2E6PA

Solution structure of the ig-like domain (714-804) from human obscurin-like protein 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGPVHILSPQDKVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obscurin-like protein 1
publication title Solution structure of the Ig-like domain (714-804) from human Obscurin-like protein 1
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e6pA01
3SGEI 1UH2A 1CXKA 2XTLA 2BVYA 4KVCL 1F6AA 5JLZB 1N59A 4NDMA 2AJYH 3I9GL 3MSPA 1I3UA 3JV4B 3WSQL 1CFSB 5ISZE 1HNGA 3ME0A 4L4VB 5IIEB 2Z0BA 4HPYL 4NQEB 5FEBA 4XNZB 1N7MH 1J8KA 4N1HB 1G0XA 2B7DT 3ZE2F 1BQLL 4OLXH 4FS0A 2IANA 1J86A 4NN7C 5JQHC 5GRYA 3L6FB 4XBEH 4AEFA 5IM7A 3O3DA 2WV3A 1QNZL 2KDGA 3ULVD 3DRQA 4NN6B 4IRJA 1NGZA 1F97A 3HE6A 5FHAL 4PJIE 1MJ8H 1QBBA 4L3ED 1XIWC 3BSZH 2NMSA 2VLME 5E9DA 3PGFL 4OM0H 2YPLA 3SGDI 1YMMD 1D9KA 4L4TA 5CUSL 1R5WA 4HGMA 5CJ8A 3GB7A 1FL3B 5DUMH 4JRYB 2WBJA 4N9GB 3VCLB 4XPBL 2XRAL 4PJEF 4X6EB 3BT2L 1PKQB 4KH2A 5DD1L 5FUCE 5DA4A 2ZPKL 3IKKA 3HA0A 5L2JA 1S78C 3ARFA 2APXA 4V1DD 1I4FB 1LO4H 1A1NA 3CNKA 1YEKH 3VFRA 2Z31B 1S7WA 4OLZL 2VLLA 1WWWX 2HVJB 2PN5A 4BZ1L 1AQKL 3WFBH 3TNMA 1LK3L 4OF8A 3LS5H 3P3YA 4F7MA 3GSOA 3P11L 1EDQA 3BHBA 1ADQL 2ITCA 2PTVA 4A6YB 2MPAH 2VZVA 4JANB 3SKMA 2NXYC 1T5WB 3IETA 3ARGC 4FABH 1FL6B 4EUPH 5KANI 3P40A 5F9DC 5C09A 1DP0A 2J88L 1XCQB 5MEPB 4JN2B 2BMKA 4XPTL 1I8LA 4L5FH 5DJCB 1OM3L 5DZLA 3BAEL 3QDGA 3JWNC 3Q2CA 2ATPA 4LEXH 4R96A 4U6XA 4KKCC 3DYOA 1FYTB 4G8IA 3IDMB 3G5XB 4AH2A 3EDKA 1BECA 2WQ8A 1T1YB 4PGEA 4Z7WE 3T4AB 4M6OH 4Y19A 4QRQA 1X7QB 4RMUA 5HHOB 5C07E 2DQFB 4U3XA 5DYOA 1LEIA 1MWAL 5GGVL 1RK0B 5EZJA 4YDVB 4UT7L 4PTUB 3BYTA 3RVTD 4OI7A 1FG2A 4P46C 3L9RB 3OKYA 2X89D 2X4SB 3AB0B 5GISH 3S34L 5IWLC 3CLEL 4CVXB 2WWKT 5MI0B 1MCQA 1AI1L 4MJ2A 5KSAA 4LIQE 1INDH 4PRID 2XKNA 3CXHK 4LP4A 4UV4L 2GSIB 2AV1B 4X8JB 1F3RB 3WSQH 2R2EA 4RMRA 5FYJH 3O4LE 3NAAL 3UTQB 1MCNA 3T04D 4PLNC 4HPYH 4L3AA 3QDHA 4N5ED 2EIZA 1DQJA 4UNTA 4OBSA 2IAMA 1BQLH 3MJ7A 1UA6L 1KJ2A 2F5BL 4PLOB 1NUGA 1W72A 2Z91A 3TPUA 3MROB 4UT9H 1QNZH 5C0IA 1GZQB 4XC3H 3TCXA 4FA8A 4DUVA 2A74B 4DN4H 5GS0L 3L3HA 4ORGB 3ZDXF 1NGYB 4EN3B 1F4XL 3CMOH 2YRLA 3NPSB 4OLEA 2W38A 4U6VL 4QXTB 1LE5A 3T77B 2PTTB 3BN3B 3FO0L 1F13A 5E1HB 1MAKA 5E6ZA 4BQBA 3IDGA 1Z3GH 4WHYG 5EUKB 5HHPA 3WIFB 1G7QB 2BY1A 4OZGA 4OZFA 4NT6A 4XRCA 3ARED 4YO0A 3RWEA 3TBWA 4XT1C 2ZPKH 1PKQE 2VXUL 4MZ3A 2R0WL 3PQYA 4WFHE 2ZUVA 4FQQB 4LLWA 3OJMB 4K8RD 2EYTB 4NYLA 4OLVL 3VFWB 4BZ1H 4ELME 1AQKH 4H1LB 5FO7B 2R2BB 4I5BA 3CU7A 4ODXA 5BS0A 2FSEA 4JFOA 4FQLH 5FYKE 2ZG3A 2F58H 2WNGA 3K80A 2PF6A 1HXYA 3MUGB 1H0DA 2EXYD 5B38G 2V7HA 1ZA3B 4RBPH 4O02L 3S5LB 3B2UC 2XICA 2XG4A 5ESQA 1UZ8B 4L3CB 3TO2A 1FYTE 1G7MB 2QSVA 1NCAL 4G7VL 4K3DL 3QDJB 4G9FD 4NUJA 5HVGB 3MRMB 3TIEB 3RDTD 5TPWH 3UTSB 1X5ZA 4ZO9A 1ETZB 3QI9A 3EFFB 3ZKMC 2GUOB 1KPVA 3MLUL 3X14A 1UM6L 4X9BA 4H8WL 5JOFB 1CGYA 5D7IA 4UT7H 1QA9B 1HHHA 4WI8A 1BX2A 1X5LA 2OZ4L 1CFBA 8FABA 5JORB 1CFNA 1SVZA 3RY5A 4JJ5A 5B39G 2DRUA 4HH8A 3BZFB 2XACC 3DX6A 3T09A 2H32B 3EFDL 1Y0LA 4ODHH 3MODH 3QIBD 3GDBA 1AY1L 2NPLX 3Q5OA 5ISZA 5B3JF 5HI4D 3KR3L 3UTTD 