3QGVA 1W5PA 1PZ1A 1HGWA 3JW7A 2GPTA 3V35A 1NFGA 2VEKA 1AA1B 4UNKA 1W3NA 3W88A 1BQCA 2PDXA 4E4FA 1O6IA 5HR6A 4MG4A 2GJPA 3RJXA 1DHPA 5KETA 2ISWA 1TWIA 3TR9A 1V93A 5A2CA 4Q6JA 4CCDA 1IR2A 3KW3A 4HK6A 4X2RA 2DSWA 5JIWA 3ZJKA 4JOMA 1VKFA 4NAEA 3M7WA 2W91A 2XH7A 3BW2A 4QIUA 3KOYA 3THDA 2XFWA 3O05A 4AAJA 4MUPA 5AKQA 3GQYA 1H63A 2F8QA 2HQAA 2WVSA 2VQUA 4MFEA 4PMZA 1LRQA 3W24A 5A3HA 2J7DA 3NQCA 4DJED 4IJBA 3QF0A 1W2PA 3W7KA 3V3WA 1KRBC 3L9CA 1Y0EA 4JS3A 1A5SA 4HZ6A 5E0CA 3IRDA 1OC6A 3UCQA 5A8OA 3POCA 1UG6A 3WUBA 3GR7A 4FR1A 1Z44A 4J3VA 3AHYA 3SJNA 2WKGA 1PXGA 2R94A 3LD5A 2VWTA 4LB4A 1F3TA 1W1ZA 1DTNA 3UF9A 4FB7A 3ABRA 2J13A 2FTWA 2CLKA 4XZMX 1VRXA 3WYZA 1ONRA 3N12A 2J7FA 3EAUA 3L4WA 2XN1A 3O6YX 2WLYA 2OQLA 2DSVA 2PC8A 3UWUA 5KSWA 3RJYA 4K2SA 3REQA 1Q65A 1DVJA 1TX2A 1J0KA 1YE6A 1J8VA 3A47A 1UD6A 3AS1A 3K8LA 4AY8A 2XUCA 1TYGA 1XSKA 3T55A 1CB2A 3F4DA 3RO8A 4JIIX 3C0JA 2ZADA 3OBKA 2A0NA 1REQB 1B90A 2ABBA 3M47A 3QR3A 3W7PA 1LLOA 3QY6A 4QDPA 3EDJA 3CMJA 1U5VA 1XBZA 4KF1A 4BZYA 3G8RA 1GQLA 1ZRQA 4PUNA 3F4NA 3JUGA 3SEPA 2VX6A 4WKFA 3C6CA 2OEKA 3N2XA 1I8JA 4CN4A 2BVDA 4IQEA 5K4XA 4JTDA 2WVUA 1WUFA 1V3IA 1KFLA 3R0DA 1C90A 5DCBA 3R58A 3V5FA 4H41A 3SFKA 4A3HA 2J8FA 3W25A 1EUNA 3BW4A 3LG3A 3TR2A 2EJ1A 2VR4A 2ZX5A 3W7NA 3PBMA 3RR1A 1DXIA 3UYIA 2D2HA 3UWZA 3WQ6A 3WLOA 1A5OC 4QE1A 4LUTB 4OBTA 2I57A 5LNRA 3GDMA 3NQ2A 3MY9A 1X39A 4XB3A 3APGA 4IJCA 4UOZA 1RJPA 5LGZA 3AU6A 1TTJA 5A2AA 5AC6A 4UFHA 2E67A 4BF9A 3N2CA 1KXHA 2FMNA 3OGSA 3S1UA 1YDYA 1K03A 7REQB 4AFYA 3CV2A 4GUGA 1MZRA 4L7ZA 4YCOA 4DNMA 5D2TA 3DZ1A 2IPWA 1H51A 1BGAA 3GXTA 7A3HA 3CWNA 4DUVA 1UJQA 4WXYA 1XFBA 3WEOA 4I9MA 1RQHA 1KGWA 2H3BA 2P1FA 3TYDA 4J3TA 4PBGA 2D3NA 3KTCA 2C91A 1YEYA 3LSCA 4H9TA 4JTHA 4XKMA 1W5MA 3L2LA 1JXJA 4KKXA 3TAKA 2G50A 1ITUA 1IZKA 4AYSA 2FFIA 4Q8WA 1UWQA 3SN4A 4G56A 4AWUA 3RFAA 3CUHA 2YB4A 4PCTA 1YHTA 4B91A 5DXXA 2VEMA 3S2CA 4TO8A 2XINA 3GNPA 4S3GA 1QASA 2AMXA 1MRQA 1V51A 5JH1A 3D3FA 3BGGA 1J0YA 4C1NA 3SB0A 2CLHA 4P7RA 1V6UA 1J6PA 1XHGA 2OZ3A 1YMYA 4AISA 4AEOA 3GG1A 3T7VA 2F6KA 1UR2A 2PFHA 5IBXC 4GBDA 4WDUA 2D24A 5LA1A 1TCMA 3KFTA 2C7FA 2FGZA 5CJMA 4XWUA 4IIBA 2EPNA 1D3GA 3U6WA 4TVCA 1VGAA 4ZB5A 5AHEA 5EY5A 2FMOA 1YX1A 3MA8A 4BEUA 3OYXA 3PUOA 2B7QA 2B0MA 2WWCA 3WLIA 1Q13A 1KRAC 1HKJA 1PWMA 4A3RA 3LPGA 4XISA 4EACA 4IG2A 4S3KA 2F6UA 2OT1A 2EXOA 4UQBA 3M5VA 2I1OA 2H9AB 3HG5A 5GNYA 4AZCB 3ICJA 3SIZA 2Z6IA 4ZFMA 3SY5A 1KWKA 2OLAA 2ZTJA 1G1YA 1TFVA 4MNJA 1M6JA 1SSDA 3TV8A 4E4UA 1QAPA 1BTMA 1AH3A 4Z17A 2AGTA 4W8LA 2CXGA 4IIGA 4J28A 2Q09A 5CGMA 3AMKA 2Y62A 1KLZA 3H7UA 1K4HA 4C7FA 3IIVA 3FJ4A 4WSHA 1XBVA 3FK4A 4QLJA 5FEXA 4LANA 3ZR5A 4CNPA 4H9UA 3KWSA 4UOQA 1E6QM 1ZCOA 1A5BA 4GA8A 5EMJA 5AVHA 1TMQA 2FLIA 2YZRA 4FX8A 3T09A 4KFNA 5I02A 3HMJG 4QHRA 4JQ2A 3TEVA 4RDWA 1HL9A 4XTDA 8XIMA 3MDWA 2PDGA 1SZGA 4Y7EA 4G1NA 8CGTA 3S83A 1K7FA 4OJYA 2QCHA 2DT0A 3WDQA 1WDQA 4RE2A 4Y9AA 5CEWA 3UESA 4QG8A 4XKYA 4D1IA 1M7OA 3VGGA 1UBSA 1KO0A 4XZNX 3BTNA 2PDYA 1B0IA 1MQQA 3EYPA 2X0SA 2Z4GA 1W91A 3LM7A 2SFPA 3CHCA 1LRTA 1XPGA 2V5CA 3WNPA 3NVDA 2HEJA 4NF7A 1Z8AA 2RUSA 3N9RA 1Q85A 1TTIA 3B0PA 3WNNA 3PF3A 2PU1A 2YL8A 3ITLA 4ADSA 3S46A 2DH2A 2ZZ3A 1QNSA 3DOPA 1S5VA 2Q01A 5CPSA 5DEZA 4P7LA 4RNHA 3NL6A 4XQ6A 4U5KA 3WUFA 3VZZA 4HZ7A 3RG6A 3GB6A 3CS2A 3EMCA 