2E6PA

Solution structure of the ig-like domain (714-804) from human obscurin-like protein 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
104
structure length
104
Chain Sequence
GSSGSSGPVHILSPQDKVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Obscurin-like protein 1
publication title Solution structure of the Ig-like domain (714-804) from human Obscurin-like protein 1
rcsb
source organism Homo sapiens
total genus 11
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e6pA01
3I84A 1EERB 1W72L 5FA4A 1JZ2A 3JTTB 3UPAA 2JJUA 3PWLB 5I8OL 3D39A 4NBYB 2VR9A 4G6AC 3FQXA 1VGKA 3T04D 3WFCH 3T0VA 4NQXA 4FXKB 5HSFA 4XXDB 4A6YA 2Z92B 5L2JB 4QXTB 1KCVL 4O00A 5E4EC 4LGSB 3S37L 3MLRH 3U0WH 1VENA 2A6KB 1EEYB 3HMWH 1F4AA 4LF3A 3TZVC 3ZSTA 3WKML 4JKPH 1FGVL 3I6GB 3WSQH 5A43C 1SVZA 2F74A 1N64H 2WUCH 1IL1B 2B39A 1LO4L 4QTHB 4PJ7A 4B5EA 4LSVL 2CDGB 1KB5H 3KPSD 4AQ1B 2N1KA 4HF5H 3OAZK 3OAUL 1JCKA 4M5ZL 5IHUL 3FB7A 1A3RH 1EHNA 3BH8B 2X89D 4HK0A 5TDOB 1CL7H 5HHPB 3QIWC 3VMOA 4ONHA 2AW2A 4UNVA 3UBXG 5IMLB 3L95A 3KXFB 2Z4QA 2YD5A 3IFPB 4YPGB 3HR5B 1J9CT 3R1GH 2HFTA 1PVHA 5L6YH 1TQCB 1I7ZA 4GKZA 4WUKH 1CFTA 3LRSA 4U1HB 2VDOH 5EZJB 1A8JH 1DANU 2YPLB 1HSAB 4U6VH 5HYJA 1B2WH 4RISL 1ZT4B 3D9AH 4Z9KB 1LK2A 1FVDB 1T2JA 2O5YL 3AY4C 4I0PD 1Z3GH 4Z7OE 4UT9H 5L88H 1ZT7A 3FMGL 1U36A 3EJYC 5EN2A 2AK1L 5E00B 2D03H 3W5NA 5AG9A 1VDGA 4JPKH 5DI8B 3TBYA 4PRIA 3HCVA 5INDB 3DECA 5BO1H 4KTYA 3ILPB 3O8XB 2NY1D 1KBGH 2DQEH 2B1HH 1CCZA 3AXLB 3QSKB 4ONOA 2VO5A 1QFUL 1NMAH 1RJYB 4NN6C 5DD6A 3IDMA 4Y4HB 4RBPH 3JWDC 5KVGL 1DBBL 1K8IB 2OZ4L 4J12A 5HHOB 5I30L 1ZT1A 5I66A 5HYSB 3F12A 1U8HA 4DZ8A 2XA3A 3U7AA 1A7OL 4G8GB 4NC2B 3DX8A 1OLLA 4BUHA 1OF2A 2GI7A 5JMRA 1EFQA 1D9KD 4XAKE 4R97C 3AREB 2P46B 3FZUC 5C0IB 3ULVH 1JNJA 4I2XA 2PYEB 3SKNA 3DVNA 4KQ3H 4HEPG 4I77L 1UJTA 2YSSB 3I02A 4ZTPH 5BZWA 1INEL 4I3SH 4L9LB 3KPQB 3EHBD 1J5OH 3TPKA 4JZJB 4RFEA 1VACA 1QFWH 4GXUM 5C07E 3S34L 1JHLH 5D7JA 4R3SB 1S7RB 1TPXB 1IAOA 4OKDA 5JOPE 4MD5A 3DUSA 4UINH 4XCEA 5GHWL 1JV5B 3H9SD 3NFSL 1CFVH 5T33L 5IT2H 3L3GA 1I8MA 3GHBL 3ARGA 2BJMH 4KKCD 5DQDH 3REWA 4K7PL 3LN9A 1YEHH 2EE9A 3CX5K 4OD3H 3STLB 3IDIA 1CZ8L 4BA8A 2NR6D 2GTZB 3ZE0E 3DETC 4P2RB 4JG0L 2QLVB 2E7CA 4Q2ZA 5TGBA 4TUOB 4TVSa 1FLRL 4X4MA 2I25N 3TCLA 1UCBH 2AABL 3HNTL 4JDTH 5EZIH 1QVOB 5DJ6A 4DCQA 4X80L 2ZSVA 1JP5A 3DX7B 3O3BA 2XA8H 2XRAH 4PV9B 1UG9A 1FSKB 5FYJL 1UZ6E 2EO9A 4NJ9L 1HSBB 4GRLD 4QOKE 1ITCA 1XIWB 2X4UA 3NTCL 4OZIA 1G1CA 1ULVA 3HNSH 4FZEL 4IDLA 4R4ND 4PJ9D 1CR9H 4HCRA 1G6RA 4XC3L 3UCRA 1ZSDA 5F7EL 4JDVA 5DD3H 5CIPA 4K8RD 3RI5F 3HMXL 3JWDH 1GGIH 4OGZA 1GL4B 3RKDC 4YHYB 1DVFB 1LEGA 2FX9L 4ZYKB 1A6ZA 1YMME 1MQKL 4TSAL 1UM5H 5CEZE 1FCGA 1I85A 4JFEE 3MJ9L 3IU3B 4ZPVA 5L0QB 1FL3B 4X7DC 3MRPA 4BZYA 2GCYA 2KH2B 4FQJL 3U6RA 1NGQL 4MDIB 3JWOC 2VLKD 5ALBL 3LSOB 4GMTH 3NMEA 4K7FA 4XCCH 3BPNB 5D1ZC 5IW6A 3N85H 2IANA 4NRXB 4YGVB 1YEFH 3GJFA 4YO0B 4S11A 2DMKA 1IEBB 3BQUC 1NGXB 1LO2H 2Y36H 3QDMB 4C83A 1G7IA 3SJVB 3CU7A 3TH2T 1I1YB 5DRWB 4EZMA 1BD2E 5JW5A 3LKSB 2NY2B 5D9SB 3H9HB 2BK8A 1RIUL 4ZFZB 5I1JH 3BUTA 1H15A 4MJID 1ADQL 3O6LH 2BNUA 2R0KH 5C7XL 2WBWB 2MQ3A 4D8PB 1QEWA 1FNSL 4JHAH 1T0MA 4KK9D 3S36L 4N0YH 1G9MC 1DBJL 5EA0L 3EW3B 4HGKC 3VFOA 1F4YH 4FQQB 3T4YA 2NW3B 2EH7L 2WINA 1J10A 2Y06L 2WMPA 1KLGB 5F7HA 3MV7D 2NYYC 4QY8A 3X3GH 4OF5A 3SDAD 4YAQA 4XMKH 1A6WH 4FA8A 4LLUA 3L9RA 3QUYB 3MXWL 1KIUA 3B8YA 3GI8H 5TDPA 1FV1A 5ISZE 4NZUL 3O2DA 4HJGA 1RZJL 3LDBC 4NN5C 2I60H 2GY7B 4OCMC 1P5VA 4X6DE 3V6ZB 2PNDA 5J9PB 5KS9E 1TVBB 5TJWK 3ZYJA 1FZMA 3C8KB 3OAYH 1U91B 4PB9L 1DEEA 3MNWB 4NHCH 5BCAA 5IGXH 1KIRB 3DIFA 3GKWH 3CZFB 4H0GA 4PB0H 3ZE0F 3VJ6B 2N7AA 1E6OL 3MROB 1RULL 5F72S 5AZEL 4ZFOL 1U93A 1Z5LB 2IGFH 1F3RB 5CHNA 1UZ6F 3JTTA 2EH8L 4S1SL 2A6DB 3MOQA 3MLVH 3DUUB 4PYHA 1F13A 3LRGA 5GS0H 4V1DB 1DUYA 3QA3B 4QXTA 1K2DA 4Z7WE 4GJTB 3ARDB 3VXRD 4XWGL 4U1NB 1ZS8A 5SWSA 4P9HL 3CUPA 2IG2H 3HRPA 3QQ4A 2OJZL 3O4OB 5T5NF 5CJ8A 1FZKA 4YC2C 2XZCL 4Y19B 1OAQL 2AJSH 3ZTJH 3QIBB 1OAYL 2FECL 1P4BL 4QWWD 5L2KE 1JGEA 3ET9F 3VH8A 5C0EB 4KAQH 3OPZH 1N7ML 1PG7W 5E9DB 3B3IA 1TTGA 1AP2A 1NMBH 4RWYL 2B1AL 3NVQA 3GSRB 3K4AA 5HJ3A 3T0EB 3MLTB 3MJ7A 5IKCB 4NQSB 5AG8A 3MNVA 5LAXB 1MPAH 5SX5H 1S8DA 3L5XH 4O2FA 4YFDB 3RA7L 3UJTH 1FZJB 4IHOA 4HWBH 4CDHA 4F7TB 4OLWH 1FGNH 2Y7QB 1FVDA 4XMLL 3NCJH 2VXQL 4EI5D 4X5LA 4YHPA 1PKQB 5DMIH 1I1AC 5FOBB 3UMTA 4FG6D 5E00A 3BGFC 3RY5A 3IAGC 1XF2B 1U3HB 4HLZH 3FQRB 4LCWE 3LKPB 2YN3A 5I1AB 3B9KB 4K3EL 4QTIH 4HS6B 4ZS7L 2G60L 1OY3B 1I9RL 4X9IA 1KCSH 4E0RA 5KSAA 3BN9C 4ODTH 1KTDB 2CIKB 2E7LC 3MA9L 3MRMB 2YBRB 5ALCL 3QDGD 5E4EB 1FBIL 5D1QD 4IMLB 4X6DF 3QDJB 4MMZC 4ELKB 5HI4D 4WI9A 4JM2C 3U0PA 1V3KA 4HUUB 5BQ7A 2O5ZL 5DS8B 2BNRE 4ZAKB 1BF2A 3K81A 2R56L 3ORJA 5DUBB 2HKHL 3NIGE 2CK0H 2APBA 2NXZC 3GSQB 1TJIH 1EX0A 4CNIB 5HI3C 2JJVA 4J3UA 3CFDB 4NO3B 1ORSA 3QIWB 5E6ZA 3WN5C 5JXEC 3QZWG 2R2BA 5IBLC 2DQDL 2JF1A 2Y25A 4XVUC 2YRZA 4ZS6C 2YUWA 2JIXD 4KDVA 5M94B 2DQHH 1NAKL 2VN4A 4Z7WF 4MNQB 3MA7B 4EN3D 4Z7QF 1BIIB 4M4PA 3RDTB 1I1FA 3BKJH 1XGYL 2BOCB 5F3BA 