4OT1L 4WY7L 5F9OL 4DCQB 4KROB 5EBLA 4JCMA 3MGAA 5JMOC 1G1CA 4QF1B 5CIPB 2PW1B 3VXQB 2F5BH 2C9AA 3O3UN 1CXFA 2P47B 3TN0C 1S7QB 5GS0H 1JF6A 4GQ9L 4XPGL 1CGUA 4FFYL 3HAEA 1LD9B 4G3YL 4RFOL 4E0RB 4MAYD 1BD2B 5I76B 3OKOA 3WNLA 3OKMA 4DGIL 2L7JA 3U79A 3FO0H 2X70A 1KTDA 5GGVY 4R3SB 2GAZA 2VLJB 4AIXA 5FYLH 1U95B 3FRUB 3IDJA 2IWGA 3EYVB 2DLGA 1JNHA 4JLRB 4PRPB 1XGRA 1IZKA 2E5EA 2VXUH 3BH8B 2Y7QA 3HNTH 3IU3A 3DSFL 2N7AA 4BUGA 2I5YH 4ZPVB 1ZTXL 3KDMA 1NMBL 3QEUB 3WDJA 3QUYA 1J0HA 1S8DB 1NEZB 4Y5VA 1U92B 2X4OA 3GSXA 2EE3A 1IGJA 2ZSWA 4Z5RA 1EJ6A 1LWRA 4PJIF 1T0NB 1E6JH 3B9KD 4LCCC 3C5ZD 1FC1A 2FL5B 5L88H 4XCFH 35C8L 4KKNA 3DO3A 3SDDC 5D2NE 5D8JL 4ZXBC 3BH9A 2XN9A 2OMNA 2BCKB 5DK0B 4WI9A 2HFTA 3PIQB 4MDJB 5FV1L 5I9QC 5T3XH 4BKLB 1X5JA 3GJFA 3U4BH 5HDOA 4Q9QL 4K3DH 5GSRA 4NPYA 3BKJH 4LSRL 3OJDB 3SDXA 5AD0B 3QDJE 2A73B 1MEXL 4FXLA 1UXWB 3RVXD 3UTSE 3VXTA 3EZJB 5C07A 3MLUH 4AM0A 5LAXB 4Z7UB 2R8SL 4J4PD 2OM5A 3K1DA 4F3FA 4NUGH 4D0BA 4L3EB 2OZ4H 3D3VD 2E7BA 2V17L 1Q9KB 1YMMB 1P1ZA 4C57C 5I66A 1T22A 2HT2C 1ZT7B 5JR1L 1UZ6E 3CDYA 1CLCA 1T1XB 1TCMA 1XGQB 1H3UA 1MHHB 3BP6A 3QJHA 3HMXL 4UQ3A 4LHUG 4OLUL 4RGMC 5FKPB 3KR3H 2IPKA 3MX0A 1HDMB 4V1DB 5DS8B 4ZFOA 1BFTA 1U8OA 4OT1H 4RMWA 1P84K 5F9OH 4F37K 2DJUA 5D9SA 4LLYA 3O4OB 4NBXB 5GIRA 4Z7WF 2HRPL 1DFBH 1P9MC 2V9TA 1T04B 4XNQA 5FYJD 4OFKA 1T5XA 2YRZA 3GHEL 3KPTA 4GQ9H 4I3RH 3ULUC 5IW1A 1ZHNA 2EC9U 4XPGH 1LK2B 2GK2A 2HVKB 4FFYH 3X13B 4Y1AD 1H9VA 4G3YH 4RFOH 3S8WA 1EVTC 2CK0H 2R4RH 2BDNL 5L7XH 2DYPD 3CVIL 5I8EA 4DGIH 3QRGL 2Y4SA 4N0FA 3IFLH 1AHWC 5H2BA 4M7LT 4I2XA 1T3FA 4GXVL 5L0QB 1FFQA 4QGYA 4QCIB 2VLJE 4LMQE 3UJJL 2FHBA 1EGJL 3MOQA 4KUCD 4PRPE 3IKCB 5EU7E 5DMGD 3ARVA 1AIFB 5ACZA 1EMTL 4LRNL 3ZYOA 2H26B 1XR9B 2J8HA 3BMWA 5EIIA 1MIML 4X9HA 5SWZA 5ACLA 3CFCH 2W91A 3WJJA 3H2WA 4HEPG 3HMWH 4EXPX 1NC4D 4PY7B 3FB8B 3WFHB 4U0RB 2ICWA 1NAML 3SOBL 2BK8A 1BJ1J 2GTZB 1E28B 3FO9A 35C8H 4PRIB 2V6HA 1R3HB 1KCSL 5D8JH 4LL9A 4XVUD 1SMOA 4Z7QE 4MNHB 1A3RL 1FNEA 3BQUC 5LGJA 5CMAB 2OS7A 1CICC 2YWZA 2KQNA 3O3EA 1IKFL 5J12C 4EKXA 4LSRH 1CF8L 5GRWA 4GS7C 1MEXH 5DQJA 1ZLVH 2FATL 4DJMA 2X4NB 3MRDB 4ELMF 1AQDB 5EO1B 5D1QA 2YSSA 2MCG1 1K4CB 1IM3B 2E8YA 1K8DA 5SWQB 4Z7UE 4RX4A 4R8WH 3GSNB 2V17H 4L3EE 3VGDA 3RPIA 5F9JB 1WFUA 3QG7H 1YMME 4JKLA 1I8KA 1UQSA 1Z9MA 4ZO7A 4L29A 2P5ED 1JIBA 4OLUH 3AREB 4W6WB 3O6FC 2V7NA 3OZ9L 2EDTA 3V6ZA 1O0VA 5FA3A 4IHOA 4EQ3A 4U6YA 2DIBA 2YHGA 4U1KB 3HRZA 1YNKL 2P7TB 3K8MA 1NCUA 1WQVT 1VADA 1YN7B 2JB6B 1ZANH 5DI8B 2DKUA 3MRBA 4NZUL 5KW9H 1ZLWH 1G7PA 1WCBB 3FRPG 2DJSA 3AROA 3P0VL 1HXMA 4MMZC 2V5TA 1CD1A 5GS3A 1R0AH 1WVZA 3H3BC 3RTQA 2P5WE 5GGQL 5IHZB 1NEUA 2B8OT 2BDNH 1ZHKA 2EDRA 3CVIH 3FZUC 5IB1B 2VLRD 3QXWA 1H3XA 2DF3A 4FQJL 4Q6IB 2COQA 3MLVL 4ODBD 5FAAA 1L9MA 5GS0D 1U2HA 3S4SB 5FGCB 5HYSB 1KN2L 4U1HA 4M6NL 3UYRL 4XNMA 1G84A 2FB4H 3VWKA 4G9FB 2A77L 1I8MB 3OB8A 3QWRD 3RDTB 4JFQA 4C4KO 4KQ3L 1EMTH 5DFVD 2P42B 4FQ1L 5FYLD 4D9QD 3TVMC 3WHXB 2W65A 3ARQA 3HRPA 5EO9B 4ZAKA 4OD3H 3IRPX 4P2CG 3UMTA 1AD0B 4JFYB 2VDOL 4KKBD 4KZEH 3QIBB 5CSGA 3F7QA 2NY5C 2CGRL 2JLLA 1KCSH 3I85A 3BD4A 3SGEH 1NFDA 3LPGA 2LTQB 3U7WL 