6ALDA 4CCCA 1I2QA 3TROA 4L80A 1KQYA 1W0MA 5KITA 2HZGA 3UZWA 5T9CE 1ONXA 1EJXC 1LOQA 3BDKA 3W86A 4M56A 3WMBA 5LIWX 3EZ4A 3QW4B 4GKTA 4W7VA 1OGGA 4C91A 3S6DA 2RH9A 3IGXA 2VELA 4IFKB 3NYDA 4C6BA 4U4MA 3MSYA 3OA5A 2CLLA 3SUVA 2J79A 1JYXA 2HE5A 3E2VA 2FGBA 4H9ZA 4UFIA 2HK0A 1F3WA 3VE7A 3SCRA 1KBLA 1OG6A 5HUPA 1GKRA 4DWSC 5LXXA 3PAJA 3VIHA 4YJ5A 3UW6A 3PZUA 4RX0A 4CD4A 3UU0A 2EPOA 3TKFA 1J5TA 3B9DA 3A4XA 5A6SA 3UPBA 3CC1A 3NDYA 5SWUA 1NDZA 3H4GA 2BTMA 3DYMA 3LUTA 2OYKA 1J2WA 3GG8A 3WBYA 4AY1A 4AXNA 4E6MA 3N2TA 1EO7A 1H1NA 3T8QA 1F3XA 2JEQA 4ZR8A 1F9CA 1XS2A 4GUFA 2VTFA 3ABZA 1RJRA 3I7QA 2Z0IA 2D23A 4Q7IA 4MNMA 4AVFA 2YXGA 2FJUB 4GMEA 3NO3A 4JTJA 2TPSA 1R8LA 2PGFA 1WOAA 4UMAA 1QO2A 3CHEA 2BBFA 1CB7B 3LLFA 1FWHC 4GD0A 3UR5A 1W3IA 3HG2A 4HYWA 4S3AA 4OBRA 1Y5VA 4O53A 3LTSA 2ZYFA 1OYAA 2EGZA 4O28A 3L4VA 3GH4A 3AIBA 3EKZA 4F9DA 4HCHA 2PPGA 4LUSB 3STCA 1J12A 2ABAA 3WLPA 5I3FA 3CQHA 2ACUA 2GUBA 5CC5A 4IGNA 1B2YA 3TWBA 1EX5A 2VZUA 4ZO8A 3N29A 4OIFA 1X96A 2G5WA 3CK5A 3Q37A 3SUUA 3GVVA 1FWTA 4G7EA 1FWBC 1U5HA 3MUY1 2C8NA 4BI7A 1V02A 3I68A 1U5JA 1YLVA 4H6EA 1VD6A 1EH9A 4HTYA 3WIJA 1R30A 4GY0A 4INFA 5CPQA 5ENLA 4H2HA 1LQ2A 1KXQA 1TV2A 5L6UA 5A1AA 3AHZA 2WC3A 1S5NA 1THFD 2GK1A 3V4BA 2AKZA 1BTCA 1O66A 1LWIA 1T8XA 3C0LA 1YW1A 2B81A 3FYPA 4CNSA 2GGGA 4GGHA 4EPKA 5BXTA 3E5PA 3WQ4A 3A22A 3CIXA 4PCSA 4NU7A 3TTQA 3ITOA 3L5AA 2R24A 3ZT5A 1LORA 3VOIA 4WIWA 3OVPA 3L4ZA 3NZGA 2GGEA 1UJPA 1HT6A 4AU0A 5K7JA 4A8LA 2PA6A 3RMEA 3LXCA 3NOYA 3GTIA 3W7EA 2Z29A 3KL0A 4KPLA 1KFBA 3GXNA 2ESCA 2I56A 3AU2A 2ZA2A 2I14A 1SO3A 3CQIA 5CZSA 1VCFA 4D8ZA 2VM8A 2TYSA 2CBIA 4A4AA 2P76A 1NQ6A 5KEZA 3QGKC 2V2HA 4ZGYA 1VC4A 3PZQA 5C2GA 1V79A 2OELA 3OG3A 2OYMA 3T40A 4ZQMA 4A6GA 3B8TA 4HK7A 4NI3A 1S38A 2GSEA 1P6WA 4DJFA 1HP5A 4CQ8A 2INZA 5LIUX 5FSEC 3ZIZA 2PWUA 5I3DA 1V3LA 2DSKA 5C6MA 1W1A1 3AIUA 1OY0A 3QFEA 3EDEA 3B9NA 1OFRA 2OWXA 3HB9A 4LUJA 1FCBA 3AAMA 2YOCA 4HPNA 3SCSA 2OMAA 3K13A 3RN6A 4Q8PA 3OZPA 3VE9A 3VX0A 3PZOA 2B7PA 4UTLA 2XU2A 2VZSA 4Z2JA 3WFLA 2GQ8A 1LWJA 4R34A 3MO4A 2FGLA 1BPLB 2C14A 1ZP4A 1XIDA 3PBUA 5DRIA 3IANA 2A21A 3EPOA 4QLLA 5DQPA 5TNVA 4QS6A 4P8WA 5KTLA 1G69A 4M7TA 3WJXA 1N8IA 2JKPA 2PE4A 3J7HA 4RKAA 1KGUA 5EYWA 2FZMA 3TYEA 3W70A 1EJSC 1GONA 2YW4A 2I5IA 4B2DD 3TJIA 1LJYA 4FNRA 4HZ8A 3BJTA 4N4PA 1TV8A 1CENA 2XIQA 3BLFA 5HINA 4C6IA 2V5JA 1ELSA 1KTBA 2PWEA 4AIBA 2Z2AA 4AD1A 3B0YA 4NSBA 3CB3A 5E0FA 1W1YA 2WWDA 1YADA 5CJNA 1LLZA 3U0HA 2ZX6A 3MYPA 3S47A 2HBXA 4Q6XA 3T42A 4HTBA 5FD0A 3PULA 1GORA 1TCDA 3CPRA 2A7RA 3S2NA 4O13A 4IGMA 3W6LA 2V5LA 4J3WA 3AJ7A 3GC2A 4YTSA 2W3ZA 3PTMA 1TV3A 1GVIA 1Y8BA 5BOEA 3PBYA 4ZMGA 2BGQA 1DQWA 2UZ9A 3B9AA 2FJKA 4KFPA 3CZLA 4FOJA 1NEYA 4UFKA 1GPWA 3L5LA 4ZSUA 3U5YA 1MDLA 2YDSA 1FH9A 4HPHA 5KMYA 4JKMA 4DZAA 4AYGA 1Y5WA 2J7BA 3W72A 3FYYA 1E6SM 3A6OA 4OZOA 4I5RA 4QJ3B 5C5YA 5MKGB 4NRSA 3W29A 1QHOA 3U8GA 3EB3A 3V7PA 1K1DA 1RP8A 2O9PA 4DWDA 4HBKA 1JZ8A 3C2RA 1MEHA 3M1ZA 5CLTA 3SCNA 1IWPA 4HVXA 4PEEA 2NX3A 1EIBA 2OVLA 3AYVA 1YYAA 3WF4A 2D69A 1R0MA 1XBXA 4EKJA 3CQKA 2WLZA 4TVUA 1A0CA 1T7LA 2D20A 2XH2A 2G3IA 4XZ9A 2R82A 4LAKA 5DF0A 3SECA 4KRZA 1KFWA 3M46A 3S5ZA 1B3VA 1BYDA 2NV9A 3RX2A 5HPOA 2DZTA 3IGUA 4BQ2A 5C9ZA 4GC3A 1BXNA 3Q65A 1A5AA 2POZA 3KAOA 1QBAA 1V5XA 4DUOA 3GK0A 3KP0A 2YCKX 2WPGA 