5C0NC 4JFFB 4PV9A 4JO2L 1LNUB 5E2JA 2D9CA 3WO4C 4CJ1A 4YNYA 5EOCH 4E42B 1JGUL 3ARXA 3TT3L 3PGFH 4XPTH 4CU7A 1WC7A 1KN4L 2NY6B 2J4WL 3TYGH 4BZ2H 1OPGL 4XP6L 5KVFL 3GSXB 2HA1A 5D2NE 2DLHA 3MBXL 3CFKB 3V5DA 1I9JH 1URLA 1OGAB 2XWJB 4QXGL 4XB7A 3RUGF 4ZYKA 2XTJC 3UTTE 2APWA 2FX7L 3V6BR 3LKNA 1FLTX 4JCLA 5CP3H 5DJ8A 1DP0A 4OIIL 2IH3B 5GGUA 3SGEH 1OQOA 1J8HE 3W39B 1J8KA 3QISA 1EFXD 5C08A 4MLSA 4M7JL 4G7VL 1AHWA 1T5XB 3FQTA 5FM5O 3QH3A 1JRHL 1OD9A 4QRRD 2W60B 4ZQKB 4R7NB 3VXME 3E3QC 3Q6FA 1IEBA 4HUKB 5FUOL 2XN9E 2QSVA 5TF0A 1JPGB 1T80A 3PGDB 1QFOA 3DROB 4DUWA 3RX8A 3GNMH 1CDHA 1IGJB 1WZ1L 3FJTA 2MQCA 4KDWA 1UM4H 5D9SA 3T2NL 1WISA 2FCBA 2G75B 2HFGL 2XI9A 1L7IH 3D0VB 4Y5YA 1CE6B 4D8PA 5IFJA 1Q38A 3GBNH 2GUOA 3DURB 4UV4H 2JJTC 3T1FB 1FIEA 4PJGA 3VDCA 1NCAH 3MRGA 2NW3A 3AU1A 4LSUL 1QBMH 4OZGF 3NBNA 3UAJD 1PEWA 2VL5A 4Q58C 1T1YB 1KLGA 4R96A 1OSPH 1YMHB 4P4KD 4Y5VA 4ZXBC 4X98A 1DQTA 5DEGA 1RZFL 2I9LA 2J6EL 1D9KC 3DI2B 4O9HL 4MXQD 1SBSL 4J3OC 4F8TA 3REVB 2DF3A 3OG6B 1P9MC 1B88A 4I0CC 4UTAH 5KS9B 2XTLA 4ZUSB 4KJWC 4Y4KD 1GVIA 4LVOC 5E8DH 5GRUH 4QHKI 2LFGA 2H2SD 3O9WB 1V7MH 3V6ZA 3VXPB 1CDGA 3C8KA 4KPHL 1AXTL 1IC5L 1FORH 3O41A 4X7SH 3MLZH 4YHLL 4PGDA 4WFGE 2UUDK 4EI6B 2OX5A 1JGLH 3RVWD 5ENWA 1RUQL 3CZFA 2JTDA 5E4IA 2OR9L 2VDPL 1GGCH 2C7UB 1T5WA 2QSQA 4KKCC 5IB3A 2Y9RT 3HZKA 3A6CL 4YWGL 1T6WA 1JWUB 2KL6A 5J1TC 3OKLB 4TVPE 3QO0A 4ODSL 5DVKA 2OI9C 4N9GA 4KROD 5DQJB 1WICA 3DUUA 2UWEE 1ETZA 3BQUB 1FIGL 4ELMF 4M1CD 4PTTA 4AIXA 2C3HA 43C9A 3CX5J 2R1YB 1ZVYA 3QULB 3QA3A 5ADPL 1Z9LA 1U8NA 5FYLE 1DQJA 5D2LE 2WIIA 3L3JA 3CXDH 3DTXA 3QXAA 4UQ3A 1FPTH 4JFDA 4PJ9C 4AMKL 1NJ9B 4KWUA 1GC1C 1UQSB 2BY1A 3LS5L 3CFEB 2PW1B 4I18A 4YX2H 4NNXA 4K8RC 4H8WL 2AEPL 3RU8H 2R0ZH 2V7NA 1AD9B 1E6JH 2V17H 4CAGA 3VFMA 1JZ7A 4MQ7B 1NCCH 5K9QI 3QXDA 5IM7B 3V0WH 3CDGB 5JA8B 3WDIA 2HFEA 12E8H 4P4RB 3HI6L 5ILTH 4L29B 4KY1L 4YE4L 2VH5L 3BPOC 3WUWA 1E28B 1R3JA 3HC0B 5IKCA 4NQSA 4BK5A 4BH8B 4EVNB 3KS0H 5LAXA 4P0DA 3UBXB 4NN5B 5D6CA 2FJGB 4HKBB 1ZLUH 2QKIB 3BWUC 2L7JA 1IKFH 5TQ0L 3N1FC 3BX7C 3RL2A 1W0WB 4HIEA 4KK6C 1D5MA 4OBSA 1AQKL 3PHSA 4GW4B 5T1KB 4XH2B 3TJHD 1QPXA 1QBLL 1OM3H 3UROR 1P7HL 1NC2D 5GGSY 1NMCC 4DQOL 4PV8A 2VXUH 4OZ4B 3CFJB 25C8L 4P2QD 4HWEH 4I13B 1XF2A 4GKOA 5T3XL 4KK9C 4LSSL 5E8EB 4X5WA 1Q9KA 4JM4L 2VXVL 5B39G 2OS7A 1M4KA 3MRDB 4YQXH 4YDLC 4I4WA 2HN7B 1LE5A 5GZNC 1AIFB 1A4JA 2VWEE 4XTRC 4GAFB 1JPSH 3WFEL 2IPUG 5JIKA 4DJMA 1LMKA 1KJ2A 3MRMA 2NZIA 2WBJD 1JF1A 5IROC 1A7BA 2BNRB 3QFDB 1H3WM 4ELKA 2JJSC 5FECB 3OBAA 5ELIA 2DTMH 2DJ4A 3A67H 5DS8A 3T0AA 3TBWB 4NN7B 4OB5H 2AXHA 3MFFA 4YC2B 3WNNA 1TNNA 1SM3L 5JHDD 4WWKC 4OT1H 4NNYA 5TE6H 4K8RH 3WXVH 3ARBA 2RHEA 4TSBH 3X14A 1WZMA 4FFYL 5C07A 3NPZB 2XZQL 2ZSWB 5KN5B 2A9MH 2IBZY 4TOYH 4PJEB 2Z31B 3KJ4B 5C09D 3SDYH 4OUOA 1PDKA 2UWEF 1B9ZA 3NZ8B 4LKXB 5E5UB 1Z9OA 1PQZA 4WHYH 1WTGT 4EBQL 1G84A 3PDOA 4PRNA 1BP3B 2FIRT 3BP5B 4R7DB 1AR1C 1X4XA 4CVXB 4NZRL 1JNHB 3E8UL 5DJ2A 3TIEB 1J0JA 1FFRA 4X0KB 3RDTA 5DHYB 2EE3A 2DLTA 3VMNA 2FO4B 2E7MA 4YDKL 4QOKA 2G5BB 5GGVL 5C0BE 4CMMB 5KVEH 1I4FA 5DK0B 1I1AB 1LNUA 1YN6B 1QNZH 5T1LB 1EO7A 1OCWL 4XNYH 3BGFB 2B7DT 4AEIH 4W6YB 1BFOB 4WFHD 4ZG1A 4JY5L 2EIEA 5I8KL 3RKPA 1D5ZB 4ODVL 5D2NB 3O45A 5GSRA 4PJIE 5C0CB 3PL6D 2W9EH 4HMDA 3EZJB 2DRUA 1RZGB 4F33B 3GK8H 4MQSB 1HK6A 3EOBB 3VWJC 3GUTA 3DX9B 3Q48A 1ZA3B 1YMMA 4LAJH 2RFXA 4PG2A 4JFEA 5K9QG 1DE4B 4HC1L 4OF7A 4C55A 3RVUD 5E6YA 1NBZB 2E27L 3O6FC 4JANB 5IFHH 1I7TB 4R2GD 1MWAB 3M07A 4FQ2L 1FFPB 4F7CA 1QBAA 3B9VA 4AENB 2BMKB 4LSTH 2NXZB 1G7MA 2VLRE 2FIKB 1CLCA 7FABH 1GRWA 4FZ8L 2EYTB 1S9YB 3KLHC 4NWUH 4IDJH 1CFNB 1A14L 2YZ8A 4R8WL 2VE6B 1JPGA 1DN0B 1BD2A 4FQLL 3WN5B 4XI5D 2EXYD 4PTUB 3A0OA 3GM8A 3LKRB 2W65B 1JZ8A 4G8FB 4ZUVA 1ZVSA 4Y16A 5BXFB 5E6IB 3BWAB 4LHUA 3T4AB 1UACL 1WK0A 2ARJB 2XY1A 4DN4H 1ZTXL 3T1FA 5JDJA 4JFYB 1F5WA 1Q1JH 1EAJA 2DM3A 3T77B 1J05A 5CZVL 5I8EA 5DGQA 1CDYA 1T1YA 3CC5B 4ZMAT 5ERWB 1J1OL 3CSGA 1D6VL 4G3YL 4UQ2A 4Z95H 5ISZA 3WO4B 1AKJD 5E2WL 3UTSE 3W81A 3L5JA 3PQYE 3U2SA 4LCCA 4TQEH 4X6DA 4ZFFB 3CDCA 1HH6B 2J3SA 2VLLB 5I1DA 4MVBD 2X4OA 3W0WD 5CUSH 5B8CC 3QO1B 1CFQA 1MI5B 2D2OA 5GZOD 4M8QA 3DMMD 4KHXL 1FYTD 1PEZA 3I2CH 3MACL 2AQ2A 3V6OE 1AO7B 4J3WA 3IFLL 3WIHA 5H2BB 3MBED 1D5BB 1QLEH 1XF4A 2XTJB 4R4BA 3QXVA 3PNWB 1MRCL 2ESVB 4J1UB 3M8OH 2C7UA 3VXUE 3RNQB 2A38A 1A5FL 4CRPA 4UU9A 1KPRB 1JWSB 3QBTB 1R3IL 2IC2A 4Z0XB 3CFCH 3MRKB 4JJ5A 2DL9A 3P40A 3MJ8B 1JHTB 3S5LB 2A6JA 4WI5A 3K2MC 5H8DA 2FWOB 4Z7WA 5A2FA 4L5FL 2EYRA 3SQBA 2P8MA 4N8VA 1PD6A 4J3VA 4PJIF 3V4UH 2R1WB 4P46B 4NQEB 1CGSH 3FO1B 3C08L 5DJDA 5DK3A 5DK2B 3CVIL 1I7UB 4LLDA 2QQLH 2DQCL 4JR9H 1BMGA 4FFWD 5DMGC 1R3KB 4P59H 4ZSOE 4LQFH 4P2CG 3ZKND 3C8DA 3L1OL 4Y4FA 3CFEA 4G6ML 4J3TA 2MQ0A 4ODUB 5L2KA 1U8MB 1NEUA 4DWHA 5GGQL 1MCBA 3WJLC 1HDMA 3QUMH 4GKSA 4IRSD 1U3JA 5T1MA 2K7PA 3VGDA 35C8L 4MQ7A 4ZXBB 4X6CE 4PY8I 5DVOA 1J7VR 1S3KL 2UY6A 4TPRL 2NLJB 3BHBA 4P4RA 4XBPA 2AJZB 5C0GA 3O2WH 3RUGA 3CAFA 3DXAD 4PJFB 5I1GL 4QF1B 4LVOB 2GITA 4QCIB 1SY6L 3OKNA 4HKBA 4X8JA 1FNHA 4P5KB 2WV3A 5LGHH 