3LN4B 2DQUL 3TO4C 3UTTB 2XQBL 1IC5L 3MRNA 3GSQB 1J9CT 1A3RH 1TJGL 5FB8B 1IKFH 1JI2A 1V3JA 4APQD 1TXKA 2CR3A 3X3FL 2IH3A 4XHJD 1F42A 4N0YL 1I1RA 2P44B 3P4NA 2BVTA 4HQQL 3RGHA 3ARSA 5T3XD 5EOQL 2MHAB 4NWTL 4MAYB 2C7UB 1FNAA 2X4TA 1SY6L 4ZNEE 4KK9D 4XMPL 2MQ0A 1A7BA 5SV4A 2CIIB 5FYJU 3O81A 1FVDB 1N3NA 5C9KA 5DD0L 4I3SL 1YN6A 3T0EE 1ACYL 3LRSB 1DQLH 1U8LA 1G9EA 3F5WA 4Q2ZB 1YNKH 4B41A 2AGJL 4PJ9C 4QRRD 4QY8B 5GSVB 1RURH 4NZUH 3QNYB 1K4DA 2AEQL 3QXAA 2ZCHH 1QVOB 5A3ID 3TA3D 5GZND 4KDTC 3C5ZB 4YGAB 3G08B 5GGQH 3MOAH 1IAMA 2AS5M 4X7EC 3TZVD 1AJ7L 1YC7A 1CS6A 1UZ6F 3DXAB 3B8SA 3MLVH 4LEOB 2ID5A 5ENWA 3W39A 5JW4R 2P43B 1A3LL 1D6VL 1KN2H 4OCNC 2A9NL 4M6NH 4EUPB 4FFWC 3ESVF 4O58L 4HEME 1R3LA 4ZS7H 3UYRH 3WFDL 3CXDH 1FAIH 3X11A 4M1DH 3SBWA 3VMOA 5IR1B 3OAYH 2QHLA 1OOAA 4YDIL 2HFEA 1VKXA 4IMLA 4U7SA 4FQ1H 4HHAA 1M71A 1A0QH 5F1OB 3JVGA 1QSED 3QFJA 4G8GD 4LGSB 3D3VB 5EOTB 4JFZL 3G9VA 3OV6A 3MNVA 3R0MA 3JWDC 4HMDA 4NQUA 4K7FB 5EPMA 5BOPA 1CE1L 4DOHB 2FO1A 5FM8A 1T66C 2IBBA 2WUBL 5HYEA 1Z6JT 4YDKH 1UCTA 1LE9A 2DQUH 3WS6A 1IC5H 1TVHB 3HS0A 3UTTE 1QEWB 1TJGH 4JO1L 1S7UA 5AG8A 5KVMC 3N0PB 1E4XL 1FPTL 4F15C 4F58H 3KLHD 2QHRL 3PWNB 4M1CC 3X3FH 2XZZA 2I60L 1OGTB 4Q9RL 4Y4FC 1P53A 4LCUB 5TGBB 1JK8B 5AYQA 3R06B 4Y1AB 4U49A 3OR7B 1BQSA 4GW1A 4HG4J 1KXQE 5EOQH 2GKIA 4JHWH 5F7DA 1QLRA 3VXUD 4UUJA 2DYPB 1QUNA 4EBQL 2KL6A 3ULUL 3KLAB 1SY6H 5TQ2L 2OMBA 4G80B 3PHQB 4B53A 5I17B 1INQB 5DMJB 1FZMB 3RGVA 1CGSL 5DD0H 1KLFA 5HYJE 3FN9A 1K8IB 2CD0A 3E6FB 4S11A 4BH8B 1CLOL 4Z7QF 3DLQR 3ZT5A 3MLSH 4JQVC 3KPLB 4R4BA 5SWSE 5J3HC 3DVNA 4BZYA 4HBCL 4GAGL 5DDHB 1ZSDA 1JGUH 2AV7B 4IIQC 5EU3B 3RWCA 4L8CB 3B6SA 4BH7B 1XIWD 4UAOB 4ALAL 5KN5B 1B0GA 2JJTA 1P4LB 2X7LB 2APVA 5AUMA 4TSAH 3OF6D 5BO1L 4MHHG 2IQ9L 1NC4B 2MFNA 5DK2B 4OKDA 4Z7UF 3ZT6A 3LZFL 4XP6H 4JM4L 4X80H 2DLEA 1ORQA 4P5TC 3TJEL 2ZJSL 4UIMB 3EKCA 1IRAY 3MV7A 4LCIH 4PJ8C 5J4MA 4H20L 1DEEA 4FP8H 4GXUN 5F8QC 3I2CL 3DXAE 4Z95L 2FEEL 3E3QC 5CINL 5KS9A 2BXYA 4ONHB 4GG8A 5CEYA 2FJFA 2X4UA 1HQ4B 4HW6A 2HJKA 4O2CA 4DW2H 3U0TB 2NXYD 1J11A 4P5MA 1A6TB 1RK1A 3CX5K 5FM5O 2KBGA 5C3LD 2IMMA 1N64H 4NM4L 3PL6D 3QH3A 2ITDA 5DJ8B 1J8HD 1R3JA 4NNXA 5EN2B 4OSUL 2R69L 4WWKA 3D3VE 4GFTB 1B88A 1W0WA 3UAJD 1AGDA 1S9YB 1CE1H 2P5EB 2AXJA 2ZUWA 5LVEA 1EEUA 3EOTL 2WUBH 4FZ8H 3OWEA 3WUWA 2YOCA 4Y88A 3NFNB 5AYUL 3O9WA 1LEGB 1A7PH 2LAAA 4AQOA 4JO1H 3EBAA 3PWJB 2H9GB 4MJ4A 4FG6C 1E4XH 4P46D 1FPTH 3ZE0E 1MFAH 1DQDL 4X4XB 1FAKT 3PDOB 2I60H 2DWEB 4OFPA 4Q9RH 4FFZL 1T2QL 3NGBB 1GOHA 2J6EL 2WAHA 4OJFH 3DURB 1TZGH 5FYJE 1ZWIB 1OW0C 1A9EB 1ZA6B 3STZA 3DUSB 4JDZB 4Y1AE 4X4ZA 4S2SB 1SJVA 1Q0XH 3ULUH 2VLRB 5T1LD 5TQ2H 1A4JB 3JTSA 2VZTA 5HI5C 4WTWA 1UJ3B 3C6LA 1OSPL 4PGBB 1VGKA 1IARB 4HKJA 1A2YA 1EEZA 1UKQA 1EAPB 1CGSH 2Q20A 5HHQB 3EYSH 4WUUA 5JNYB 3BZ4A 1B0RB 5KVGL 2FJGA 5FUOL 2WM0A 3V6BR 3FFCA 3FOMA 1GGTA 3V6FA 5D7LA 1TZIB 1CCZA 4HBCH 3WL9B 1S7RB 2BNQA 4UNVA 4HIEA 2LU3A 5KZCD 1NGPH 3V0VB 4XXDB 4M6ML 3LIZH 2OI9B 3V4PH 1Q94A 3WKML 3MRLA 1AXSA 1OLZA 2X6MA 1KIPB 4MD0A 2IQ9H 1N6VA 1WZ1H 5HDQL 3MLTA 2D7TH 3LZFH 4IMKA 5GRUL 3KXFD 4WI4A 1NSNH 3QHZL 3TJEH 2ZJSH 