1FTXA 4AIOA 1AH0A 4DVOA 1OINA 1OCNA 1OJXA 1MW2A 1TPB1 4JDYA 4RDVA 2XVLA 4H83A 2P3ZA 3UZYA 1WX0A 2FZ8A 2XJ7A 1VBGA 2X30A 1BXBA 1DJWA 2GGJA 3ARPA 1E56A 2JF6A 3WD0A 5G5IA 3RITA 4IWWA 4K6AA 1LUCB 4CQBA 1S2UA 2PDHA 3U2ZA 1XKYA 1J4EA 3VA8A 4LB3A 3ZR4A 4S3FA 3EX4A 4ZEPA 3KLKA 3ZVHB 1P0BA 3PZ9A 4FHAA 4PBFA 2Y7DA 1WP6A 3N2BA 1EGVA 4JEJA 2BY1A 3W7OA 3PTKA 2GJXB 4Q4KA 5HMEA 4WKHA 1KA9F 5C9XA 1E0TA 2TSYA 1O94A 3ITVA 4F4RA 1H5YA 4ZQOA 1QHPA 1RD6A 4I5UA 4LPCA 2H6RA 1A5MC 2J7GA 4WEVX 4OT7A 2JALA 2FVMA 3NSMA 3EMQA 4U2YA 1W17A 4JGDA 4QEEA 1BYBA 1K8XA 3BAYA 3I10A 5I6SA 2PDFA 2PGRA 3OLIA 2AL2A 2WO5A 3KX6A 1XLCA 3SRHA 3UEQA 3T78A 3TTEA 5GJPA 1CGWA 2V3FA 3NGJA 4CD5A 5CBBA 1MW1A 2BVTA 2XH4A 4B92A 4IQJA 1W1TA 4MF4A 4RCXA 4S2BA 3G8EA 4UR7A 1TV7A 1B31A 5A8PA 1RVGA 3NZQA 1XRTA 2PU0A 3URQA 3VAVA 3G1YA 3K4WA 4BKNA 1C93A 1H41A 1RBAA 2XDFA 1OWQA 1POKA 1LWHA 4IF2A 2OQHA 2PRLA 4PTNA 1CI1A 1PX3A 4A8IA 1CT5A 3LHTA 3CAKA 2JKEA 4QQUA 4GISA 1J0IA 3WD3A 2BX7A 2OZTA 4GOAA 2IKHA 5D9NA 2HSAA 4IGSA 4IPIA 3PZNA 3E96A 1JUBA 2QCDB 2WJFA 4M0XA 1SFLA 4XVEA 5HMFA 4AVOA 3FOKA 5EGRA 1ZY9A 2PBOA 1WKDA 4M80A 3KOXA 2WHMA 4LWWA 1FWGC 1MZHA 2E28A 2V69A 1GEQA 1NDVA 1W1B1 1I0DA 3HPAA 4N02A 2RKXA 2Z7KA 3R7MA 3QN3A 4FNQA 1DXFA 3CZGA 3QSTA 2E9MA 1JDCA 3QVQA 5AYBA 4MYXA 4HNNA 2ZVIA 2AMGA 1E43A 3G1FA 4BWLC 2FPYA 4NYYA 1QI3A 1YE4A 4DWSD 2V81A 3EDKA 3M9YA 1FA2A 1EF3A 3ZSSA 4O17A 3HU7A 1FRBA 2XVGA 3R8GA 5I0DA 2HDJA 2XM1A 1B9ZA 4DLMA 3UCDA 3LTYA 4UTHA 5LNWA 2V30A 1R7OA 3KL3A 4P7OA 4GABA 3AIQA 3OLDA 4J27A 4H04A 3SURA 1X7IA 1Z32X 4OVXA 3KHDA 2DVXA 3ITTA 3GH7A 4XIAA 4FIQA 4MB4A 4P5UA 1SW0A 1GJUA 2I9UA 2CETA 1VBRA 2W0UA 1BVZA 4A2SA 4DBSA 3NXFA 1RCXB 1EP1A 3B0VC 3LQLA 2YYTA 2NUXA 3M41A 1SO4A 2VXNA 5D8WA 1ZALA 3CUIA 5T26A 1GQKA 2G8ZA 3GUWA 5EA9A 4DAIA 4KRTA 1XQLA 1YKWA 1NVMA 1TELA 1QNRA 3UJSA 1MQPA 3S6OA 3HPXA 3CWOX 4BI6A 3PPFA 4RZ4A 4GQQA 2Y7FA 3E0WA 3TC6A 1RQBA 2V5KA 1EYWA 3VNJA 4U31A 1FWJC 3P61A 3QV9A 1JI1A 5AHLA 4WR3A 4JN7A 2NSOA 1XIGA 3K1GA 1CEOA 4HHLA 4E4PA 3OODA 4O12A 4UTWC 1XD1A 4HK5A 1CGUA 3F2CA 1RJQA 3M0XA 3BCDA 1OCBA 2PWGA 5E9AA 4YWSA 2I9EA 3CV7A 3H7VA 1JPKA 4NAFA 2J77A 4XO6A 2IPJA 3TCEA 2EF9A 3RYSA 3EWDA 1F61A 4O54A 3WX7A 4LBUA 3ATYA 3YPIA 3OIHA 1TPH1 2PLMA 3TNBA 3NQMA 3HQ1A 3WH5A 1JRCA 3F4VA 3LGDA 5I79A 3KCJA 2NUWA 2CHNA 5HQEA 3KZPA 3GAYA 1KM5A 5CZKA 4NI8A 5IM51 2OU4A 1VLWA 4OUEA 3T4WA 3QV7A 2VOTA 1R3WA 3VX1A 2PLJA 4ZODA 1BEUA 4MYAA 3LRLA 4I5XA 3CHFA 3S5NA 4MY9A 5I3KA 4BHYA 7ENLA 1HP4A 1OCQA 4DJEA 3GDTA 5K3VA 2Y88A 1V3HA 3HPSA 3PZGA 2WMFA 3C5QA 2PEVA 1K9TA 4GVHA 1KXVA 1OK6A 2BFGA 2R1KA 2GSJA 2J25A 3KZSA 2CU0A 4P8XA 5KZ6A 3IJLA 4ZOEA 3W1AA 4M3PA 4CD7A 3O07A 1DIOA 1RK6A 3COTA 1HZYA 1OVDA 1MFVA 2WVVB 4RZ6A 5C9WA 4XAFA 4REQA 3AWNA 1T41A 2QJNA 4DXVA 1R3VA 4R5EA 4LQ1A 5D2WA 2HXTA 4V1YA 3LNPA 3HOJA 1AL7A 1SZRA 4MPKA 1ONEA 2VO5A 1IGWA 4EANA 4C6KA 1ADSA 3OLEA 1QDSA 1GYNA 1HJWA 4FALA 1NF7A 4QJ1A 4PMRA 2E5CA 1OZMA 3GY1A 3TOPA 4MJZA 4EIVA 4XZHA 2NXHA 1KKOA 1EQCA 4RE3A 4EWJA 2QHAA 1O1HA 5E1QA 2QCFA 1SVDA 1EWEA 1OFOA 1P1XA 5I78A 5C8BB 4MVAA 2DY3A 4JIPA 3OOQA 1PL9A 3KOWA 5EMUA 3VDCA 4YPJA 1DJNA 4UB9A 3WQ8A 1VFHA 4JTAA 3WSUA 4HNVA 1EA9C 1DHKA 2D0GA 4ZZ9A 1UHVA 4LTSA 4ADTA 3V0UA 2PP3A 4QR6A 3G24A 1PIGA 3CAWA 2CHRA 4FNSA 2BG5A 4WCJA 5AHNA 4R3UA 2QUTA 