1TIUA 4UIKH 2J5LC 4F80A 4UT7L 2OMNA 1A1OA 3P0VL 1LD9A 4E5XA 5T1KA 3PIQB 1X5HA 1NAMA 3PWNA 1E4XI 1PZ5B 3EIFA 4LCWA 2YK1H 4OLXL 3P73A 3VG0H 1C1EH 4RAUA 1VCAA 3G5VB 5DJAB 1N4XL 4EOWH 3QUZB 1OP9A 1Q0YL 3T65A 2YWYA 4RMQA 4P5TD 3N1QC 1RK0A 1V5JA 4HJJL 4OCSH 4C4KT 3V4VL 5FF6B 4FQIL 5FXCH 1AIFA 2QV2A 5I0DA 1A9BB 1KCLA 4LBEB 5EIIB 1OP5K 3U1SL 4OKVA 3MRRB 1NC4B 1IFHL 4F58L 5FECA 1U58B 1NGPH 2NX5D 2LAGB 4LCUA 1OTSC 1VPOH 5ANME 1CXIA 2PR4L 5LKNA 3KYMB 4FTVE 1HIMH 1N3NB 4OJFL 1RUPL 2H2SC 3RNKB 2BDNL 4KTDH 4YZFE 2CJUH 5T1DH 2BSTB 5IK3A 4EIZC 1I9IH 1S78C 2DDQL 8FABB 4HIIA 4PR5A 3SE4A 1YEKL 1XF5B 3ZHKA 3T2PA 5EU3A 4POZD 1CDUA 4FHBD 4I3RH 1U8KA 4APQC 3EYSH 1FL5A 3BPOB 3H42L 3RTQB 5DMYA 3PHOB 1HQRB 4NJAH 4XNXH 1YNLH 2NY3C 3OKEB 3PXJA 4OZFH 1W2KT 3Q5OA 3QZWB 3SDCA 3FCTA 3QNYA 2D0FA 3OKKB 2CLZA 2CLRA 2XICA 5J89A 5BJTA 5FYJD 2H32A 5DHXB 4P57B 1DUZB 1BBDL 3PXHA 2C5DC 3OJMB 3IAQA 4MQXD 1XAUA 3VFGH 3X12B 2XKNB 3VRLE 3PGCA 1NMCB 1YN6A 2DM7A 4ZOCA 4KUCD 5L7XL 1UKSA 3MRIB 5IMKB 2ZUQB 4L3CA 1F6AA 4X6CF 1QR1B 5GISH 5LGJB 3Q1SL 5K9JH 3RWIA 4AEHL 1HWHB 5D2NA 4V2CB 3RVXD 3F7YA 4M9OA 3QG7H 4S1RH 1ONQB 1RZGA 2B2XH 4F33A 4YDLB 1O7VA 3TC9A 2XQYK 3UZEA 2KBGA 5A40E 3UTTA 3BRGC 4LLWB 4HKZA 3L7EB 1FZOA 4HIXH 1U8OA 4F37K 1J8HA 4E41E 4JFOA 3KPRE 1HWGB 1G9NL 4JANA 3ULUE 1MHEA 5HHNB 1RAMA 5I8CB 1AJ7L 5DO2C 1CI5A 4WWKB 3DRTB 1XGPA 3VXMA 4YEEA 3H6JA 1MCFA 2XN9A 1WEJL 2CUMA 2P48B 5CSGA 2HTLD 1INQA 2IPUK 1MLBA 4JGUA 4NQCB 5HGGS 4HBCL 1FO0A 4QHMB 2X7LA 4UB0L 4F37F 1VFMA 3MLYL 1WBXB 4IJ3C 4GXVL 3FN0L 3PHQA 1GZPB 4MNHA 2LAAA 3WHE0 5E6IA 3D0LB 1KOAA 3BWAA 4RDQG 2DS4A 3HZVA 3T4AA 3ZZ1A 5F9WC 4M62L 2QADB 2ARJA 4XHJD 2DWEB 1P7QA 4ALAL 1MIMH 3ULVE 3K8MA 1SEQH 2AEQH 3CCHB 3MLUH 1YJDL 4MQTB 2JELH 4JHWH 1E4KA 5CMAB 4IOIB 3TCXA 4L4TB 2BOBB 2ENSA 4YZFF 5ERWA 5TPWL 2AGJL 1YUHA 4YK4C 3PQYB 3VWKA 4V2BA 2BVTA 2GFBB 5TQ2L 5JW4R 2BNQB 1DQQA 3JZ7A 3QUKB 3H7BB 2VLLA 3GMLB 4KXZI 4X7TB 2ICEB 1J0ZA 2ADFH 1CICD 1CYGA 4HKXB 5K9KA 1CGVA 3VWJB 3NPSC 3JSSA 4NDMB 1OB1B 1S9VB 1AY1L 1XCQA 5H2BA 5J1AA 3F5WB 2ARJQ 1IQDB 3O6FB 2ITCB 2JLLA 4Q9RH 3RWCB 4ZOEA 4DGVL 3U0WL 3OKDB 4NRZA 2CKNA 1QR4A 2UWEA 1KXVC 3MRKA 5DWUL 1GIGL 3C5JB 4NKOA 4U1JB 3FQUB 2W9LA 2GQHA 2R2HA 3CXHK 2E6PA 2JB6B 3DHMA 1NUNB 4JGJA 1VEMA 1PSKL 1MFAH 3ARYA 4J7RA 2R2EA 5D2LA 4ZUTA 1MFBH 2R1WA 1A3RL 5DJXA 3ARTA 1I8LC 3EJZD 3O3AB 5CGYD 1CL7L 3MNZB 1GAFH 3EYFB 1YDPA 1R3KA 1NDMA 2VXSL 2PYFA 3QRFM 1P4LA 2X1QA 2YPKA 3G5ZB 4RBPK 5IVZB 5JW4Q 5E8OB 4JVPA 4WUKL 1TMCB 4J3XA 3VG9C 2RCSL 4C56D 3OR7B 1B0GB 4PIRF 3RL1B 5F7DB 4ZDHA 1MF2L 5ADOL 1KTKE 2IAMA 4H0HB 2ED8A 1U8JA 3BRFA 4YUEL 1S5IH 3DLQR 3MJGX 5E94A 1U2HA 3K8KA 1HZHL 1DDHB 1L6ZA 3VFSA 3B2VH 4P3CH 5CP7B 5L88L 3BVNB 4RX4D 2D03L 4QF1A 4HLJA 1NCUA 4WV1C 4LEXH 5GGRB 4P5KA 3ILQC 1VFUA 4PRAA 4KU1A 2DQEL 2B1HL 4K55A 1JPFA 3HE6A 3HC4H 4MXVE 4RMSA 1G0YR 3PIQA 5BMFH 3DRQA 3QWRD 4WIQA 5C2BH 2XZAH 1UB5B 1YPZE 2DYPA 3G5VA 3CSYB 5JUEL 4KRPD 5FYKU 2GJ6E 5E95B 4TRPH 2C3GA 1T0NB 2WUBH 5ICXA 3D18A 3EO9H 1G0DA 1GGUA 4UTBH 5K59E 1T03L 2AXFB 4TNVK 1JIBA 4MB4A 4L1HA 4RFOH 4HPOL 2P45B 2FECI 1BJMA 4ZTPL 1P7KB 5KANI 2NMSA 5EU6D 1A9BA 4GAGL 3VGFA 5EIIA 5B39B 1NCTA 1J5OL 4G6KH 3TO2A 2F54D 1R0AL 1NC4A 3HE7A 3TO4A 1YECH 1I3VA 1KIQB 5C0AE 4JHZA 4RGND 5F88B 2V7HA 4NQUA 4IRZH 1ZOXA 1XF3A 3KDMB 4DGYL 4GRMB 1IM9D 2DQUL 3AS0A 3KPOA 4MAUH 5IVXB 3KYMA 5ACZA 1AD0A 3H7LA 5I1IL 5IT2L 5GZOC 3QJHB 2E8YA 3RZCA 4TNVF 3C9NA 5EZLB 1A7NH 4KKAC 5FKAB 3V5HB 2BSTA 5B3JE 5AWNH 3MUY1 5IEKB 4Z7VB 3NAAL 3DO3A 4WHDA 4WY7H 2XFXB 3U7YL 5HPMB 3EZ8A 3JVGC 3V7MA 3D69A 3K7UA 3MCLL 2FR4A 5J13C 1CD1B 4NC0B 4CJ0A 4XNQB 4HJ0C 1KLUB 1RJLB 3AC0A 2GY5A 5GS1C 1YA5A 2EDDA 5BRZB 3QZWA 3WIFA 1I8IB 4YHOH 1NLDH 3OKKA 4N5UA 1ZHNA 2VDLL 1WAAF 1NBVL 2VTFA 3MO1A 1CR9L 1CWVA 2BC4B 2J5LB 4PREA 1FP5A 4G9FB 5I74C 5HDBF 4Y0GA 5C0BA 3WL9B 4FRWA 1DUZA 1VA9A 5E2VH 1RJCA 3MRHA 4HUXB 3JWDL 1GGIL 4A2LA 4BFEA 4NWTH 3QDHA 5ICZB 3FB5A 3B9AA 3L3HB 3SY0B 4FFWC 5SWQB 4Z7NF 2X1PA 3MRIA 3QI9A 4PJIA 3QFJB 3UJJH 3EDKA 4FABH 5JHLH 2X4RB 3HAEA 4OCLC 1MNUH 3U4EB 1JI1A 4MNGB 1F6FB 4WNQB 4FQCL 2H1PH 3CMOH 2EE6A 3MOAL 3RZWA 3TBVB 5FHAL 5T5FH 2HLAA 4NGHH 1KJ3H 2AK4E 1K4DA 4LMQE 5KJRL 1S7VB 5H37G 1CDIA 1KGCE 4QRSB 5EU5B 3BIKA 1CXKA 2XQBL 5JDSB 4U7SA 2NY5L 4QGTA 2VLRA 5HI5D 3UC0H 3LN4A 3R4DA 3OAYK 4PRHE 2R0KL 5CJ5A 3PWPB 1X44A 4LFHG 1WBYB 1A64A 5JPMA 5EO9A 5KSUA 3SE3C 5DRZB 2LTQC 2YPVL 4UIMB 4W68A 4PLOB 1W72H 1MRDL 3UTZA 2K9UA 1Q94A 5I8OH 2WP3T 3UTOA 5HHQB 4APQB 5D5ME 3X3GL 1H3TA 1GZPA 4OQ1A 2NY3B 2B8OT 1A1MA 3EOTH 1A6WL 4F57L 3RGVC 2P7TA 4CDGC 3S37H 3L3OA 5HVWA 2CPCA 3T8XB 2P24B 4JZOB 3WKMH 3BZFB 1FGVH 1MUJA 5IBUG 3BW9B 4U6YA 3CDYA 3BOVA 1IQWL 5BS0D 4CGTA 4OD2B 1LO4H 2EO1A 2WWKO 5KANG 4LSVH 3UTSA 5FV1L 3TA3D 5F6IC 1MRFL 3OAUH 4G8IB 4M5ZH 3AM8C 1UB6B 5IHUH 4WCYL 3GKWL 4PGZA 5JW4M 4PB0L 1JJUA 2OTUB 3BJ91 2A1WL 3QUKA 4KI5E 4HZAA 4KGLA 3BGMA 4AM0A 1T04B 4U6XB 3S7GA 4X7TA 4L4VD 1JRHI 3VXTA 3JWOL 3V6OA 3WLBB 4AG4H 1YEIL 1RZIB 4YBQC 5DD5L 3GMNB 3CZJA 4ETQB 3D3VB 1WQVT 1CD9B 4POZC 3KPMB 4NDMA 4ZO6A 1IKNC 4JFQB 