5C0FA 4JAMA 3ZYZA 5DA0B 2J7LA 4OV5B 3MXWL 3WN5A 5I8CA 4XPHH 4I4WA 4OM1L 1LO0H 5GRVK 5J57B 4NQVB 5CINH 2VMFA 1WUNT 2NY5L 4RMTA 4KJQC 5E2VL 5EOCJ 4H25A 5E5MA 3TBSB 4GRLA 2Y06L 1NCCH 4JR9H 3WHE0 4APQB 2YUVA 1T1ZA 2JKXA 5DJ6A 5MERB 4YC2C 1DBML 3KPSA 2NTFA 1EHLH 4XWGL 2DQJL 5TF0A 3RNQA 2HLFD 4XGZA 4MA7L 3IVKB 4NM4H 1HSAB 5DQ9A 1BZ7B 3IDIB 4NWUL 3B2UD 1N4XH 3TIDA 1QR1A 1HK6A 4HSQA 2VJXA 3FQRA 2R69H 2F9BT 2WSKA 4LVHB 4O2FA 4XCYA 3U0PA 5KSUB 3UP1A 2ZKHL 4OFYA 1M7DA 5EBWA 3BWAA 3MPCA 3RWDA 2G5BA 3U7YL 1KCLA 4NHCH 2R0ZH 2VQUA 4HX1A 4GAFB 1MELA 1QLEL 1VPOH 2ADFL 3SDCA 5AYUH 2DI8A 1I7UB 5EO0A 4QYOA 4HAFA 5GHWL 5MEND 4QRRB 1W8NA 2RCSH 1IMHC 2FWOA 5J6HB 2H3NA 1XF2A 5IMKA 4LVEA 3CH1A 3UJIH 1JGVL 3LQZB 3TA3B 5IP4A 1KB5A 1IFHL 1XGTA 3HFML 4TNVF 2HKFL 2C1OA 3TZVB 4HMCA 4HGWA 4CKVX 1MI5E 4UTBL 1LMKA 4O2EB 4JPVL 3LH2H 2LU7A 3BEVA 4U1GC 3WNOA 3G5VA 1OSPH 1DQTA 3DIFB 3ROLA 5EU4A 3T8XA 3VFMA 1KGCD 4PGCA 2WBKA 5HYJA 2AW2A 2P8PA 3H9SA 3JV0A 4OAWB 5HGGS 2XPGB 3GIZH 4H1LG 4LLVB 4X5XA 1U93B 3OB0K 4FXGB 2FBJL 5TH2A 4JO2L 3OJ2C 4RGNC 5DRXB 4XMKH 5BW7C 1U8IB 1H5BC 2QQNL 1NBYA 5FYLE 1NCBH 3T3PE 1QSEB 5CS7A 4I0PA 4G8GB 4MJID 5IVXA 3HC3H 5HYFA 4D9QE 4KDVA 4QRUB 1N6QL 1DBAL 1OAYL 2E6QA 4UILL 3S5LG 4N8CH 4DUXA 5C6TH 4MLSA 4N1EA 2K7PA 5IHUL 4UQ2A 4OZIB 3IJHB 2MMXA 32C2A 3QUKA 4HV8A 1ERNA 3JWDL 1T83A 1U3HD 5I1KL 1U8NB 1RFDH 2LV4A 4OM1H 4Z9KB 1VESA 1T20B 3C2AL 1KLUA 1CFVL 4X9FA 3K2UH 1KCUL 5DTFA 1OWRM 4KMTL 2V9QA 1X9QA 1I8IA 3MRFB 4BELD 4UU9B 1EK3A 1AGFA 3O2DL 5DVOA 3CVHL 1DBMH 1HIML 2OR8A 2DQJH 2IPTL 3GBMH 2BNRE 2DQTH 1PZUB 4J2XA 1EZVY 3T4YB 4X98A 1WBXA 3BYYA 3VXUB 3QUML 1W2KT 2HAZA 4GMSL 3VXSD 4F8QA 3U46B 3KJ6H 5T3XE 3VXRA 1FIEA 2OTUB 4ZYKB 2VSCA 5FK9B 3KAAA 3ARZA 3U7YH 4DK3A 3T2PA 5BVJB 4WVRA 5DVLA 1QLEH 4CJ1A 2F53D 4MCZA 2ADFH 5HJ3B 4WW2C 1IILE 4KTEH 4I0CC 3DX7B 4HKXB 4XNUL 4DTGL 2HKHL 1RJZB 2C3GA 2V5SA 2BVOA 4PRHE 3RAJL 1U36A 2HT2D 3BX7C 5FF6A 4Y2DA 2ARWA 1I75A 3CSBA 3L7FB 4D8PB 3V7MA 3HFMH 3PGDB 4YIQA 1P5VA 1T7WA 1FZOB 2ADIA 1OGAA 1IM9D 3HPLA 4YXLL 3GRWA 1WTGT 3MLPA 3RWIB 3OAZH 3QQ3A 2L0DA 3SGJA 2Q8BL 3GMMB 1PW3A 1JZ5A 1QSFD 3ULUD 5GQBA 2NXYB 3ZE0F 4JFHD 1NEZG 1H8OA 3O3BB 4HG4K 4JO2H 4YFLF 4OIBA 3VWJA 2QQNH 3PL6B 1FO0H 1G6VK 1J8HB 4GOSA 5D1XC 4WI6A 4Y16C 5FGBC 4RAHA 1L7TL 4FZEL 5E4EB 2VITB 3SO3C 1OAYH 2WWMC 4UILH 2HLAB 3R0NA 4ZUSB 5IHUH 5TE7L 3MREB 5H35A 3S88L 4P4KA 2EDQA 1OP9A 5T1MB 3ES6B 3T0AA 2XQYG 5ANMA 1VEPA 3D39A 4HZLB 5I1KH 2LFGA 5DFWH 1TJIL 2VABB 5H37H 2OL3L 4XP9L 3D25A 4P46B 1RULL 1NAMB 1MCSA 4L4JA 1PQZA 4WEBL 3P30H 3I50H 1BF2A 4JHAH 1CI5A 3AY4C 2X4PA 3O2DH 3S35L 1WIPA 3FT4A 5GGSB 1PBYA 2P24A 2IPTH 2ICES 3IXTB 1VHPA 4Y89A 3WLWC 3LKQB 3RX8A 3EHBC 1NDMB 4GMSH 5ELIA 1O7VA 1XCTB 1HHJB 2JF1A 5D2LE 4NKOB 2XKUA 3BQUD 5EBMA 2H2SD 3UYOD 5IW6B 3W5MA 3O6ML 4F57L 1CICD 4H5SA 4JPKL 2VL5A 3NCJL 3MV8A 3P9LA 1H3PH 5E2WL 1FRGH 3ISWA 4KKLC 4XCNB 1JWUA 1B9ZA 2NY1C 5L2KD 4YHNA 4XCEA 2DL9A 4XNUH 3O45A 3O41B 1N5YH 1HKFA 5A2LH 1S9VB 5E4IA 5KZCB 3NA9L 1HEZA 5T5FL 4WEUD 3O11A 3QEQA 1Z5LA 5GRJH 2DTSA 4Z76A 4L8SB 4YPGB 3DHMA 3O6FD 1QR4A 3KXFB 4R2GC 1NPUA 3T2OA 2I07A 4Y4KD 5T1DH 