1GPFA 3NURA 4TIMA 2VGIA 3MP4A 3BMXA 2HMCA 1VHNA 4WY0B 1H2JA 3MV11 1IEXA 1G4TA 3DFSA 1VP5A 3NQVA 1XLLA 4R7OA 3BMWA 4QGCA 3VIMA 3H2CA 1DYSA 4FK9A 5K9XA 3V36A 1ZAHA 1HKVA 3EA3A 3E02A 2V5BA 2WCAA 6XIAA 4R7WA 5A6JA 1TV4A 2YSWA 1O4UA 4JAWA 3W1UA 3GNNA 1JCYA 3L4YA 3WQGA 1SFTA 3H6OA 1KV8A 3G0UA 3PB0A 4CVWA 3SIMA 2X1SA 3VDBA 4EAYA 4OWGA 4LCQA 4YMZA 3F5JA 3BICA 3EWYA 4XSMA 3THQA 4WXZA 2GVYA 3R6IA 1HN1A 4E3TA 1JZ2A 3WQDA 2P88A 1XIEA 2I17A 2ISSA 4UZSA 4Y9NA 3DFYA 4XUYA 1CTNA 2PDBA 1WZMA 2YL9A 4K8HA 3AOFA 5J04A 2WQDA 4MTVA 4DI8A 4IPPA 3TUUA 3BWWA 1VFLA 2ZVRA 4NXSA 4GYFA 4NJKA 1GTHA 5LA2A 1JXKA 1MNSA 3NSNA 3RM9A 1ICPA 2NVCA 3VIGA 1D7KA 1ITCA 3BGAA 1S3HA 3M64A 2DUAA 1UP0A 3UP8A 3GW0A 3FDKA 4D6DA 4U33A 3MTWA 3CT2A 4CNUA 4L4PA 5DCDA 3T81A 1QPNA 2O9OA 2QF7A 4ZB0A 3GYEA 2QVHA 4YTUA 3EWXA 1IXPA 1WCGA 4W9TA 3S9YA 2BOEX 2YXXA 5G4EA 3MB9A 2C1HA 6A3HA 3PBVA 3KOZA 3W2KA 3U57A 1KC7A 1OCJA 1L0PA 1DJHA 4UNLA 2Z24A 1G6CA 5I7GA 1JGMA 1YPFA 3CPUA 3SRKA 5AYYA 1RA5A 4DF0A 3C2YA 1IXOA 4Z42C 3O0FA 1MW3A 3QTPA 5LHEA 5I09A 1S39A 4AZ7A 5B7YA 2HISA 3VIFA 4ALDA 3R8HA 1DL3A 4GZIA 2PLCA 5BZAA 1TPUA 4E2VA 1WQ5A 4W8BA 3E0VA 1CBGA 2HE8A 4JIHA 1OX4B 3H70A 3UY7A 2WHKA 4HQVA 1QOPA 5I3JA 2IW0A 4AEEA 4IQLA 3GC4A 3QR0A 4K39A 5FEZA 3I3BA 4LCRA 1DWAM 3B8WA 5CQ1A 5F4SA 2E40A 3FA4A 1TV5A 5CXPA 3MWCA 2CBVA 2IPGA 3C3UA 1P6BA 2CYGA 3MBFA 1WXJA 2WMIB 4I3GA 1SUXA 3QZ6A 4PC8A 3DIPA 3BOLA 2WC4A 1HNYA 3SQSA 3VKAA 4RV3A 1LQAA 4ENLA 4AIUA 2P10A 1CXIA 5LXEA 4CGTA 2QJHA 4OTKA 3IJ7A 1SZFA 3I7RA 1HJVA 3BAXA 1AK5A 4H7CA 2PBGA 3L21A 1A0DA 2VFHA 3BCFA 3N6JA 1ZQ5A 4JICA 1M3UA 2GSHA 4GJIA 4MWAC 3A3HA 4KWVA 3PUDA 4HJFA 1E1EA 2X42A 1GGOA 4WY0F 1EL3A 3F1QA 1UZHA 5CG7A 3TQPA 1XPYA 4J40A 2WBKA 2WK2A 1YNPA 5M3WA 1PYFA 1Z3NA 3O8AA 4O18A 2QCGA 3IK2A 1QNOA 5BOOA 2ZFAA 1JPMA 3I3DA 4GZ7A 4QFUA 5H91A 3FHQA 1UR0A 3QTGA 3U2CA 1GOIA 5CC6A 4XAPA 4MADA 1VIWA 3G0SA 2Y85A 4PYSA 3UJEA 1EUAA 3RF9A 3OHIA 3SSJA 3OVQA 5HMDA 2VHLA 1GWJA 5REQB 2FB3A 3PB2A 4C65A 2GWNA 4UTTA 1EWDA 2DUXA 4FXJA 4LYRA 4GQ0A 4HU3A 3H2NA 1ADOA 5CCZA 3DBPA 4MZ8A 1EP3A 3ZMRA 1RQEA 3QMTA 3C8NA 3CLMA 2J8TA 3RR4A 1E15A 3NNTA 1LP6A 2VDGA 4GO9A 3ARWA 2OYLA 4A3YA 1ONWA 1OX6A 1OZQA 4AHOA 1QPRA 3L2MA 3FJLA 3DHDA 2B4GA 4AWTA 1HXJA 4XAYA 3PC0A 1FWRA 4LAUA 1F76A 2I16A 3H2MA 3R11A 4MGGA 2A3EA 4MWAB 4F0SA 3RRAA 5LKYA 4PMXA 1SM9A 5EFFA 4E2DA 3Q4DA 3SW6A 3PPCA 3TX9A 3O0KA 1TUXA 4LUIA 5AN7A 3KCOA 4MM1A 2EQDA 1B3WA 4GBUA 3VC5A 3AFBA 3B40A 4ZE4A 5DT7A 1L2UA 2J78A 5T91A 2XGZA 4GWEA 4WZHA 4ZSTA 3NSXA 4AC7C 3ZJ8A 4NZFA 5FF2A 1M65A 4LNYA 2J27A 3MV01 1AW5A 3SY8A 4C7GA 1Z89A 3GU2A 1BD0A 5D30A 3NQ8A 1U33A 4DF2A 1GOWA 2IKJA 1G5AA 2AAAA 1ZS2A 3CB8A 4BQ5A 4LXFA 4XD6A 3A24A 3GUGA 1YBQB 2E3ZA 2QXWA 4IMCA 4Q4MA 4AZGA 1VBUA 2XSAA 3KUMA 6CGTA 1J96A 4NASA 3VU2A 1XH0A 2QIIA 3K30A 4A2RA 4PUJA 1U1HA 2PDNA 3BLEA 1PDZA 3WLTA 2PC4A 3TAOA 1EOMA 5TQLA 2YL6A 3P5YA 3OQ8A 1MDRA 1HTIA 4ADUA 3TXVA 3WUEA 5D02A 4QLKA 4Q8VA 3QRHA 4LF1A 3W27A 3L12A 4O57A 2W27A 4ORIA 1KFKA 1VCVA 3G0XA 2O55A 3NO5A 1QFEA 4IIDA 2JEPA 4QXIA 4YNGA 1REQA 2QCMA 2WNQA 2IKIA 1CXHA 1GCYA 1MFUA 1XX1A 1C8YA 1MYRA 3JS3A 1AMYA 4CU6A 4L6OA 5CC7A 1ZBKA 3NQ7A 4JFUA 4AZIA 4L64A 5ABTA 2GJLA 4UCFA 3K46A 2AL1A 1F8MA 2PCQA 5LHFA 2BGSA 3VIIA 4RNJA 2QUMA 3R25A 2DW7A 1Q8JA 1WB0A 2ZRYA 