3G6DL 3GIZL 3QG6A 5CSBA 1A6PA 3F5WA 3VXUA 1GH7A 4WEUD 2ITCA 4RISH 4GMSL 4U1KA 3BDXA 2HVJB 1MCDA 2N7BA 2BCKB 2OQJA 3QNXA 5DYOB 5SX5K 3MUJA 2EIZB 3DGCR 1F11B 2VIRB 4X6EA 2MHAA 3WNOA 3TVMC 1RFDH 3FMGH 4L8SA 2HKFL 4HUVA 2VQ1B 1GGYA 2AJUH 1G9ML 2AJSL 3QEQE 5EDXA 2Z8VC 2PXYC 2EE2A 4MQXC 4NCDA 5DFVD 5GRWA 1AXSB 4WHTB 1QFUH 4IJ3B 1PY4A 4ZSOA 3S37X 3F8UB 1D6EB 1NGYB 1AGDA 1T89A 5KVGH 1DBBH 4JHBA 2OZ4H 5I30H 4CKVX 5HGBA 4EDXB 2SEBB 1A7OH 1C5DB 3UTQA 2M8XA 5MEPA 2X5PA 5E8OA 4O4YL 4UOJA 3L5XL 3PP3H 1C08B 3QEGH 3KPNA 4X6CA 2CKBB 3NA9H 3IKCA 2HYMA 4I77H 5D7IF 1UEYA 4F7MA 1INEH 3BO8A 1CG9B 5FO7A 2FH8A 1U3YA 3T3PF 4LLMA 4E9LA 5GRVK 5MENE 4WUUE 3Q3GB 1MAKA 3BVNA 5MEOB 1LO3L 3MV8D 1GSMA 3S34H 3VXSD 5CJXA 5GGRA 3WNLA 3G5YB 3SKUD 1NEZA 1BLNA 2HTLC 5GHWH 1JHKL 3NPSB 3NFSH 3I75A 1MCQA 1I1RA 5TFSL 2BXYA 4HULB 3GHBH 4XBGA 4K7PH 5AEAA 5T3XD 1ZLVH 3OGCB 1FAKT 2X1XR 3UPRA 1RURL 2ED9A 2YA0A 4JAMB 1CZ8H 4M1DH 3FT3B 2HG5B 4JG0H 1UB5A 4QRQB 1BQSA 1KN2L 4Q97A 2DQFA 1K85A 1SMOA 2J8OA 1C12B 2QQKH 1BWWA 1N6UA 1UZ8B 3FQNB 4P48A 3O3EA 2AABH 4XVSL 1IC4L 3EDDA 4X4ZA 4ZPTB 4X80H 3HC3L 3LZFL 1EEZB 5FYJH 4BSJA 5B38G 4DZBA 5E08L 4NJ9H 2C1OB 3ZMRA 5H94A 5I1LB 3IFOA 3NTCH 1RD6A 3TBTB 3VCLB 4D0CB 4FZEH 3SDXE 1UM6L 2AV1B 4P2OD 4LNRB 4PJEF 5C2UB 1JVKA 3KPSE 3QYCA 4XC3H 5B39A 4P3DB 2FBOJ 2OK0L 1WZKA 5F7EH 3S3PA 3AS1A 4O2EB 1IAIM 5ANMA 3HMXH 4FTVA 2P1YA 3VRJB 3VXQA 5HY9B 1NFDE 3KDMA 2FX9H 1KEGH 5FO8B 4GRMA 3F62A 5DEFB 5GGTA 1MQKH 4TSAH 1CICC 1GZQA 4JPVH 3QJHA 5GS2D 5JORB 1CXLA 1R5IB 3BDYL 3QWQB 1AC6A 4KXZH 5ALBH 1EAPA 1NGZA 3BKJL 4L9DA 3H0TB 1CVSC 3BESR 2AEIT 1U6AL 4UBDD 2FJFB 3DI3B 3R06A 4OCYH 4OUUB 5EBWB 2AQ1A 1KTLB 4WV1B 4IRJA 4K7PX 3PGFL 2EDHA 2H9GB 3MRCB 3QUXA 3QXUA 1RIUH 3BAEL 1ADQH 1KB5A 1T7VA 1C16B 5KVDL 2IALB 4JM2F 1XF1A 1FNSH 1T1XA 1ED3A 3S36H 2KQMA 1DBJH 5EA0H 2X9YA 3CXHJ 3HUJF 1IBGL 2PO6D 3L3HA 5IESL 2EH7H 1C7TA 1A6TB 2Y06H 4F2MB 1T22A 4DAGL 5LG1A 2X4RA 4HV8A 2L0DA 4L1DA 1MWAL 3U4EA 1F45A 4AQOA 2ZCKL 4XCNA 5J12C 3MXWH 3EKCA 3C5ZD 4NZUH 1RZJH 1A6UL 1T2XA 1C5BL 2AK4B 4G9DA 4E41A 1ZMYA 3KPRA 1AGCA 4XX1G 2ZUUA 3KPLA 1HHJA 4ENED 1S9XA 1H0DB 1FDLL 1U8PA 3WS6A 1BWMA 5DVMA 2AI0H 4NM8H 4PB9H 5F6HJ 4DN3L 5CD5D 5JDSA 4PRHB 1X7QA 3UP1A 1ZA6B 2YEZB 3VFRB 4PGEB 2CLVB 3BUYB 1L7IL 2HTKD 1NCDH 2AS5M 3WFHB 1RULH 4M7KL 3EBAA 5AZEH 1DBKL 4BFGA 2FEEL 1QSFB 2E7HA 4UIMA 1T66C 3TH4T 4KZEL 2BSSA 1J12A 2EH8H 5J13B 4S1SH 2N4IA 3VFTB 1QBML 3KNBB 4XGZB 1O0VA 4NQDD 4EJ1C 3B2UC 1OSPL 1U0QA 4JPWL 2JK5B 5GS1B 1U8QB 1QO3A 4KK8C 5A1AA 1JPST 1WCBA 1H3GA 1K5NA 1T4KB 3FAXA 3TV3H 5AYUL 3S36X 3MYJA 4U6HA 1ZEAL 4HAFA 4P9HH 5I74B 4P9ML 3RWFB 3MGTA 1KACB 3MRFA 1JYWA 2OJZH 4ZD3L 5DMKB 3E2HC 1SYSA 2XZCH 4N8CL 2P43B 5DSCB 1OAQH 2WWMD 4RGNC 1OAYH 2UYLA 2C4FU 2R4RL 3P4LA 3LVEA 4OV5A 3TF7C 4KC3B 3PG2A 3GSNB 3LV3A 4XPFL 3R8BB 5CINH 3G6JB 1NUFA 4RWYH 3O4LB 4WU5A 2DWDA 4KVCL 2B1AH 2X1OA 3FQWB 4AH2A 1OTUC 3WLBA 5E24E 5FKPA 3TNNA 1EDQA 3IKKA 4YBLB 3BD5A 3GJEB 3UZVB 2OTWB 3HG1B 3ABZA 4MD0B 4GAYA 1HHKB 3IXAB 4Q9BA 3C5SB 1VESA 3RA7H 1HXYB 1T83A 3AY4A 3GMPB 1LDSA 5DYOA 1ZLUK 2F58H 2VIRA 4XMLH 2EDWA 2X41A 3CXDL 4GBXD 4CN6A 4OV6F 1EJOL 1Z0MA 2VAAB 4P23A 4Q6IC 4W4OC 5D1XC 4LEOA 3SEPA 5T3ZL 4FFVC 5E1HB 1TCRB 4OFYD 5DJZB 4YX2L 3D2UA 2LTQB 2VDML 1N6QL 3OR6B 5FUCE 5EUOE 1KEML 3KXFD 3SGKC 4ZS7H 5I17A 1I9RH 4WHTA 1TITA 5DRNB 2Q7YA 3MV7E 4L3EB 1HEZB 4ODXA 5JOFB 3MA9H 4HGMA 1MFEL 4XP4L 3T3MF 1FBIH 4YJZL 2YPLD 2FRGP 3RPIB 2CIIB 1UGNA 4CW1B 1VKXA 2O5ZH 4DFHA 2V6HA 3FT2B 1G7HA 3BD3A 3FRUA 3ROOB 1ND0A 2HKHH 4UT6L 4LLYB 5F6IB 1CG9A 4PRPA 1L7TH 3O8XD 3P77B 4OZHE 3ALPA 1D7FA 1M05A 3ARFB 5EFIA 2MJWA 1WBZB 2YOCA 2VXUL 5ITFB 3BP4B 3VFUB 5BW7A 4Y4HD 2DQDH 5HHOD 4OLVH 3G5YA 1NAKH 2EYSB 4HIHA 1ZHKA 3S88H 1RVFL 3HI1B 4G8GD 5SWZB 1H5BC 2OSLB 3SKJL 3MJ6A 4YQXL 2PCPB 3RY6C 1YPZA 3TGXA 3KPPB 1UXSA 3PV7A 1XGTB 4NUJA 3ARED 3FT3A 4PJ8A 2GJ6A 2PYED 1XGYH 3SDDC 4F8QA 4WFFD 3TVMB 3A67L 1NCNA 1QSZA 3SDXB 1P2CA 4JO2H 1GC1L 1WJ3A 4KUZL 2HWZL 5DTFB 3GEWB 4J6RL 2RJMA 2OR7A 4OT1L 1JGUH 2ICES 3TT3H 2GTWB 2C26A 3IDNA 1KN4H 1MJJB 5C0AA 5IF0B 1OPGH 3O11A 3CH1B 4R6UA 1NFDB 4XP6H 1FVCB 5KVFH 1MJ7L 4O2EA 2A9ML 1I3RB 2CDFA 3MBXH 4PJDF 4CVUA 2P5WA 4OAWA 4KJYA 3SDYL 2YA1A 1NGWB 4QXGH 3FO9A 4P2RD 4LPXA 3D85B 1G7LB 2FX7H 1JUFA 5FIEA 4OIIH 1T7XA 2V2XB 4KDTA 4PJCE 5D1ZA 5I1HL 1R5IA 3GO1L 4XZUA 5K9OB 2EECA 4WU7B 1WLHA 4M7JH 3U36B 1XIWD 1JRHH 1WIOA 3X13A 3MGOA 4UOW1 5D72L 3EO0B 1VFAB 1S7SA 1S7TA 5AZ2L 1JN6A 4WW2B 4R0LA 5FUOH 2EDNA 1YNTB 2ZNXA 1RUKL 1XT5A 3AAZA 4YIQB 4FQXA 1KTLA 5EBWA 4JY6A 1WZ1H 1K3ZA 1RHFA 1DVFD 3LB6C 3T2NH 3TBSB 2P47B 2HFGH 5JNYA 4MAYD 1I75A 2W9EL 3L3KB 5KVMC 1A2YA 2MKLC 3TNMB 4KKBC 5DFVC 3TN0A 2EDTA 1QLFA 4BFIA 4X6BA 4JO3L 3W5MA 3WCYA 1OW0A 5DVNA 2XPGA 5DA0B 4M1GL 2A0LD 2CRMA 3QDGE 3S35L 4NZJA 3WV0A 3PDGA 5EBGA 4LSUH 3NOIA 4JQVA 5INCB 5J06A 1MVUA 4JVWA 3ZL4L 4EQ2A 1OTTC 1KFAH 1RZFH 2J6EH 2H3NA 1OAXL 4O9HH 2BHUA 3QDMD 1J11A 3ESVF 1SBSH 4ODWA 3SJVD 4GLRI 2DMBA 5IEHA 1CK0L 4HWZB 4UDTB 3ULSA 4HWBA 2AK4A 1A9EA 4EIGB 5TE7L 2NY2D 3MLWH 3IXTB 1A3LL 1H0DA 1YEEL 