43CAB 3SPVB 1YDPB 1CE6B 3DPBA 5M95B 4E42B 3QQNA 3HI5H 1TQCC 3B2VH 1UB5B 1YEJH 2EZ0C 4NZJA 3RUGA 1YMHB 3DVGA 2Q8BH 2C3XA 4JM2D 1FZJB 1MCDA 1JN6B 4LLUA 3Q1SL 2VOTA 3V52H 2R1XB 3L95A 4UTAL 4PJBB 4D0CB 4X6BB 4PIRF 3W11C 4WEMB 3EJZC 3MNZA 2DMCA 4LVOB 2A6JB 4Y5YA 3FZUD 2G2RA 3RKDC 3L5HA 2AXHA 4PG2C 4H26B 4BFEA 4AMKL 4FZEH 5CBAA 1J8HE 2CRIA 4P2RD 1QG3A 2WIMA 5C0JA 1SJXA 5TE7H 3S88H 1SHMA 4U1JA 1T7ZA 5IJVA 1MPAH 5TF1L 3TBYB 3OKLB 4Z77B 4LKCB 2X4RA 4HT1L 3QDAA 5DUBA 3TYGL 3MBXH 3I6KA 1S7SA 4G42A 1BVZA 25C8H 2EDHA 4N0UB 4PTTB 1IEBB 2FX9L 3EO0B 4F7PA 5MENB 3TVMD 1RULH 4NZRL 4MXWH 1Q9OA 4NKIL 1EPFA 5DJDB 3DSNA 3PDGA 3BKYL 1I3GH 2UVEA 2XWBA 2K9UA 5ALCL 4PV8B 3SJVA 4P2YA 3ZO0A 2UYLA 1MFCH 3MRQA 2YEZA 3T3PF 4P3DA 4JO4L 3DMMC 2CUMA 1EUUA 3Q3GB 4U1IB 4UMGA 2ZG2A 3PHSA 3V0WH 4QXGL 1S7VB 1XH3A 4RFNC 1AE6L 4JPKH 1RIVH 4KQ4H 3NCJH 3A6BH 2Q76A 5D6CA 5E6YA 5HPMA 1M6OB 1QO3A 4MA3B 1K5NB 3C9NB 3VRLE 5IB4B 4H0GA 2H41A 3GJEB 3OXSA 3WO3B 4Y8DC 3JTTB 3JZ7A 5T5FH 4WHYH 4JZOB 2WZPD 3J7HA 4MJIB 1BFVL 1DVFC 4LASH 2OQJA 2UZXB 1SEBB 4CBPA 2XZCL 2CJUH 3L3IA 1CD8A 1HKLL 2FX8H 2ZWLT 3BPLC 3BEWB 4P23C 1NMCC 3SE8H 5D7JC 2R29L 1ZT4B 3S4SG 5HYSG 3L7EB 2IADB 5INCB 2Z4QB 1UT9A 1U3HB 4ZOEA 5CWSB 4PJ9D 3VXNA 2J8UA 1N8ZA 3ARTA 5F89B 2AK4D 2GJ6A 1ONQA 4QLRA 5AEAA 1C7TA 1NFIA 3FB6A 4DVRL 1DBBL 4PYGA 4FFVC 2OTWA 3HC4L 1EJOL 3PP3H 3MRHB 3VXSB 1FNHA 4AMKH 4DKAA 3BJLA 1PKOA 1YYML 5IW3A 1Q72L 5DHYB 4F9LC 1GRWA 4NZTL 3A6CL 4M00A 4FFWD 1KJVB 3JV4A 4NN5B 1CFSA 3R1GL 2GY7B 1G9NC 4L4VA 5HGBA 1WLHA 3PGCB 5IIEA 1FLRL 4NQEA 2F53B 4MJ6B 3QDMD 4HIHB 1DUYB 3W2DH 3VFSB 4HXAL 1TETH 4JN1H 4MSWA 3WS3B 5EU5B 5FOBB 4MA1C 3N85L 4N0UE 5INDB 4NZRH 1DBJH 1SM3L 3MMEB 1RIHL 4R26L 1A7QL 3R4DA 5GZOD 4LSUL 4F7TB 1G7LB 3GMNB 5ALCH 2PYEE 3BOVA 3R8BB 3MRGB 4RGMB 4KRPD 4JKPL 5LGKA 1OCWL 4TVPH 1T66D 1UACL 1IM9B 4JRYA 4ZOAA 4N9GA 5E2JA 1FDLL 2NYYC 4KVNL 4X6CA 3MCKA 1I4FA 5FUCC 4FQXC 1F00I 5IFHH 3QULB 4K7PY 4M93C 5IGXL 2YD4A 1RQ5A 2CRZA 1KCKA 4AIOA 4XXCA 4PBXA 1KF9B 1UH4A 5TDOA 2OJZL 5JO5B 1FV1A 3NACH 3P9MA 1ZVSB 4F33A 4OD1L 1ACZA 1T5WA 3TH4T 1F3JB 1JNNL 4MJIE 4QRTB 2VUOA 5A2IH 5DSCB 3DI3B 1HKLH 5I18H 4OGXL 4PJGE 5KSBB 4OV6F 5DJCA 3AFLA 2ICWI 2JCCB 4AEEA 2CMRL 2FR4B 4PJAB 5D2LF 1MCBA 4S1RL 3O0RH 5J3HD 4HK0A 4J3OC 2A6IB 2Y72A 3U2SA 4MAUH 1FSKB 4RAVB 3V95A 4ZFFB 2ED9A 2W9DL 4HWEL 3BGMA 3BKML 2Z8SA 5HHOA 1P6FA 2DQFA 4DZBB 3G04B 1WT5A 4YDVA 4PTUA 2FBOJ 5FUZL 2LQRA 2AEPL 1EJOH 2AAVA 4PJ8D 4W6XB 1BP3B 1XF3B 5EIVA 1QP1A 2FYYB 4HS3A 1CG9B 1Q72H 2M26A 3BQUB 4NZTH 2GSIA 2AV1A 4X8JA 1YEGH 1CICB 1S7XB 3C8HA 3RA7H 5D6DC 1YEFH 1QHPA 2XG5A 5J12B 5DZNA 1U0QA 4U7KA 4GS7B 1P69B 2VXQL 3REWA 2WMPA 5L2KB 2F53E 3QEGH 3MO1B 4HXAH 3UPCA 2XTJD 3MRRA 4R6UA 1U8HB 4ODWA 5IVNA 4YDJB 3MROA 2DQHH 3N85H 2NY2D 3QPXL 4LSDA 1SM3H 2A74A 5CLWA 4R26H 4ORGA 4ZNCD 1NGYA 4EN3A 4ESKA 1YC8A 1U8QB 4ZO8A 2W0LA 2Q8AH 3VI4E 3KYAA 5FKAB 2VC2L 4QXTA 1OCWH 3O6FB 2PTTA 2D03L 4Y4KB 2BSRB 4WFFD 5CILH 1UACH 3CSPA 3ZL4L 2WBWB 3WIFA 1G7QA 5E94A 1FDLH 3UTZA 2PO6D 2V2WB 5E1AA 4FG6D 4KVNH 2O26U 3OKDA 3ROOB 5B8CC 5E8DL 1NAKH 3TT1L 2H1PL 3NPZB 3TWCL 1CFQA 4FQQA 5CBEB 1LILA 