1CLVA 1JFXA 3VK5A 5DMMA 1IT0A 1ZP3A 4I6VA 3LU2A 2FH8A 1X8CA 3TA6A 3R5EA 4QTGA 3DUGA 4PZVA 4K7YA 1AUSL 2CZEA 3CMFA 3HJEA 5FCZA 3SCTA 2PF8A 3V16A 3NL2A 2ZCGA 5F1VA 1L8NA 3SN1A 3UWYA 4IJRA 1DE6A 4HSHA 4LT9A 4LUTA 1GOKA 4NKCA 2X2YA 1WZKA 2NW0A 3AIVA 4UOJA 1YNQA 2FDMA 3WK3A 4DJDD 1I2OA 4RE0A 4RJEA 5I00A 4H00A 5F7UA 3WJYA 7REQA 3S5OA 3GFXA 1QI2A 3ES8A 1CWYA 2QUVA 3SUWA 1UOKA 3USZA 2JIWA 3W02A 4GNKB 2ZKMX 2NWRA 5A6BA 2FVKA 3LK6A 1JD9A 4JKLA 3MU7A 3DKLA 3QQ0A 3ID7A 1B5TA 4JIQA 2D22A 3IJ9A 3EMZA 1OIFA 1NDYA 2FHBA 3CUXA 3E5BA 5AOUA 3U3HA 3PANA 4Q4RA 4TMCA 2O92A 4IPJA 4M81A 1BWVA 3PHAA 2QULA 4PUDA 2PLKA 3F03K 2BSLA 2OGJA 1SR0A 1Z48A 3WD4A 1JZ6A 4H1ZA 4B2DA 2ZRUA 3E2QA 1JAKA 4F2UA 3MUAA 3FHAA 4P7QA 3QMSA 1E40A 1KCZA 2C16A 3NEVA 2FYMA 2WANA 2H8XA 1VJZA 5JMUA 1XYZA 1GJPA 1QOXA 2D3LA 3N6QA 1US0A 1NOWA 2YZ5A 4NG3A 1FBAA 1OADA 3WFAA 5BWFA 1I6NA 2W79A 2ZUWA 4UCGA 1PKMA 3UZ5A 3XIMA 4O4VA 3BG5A 1QXLA 4S3EA 1O5RA 3R79A 2YGYA 1EFZA 1OGBA 2GDQA 3LLXA 1IIHA 4JX4A 3SUTA 4QE4A 1TVNA 1JCTA 2EPKX 3JZEA 1YPXA 9RUBA 4GRSA 2G3JA 3UZXA 4GLEA 1UBPC 3G1VA 2XH0A 3SSZA 2W66A 4GYPC 4Z2HA 2QAPA 4C1LA 1HKMA 3AICA 3T0BA 4DBDA 3TVAA 3NUKA 3W7QA 1IEQA 4CVUA 4KFOA 4HA4A 1E5NA 1Y5XA 1KRCC 3I6EA 3KBNA 5E09A 2H9AA 1M5WA 4AZCA 5G2HA 4CEXC 2FZNA 1O12A 4AWEA 3LCGA 3EWBX 4HN8A 5AVNA 2GVGA 2NQJA 1JNEA 3EX1A 1T96A 4WDTA 2PD5A 4C6NA 3CNYA 2WYSA 1O60A 1OK4A 4KQNA 2Y1HA 3OO2A 2CBJA 4Q8NA 1V6XA 2JGYA 2DORA 2DW6A 3OZOA 1FHDA 3Q67A 5C2CA 1TREA 3O16A 4JTGA 1ZJBA 3RO6A 4H19A 4M1RA 2DT2A 2V5DA 1VR6A 2WMKA 4M82A 2XIMA 2GQ3A 3S5SA 3CM4A 5D33A 2D2JA 1XYFA 3T0DA 3W4RA 3BO9A 5IBXA 4ZOAA 4JR5A 3N4FA 4O8RA 1OFDA 4CQDA 3XINA 3EOEA 1PZ3A 4WSJA 3BC9A 4HMDA 4N9BA 2WNZA 2HROA 4UFMA 1FDZA 3CPGA 4BF5A 4JY8A 1S3TC 1TPWA 1AZ1A 1YXYA 1H7XA 2ODOA 4LU0A 2BY3A 2F7FA 4HGXA 2YBVA 4YHEA 2OWCA 4LAMA 3FX4A 2R6OA 3QW3A 2DEPA 1QCWA 5AC7A 3A9BA 3HO8A 1NTHA 4Q7NA 1GOMA 4X61A 2R1MA 5LIYX 3BV7A 1XUUA 4IP4A 1W37A 4JTFA 1QWGA 1TJPA 1RH9A 3M5YA 2CERA 2VDIA 3CZJA 1GQNA 1J9YA 1JF5A 1DWJM 3T0TA 4GJ1A 1Q4WA 2JBMA 2W6RA 1AL8A 2DZSA 2E6DA 2YA2A 3UNTA 3PWIA 4MLRA 4PRWA 1XCFA 2VT0A 3LZ5A 4LYKA 1YDVA 2EG6A 3BUVA 2UY4A 4XUGA 1WO2A 4LH8A 5D9OA 5LGXA 4YCPA 3BL3A 3FAXA 4D6HA 2TRSA 5HOSA 4WGHA 1R5YA 3CAVA 4GC4A 1UKQA 5H1WA 1X6NA 3AHXA 2WSYA 3W82A 4B3LA 1PWLA 3ARXA 4A22A 3LDVA 4IFKA 2E77A 3GLCA 5RUBA 4WOZA 3OW1A 3XISA 3WFZA 2E7FA 1CCWB 1DTUA 1RA0A 1BQGA 4MNLA 3W85A 1NF0A 4RDYA 1UB3A 4X3ZA 2QJJA 1MI3A 4DYEA 5FF3A 2O9RA 1OEPA 2C19A 4KH2A 3IIZA 3NQEA 1HF6A 5IRPA 4Q4QA 3SBFA 2HVMA 2VEIA 1Q2SA 3M07A 1DV7A 4XZBA 4ERGA 1HJUA 4NIRA 3QOMA 1VPQA 2ZC8A 4MWAD 5HQLA 1DIEA 2DUZA 3SCPA 2PDJA 3W87A 2QW5A 4HPJA 1SU5A 3GTNA 3QGAC 3WLMA 1WKEA 3UXKA 2VC6A 5LYRA 4AW7A 1FOBA 1JZ7A 3W76A 4B5UA 1XLFA 3GNXA 1A5UA 3KXQA 3G18A 2Y8UA 3N13A 4QRNA 3WJWA 4O11A 2OX4A 5CPLA 5BROA 2WSKA 4GVIA 1A3WA 1VCGA 5C0QA 2FPVA 3KLLA 1BFNA 2DH3A 5D2XA 1UCWA 4JFSA 4LUSA 4E38A 3LV6A 3HV9A 2HVNA 4PB3A 4ACYA 4DI9A 3WBEA 3P60A 3O6AA 1RLDA 2V67A 3R4IA 1J0JA 1CLKA 2J6XA 1F5ZA 3GAKA 1TPVA 4D8AA 4HIBA 4TU1A 4LC6A 4MJ2A 4PRTA 1QTWA 1NP2A 4B5TA 2Q8XA 4E8CA 3LERA 4B5SA 4B4HA 1OX5A 2ZZ1A 1XP3A 3WKZA 3GR4A 4JTTA 4LEFA 3ARQA 2FFCA 1FXQA 3WQWA 2VCCA 1OC5A 5CZTA 3PN8A 4PMYA 4PSPA 1WDDA 3VDGA 4JZ5A 1H1YA 3KTXA 2BMBA 4WJ8A 2WCSA 2NXGA 3IEBA 1TPFA 