3H2WA 4KPHH 1AXTH 1IC5H 3I6KA 4YHLH 2J8UB 3NFNA 4PJHE 5D7IA 4PRHA 2VRAA 1J18A 2YEZA 1RUQH 4XX1E 1FL6B 3OX8B 2FDBP 4OCXL 2YRLA 4PLKD 2VDPH 1FG2A 3W9DB 3D6GA 4QNPE 5MERB 1XGUB 5DFTA 5TDNB 4X7CC 2RR3A 3MLSL 5DA4A 3MV9B 3TWCL 5D5MA 3U30B 5BZDA 1BIHA 3QUYD 1I7RB 2OL3B 1A21A 4ODSH 2GSGB 1QFWM 3VH8G 2DQTL 5C9JB 1MLCB 1FIGH 2JK5A 1Y18B 1TJGL 2JCCE 3N9GL 4ONFL 3E6HB 3ES6B 2F19H 1MREL 2EZ0D 4QRTA 3BYTA 3SO3C 1T4KA 4ZO9A 1OGTA 4LU5H 3VI4E 4UAOC 1FNAA 5D7JC 1BX2A 1TZHA 3OKMB 4AMKH 5DMKA 1LILA 3LS5H 3V9FA 2X4TA 5FDWA 3OHXB 3I2CL 5IBUB 4H8WH 2AEPH 3ARGC 2P5EB 4PJCF 2CR6A 1RZ8B 1XR9B 4PJXB 5CD3A 3GSNA 1MHCA 5EOCJ 1DQLL 2FSEA 3CFBB 3DYOA 4PP1D 1TZGL 1ZVHA 3HI6H 2KDGA 1AGBB 5J12B 4YE4H 2VH5H 4V1DD 3ARDD 5EWIL 2V9QA 4QRRE 3VW3L 3HLAB 5FAAA 2YC1B 4Y7MA 5I2IB 3ZDYF 1RJZA 3EGSB 5TQ0H 2EXWC 5C0FB 3VI3F 5EU4A 1UXWB 4LVEA 1AQKH 3OQ3B 2D7NA 4Y19D 1D5XB 4WJ5A 1K4CA 4S2SB 1YYLL 5F21B 4NO0A 4XCFL 3QIBD 2OBGA 3BSZL 4JFHD 4JR9L 4MS8D 5J11C 1QBLH 3V8OA 1YY8B 5BVJA 5DRXB 5C3TA 1M7IB 4DQOH 3QEQA 25C8H 4D3CL 5EUOB 1W0VA 5E9DD 1I85C 4HD9A 5T3XH 5JLZA 4JN2B 4LSSH 3ECBB 3AFLA 5IB5B 2E7LA 3VMPA 3T0ED 4JM4H 2VXVH 1F58H 3V0AC 4JO1L 2PO6C 3BEWA 4WO4B 4Q9CA 5EU7C 1HEZA 2AXGA 4JRYB 3L3DB 3LMJL 5EC1B 1A6AA 3H3PL 2ZG1A 1SJEA 5CP3A 5D8JL 3WFEH 5CBEB 3B6SA 3QWOA 4OLZL 1OL0A 4XNUH 4EUPH 1BVKA 3RPIA 4MCZA 4PY7A 4CW1A 2R1XB 4PJHF 1OLZA 2H6PB 3HS0A 3BPCA 5IV2B 3E2HB 3NN8A 2DICA 5CSZA 5F1NB 1WWCA 1IM3B 1BQLL 2NCMA 4ENEC 3CLEH 2AEWA 4XC1L 1U3HD 3SCMA 1XR8A 5MENA 2IWGA 3FB8B 3B9KD 3PWJB 4WUUA 4JO4L 1QPPA 2X4QB 4NKMB 1F90H 2A73B 3P77A 3H3BC 4KGJA 2XZQH 4G6AD 1C1EL 4MDJB 1TETL 3BP4A 2X4SB 5GS2H 4M48L 5ICYA 1A4KA 4X9HA 1EH9A 1IAKB 3AGVA 2EYSA 1DLHB 3DO7B 3UZQA 4WI2A 3NCCB 3HI1A 3QDJD 4EBQH 3MODL 5GSVB 4IS6B 3TZVD 3KPPA 5EIVA 5D93C 2W07A 4Z7UE 5IG7A 4XPHH 3VI4F 4ZAKD 1HOCA 4WGWB 1TZIB 5CS7A 2CMRL 3C6SA 5IVXF 4PJ5B 4RQQB 1DR9A 3INUL 4HX1B 4HUWA 4D0BB 4YDKH 2C4FT 1J1XH 1QLRB 5GGVH 1T2QL 3CFIC 1SBBA 2BRRL 1UJ3A 1P1ZA 1YYML 4Y2DB 1OCWH 5D1XB 2OJEB 3KPSA 3BT2L 2BVUA 3ZKSD 3QIWD 2D9QB 5E7FA 4JY5H 5I8KH 5IMMA 1X5AA 2X89A 2GTWA 4LIQH 5B38B 1LP9F 1MCRA 2DQIH 1UCTA 1BQHB 1NFDA 1NBYA 2X09A 4MNQD 1MVFA 3EYUL 2W59A 1FJ1B 1QSEB 5KG9B 2KKQA 5C71A 3EYSL 5KBNC 2MNUA 3MREB 2BSRA 4HC1H 3BRDA 1YNLL 4TYUA 3ZKXC 3DGGA 2F53B 2ZKHL 1IGCL 2Q6WB 4XPAL 4FQ2H 5ID0B 3C6LB 4QRUA 2HFFA 4G6FB 4JFFD 3W2DL 5DHVB 3EJYD 1PBYA 4X6FA 5DUPL 5E5MB 3H3KA 4I0PA 3GBML 3L7FA 1Z0NA 5GRZA 1J1PL 4FZ8H 3QDAA 3QCVL 3NCYS 4H1LB 4WTWA 2GK2A 2NY6D 1A14H 4WW2A 4R8WH 4OGAC 1MJUL 3MOBH 4FQLH 5ETUB 2W0KA 4P2QE 5FM4A 4JREB 3KS0J 4D2NA 1OGAD 3GMRB 1E27B 2VITB 3FFCD 1H5BB 4A2MA 3L3KA 1F3JA 1KULA 3TNMA 1EGJA 5ESQA 5I76B 3AMLA 1UACH 5E1AA 3FZUD 1ZTXH 3MLXL 1BQUA 3PP4L 5KTEL 1H8SA 2ZOKB 5CZVH 4YHML 4MJ6A 3SDDB 3OJDA 5E8PB 1D9KA 1JF5A 3WE6B 3ELAT 3P9LA 1J1OH 3LQZB 3W9EA 2ZCLL 1D6VH 4G3YH 4BSWA 2ZUYA 5E2WH 1N59B 1HQ4B 3NIDE 1P5UA 4XP9L 4M6AA 5MEQA 4EXKA 4ACPA 1FNGA 3KYNA 3O8XC 3D39B 5GGSB 3MACH 3FQXB 2C1PA 3ZKMC 5KSAC 3H9SA 5C09E 2EC9U 3IFLH 1I8KA 2X4NA 3DETD 3N1GC 1YY9C 4Z7UF 4A6YB 1MRCH 1NKRA 3ARRA 1FYHB 3WFZA 1A5FH 5MERA 3UX9B 2GHWB 4MZ2A 4U3XA 5TDNA 4XAWL 2XZZA 1IAMA 3HRZA 4GT7A 3IGAB 1HE7A 4MA1B 4OQTL 1XEDA 2F74B 5F1IA 1JZ6A 5JW3L 4FQ1H 5HGDB 2JCCB 1AFVL 3F7PC 4PJ7B 4C57C 3LIZL 4GRLA 3WEXA 4L5FH 4DTGL 5AYQA 3K1DA 3FB7B 3O9WD 4L9LC 4PJ9A 2DQJL 1VADA 4JZJC 3C08H 2Z91B 4HK0B 4WFHE 3CVIH 3WUWG 4Q74A 3RKDD 4U33A 2DQCH 4LP5A 4TULL 1FVEB 3HI5L 3L1OH 2Z4QB 4IIQA 1OOAA 2DAVA 3B5TA 4G6MH 4UNTA 1CDJA 4GKZB 1I7ZB 4OM0L 5GGQH 1CFTB 3LRSB 2MPAL 4D9QD 3UDWC 1C5CL 3EAKA 4U2ZA 5HYJB 4OFKA 35C8H 3RY4A 1IGTB 3KR3L 4PS4L 4AIZA 2O61A 1S3KH 1QBBA 2VLKA 2UVEA 2YD3A 1LK2B 1N6VA 3BQUD 2ZUSA 4PJDA 1AGBA 5F3HA 1MCLA 1BEYL 1ZT7B 3DSNA 5EN2B 4ISVB 2I07A 2VDQL 5BV7B 1SY6H 3TBYB 4PRIB 3HCVB 2IPTH 2J12B 3GFUA 1MFAL 1K6QL 4ODBD 5F9OH 4UT7H 3NZHL 3P0VH 2YXMA 4MJIA 5DD6B 3IDMB 3GSOA 4N0FA 4S2SA 3P4MA 2AJVL 1ZT1B 4YHYC 3MRQA 5I66B 4OLXH 3F12B 4NYLA 3V6FA 5J6HA 5IJVB 1II4E 4DZ8B 1M7IA 4DVRL 4U1GB 5EUOA 3DX8B 2GAZA 1OF2B 1LHZA 4H26A 3IVKA 4JN2A 1KCUL 5BOZG 3MV7A 1Q0YH 4L8CA 4P4KB 3V5KA 2CKBL 3SDAA 1ZK9A 5I16A 3SKNB 3DVNB 5IROA 2DBLL 4HJJH 4WO4A 4PJAE 4QO1A 4FQIH 5BZWB 4RRPA 1KC5L 1G9EA 2ZWLT 3M17A 2GJJA 3SO3B 3U1SH 3QAZC 3SE9H 4RFEB 3WIIL 1VACB 1IFHH 3CH8A 4WI3A 4DKAA 4F58H 4GRWB 2DI7A 1G9NC 1NANI 5D7JB 1IAOB 2R69L 3B9EA 4KQ4L 4MD5B 3T1WA 1EO8L 3THML 4XCEB 2PR4H 4JRXE 2COQA 5EBMA 1BOGA 4OJFH 1FFOA 1OT1A 3L3GB 4XWOC 3HC4L 2BDNH 1FYTE 3ARGB 4Y5YC 3REWB 1I8MB 4HDIB 4OZHA 4GLRH 2YRPA 2X4QA 5BMFL 4NKMA 3IDIB 2DDQH 5DD1L 1YEKH 5CBAA 5TGBB 4Q2ZB 2ITDA 3IJSA 2ATKA 3TCLB 3PWVA 3SHSA 4POYA 5C8JA 1H3VA 5DJ6B 4DCQB 2ZSVB 3O3BB 4Y5VC 1IAKA 3H42H 1CFSA 1EHLL 2BNRD 2X4UB 4OZIB 2Y1VA 4M00A 5JTWA 3QUYC 4RFOL 1N2RA 4U2YA 5T5NG 3VXRA 1G6RB 2R39A 4G6KL 1ZSDB 4JDVB 1BBDH 5CIPB 4D0BA 4QEGA 3CGTA 3EYQC 5F9JA 1LWRA 4HPYL 3OKOA 4IRZL 3SKMA 4WEMB 3HZMA 4XP5H 5L7XH 1A6ZB 5I15L 3GMQA 3ARWA 3RAJL 3RIFF 2Z31D 4ZPVB 3Q1SH 4AEHH 2BFVL 3MRPB 2GCYB 3U6RB 2FL5A 2FEDC 2VDRH 4K7FB 4F3FA 3PUCA 3S6CA 3QIUB 