4JM2B 2CKBL 2EYTA 5IGXH 4BFGA 1JPFB 4QTHB 5C08E 2DL2A 2R56L 3NOIA 4GLRI 3RX7A 3SDYL 1FN4B 3MFFA 2Z31C 3ZTNL 2JJWA 3HZYA 4CU6A 2VZSA 3H7BB 3QXTA 5HI5D 5C0AD 2BY0A 3D1MC 1CDJA 4ZOBA 4P2RB 4HUXB 4HPOL 5T1KD 4NQDD 3T0DA 4OBRA 4MJ5B 2RJMA 3MUGA 1DDHA 4EI5C 2LVEA 1ZA3A 1FORH 5KSBE 3BD3A 4I0KA 4ONOA 2JCCE 2UY6A 2BNUA 2Y07H 2CLZA 1FNGB 1UZ8A 1JRHL 4L3CA 5IUSA 2HJLB 1A6WH 5J9PB 4X83A 2XOTA 1HH9A 4M7LL 2O61B 3TVMB 2F19H 3DRTB 3DGGB 1OWWA 1I9EA 3C8DA 3BKMH 4HWEH 1JVKA 3EFFA 2GUOA 4DVBB 3VRLF 4NHUB 4R0LB 1I7TB 4J6RH 5JPMA 4R90H 3AU1A 3GMOA 1RZJC 4X6FA 5FUZH 4AT6B 2DIAA 2OR9L 5JHDD 5JORA 2AEPH 2GTWA 4YR6B 4HCRA 3L5WA 2OYPA 3FO1A 5DURD 4RGOH 3BZFA 3MYJB 5C2UB 2Q7YA 2H32A 4QRPD 3AB0C 5HPOA 4KJQD 1FL5B 5MI0C 4HUVB 1KSRA 1MRFH 4DQOH 1CK0L 1AGBA 3H9YA 4LSSL 4OUUB 4DCQA 5T3ZE 1L0XA 5L6YL 4J7RA 1IBGH 2DD8L 3M45A 4TQEL 5LCVL 1W8OA 4QF1A 2PW1A 4HS6A 3V8CA 2YD1A 5ETUB 1TZHB 2GJZB 2BSSB 1VACA 1UH3A 3U30B 1AP2A 2HT4C 1UGNA 4LSVH 3VGFA 4NC1E 4PJCB 1YEEH 5IT2H 1IC1A 3CFDA 4IOIB 4YGVB 3INUL 1LD9A 4CN6A 1ND0A 4E0RA 4JRWA 4MVBC 4M5ZL 4XPFL 1BD2A 2VC2H 5F1IB 3HUJB 4ZS6D 1CLZL 2R2CA 3NPSC 3U36B 2YC1B 3TV3L 3K46A 3QPQD 3E2HC 1ZV5A 4PJDB 4TVSa 4HUMB 2ICEA 3FRUA 2ZCLH 4LCWA 2FHFA 3D18B 3LDBB 5EUOE 4ZUVA 4OCRL 3SKNA 5DJZB 2AK4B 3BH8A 4PD4J 4TVPD 2H1PH 2J4WL 3IFPB 1SYSB 3TWCH 5ACMA 2X1OA 1SEQH 1CVSC 4CNIB 2CKBH 5KJRH 4ZPVA 4LRIC 4NNYB 2VDNL 1T6VN 3QEUA 1U91A 5A1AA 1QBLH 2R56H 1KBGH 4L8BA 1LP9B 1NEZA 5C8JB 2ENSA 3LN5B 3FQWB 4HWBA 5EH1A 2EYSB 2A6KB 3PWUA 5JXED 2OBGA 3GSUB 3RIFF 2FL5A 4HPOH 2Q1EA 2D31B 1FG9C 4OFVA 2NX5D 4P2RE 5F93C 2X09A 5IROA 4MB5A 4WI3A 5FA4B 2CXGA 1K9TA 2BCKA 1VERA 1FO0B 3PIQA 1WC7A 5D2NC 1KTKE 4MDJA 4OD2B 5BZDB 2QJDA 4WIQA 5ILTH 3FMGL 4BKLA 4RGND 1D5BB 4JZJC 3BP7B 4JG1L 4ETQB 1G9NL 1YNTA 3Q6GL 2R9HC 4M7LH 2WP3O 3OJDA 1IGYB 3KLDA 3P77B 1X5YA 5HGAA 1UXWA 3NMEA 4Q58C 1IE5A 2BVEA 2HRLA 3S36L 2FHCA 3T2NL 3ULSB 3U83A 5IB2B 1BLNB 3MRPB 4JGMA 1W72H 1MCEA 2OR9H 2DBJA 4KRPB 2YPKA 1Q9KA 3LPWA 1HINL 1BBDL 2IG2H 4HJGB 4LGRB 1T1XA 4GKZB 4JFXA 1K85A 4PJGF 1WWBX 4F9PA 4F15B 4EDXB 4ERSH 4R9HA 5FKPA 1ORSA 4LSSH 4V1DA 5GS1B 5L6YH 5DD3L 3HC0B 2MSPA 4OZFH 4GKSB 5IJKA 5I2IB 4KROC 1OP5K 1JNLH 5LGHL 2YXFA 5JIPA 4O9HH 3DO7B 3SCMC 3H8NA 3W9EB 1NL0L 5TFSL 4Z0XB 1CDCA 5GRVL 2NY4D 3B5HA 1LK2A 5IKCB 2VZUA 2HVKA 2WIIB 4PJCE 5J13C 3INUH 3D9AH 3MV11 1BVKB 1RZ7L 3IJYA 3NFPA 4M5ZH 4XPFH 3VA2C 3UPRB 4JFED 1CLZH 3FONB 2VRAA 5K9KB 2W9EL 1OPGH 8CGTA 1T21A 3G5ZB 4QOKE 4QCIA 5CP3H 2XFXA 4PJ7B 3GI8H 4PJDE 5GS2H 2FO4A 4LHUD 1WIUA 4O51B 1S9XB 1UADC 2YN5A 1GYAA 5DJXA 2J4WH 4U6TA 3IKCA 2VIRB 5CZVH 1CDGA 4WV1A 2AK4E 3T65B 5CJBA 1A02N 1AIFA 4ZODA 4ENEC 4NO0A 3RL2A 2OJEB 2H26A 4R4FH 1XR9A 5KVFL 3GM0A 5JW4M 3G9AB 2Y5TB 5EU7C 4X6DA 2VDNH 3IDXH 1IAIL 3LEVH 4AG4L 1FGVL 2AK1H 4PJ8B 4RAUA 4QHKI 1CBVL 4P59L 4LVNB 2N56A 4PY7A 3WFHA 2C4FT 2DQCH 4OLWL 2Z92B 1DN2A 5AG9A 3VI4F 2P49B 5DMYA 1A8JH 2QQLH 2RHEA 4PJFE 4PRIA 4F7EA 3D5OF 5GGTL 2IC2A 5I30L 3DROB 2VLKA 3SDAD 1PLGH 1BOGB 1VFBA 2HWZH 3G6AA 2JJVA 4ZOCA 1VFAB 3RVUD 1GHFH 2EH8H 3VG0L 2Z35A 3FB7B 4IM8A 4LIQL 3FMGH 2XTJB 1PY4A 4PG9A 2ZOKB 4HWZA 4UNUA 3Q6GH 