4V28A 3TK7A 3KDOA 3QQWA 3CIWA 4IP7A 2CCRA 1IT8A 3VYLA 1ITQA 1JPIA 2BY0A 4A05A 4ZENA 3GFYA 5M17A 3TW9A 2WNWA 3C8FA 2XVKA 3LLDA 3S8HA 4JTQA 4HU8A 2BXYA 3P8JA 3CL8A 1BSLA 1TIMA 1JG9A 1GHRA 1IHIA 4I9TA 4OOUA 1PKYA 2E25A 2QQ6A 3RXZA 2GGIA 4BY3A 4RL3A 1HVXA 4Q33A 5GJMA 3IUHA 2A6LA 4X22A 1VB9A 4IH3A 1FDJA 5DT5A 4DYJA 1WAWA 3NQGA 2ZA1A 5ABEA 4S1FA 1EJWC 3TLQA 3DXIA 5AYXA 3KBWA 1ZBWA 2CLPA 3EKLA 3V0SA 1D7FA 1U30A 4JQ4A 2J9YA 3GHTA 1I9CB 1U2YA 4E2BA 2A5HA 2WHLA 5AECA 4MWAE 2QPSA 3HG4A 3KEHA 3H2EA 1EGZA 1UA7A 5IFPA 4FP1A 3WJZA 7PTDA 4BA0A 3SRDA 4QM1A 3Q58A 1U1JA 4TR9A 4PODA 3A4WA 5FOOA 1AD4A 3TWAA 2A3HA 2AAMA 3DG7A 3CUGA 4ACZB 4C6QA 4G7FA 3IIXA 3BPWA 3QLLA 1UWUA 3U7VA 3RUBL 5K9CA 2VJXA 4HHHA 2C1GA 4JX5A 4IMAA 3SY1A 1K02A 4O1EA 4PR4A 1K77A 2J7HA 5DO8A 5I03A 1JCXA 1SW3A 4O8AA 4PRRA 1QU4A 4GNVA 4HPGA 3FJNA 5FF7A 1TJ1A 3WBWA 4MHBA 1XG3A 4EK7A 5FL1A 4JHOA 1Q7QA 4W88A 4C6OA 3N11A 1RXOB 5I23A 4NVTA 5FJJA 3B3DA 4NJHA 3W26A 1GKQA 5DBUA 4L1WA 4NQ1A 5BMWA 1W6TA 6TIMA 3UG5A 1PJ9A 1XICA 1CXFA 3GXFA 1UR9A 4MOZA 1LL6A 2WAGA 2Z1KA 4JTIA 1XLHA 3KBSA 1QRQA 1F2JA 1EB3A 3CXOA 1CPUA 3W74A 3H2OA 2O7SA 2OOFA 3PJXA 2BOFX 4TX6A 4N9CA 4LX4A 1YDNA 1HQTA 2X05A 1KWGA 3IVTA 1F3EA 4BEQA 1W8SA 2CLOA 1CGXA 2YCLB 1J11A 1ZJIA 1UKPA 1XISA 4WUIA 4TOQA 1Y7VA 4IFRA 5AHIA 3DEQA 3HGRA 2Z1WA 3LX9A 4CN1A 2VR2A 3VKDA 1F6KA 2ZZ6A 4AC1X 1QI4A 4EXBA 4EE9A 1Q66A 1J79A 1UASA 2ATMA 1V77A 3TN5A 2G0WA 3HFTA 3VKBA 1EBGA 4GZEA 3A12A 4NJJA 1ICSA 4AIEA 1G9HA 3UD6A 1QO5A 1EJ7L 5MKGA 5F4WA 1G7VA 5IHRA 3LCHA 3VC6A 2RDTA 2CHOA 4TX9A 1E73M 4G9PA 1H60A 1B4EA 3L4TA 3VNLA 3FSUA 3I6RA 5FF0A 1WBHA 4GACA 2ALDA 4Z2GA 2W61A 3MSGA 1HKKA 5HNTA 4IUOA 1HJQA 1K7EA 2Q8ZA 3VOCA 2NT1A 4I9JA 3TYBA 4IXXA 4UFJA 2INFA 1XLAA 4PUUA 3MVIA 1QW9A 5EPDA 3BOXA 4IMDA 3GS6A 4H8HA 4GIYA 1W5OA 3VNIA 1KTCA 3WEMA 3AYTA 5EBAA 1QW8A 7ODCA 2V0TA 3T1GA 1SJBA 1FH8A 2XIOA 3HTWA 2VGGA 3RNDA 1QUMA 2G3MA 4K36A 1ZPTA 4S3DA 3TW6A 5JBFA 2ZOXA 1KBBA 2UWFA 2XGBA 5CKSA 3DC0A 2PURA 3RK8A 3T4CA 1L6YA 5CG0A 3CASA 3ZWSA 3LCXA 3NEHA 2CITA 1HKIA 3EXSA 1C8QA 1KFCA 4F0LA 3MZ2A 1SO6A 2WMJA 6REQB 3E38A 1PKLA 2Z1BA 3MMWA 3STFA 4ZQRA 3MKCA 3BK0A 1TZZA 3VIKA 3P7YA 1G01A 4NT0A 5GJNA 3URAA 1LUCA 3WDHA 3CUZA 4HMEA 1QOQA 1F73A 2ZICA 4I7UA 5G2IA 1H5VA 1JDEA 3CZ8A 3KHJA 4OQVA 1WYIA 1XG4A 1ZCCA 1TX0A 1GW1A 1UD5A 3ZVHA 1W5NA 2NQZA 3W2JA 3N19B 4XD4A 1Q2RA 2JE8A 2ZUVA 1QK2A 3CQ0A 3IVUA 5D8ZA 2ADAA 4KCVA 2BXZA 2NLIA 4QAIA 3CV1A 3AI0A 1Q6LA 3UCCA 3K1DA 5LNSA 1Q7ZA 1OFQA 4ZQPA 3AXHA 4PL1A 2GJXA 1NH6A 1MXSA 4MY8A 3DKJA 2RAGA 3P62A 3T07A 1DBTA 2WMGA 3VNYA 4FR6A 1QHZA 3ZLHA 3BQ5A 4MB5A 3E74A 4GJJA 2WM1A 1WNOA 4RE4A 2Y70A 4QG9A 5BW6A 2OZ0A 2NSXA 1E6XM 4D71A 3FGCB 4W93A 3WN6A 2DZAA 5A8MA 1UQZA 4ML4A 2VYOA 4V27A 3L68A 3AUOA 4ICNA 3NPVA 3UR2A 3MHFA 5LZLA 3B06A 3H4WA 4U3CA 2Y2WA 3KVJA 1V7YA 2E1DA 5DY2A 3MHUA 2G41A 3LMZA 2UV8G 4UMBA 4LRSA 4MY1A 4PEKA 3APYA 1ZAJA 2V3EA 4UTUA 3W1QA 2BOGX 3K8MA 2DZVA 1TVPA 1KR0A 3GTHA 1TIWA 1H0GA 3KRSA 3UZJA 1UR1A 3GU9A 1NFBA 4KCUA 4ZL1A 4ATLA 1EPVA 1FWDC 4RW5A 3LCLA 3RPDA 4KESA 1M7PA 1SJAA 2GDVA 2VDHA 5K9DA 4L4LA 3B8DA 1Q7MA 3UT0A 1GZJA 3E2SA 2WV8A 3NZRA 4FAMA 2BS9A 2QCDA 4OV9A 3OPSA 3OEXA 5A6LA 5C9RA 3N1AA 2C6QA 4QCEA 2DQXA 4F48A 1CXKA 3HPZA 1RY8A 3WLHA 1RV8A 1YTDA 4AVNA 5TF0A 5HMSA 5M2FX 2V3GA 