5ECJE 5IW6B 1F4HA 2XOTA 1HYRC 2IANB 3GJFB 1CIDA 4N90D 4NO5A 4PP1C 4PJCA 3MREA 4OFPA 3CSBA 4C83B 1G7IB 1G9NH 3DXAE 5KSBE 4LHUG 4TUKL 4JKKA 1AJ7H 5JW5B 1MHPL 2HT3C 1I1AD 5DHVA 1H15B 5T1LD 2EIDA 1RQ5A 2BNUB 3O4OC 4EI5A 1QEWB 2ID5A 1WEJH 3GHEL 4I18C 1JGDA 4Z76A 1RMFL 1CE1L 1KF9B 5C0CD 3VFOB 3O3UN 3QIBC 4HBCH 3SN6N 3T4YB 5ETUA 3BN9D 2WINB 4UB0H 3CIQA 4RAHA 4WGVB 2V5TA 3MLYH 3UJJL 4GXVH 4QY8B 3DOSA 3BH9B 3FN0H 5DJYA 2YWZA 1YEGL 4YAQB 1IGFL 2W0LA 2H1PL 1E27A 4N9OB 4HGWA 3X3FL 4LLUB 3L9RB 3FRPA 3ZTNL 4NCC1 3QUMA 3QDGA 1FV1B 5TDPB 4M62H 5D1QA 1HKFA 5DLML 3SGDI 4ALAH 5T5FL 5F9DC 2NXZD 4RZCA 1YJDH 5MHSD 2ICCA 5E8PA 4L8DA 3WE6A 5FO9A 2NX5E 5TPWH 2QBWA 5HI3D 1KG0B 2AGJH 2VUYA 3T08A 1DEEB 5TQ2H 1JTOA 1BVLB 3DIFB 1N59A 1HQ4A 5B8CA 3L6FB 5JXED 5IBLD 5HYFA 4K23L 1U93B 2NTSP 1X5FA 5HVHC 5E6ID 4PJHA 2DJUA 4BQ8A 4N8VG 1CGUA 2JIXA 5GGSA 43CAA 1U3ZA 3MTRA 4HHAA 5IB1A 1AY1H 4G80A 1QSVA 2D31A 2FBJL 3ZKXB 3AROA 1EHXA 5AAWA 3EOTL 4YFLI 1DUYB 4EN3A 1K2DB 1X4YA 3EJJX 1E4XL 4DGVH 3C09C 2IQAA 5C0ND 2VDNL 3CVHB 3FKUS 3FO0L 1ZS8B 5DJ0B 5SWSB 3IGAA 5CJQL 1AQDA 3CUPB 5FYJE 2WLYA 3QQ4B 4ZAKC 2FO1A 5DWUH 1GIGH 1FZKB 2NY0C 5HGDA 2JCCA 1M6OA 4JFDE 2BVPA 3G6JF 4JPIA 1NDGA 3ARBC 1PSKH 4F7PA 2R8SL 2D3VA 3NABL 1MI5D 1JGEB 3VH8B 1TVHA 4IBLT 3H9YA 2Z91A 3GSNL 4X4XA 1AO7D 1J0KA 3B3IB 1AP2B 5JZ7D 3HN3A 4F9LA 1FVEA 5F89A 2XTJD 1MAML 2V2WA 2VXSH 5HJ3B 3WJLA 1NQBA 4AG4L 3MJ7B 4HXBL 2ESVD 3MNVB 1NUDA 1PX3A 5KSBF 4CADA 1S8DB 5B22A 4O2FB 2RCSH 3DV4A 3CPLA 3O3DA 4R2GB 1MF2H 5FDYA 5ADOH 1S5HB 3K0WA 4IHOB 4PLNC 1EFXA 1IGTA 4YUEH 3RDTC 4OZFA 3PP3K 1ACYL 1HZHH 2ZG3A 4QRRA 5IJKA 2YUZA 5HHMD 2FGWL 4YHPB 1RFDL 3N50A 4P46D 5IB2B 4NQED 2EDBA 2FEEI 4ISVA 5FUZL 2AJUL 1TLKA 2QQNL 2QHLA 4OSUL 4EDWL 2VC2L 1NH6A 4G43B 1CF8L 2NY6C 3MRNB 4U0RB 5T3ZD 4E0RB 5KSAB 5I1KL 5HGHA 5LQBH 1T6VN 3VFNB 3ISWA 4J8RA 1FN4A 4PG2C 5IJVA 2V5SA 4WI4A 1GPOL 5EPMA 5JUEH 1ZLVK 4ZXBD 3U0PB 5FFLA 1OAZL 2X05A 5BQ7B 1BAFL 3FB6A 1CLOL 3S4SG 4MGXA 3QEGL 4S0TD 4L4JA 4P4KA 3VA6A 1T03H 4UILL 3NA9L 4KJWD 1SYVA 4HPOH 2YXFA 4MHHG 4GAGH 3TESA 4JJHA 4BQBA 4HKJA 3X17A 2HH0L 1LE9B 1AGFA 4Y4KA 1UT9A 3JV5A 1QKZL 1R0AH 2EC9T 1ORSB 5LWYL 3NFPA 3RWGA 4NCC2 2DIBA 2XIDA 4JRXB 4NPYA 3DMMB 4O02L 2R2BB 4IMKA 4PFEA 3C8HA 4DGYH 2DQUH 2NY5C 3MBEB 5I1IH 1E4WL 3OSKA 4HDIA 4S10A 4XPBL 3LPWA 4M4RA 4GG6F 3QUZD 3ZYZA 5SV4A 3NAAH 4M1DL 5FHBH 3U7YH 2EKSB 3RI5K 1I3UA 3MCLH 1I1FB 2O5XL 4LASL 4XPGL 2QQKL 3ZE1F 5F3BB 4BSVB 3GIVB 4KUCF 4Z7UA 1KELL 4PG9A 5CGMA 4YNYB 1LQSR 2F8OA 5CZXC 2VDLH 1XGRA 1WC7B 2ATPA 1BFSA 1NBVH 2X70A 5EORL 2EDFA 4OCRL 2HP4A 4F7EA 3O9WC 1GXEA 3WD5H 2E9IA 1FFNA 4RCAA 3V5DB 5FM5M 4NQTA 1BECA 2NZ9C 1KEGL 3B5GA 1LK3H 2ZPKL 3BMWA 4JKMA 3LKNB 5DJ8B 4JPVL 5DMJB 5GGUB 4RGOL 4FQCH 4C56E 3RTQD 5C08B 2BVQB 4HFUL 3MOAH 1AHWB 1Q9OA 3FQTB 4ODHL 4Y5XA 3QH3B 4B53A 5FHAH 2Y4SA 1LO5A 2E7BA 3QIUA 3Q6FB 3QAZB 4I3GA 1TJHL 4LOUC 4KK6D 2VKXA 2VLMD 1X3DA 1K8DA 1A0QH 5KJRH 3QNZA 3VRIA 3V79C 1HXMA 3RWHA 4OCYL 4XNZC 5LXGL 4KZDL 2XQBH 5JQHC 4GW1A 4XBEL 5C6PB 3BN3B 2NY5H 2R23A 5C92A 3GSWB 4ORGA 4Y5YB 3LCYA 4Y4FC 3BMVA 5IFJB 2Q7NA 1ZAGA 4C59B 1NC2A 2F5AL 5FK9A 4DUVA 5JIPA 1JYNA 2GUOB 4P2QA 4X9GA 4FXGB 2YPVH 4PJGB 1IC1A 1Z9MA 1MRDH 1Y6NR 2BRQA 3MRGB 3AU1B 4XCYA 1ES0A 1S7QA 3O6ML 2VL5B 5GZND 4R96B 4XTRD 3BH9A 1MEXL 4Y5VB 1GJIA 4X98B 3LAFA 1BZ9A 5DEGB 1OT2A 4S1QL 4XT1C 4F57H 2I9LB 3K4ZA 2ERJC 2J8UF 2WBJA 2Q87A 3HFML 3DBXA 3H8NA 1VFBA 3KLAB 4WWKD 1LEIA 1IQWH 2F54E 4QXUL 5FYKL 2AI0L 4NM8L 3O41B 4X5XA 4GFTB 4PGDB 1KG0A 5JHDA 1MRFH 1CGWA 2CK2A 3MMEA 1V3JA 5ENWB 1BVLA 4WCYH 3TYFA 4NQCD 4N68A 4KJPD 1FAIL 2PF6A 3L6FA 1NCDL 2A1WH 2Z8SA 1T5WB 4DK6A 1F8TL 5IB3B 4KMQA 1HHGA 2OCFD 3HZKB 4LSPL 1NANH 3JWOH 5C09A 1YEIH 4HWUA 4AT6B 1HILA 5DD5H 2OL3L 3QO0B 3UTPD 4N9GB 3EDJA 2QADD 4G42B 1HYSC 1AR1D 4KMTL 1ETZB 3C87A 4PGBA 3G6DH 3JV6B 5FGCE 3GIZH 3BJLA 4PP2A 4PTTB 4PRDA 43C9B 3IDYC 1JTPA 3MPCA 1XGQA 4GMSH 3F58L 1U8NB 1DQJB 4L4TD 5EO0B 3ARVA 2K7QA 4GKNB 2WIIB 3CVHA 3TV3L 4Z7QE 3L3JB 5DJ0A 3PQYD 3DTXB 3QXAB 3G5XA 3DHJA 4UQ3B 4JFDB 2Z35A 1T21B 4PJBE 4NN7C 2BNQD 2HKFH 4PJXF 3U9UA 3UYPA 1VHPA 4M43L 1V7NH 4I18B 4BK4A 4NNXB 1G9MH 4QHUA 3B9DA 2DI9A 1N5AA 1PAMA 2V7NB 1KXTB 1OHQA 5C0JA 2H2PC 4LPCA 3VFMB 1F00I 1RU9L 3VWJD 3SE4C 2Y6SC 3F65A 2IADA 3ARQA 3PL6A 1SMAA 3QXDB 4P5MA 3OZ9H 5CINL 2Z31C 3KJ4C 2HFEB 4WVRA 4R4FL 2AV7B 2APFA 3O6FD 3WUWB 2B4CC 1R3JB 2XG5A 2HJKA 15C8L 4UV7L 5J57B 2A6IA 1MCIA 3SDCC 5D6CB 1GOGA 4O4YH 1KPUA 3ZDXE 3RUGE 5LBSL 4YHKL 3EFFB 3RL2B 2PTUA 4HIEB 1S5HA 1D5MB 3ZT7A 1GCFA 1BOYA 1R5VA 1DLFL 2F58L 3KLHD 8CGTA 1VEOA 1N0XL 3L5WB 1R5WA 5IB2A 1LO3H 4PV8B 4Z77A 4GSDL 1T1ZA 5HVHB 3VXOA 3GRWL 5D2NC 4K94C 1JHKH 4X5WB 4G43A 5TFSH 1QRND 1Q9KB 3MRNA 1JI2A 4I4WB 5IQ9A 1LE5B 1RURH 1A4JB 2VERN 2UZYB 1MH5A 3VFNA 1KJ2B 4PY8J 4CMHB 1KN2H 1JF1B 3C09B 4OM1L 2X2YA 4YPJA 2DIAA 4XVSH 1KTRL 2IQ9L 1IC4H 4U31A 3HC3H 3LZFH 2FHCA 4AYFA 4PJAA 3QT2A 3MFFB 5E08H 2NY0B 2MWCA 2P8PA 4OZGE 5BS0E 4NZTH 3TIDB 2NY7L 1UM6H 4NNYB 3VGGA 1AKJA 2X4PB 3ARBB 3X14B 5EOTB 1L7TL 4KMLB 5C07B 3CJJA 1LE9A 2OK0H 3VFPA 5K93A 