5DRNA 3UDWA 4FQPA 1NBVH 2NY2B 2CUIA 1FNSL 5D1XD 5BRZD 4Y16D 1MCFA 2X4NA 3IU4H 4AENA 3IJSB 2WWMD 1H3GA 5KOMC 4ZUWB 4G9DB 4L8DB 3T2NH 5CGMA 2YZ8A 2DQIH 3OJVC 3TNNB 2ADJA 3MLWL 4RZCB 4OKVB 5FDYA 2EDYA 1HINH 1IAKB 2D2OA 3EYUL 3V4VL 3V79C 5F9JA 5DMIH 4NO5A 5E8NB 4IJ3B 3QUZC 2VDMH 3VDAA 2PO6B 3QQ4A 2VXSH 3QO0B 5KSBF 5IQ7L 2JCCF 3FCTB 4GBXA 3GGWB 1FGNH 3K4AA 5C0CD 4IRJD 5E6IA 1YN7A 2BHYA 3FT3B 2C1PB 3KJ4B 4X4MA 5CCKL 2YPLD 1J05A 2JJTC 1NL0H 3BDYL 5TFSH 4RMVA 4XP4L 1D9KD 4L4TD 5C0AB 2APWA 1MCJA 3V4UL 2WBJD 4TUJA 5T1KB 4NQDB 5IHZA 1LVEA 1A9BB 1MVUA 2EKSA 3CCHB 1YY8A 3O8XC 5J06A 4C4KT 5IB1A 1JHTA 4Q6IA 4ODTH 3KYNA 1TITA 3FQUB 5CEXA 1F4YL 4A6YL 1TPXB 5J1TC 5FYKL 3QWOB 1A6VH 5GGUB 5C0BD 4PJ7E 4N8VA 2EIBA 3WJLA 1RD6A 2WUCL 4G9FA 3S36X 4A2LA 4BSWA 4KZDL 3EDJA 5JTWA 5BZWB 3GUTA 4G8EB 5C9JB 3PJSA 5KVFH 3MA7B 3BESR 2OR7A 1R24B 3GJFH 1C1EL 4R2GD 1GGIL 4HH9B 5JHDB 1YEIL 4FQIL 1T03H 3C60C 4UOJA 3G5YB 1FGVH 5EO9A 3CFKA 1U8KB 3QDGD 4P59H 5DURB 4CL7A 4JFYA 1KPUB 1IGCH 1RZJL 4WWKC 2VUYA 1PAMA 3TBTB 4QRPB 1S9WB 2EZ0D 1V3KA 4K3JH 4U0RC 2JIXA 5GJTL 1G9MC 3LN4A 3LVEA 4E41D 2C4XA 3ARDB 2AXGA 2V2TB 2J8OA 2BFVL 4KU1A 4Y19D 2CIKA 3GSQA 3U6RA 4E9LA 5EUOF 1I7RB 3TYFB 3W11D 1SJHB 2BY2A 1JZ2A 5E00A 1NKOA 4DN3L 2XTJE 4KAQH 3RKDD 4N5EC 3DV4B 1Q9WB 3PWVB 5I74C 2SEBB 4PB9L 3KPRE 2YD8A 1CWVA 4JM2F 2BOBB 4HKBB 4OCXH 5KSAD 1G7IB 2MHAA 4MAYA 3MLWH 1MRCL 4D3CL 3IDYC 1P4BL 1FBIL 2MWCA 4NSKA 3QYCA 5HBBA 1ZLUK 3H0TB 4XBPA 3RY4A 4L9LB 3OB0H 4J3UA 2IAMD 4IDJL 4LOUC 1KYOJ 5F1NB 4YE4H 4X4YA 1U6AL 4JQIH 3KPNB 3LRSA 4GRMB 4LARH 5IQ7H 5HYIA 3RZCA 4KUZH 2QSQA 3T0EC 4Q2ZA 4PJXB 1N5AB 3AREC 1WBYA 1X5IA 2AJVL 4CN4A 1UWGL 1CT8B 3IXAB 3VXMA 1I85C 5K9QG 4Z18A 4P2QE 3DMMD 2D3VA 4ZUTB 1H15B 1QVOA 1BMGA 3B8YA 5IOPA 4XP4H 3EZ8A 2X2YA 3B9KA 4QHUA 2Q86A 5CGTA 4DKEL 1A5FH 3V4UH 4YHIB 5I8KL 4Y0GA 5C0AE 2NX5B 4NQDE 2EIDA 1ZLVK 1BAFL 1GC1H 2M2DA 1OHQA 3KWWB 2VE6B 5F1SA 4O4YL 2XWJA 2EIEA 3MNWA 3PQYD 1LNUB 4LEOA 2CH8A 3RU8H 2I25N 4HC1L 5FYKH 3SQOH 5H8DA 3FAXA 4EUPA 2ERJC 4FOMA 4RGNB 2W0FB 1H5BB 2CDEB 2WUCH 4TNWF 5KANG 4U1MA 2QKIB 4CAGA 1DVFD 1RJYB 1U8JA 1MLCB 5BS0D 5HHXL 1CL7L 1G7JB 1J5OL 3FQXA 4P23D 4J4PA 2IFFH 3H42L 4M5YL 5GS2D 1C08A 3RDTC 3HE7C 1C1EH 1P6AB 4WUKL 4E5XB 2AKRA 1YEIH 1EZVX 5EOTA 1G6RA 4Y5XB 3DYMA 4MNGB 1HE7A 1I3VA 3ELAT 1TNNA 3UZQA 4K7FA 2JK5B 2YRPA 3K4DA 4XHQA 3EO9L 1XAUA 1UXSB 1GGBL 4QRPE 1OARL 3DX8B 4PD4K 1UG9A 3O2VH 5DGQA 4RQQA 1ZE3C 3MRIA 1M05B 4MXVE 1QFWI 3BI9X 3QIBC 4PJDF 4X0KB 3V6OE 3ZTJH 1QEWA 5KTEH 1X5HA 4WHDA 3U9UB 1RZ8A 3LSOA 3TC9A 4DN3H 1A6ZB 1DQQB 5EZIL 3W0WE 3FQNB 1ZHBB 3HR5B 4XH2A 4PB9H 1X5KA 1JWMA 4LCUA 3PABB 2NY4B 4WENB 2XZQL 5A43C 2YPVL 3JV5A 1NUNB 2JELL 4JFEB 1V7NL 4WDIA 1FBIH 4KJYB 5ISZD 4LF3A 1GZPA 4PREB 4PJFF 4JVUA 1FZMA 1T6WA 3HG1B 3BZEA 3QIUA 1B2WH 5E2TH 1B6UA 1TVBA 4NP4L 1X3DA 2DQDH 3VGAB 3V5DB 5SX5K 3LKOB 2BVPA 1U6AH 1E0OB 3IYLW 1KJMB 1K8IA 3E6FA 4BH8A 4RWYL 5I73C 3LV3A 3KPLA 5FGRA 1LEKB 1OD9A 3WLBA 3DTXA 4OFIA 4TVPE 5HY9B 1CFTB 1KT2A 4PJXE 1UWGH 3NABH 4JPWL 5ITFA 4BFBD 1QBML 1WZKA 5KN5A 4PFEA 4PJHE 2G9HB 1P4LA 3IFOB 4HF5H 4HIXL 2EDLA 3C5SA 1XZ0B 1I3RB 1JRHI 