3NM1A 4GUHA 4PMDA 1E0XA 4HD5A 4C6FA 5AYZA 5I3GA 2OX1A 1V6TA 2NXIA 3CHDA 1EX1A 4C6LA 2VP8A 3SRFA 1Q6FA 3W6YA 3ECQA 3WH8A 3LTPA 4NZ1A 2ZQ0A 2IUZA 2V63A 1R3QA 4GINA 2G96A 1BVNP 3LS9A 2HS6A 1YXCA 4FOUA 2E8YA 1E5JA 1W2VA 1XH2A 4W8AA 2V68A 3W75A 5D37A 1TTPA 1EZWA 1EHNA 4GUJA 1A5CA 1I60A 3QZAA 4GCXA 4XVDA 1XFCA 2YX0A 1Z69A 3SCVA 3SQMA 3TQ0A 4HOZA 4JN8A 2GZXA 4N42A 3DFHA 2Z7GA 3BJSA 3LGEA 4HA0A 3ARSA 1RBLA 5EMLA 4M6VA 5I5RA 2VVNA 5HXMA 2QAFA 4D2JA 3HGJA 3HA1A 3LGGA 2VUYA 3DYOA 2PUZA 2QPUA 3PK7A 3LY0A 4M24A 2QDGA 3D6NA 3W1PA 3G3DA 3IACA 4RNFA 1NAL1 4TMBA 4V33A 4JIRA 4FOKA 1V3KA 3LHYA 5C55A 2FTYA 4Q22A 2NQHA 3LNMA 3SI9A 3G6LA 1Q6CA 5BXSA 4CNTA 2MNRA 4QQ3A 5DELA 4BWLA 2XIJA 3HF3A 4Z1DA 1FDYA 2VQTA 3QV6A 4XBSA 1X1OA 1RUSA 1MSSA 1JUKA 3VCRA 2YPIA 5DMNA 4KCWA 3ABSA 1SZNA 5GVJA 1NOFA 1R87A 2VZVA 2BHUA 1UOZA 3BLPX 3I4EA 4AD3A 2C18A 4QG6A 1FCVA 4UIOA 5I77A 2OKOA 5DANA 2HCVA 2ZDRA 2ZUMA 4B5XA 2OR2A 3NQ6A 5BXPA 3PNZA 3TZFA 4LY4A 1C8XA 5C9UA 3APTA 1ZTVA 3VCCA 1F4HA 3EPNA 3T05A 3M6DA 2A3LA 1W5QA 4FXRA 2HWGA 1K8CA 3K4DA 3F4WA 3C61A 3SGZA 1LTDA 3QSRA 1JNDA 1I2PA 1UR8A 3TQVA 3T8LA 1XIMA 1SJCA 4O16A 2A1YA 1ZU8A 3H21A 4XD3A 3JVAA 3URNA 4LFYA 3PM6A 3VM7A 2GVJA 1XF0A 5I07A 1IXQA 5EBUA 4J1OA 3UETA 1HL2A 3HM7A 3LSBA 3RX3A 2VRQA 1DIKA 1SSGA 3S0CA 3EA1A 3W2LA 1VENA 1BKSA 5EU9A 4OU1A 3TYAA 2QNEA 1NJJA 1RLCL 3ARYA 3AALA 3FKRA 4N4QA 3SZ8A 3WQCA 5FL0A 3S2MA 3W1RA 2CLMA 1XRVA 4HMCA 1NELA 2RDWA 2ZRWA 4KERA 3WLRA 4PN2A 1C7TA 5LIKX 3DHFA 3RLUA 4M1BA 4NILA 1TJRA 2DFAA 1G4EA 3AXKA 4IUGA 3RM8A 3MMDA 4PMQA 1WA3A 3ZO9A 2HVOA 2VD9A 3TN3A 4UTWA 3FXGA 3GXPA 3CIVA 2ZXQA 4R27A 1E9YB 2ZDSA 4JIEA 2WVVA 2Y89A 4DIAA 2NVDA 4ZTXA 3VVGA 1L8PA 3WH6A 3TN4A 1UWSA 3VIJA 2J6VA 1E3XA 1EP2A 2F2KA 4AB4A 1J93A 3DFTA 1AD1A 3GTXA 2VEGA 1KM1A 2DGAA 3DFNA 2E1WA 2BVYA 4C90A 3N9SA 2VGFA 2YW3A 3W7MA 5E6YA 4E5TA 1E1CB 3VCNA 4AZ5A 1JCLA 2CEQA 3ZJ7A 3W7GA 1FWNA 4N2YA 1LOSA 4G5DA 5A5WA 4HCDA 4K3ZA 2QYGA 3PJTA 3LHUA 5A95A 4IIEA 1FKXA 2OZ8A 1BHGA 3GKFA 4JTEA 3RDKA 3IAQA 3PZVA 3FIGA 3MUZ1 4S39A 4JQAA 1HG3A 1LOLA 4LS0A 3NA8A 4LF2A 1UWRA 1JDFA 4ICMA 1YPIA 3TONA 4GY1A 4DAFA 2DZUA 2DJLA 3TXZA 2ONEA 3LXBA 4LGXA 2Z1SA 2YDAA 4KEMA 1R9YA 3C4UA 2PMQA 1A53A 1UZDA 3KWXA 1PE1A 5IOBA 1IZJA 3M0MA 3WDRA 1VPXA 4J3SA 4US5D 5C2XA 3EEZA 5D38A 1SFJA 2WJEA 4W5UA 1C91A 1W9VA 1M53A 3NDOA 2X7WA 1SMDA 3W6MA 1OD8A 4B15A 4L65A 1WOBA 3TH6A 4WY0A 3TMLA 1MEWA 1X97A 3D46A 4R88A 4V2XA 5AY7A 1CGVA 3CEUA 2NV1A 3GU1A 3W83A 4P61A 3IPWA 3IIOA 1B3XA 2VFFA 2R8WA 1VEOA 1FKWA 1XIIA 3H22A 1PZ0A 3ENLA 4H8UA 3EXRA 4KETA 1PCWA 1Z42A 3B8IA 3WBAA 4A3QA 4GYJA 1QR7A 3NJ3A 3N14A 2J74A 2G4JA 4A29A 3WK0A 3BGJA 3FSTA 3EPMA 3KVLA 1H50A 3WD1A 3U9IA 1JZ5A 1XIFA 4GH1A 2AQWA 3WCZA 3EA2A 4B3ZA 4PUKA 4PL2A 4FX7A 4O19A 3WQ5A 1P0DA 3RIKA 2VKZG 4DWSB 3CLWA 4NNCA 1HW6A 4J3ZA 4MNKA 4KT2A 3AXXA 1VYPX 3NPXA 2EG7A 1OC7A 1VYRA 3QKZA 3PTDA 1XDLA 3L5MA 1TPEA 2BXVA 1SMAA 3VGDA 5C54A 1VEPA 3ZWTA 1IXNA 2YXOA 2BNJA 3H24A 1KKRA 3WH9A 5AHMA 2QKFA 3GHUA 1K9EA 3TW7A 2E9BA 1NQKA 3R43A 1HGYA 4FNUA 3UXAA 2YR1A 3KBMA 3CQJA 4UBPC 1LYXA 2Q3OA 3CMGA 1L6SA 4BI5A 1US2A 1Q45A 3B0UX 4ZFCA 2GJNA 1GVQA 3W2NA 3CYJA 6XIMA 1IWAA 1UIOA 1WE5A 5HNUA 4LBRA 3N04A 1ITXA 4WSKA 4FLQA 4GY7A 1TRIA 2VI0A 5ABHA 4UC5A 3SJ3A 3CL7A 2RDXA 4CU7A 4MAVA 1AW1A 