1BBJB 2I9TA 3GMOA 3SGDH 1TCMA 2APTA 1IRAY 2OR8A 4JRXA 3WS3B 3FOMA 3DMMA 4CBPA 3EUUA 3KLDA 1CLZH 4L4VE 1FYTA 2C4XA 4OLVL 4DUXA 1PQZB 1ZV5A 3S88L 5E6IC 3MBEA 3V4PL 3PDOB 4PRNB 1W72A 2FX8L 4HQQL 3BDYH 2FYYA 2E8ZA 2X40A 2JB5L 4KTEL 5DJ2B 2QTEA 4L8BA 2EKSA 3EYOA 4PJBF 3L3IB 3VD4A 4YGAB 2Q86A 2FHFA 1E4KC 2PW2A 4QOKB 1EZVX 1U6AH 4BSVA 1I4FB 3HAEG 1WWAX 4Q6YA 1RUAL 3GIVA 3VWKC 4ZFGL 3IDJA 5JO5A 1ZLSL 3PJSA 1MJ8H 5DMGD 1N8ZA 3O45B 5GSRB 4EEEA 2N56A 4ELME 1CBVL 3BAEH 3IDUA 1RIHL 1T7WA 4XMPH 3R8QA 5KVDH 5I73C 3P0GB 3P4NA 3GUTB 3P4OB 1EK3A 1U92A 1YMMB 5F1SA 1KV3A 2RFXB 5DXWA 4JFEB 5JZ7C 1IBGH 4YFEA 3ZDXF 5HYQA 5IESH 3GM0A 4MX7A 3W11C 2BY3A 4Y89A 4DAGH 2GKIA 4D9RE 3P0YL 4IRSA 1MWAH 3OB8A 4F7CB 2ZCKH 2BVQA 1G7MB 3EOYG 1JWMA 5BRZD 3PF2A 1IEAA 1A6UH 3ZKQD 1C5BH 3L5IA 4GW5A 1BFTA 5FCSH 4HXAL 5DJCB 3DXAA 1J88A 5KSBA 2XT1B 4G9FD 4CL7A 1KT2A 3P11L 1FDLH 4K3JL 4KJQC 1BD2B 3MV8E 4P46C 3EYVA 3WFBL 3P3YA 2BY0A 4DN3H 3RQ3A 1A7QH 4ZUVB 1ZVSB 4Y16B 3T2QA 4LPVA 2BSED 3GSWA 4DKDC 1KB9K 4LHUB 4LCYA 4HWNA 3QFJD 1A6VL 4M7KH 5T3XE 4TUJA 3QXWA 1DBKH 1KJVA 1QG3A 4RMVA 4FXGA 4KRPB 1EUTA 2VSCA 3WHXA 4KZEH 2Q3AA 1J05B 2OZ4A 3LPGA 5I8EB 4S0SD 2MKWA 2IAMC 3KWWA 4JQXA 5BOPA 4P5TA 4JPWH 1KSRA 1UVQB 2D0HA 4NHUA 4UQ2B 5ISZB 1KFAL 4H25A 3HB3C 1R3LB 4GQ9L 1G7QA 1Y0LA 3U2SB 4LCCB 4X6DB 1OTSD 3OTTA 5AYUH 1ZEAH 5I1DB 1UWXH 3U9PL 3LEXA 4DW2L 2X4OB 2AJYL 4P9MH 1BJ8A 3MLWL 4N0UE 2NX5A 4ZD3H 4FQHA 1CFQB 3KLAA 3IJYA 4IOFC 3AM8A 3IETB 3OXSA 4M8QB 4OBRA 3PWPD 1WF5A 4N8CH 4JDZA 5CEXB 1S78D 3S3SA 1XF4B 2R4RH 5DD0L 4A6YL 3EFDL 4JFPA 4OLEA 4R4BB 2JKXA 4YHZH 4RMTA 3QJFB 5GIRA 4XPFH 4O58L 2W0FA 4APQD 1EUUA 4UU9B 4ERSL 4KVCH 2NY3D 3SPVA 4GUPA 4X99A 3QUZC 1PKOA 4AT6A 4CVZA 4JJ5B 4ZOBA 1U8IA 2WLZA 5JXAL 2VWEC 2XXCB 3QPQC 2FB4L 2A6JB 1ZANL 4G42A 4O2CA 4Z7WB 4WENB 3GI9L 4LCIL 3JV6A 4UZGA 2EYRB 5FYLH 2P8MB 4N8VB 3RRQA 5IBTH 2F19L 4XNZB 5DJDB 3LQAC 5EO0A 3HE7C 3QB7C 3TO4C 4GKNA 4LLDB 4LU5L 1MCPL 2ENYA 2RBLA 3WO3B 2HT2C 1EJOH 1T21A 2DJSA 1MAJA 4Y4FB 2IBBA 4K2UL 1FC2D 1DZBA 5T3ZH 5L2KB 1RUML 2VDMH 4M7LT 1N6QH 3HMXA 1KEMH 1HDMB 1YEJL 4GKSB 4B50A 3V7AE 5DZOA 5T1MB 4M02A 3D3VD 3LQMA 5EUKA 2BHZA 1U41A 4JY4A 1IGYA 1JBJA 3MJ9A 1MFEH 4XP4H 3BHBB 2AV7A 5EO1B 2DKSA 5D7LE 5AUMA 3RTQC 3V0VA 3BZEA 1NEZG 1F6LL 1QA9A 4XBPB 4ZO8A 5C0GB 1UKQA 2ERJB 2NW2A 3RUGB 2H26A 1R3HA 1WFNA 4ZUUA 4U1LB 1OAUL 2I27N 2GITB 3OKNB 5DO2D 4X8JB 2UZIL 4LPTA 3EFFA 4UT6H 2V5MA 2ZG2A 4XXCA 1A1OB 5I75C 5HD8C 2XQYG 3BKYL 1EXUA 1LD9B 4E5XB 2YD6A 4Z8FL 1NAMB 3PWNB 3RWDA 2OLDA 2FZ3B 4LCWB 2HJFA 3L5WA 3P73B 3QP3A 4LDLB 4RAUB 4TN9A 1ADQA 1O5DT 3QI9C 2ZUQC 3LKOA 3T65B 4MLIA 5B3NA 1RVFH 1RK0B 1QFWI 1QHPA 1F58L 3SKJH 4NQDE 2CDEA 3IDGA 1Q72L 3IDYB 4OKVB 4YR6A 3IRPX 3DJ9A 4XNUL 3LQAH 2RQ8A 3LHPH 3AUVA 2ZUTA 3UYRL 3HZYA 2E5EA 4LCUB 5CEYA 1GC1H 4KUZH 2HWZH 3TA3B 1TTFA 2R0LL 4MCYA 4NQVB 1PYWA 4J6RH 3TIDA 3FFDA 3CLEL 2C9AA 4JGMA 2X4PA 1EO5A 4KI1A 2LU4A 1JMXA 5IK3B 1MFNA 5EOTA 4LSQH 1F90L 2EDJA 1BBJA 4HIIB 4PR5B 3EDFA 2PTTA 1MJ7H 1X5ZA 3ZDZF 4OZIF 4XVJL 5EU3B 2BERA 1CICA 4KJPC 3WS3A 4OLYL 5E99L 4M6NH 5GRYA 1U8KB 5MP6L 5EC2A 1FL5B 4X83A 4HFWA 1CT8A 4CUCA 4MD4A 3ARPA 3SDCB 1S7XB 3OG4B 3FCTB 3QNYB 2D7QA 5B4MC 2CLZB 4NC1E 5I1HH 4AL8L 3GO1H 2CLRB 1A7PL 2GSIA 2QADC 4XPHL 3WNMA 5BJTB 4QXWA 4HCRL 3RWJA 1G6RL 2H32B 4MXWL 3L3IA 5D71L 4YHNB 4K3DL 5D72H 1J1XL 4HH9B 1UWGL 5DQ9A 5FA3A 5AZ2H 4K9EL 3PGCB 5CZKA 1OARH 4HZLB 3RBSA 3U46B 1RUKH 3Q5TA 5D7KD 3X11A 4H20L 4L3CB 1F6AB 9CGTA 4QRPD 3RWIB 4LIQL 5JIIA 2EC8A 3U7WL 3KXFE 2CUHA 2DQIL 3F7YB 3W82A 3V6OC 3NIFE 2QL1A 1JYXA 4KK5C 2CRIA 4JO3H 3P4OA 3I3BA 4BZ1L 3UTTB 4HKZB 1FZOB 1JGVH 1SEBB 4M1GH 1U8OB 3MGAA 3S35H 3AMKA 3WMSA 2YPLE 4F15B 1J8HB 4JFOB 4P99A 4C56A 3QEUB 4AY0A 4N5EC 4PLJD 1MHEB 2EEAA 3QCTL 3SBWC 3ZL4H 3ZHDA 1IT9H 5HHXH 1OAXH 1XZ0B 4Y1AE 1XGPB 2LE9A 4GAJL 3VXMB 3UXFA 2QR0A 1CK0H 1F3DH 5DEZA 2XN9B 1MCHA 3DYMA 3ILQD 4LARL 4RX4A 5TE7H 1INQB 5DJCA 2B20A 2RAMA 1CXHA 1A3LH 1MLBB 1FO0B 1YEEH 1W8OA 2X7LB 3MOBL 4LRNL 3KVQA 4DOHE 5D70L 3I50L 4JVUA 5L8JB 3C60B 4HEME 3PHQB 4RA3A 3V8CA 4MNHB 5HHOE 3VXNB 3V2AR 4JFXA 2DKUA 4OCXH 3P9MA 3QWRA 1QOKA 5DUML 3HZVB 2CD0A 4PRBB 3O2DL 5EBLA 3UO1L 3MLSH 1P7QB 4YDVA 5HGAB 1MY5A 3TWCH 2PYEE 1RZKC 1A22B 3GSVA 1DQDL 1XMWA 2J1KA 2VJXA 4WFFE 1G0XA 2YD7A 2DQTH 3WDHA 1G7JA 3QQ9D 1YUHB 1TJGH 1UVQA 3N9GH 5CLWA 3VWKB 4ONFH 3IDXL 3LEYL 5IOPA 1MREH 1NLBL 3O2VL 5EU6A 2GT9B 1R3LA 3BP6A 1DQQB 3DV6A 5DC9B 5LVEA 3BZ4A 1RZ7L 4N0UB 3ROLA 4Q0XL 2F54A 3GMMA 5CJXC 5I73B 4H88L 3S35X 5K9KB 2AERT 3IETA 4H5SA 1IILE 1IM9A 4KKAD 4H0IA 5E03A 1P4IL 1H3UA 5TF1L 5CEXA 3ZE2F 1CU4L 2X1WL 1WIPA 1J0IA 1QSFD 1XCQB 5J1AB 2HT4D 2XYCA 4LRIA 4L3AA 4P2RE 1AR2A 3JWNC 3LEVL 5J56B 3GB7A 4W4NA 1KENL 3QJFA 3LN5A 4HJ0D 1DQLH 1EMTL 4JB9L 4NRZB 1YZZA 4DKFH 1TZGH 2VXTL 4U1IA 2VLJD 2X42A 2UWEB 5EWIH 3K8LA 4NKOB 4FQ1L 2HMIC 3VW3H 2R2HB 4U1SA 3WJJA 1Q8MA 5ESVA 2R2EB 2W38A 5D2LB 4ZUTB 5D6DA 4Q6IA 5EOQL 5DJXB 2ICWJ 1SJXA 3NIFF 4PJBA 3UJIL 3IU4L 1YYLH 3SGJC 1ODAA 4XCFH 3BSZH 3OB0H 1YDPB 3WXWL 1NDMB 2PYFB 1P4LB 2YPKB 4D3CH 3GSUA 4RIRA 4CN1A 3L5HA 3G9AB 3O4LD 2ZP0T 4RFNB 4NZDA 4ZDHB 1CFBA 3FN9A 2IAMB 4JO1H 2NY4C 3HG1D 2O93L 1U8JB 3OMZA 5D7LB 3LMJH 3QQNA 3H3PH 1BHGA 2ICWA 3MRBA 5D8JH 3DWTA 3Q2CA 5E94B 3JV4A 4R26L 3FT4A 4OLZH 5EO1A 4I5BA 3VFSB 2A77L 3QDME 3SJVE 1MELA 1XCTA 1IZKA 2M2DA 1YC7A 4OCWL 4U1LA 1KPVA 2IPTL 1M7DA 4JG1H 3QUXC 3JV0A 1BQLH 4PRAB 2IH1A 5F9OL 4TSCL 1JNNL 1JPFB 1FRGL 3HE6B 4XC1H 4NNPL 4RA0C 4G5ZL 3TT1L 5KW9L 4JO4H 5M7QA 5B21A 3DRQB 4NO2A 3KPTA 5F7MC 1TTUA 2FZ3A 2LVCA 2CRZA 2DYPB 4RAVB 3G08A 2UY7A 1TETH 2Y07L 3Q6GL 4L3ED 4M48H 5CCKL 2VISA 4GQPH 1T0PB 1M7XA 3RGVD 5ICXB 3D18B 3D25A 3MODH 1UH3A 1KB9J 3MUGA 4J2XA 1CXEA 2Z93A 5DF0A 2M26A 5EZOH 2CMRH 4YDJA 3SE9L 3TO2B 4BH7A 3ULUC 5CAYB 3HE7B 4K3HA 3TO4B 2IPKA 2J6EA 3INUH 3OF6D 4ZNEE 3WS6C 2V7HB 4OZGA 5BS0A 4I1NB 1T2QH 1XF3B 3EDEA 4MYWB 2BRRH 1YYMH 5J6GA 3KPOB 3NH7H 3TA3A 1S7WA 3ARFD 3RVVC 4NQVA 5ACZB 3BT2H 1AD0B 2ADJA 1ZWIA 3MRLA 1KYOK 1Y6KR 3BKML 3RZCB 3C9NB 3S4SA 3HA0A 1N5YL 4I48A 4NIKB 4YBQD 2WP3O 5SWZD 1RK1A 3D69B 4L4VA 2FR4B 1Q9LA 3TPUA 3EYUH 5I18L 5F7UA 4BKLA 1IGIL 3MRJB 4KFZC 3B8SA 4V1DE 1RHHA 4UI2A 3NGBB 4OGYH 2ZKHH 1IGCH 3WIFB 1S7XA 3ZTJG 2Z8RA 4XPAH 4OI8A 1YNKL 2XKUA 1HINL 3TVMD 1ZHNB 3ULVC 1EIBA 3W2DH 5HBBA 3MO1B 1GYAA 4PBWD 4R90L 5DUPH 4PREB 1AGEA 3IF1A 4U05A 5I75B 4UUJB 1FNFA 5C0BB 2BVOA 4GBXB 4YHNA 3GBMH 3MRHB 4Y19E 1KNOB 1J1PH 3SGEI 4HH9A 2PXYD 3QCVH 4NSKB 4JFHE 3MLPA 3FB5B 5F70A 4DK3A 3D87B 4HZLA 4XP5L 1IGML 1MJUH 5MI0B 3U46A 3VFVB 4ELMA 2LU3A 3QI9B 4PJIB 2AKRA 3HKFA 5E9DE 2V2TB 3HAEB 4LGPB 5C6WH 4HS3A 2GJZA 3RJQB 2YMXL 4GH7B 3GGWA 3T0EE 2VR4A 2QSTA 3D85D 3KYKL 2VDRL 3FTGA 4DVBB 2F5BH 4XB8A 2EEBA 3I9GL 3MLXH 3PP4H 5KTEH 2HLAB 1SEBA 2NXYB 3ULUH 4YHMH 3B4NA 4HLZG 1K4DB 1T83C 4JLRA 1M1SA 4FFZL 3QEUA 4Y1AB 3BIKB 3ME0A 4Q7DA 1U8LA 2ZCLH 3VD5A 5LGKA 3KYOA 3G04A 2P4AB 3QCUL 4GXUN 2VLRB 1PKQE 4PJGF 1XZ0A 3LN4B 2W0PA 1DN2A 4NRYA 4XP9H 1G7PB 2AJ3B 4P23C 3E6FA 3KYAA 4NBZB 4MA7L 2OM5A 5JPMB 5EO9B 4DOHB 2E3VA 3MV8A 5KSUB 3VGBA 2C3WA 1MCEA 3UTZB 4MA3A 3VXSA 1NL0L 1Q94B 4YLQT 2V9RA 1B90A 3MZTA 3C60A 2DQGL 5I9QB 1O7SA 1GOHA 3VXNA 5GQBA 1A1MB 1MIEL 2DTSA 4Z78A 2P7TB 3QDJE 1V3LA 3L3OB 2VABA 4PRBA 4W6XB 4XAWH 1KCKA 3FO2A 4OQTH 5HGAA 1KJMB 1MUJB 4U6YB 2CO6B 5JW3H 3FONB 1YQVH 2ARWA 1MCKA 1AFVH 4W81A 3LIZH 4EUPA 3UTSB 1VGEL 1UEMA 1T1WA 2EDEA 4DTGH 4P2OA 5FYKD 5DVLA 2DQJH 2GT9A 3MCKA 4LSDA 3LKQA 4N0UA 5I1EL 1Q9WA 5LJYH 3BGMB 4AM0B 4TULH 5BW7C 1DCLA 3HI5H 3U0TB 3VXTB 4Y8AA 1DBAL 1VERA 3SKOA 3HPLA 4LVHC 4O51B 1HHHB 4MNQE 3QEHA 5C86A 4OM0H 4JQIL 2WSKA 1OQXA 2C3VB 2MPAH 3U83A 2W91A 3QG6B 2EDLA 1C5CH 3VXUB 3MV9D 1BPVA 4LFHD 4WFED 4G8EA 4PJ8C 4U1KB 3KR3H 4PS4H 2OQJB 3QNXB 2DOCA 3BXNA 2BVEA 1X5KA 2MHAB 4JFFE 1YEDA 4X6EB 4BYHA 1LGVA 4G7YL 1BEYH 4WTZA 1HI6A 1T20A 4L8SB 3HNVL 5H35B 5KZCD 4WW1B 4HUVB 2G2RA 2VDQH 1P69B 1K6QH 2NTFA 3NZHH 3FOLA 4ZSOB 1WT5A 2MOVA 4MAYB 1WAAE 1AGDB 2HLFC 2P5ED 1OGAE 2AJVH 3I6LD 4NUGL 2NQCA 5HDBE 5HGBB 3ZYIA 3FFCE 2MCPL 1RI8A 4DVRH 3MCG1 1NCBL 2Y5TA 3UTQB 2PO6A 5MEPB 2VZTA 4Z7OF 5DT1L 5C0DA 3AB0C 4KDTC 1KCUH 4OF0A 5C1MB 3KPNB 4X6CB 1HHIA 2CKBH 1FNEA 4HIJA 4Z7NE 3IKCB 2DBLH 3BEVA 3RIAK 4HC1A 1EBPA 3NCEB 5GS0C 2ZUWA 5D7LA 4F7MB 3BO8B 1KC5H 5FO7B 5EIQA 1XH3A 5ITBL 3C5ZA 4PLJC 4LLMB 5IVNA 3RX5A 3MV11 5HXMA 1PY9A 2Q76A 5F71A 3WIIH 5C0RL 1K9TA 4R0LC 1ZHLB 4PRPE 1TFHA 4QYOA 2FJHA 1WV7T 2R69H 2NNAA 5CILL 4FQXC 1OSZA 4KQ4H 3QHFL 3WHE1 5FGBA 1NCWL 1EO8H 1NEZB 4LLVA 3THMH 1BLNB 3I75B 2H8PA 3VFWB 4LLAA 3VE0A 4QHNA 4XBGB 4W70A 4X4YA 3RIAF 5LQBL 3OGOE 1HN1A 4GOSA 4K7PY 3UPRB 4LGRB 3TN0C 1T66D 3SQOL 3PV6B 5DD1H 5I71C 4WI6A 1OW0C 4XHQA 1KJ2L 4Q9QL 2DQFB 4RAVA 3B2UD 5BVPL 4WO4D 4JQVC 1UWEL 1FC1A 2ZOLA 3O3EB 4JRYD 4LHQB 3STZA 1JMZA 4KK8D 3S96A 4NQDA 3SO5A 1JK8A 1TENA 4JFZL 1EHLH 4DZBB 5H94B 5IIEB 3IFOB 5IB4A 4BELD 3QQ9C 1RV6X 1FE8L 1T3FB 4QHLA 5CGTA 1B0WA 5ANMB 3OXRA 5FM8A 4FTVB 3VXQB 4HPYH 4LAQL 3WFDL 5I15H 3S5LG 1ZGLP 2P5WE 4AJ0A 3RAJH 1ZLWH 5JR1L 2MCG1 1GZQB 5IMOA 1H3PL 3MFGB 2GIYA 5ACLA 3PWLA 2BFVH 1X6NA 1OTUD 4D9QE 5FHBL 2HT4C 2NY4B 4FXKA 1OP3H 4XXDA 1EAPB 1NGZB 2Z92A 5L2JA 2HRPL 5GPRA 4WWID 4K07A 5E2UL 2A6KA 1EEYA 3MRJA 4OIAA 3NCBB 3R0MA 5F1OB 4PJ5D 3F7RA 3I6GA 3R06B 1PZUB 4NP4L 4IRJB 2DLFL 2VR5A 4TUKH 1IL1A 3QUXB 5FCUL 5F7LB 2FH6A 4QTHA 1MHPH 4Y2DD 2CDGA 5D1XD 1KB5B 3KG5A 4FFVD 4ONGL 4UUJA 4GBXA 1T1XB 2FD6H 3GHEH 1ED3B 1KNOA 3WD5L 3BH8A 3IJHB 4NSKA 2WK2A 1RMFH 1CE1H 5TDOA 5CEZL 4BJLA 4NFBA 4OFYA 5HHPA 3MSPA 4KI5C 1LK3L 4AZ8A 1VB9A 3VFVA 3A6OA 5IMLA 1IZJA 1T22B 2GYSA 3KXFA 3ZO0A 3RX7A 2V2TA 3IFPA 4HV8B 4YPGA 3CK0L 3HR5A 5C6TH 1YEGH 1QSED 1IGFH 2R29L 4XCNB 3X3FH 4U1HA 3ZTNH 4BM7A 3S9DB 3SE8L 2F53D 5EZJA 7CGTA 2YPLA 4YBLC 1HSAA 3BPLC 5DLMH 4G9DB 3VGHA 1ZT4A 3C6LD 3KPRB 1AGCB 4G6FD 4DVBA 4E41B 5L9DL 3WLWC 3KPLB 1HHJB 1S9XB 4UMGA 4LVNC 1A0QL 1U8PB 1W0YT 2VQUA 4Y1AA 1IC7H 1X7QB 4HS8L 5DI8A 1SY6A 4OFDA 5INDA 5JMOC 5D7IE 3ILPA 1G7PA 2AJ3A 3O8XA 4NM4H 3VGAC 4Y8DC 2ILLA 4D94A 3AXLA 4K23H 3T3PE 4I9WD 3Q0HA 1RJYA 2LABA 4Y4HA 2BSSB 4YXLL 1K8IA 5HHOA 4N0CC 5HYSA 1SJHB 5KS9F 4G8GA 2FBJH 3TZVB 1QO3B 2DD8L 3SDDD 5J3H