2FZ9A 1J0HA 1UC5A 3EDFA 2WMHA 1ZJHA 2QDHA 2C13A 4HNLA 4LVBA 3BVJA 1ICQA 4UMCA 3T0AA 3B8UA 4YYCA 2YLLA 2QUNA 3FN9A 3PPGA 3QHOA 4J3XA 2QMKA 3WQVA 4JTSA 5B80A 4Q8QA 1ZBVA 4ATDA 1ADDA 2J62A 3KDNA 5D4YA 2BB0A 2OSXA 3VGEA 1CX9A 4FXSA 1QPKA 5A8NA 2ZXBA 3N6HA 1E9ZB 1M01A 1OB0A 4Q3MA 3TP4A 3TOYA 1W3TA 2H8ZA 5F4XA 4XZLX 5T9BG 4D6EA 4PUEA 1WUEA 2REQB 3LA4A 1X98A 1OX4A 4QITA 3LI0A 3NIYA 4GIAA 3P8IA 4Q4OA 1PV8A 3W71A 4A21A 1BAGA 3ARZA 1TMLA 3VNKA 2EEXA 4FLRA 4LSBA 3O06A 5DMLA 3NG3A 3ONBA 3H12A 1TMHA 2XM2A 1TPC1 3OJGA 3IWPA 1RPKA 1TZ9A 1XRSA 4CQ9A 5D2YA 4CCEA 2WMIA 4F0MA 2OOGA 5TBOA 2H3DA 3SADA 1XUZA 4UQAA 2WKJA 2GFTA 2W5FA 1E4MM 1HO4A 4S23A 1H3GA 4DLFA 4ERAA 4I7VA 1VFFA 3OIXA 4N0RA 4W89A 2C79A 4LYQA 3STGA 5J5DA 3R0UA 4WHBA 1F7BA 4Y90A 2P53A 1KNWA 2CZDA 1E9LA 2DSUA 3WMLA 3G1HA 3MJMA 1EXPA 1HFBA 3NVTA 2Q6ZA 1MRAA 2J24A 1M03A 4KGJA 4O10A 1MWOA 1MMFA 4B4FA 2X16A 4MDOA 1DOSA 3BW3A 2QR6A 1FY6A 2PB1A 1G67A 3EEGA 3UG8A 3IAPA 3T08A 1PTDA 1EEXA 5G4HC 4YLWA 1PPIA 4DUWA 3U7BA 1C8VA 7TIMA 2KX9A 4PMJA 2C0HA 2ZZ7A 1Z7AA 1XYBA 4MDPA 2NQ5A 4QBXA 1QWKA 1K6AA 2PD9A 5MHBA 4AD5A 1WZLA 5A6KA 1N8FA 2HXUA 1KM6A 5E93A 2Y6ZA 4Z1YA 2E0PA 5M5DA 1CECA 2CNCA 3MS8A 1GVRA 4FSAA 1R46A 3F4CA 3W7DA 4L4OA 3PBWA 5REQA 1IYXA 1PBGA 2QGHA 4HZMA 1JYNA 3IGSA 1CIUA 3AHTA 1Z9AA 3WMSA 3AUJA 4MJ4A 3BSHA 3II1A 2X1RA 3DESA 4LUYA 5E6ZA 4R9OA 1OT1A 1RALA 3PFMA 3PG8A 3RHGA 4WD0A 1H7PA 1KD0A 1RAKA 3ALFA 3BLIA 3K4AA 3T44A 3S1XA 3A3XA 4H9XA 4MWAA 4IMFA 4WDXA 1Q6DA 4J3UA 2P50A 3GO2A 3DFPA 4B5VA 3ITCA 3LQGA 3NQAA 3CV6A 4O1AA 1K7XA 1BYCA 3FAWA 5D2VA 4B5NA 3WQPA 4PMNA 1K8ZA 1UROA 3TJLA 4BFAA 5AC8A 4RLIA 1LT8A 1RR2A 3O9NA 2RJGA 3ES7A 5JBDA 4O0ZA 3UXIA 1B3ZA 1OFAA 2DV0A 4DF1A 4AQLA 2VRKA 1R3YA 4ZQNA 2QJMA 1JGIA 1TA3B 3UY8A 1YBQA 1UKOA 3O63A 5HWNA 3N4EA 3VGHA 3ZZ1A 3JZUA 4C6JA 1MUMA 1AW2A 3WK2A 5A6TC 3CUFA 3L67A 4UTJA 2CW6A 2Z6JA 4JD4A 3UZZA 5H8PA 4EAMA 4O50A 3W1TA 1AG1O 4H3DA 4WK9A 1SW7A 7CGTA 5HJYA 4EPBC 4CNOA 3H53A 4Q7BA 3IUDA 5FJTA 3N3TA 2GDUA 3CJPA 1O5KA 1ZBCA 4Z08A 1BG4A 1BF2A 3FEMA 4IT1A 2ZE3A 1GZ1A 4GQGA 1P48A 2VC9A 2OLHA 2QDDA 1OHLA 3W23A 3NPWA 1SZEA 1PEZA 4KEVA 3ZR6A 1V6YA 3W07A 1DJXA 3TNOA 1EC9A 1JJKA 2VMFA 5CLWA 4JFWA 1EDGA 1HUVA 5FIPA 1FX6A 1HO1A 3L65A 5CSUA 3ZM8A 4GFSA 5D05A 5JVLA 2ZE0A 3ITXA 1B3YA 1PZ2A 5HULA 1OBAA 1FFQA 3GDKA 1V3MA 2PS2A 1UMYA 1TRDA 1H62A 2VFIA 3G1SA 5LNVA 5E0KA 2XSBA 1LLWA 1LBMA 3OVGA 2V2DA 1XI3A 5FF4A 4A3UA 3QYQA 2KZHA 4ROQA 5JQ9A 2PWHA 1E4IA 3VZYA 1GG0A 1XSJA 3B4UA 3RCYA 4CNNA 4LYPA 3CH0A 1DJGA 1WKYA 2CLEA 1BRLB 3S1VA 3AMLA 3M44A 4CEUC 2Z27A 3GHSA 3FVDA 2ZZ5A 2W4XA 5HAOA 1GT8A 4Y8FA 3OBAA 3AXMA 4NYUA 5XIAA 1LROA 2ZA3A 3FY1A 2QLYA 3ZLFA 5DX7A 1DJIA 1P0NA 1HJXA 1PIFA 3GVGA 4ECLA 4U10A 1V6WA 5I3HA 3ERPA 5K4ZA 1IV8A 4LALA 4H4IA 1M1BA 1S46A 1M7JA 4DZ5A 4QJ4B 2A6NA 4Z1BA 1Q63A 3NYZA 4TX8A 4J9JA 4UTFA 1W1IE 1NWRA 4MIMA 3PZIA 1EO5A 3H2AA 2I5QA 2VZTA 1KM3A 4RK8A 5FEWA 1A5NC 5CSYA 1SYTA 5IFTA 3WF2A 4GNJA 4HMNA 3LCIA 4B5WA 2RJHA 1L9WA 4MSSA 4YS1A 3QPZA 1D2KA 3R2GA 4R53A 3SFWA 3RGTA 3WLLA 3ARRA 1N7KA 1KV5A 2EPHA 2VGBA 4C6DA 1ZHAA 3NOEA 1NU5A 4C6PA 1XYAA 4Q8UA 1VZWA 5J5RA 4W7UA 3MO7A 1P7TB 3W81A 3EOLA 5KINA 3UJFA 3LRMA 1XGDA 4BS0A 3FXYA 4HP5A 3T0CA 3R13A 4P7NA 1LL7A 2Z1VA 3GXDA 3S9IA 5BOFA 1UC4A 2ZTKA 3FDGA 3UFYA 1H7WA 3DBNA