1X5GA 4P9HC 4OF6A 4J12A 1FCGA 4LU5H 4MQXD 1E4KC 4GLRH 4BUHA 2EEAA 3IAPA 1QSVA 5JQ6L 2R4SL 3HI6H 2DQGH 2I9LB 4AEIH 3CFBB 1J1XL 4ZQKB 3WFCH 3X3GL 2E8ZA 4O4YH 3Q5TA 3C5ZC 3SDAB 3ILPB 1ADQA 3OKKB 2CLRA 1OSZA 4U6HB 5DD5L 4ONHA 5IBUB 1U3YA 1HQ4A 1UCBL 3QUYD 3CSYA 2C3HA 4FHBD 3V5HB 4LAQL 5BRZB 4Y16B 1R5VA 3L3JB 3LKNB 3MCLL 5EOCL 3SO3B 1MJJA 4HDIB 3TJHC 3QSKB 1J1PL 2PW2B 3H42H 3PP4H 4FQCL 1F6AB 5D7SL 1N59B 5EN2A 4PJEB 1RUKH 3F7YB 2XN9D 3BW9B 4IRZH 4MNGE 4M3KB 1B6DA 3U0WL 4JKKA 4XVTH 1SVCP 1MWAA 4LLQB 1DLFH 5LG1A 1S9YA 5HVFB 3EO9H 3RL1B 2P5EA 2DBLH 3ABZA 2H45A 1JFQL 1T0MA 5IM7B 4ELKA 4M7JL 4U4BA 3AUVA 4PRBA 5C0CB 1OQXA 4PJ7F 4IRJB 5C07D 1NGZB 2D7PA 1F3DH 1E27B 4BQ9A 1KCRL 2DWEA 2PXYC 3G6DL 2EXWC 3KYMA 1ZT1B 2YPLB 3DVFA 5F7KC 1C5BL 4UT6H 1D9KB 4L4TB 1R5WB 3GB7B 2XZQH 5ITBH 2WBJB 4OTXL 3DUSA 4MWFB 2YPVH 3PV6A 4ETYA 4JDZA 1TIUA 4DFIA 2D7QA 3W9DA 1ZOXA 4A2MA 2VLRA 3RVVD 1NLBL 5FOJA 4JFEE 1UJ3A 5L2JB 3O4LD 2ZNWA 5DC9B 5I15L 5IFJA 4X8XA 3HG1E 4JFDA 3VFRB 1N0XL 1SBSH 1S7WB 5DJYB 5C0BB 2VLLB 2K1MA 1B0RA 3TNMB 4RWYH 4F7MB 3BHBB 2NCMA 1TZIA 2ITCB 1S7RA 3BVNA 2YA2A 3SKMB 3IETB 3LKSA 4XXDA 3OTTA 4JY4A 4V2CB 5E8PB 5ERWB 3RIFK 5I1GH 4R2GB 4RMQA 4P2QA 2YMXL 1INEL 2BMKB 3FT2B 2A38A 4MLIA 1MJUL 1VA9A 3C09B 3NCCB 3QDGB 2HH0L 4UAOC 4ZTOL 3ILQD 2ATPB 1A21A 4R96B 1P4IL 4U6XB 1XGPA 3THML 2CKBB 2V2XB 2Q6WA 1TQCB 5C0RL 3U7AA 4HJJL 4TTDD 4OF3A 1J1XH 4LDOB 1JF1A 4OV5A 5DUPL 3RY6C 3X3GH 5HHVL 2XNAA 4PGEB 3GKZA 3CSGA 4MQSB 4Y19B 4QRQB 4NQVA 4OCSH 1S3KL 4NCC1 5DYOB 4ZG1A 3CLFL 4YHKH 1ZS8A 1V7ML 3FN0H 4XVUC 1G9ML 3CFEA 5EZJB 5SWZD 4DZ8A 5I19L 3FOLA 5IEHA 1FG2B 1UCBH 4NQSA 4APQA 4LAQH 2QV2A 3O6LL 5BRZE 3AGVA 1IT9L 3MCLH 5SX4I 2D4DA 4YHZL 5FO9B 5FYKD 4EI5D 1MQKH 2VWEE 1MLBB 1QKZH 1QPPA 1TDQA 4IRSA 5KSAB 1BZ7A 2XKNB 3FJTA 4LSPL 5MP6L 3CD4A 2IQAA 3U0WH 2NTSP 3WE6A 1DQJB 2IAMB 3MJ8B 5DZOA 1JFQH 3TPUB 2IANE 2VR4A 4P5KA 3OX8B 1OAQH 1IGTB 3GSNL 5C0IB 4HUWA 3C08H 4M43H 3MLRL 4QRRA 4M1GH 3SKOA 4NKMA 1UWEL 4AEHL 5D72H 4RX4D 3DMMB 1LE5B 3NFSH 3K4ZA 3T08A 4DAGL 1XFPA 1I9JL 5E9DE 3PWPA 2YPLE 3IDGB 1G0DA 1RIUL 4L4TE 4OTXH 4OZGB 4OZFB 5EZOH 3KHOA 1OF2B 3NGBC 2VR9A 4YO0B 3RWEB 3WV0A 2AEWA 2OK0L 2HJFA 4O2EA 1NLBH 2A0LC 2AJZA 3PQYB 3RRQA 2XZAH 3QIWC 3GKWH 3SKJL 5I15H 3RWGA 4LLMA 3RWHA 1RUQL 4ODSL 4NYLB 3PWLA 1N0XH 1PG7L 2MKLC 3AS1A 1IAII 5JUEH 2HT4D 4OGYL 4MXVF 5T33H 2DM4A 3ZDYE 3FL7A 1EEYA 5D5ME 1DVFB 4FXKA 4QO1A 3WIIL 5FXCH 5BS0B 2V5MA 5K9JL 4LDLB 3OKNB 4MVBD 5CZXD 3BPLB 5DRXA 4P23B 2MTPA 3RTQD 1IEHA 3U4AA 1Y6MR 5IMLB 1QSEA 1HXYB 4PJHA 1IGIH 4QNPE 1YECL 4G8GA 1H0DB 2YMXH 1INEH 3QHFL 2JB5H 4K7PH 5B3NA 2V7HB 5HDLA 1MJUH 5C09E 1JF5A 1YQVL 4M62L 2OI9C 1BM3L 2AI0H 4ZTOH 12E8H 2G75A 3QDGE 3H3KA 3THMH 3WEXA 4Z8FL 1DUZB 5I1DB 3X17A 4OZIA 2ZUQC 2ZSVA 3TO2B 1NMAL 3QUXA 1W0YT 5DUPH 2K3TA 2E9JA 4UV7L 5HHVH 4R7NB 4XWOD 4YHPB 4Z0BL 1U8NA 3BUTA 3EAKA 2XA3A 3QISA 1S3KH 4Z78A 1HHGA 3S3SA 1QRNA 1A22B 1KPVB 2B4CH 3X14B 5D1ZA 1NANI 1JNJA 3UO1L 4TSBH 3MRFA 1BX2B 4UU9A 8FABB 3ZDXE 1CFNB 4JJ5B 1QQDA 2ZUUA 2AJUH 3M8OH 4EZMA 5JXAL 2NR6C 2OLDA 3DX6B 4YHZH 4PJHF 1XGUA 1Y0LB 4NO2A 1MCKA 3CZJA 1AR1C 3VXUA 4NKDA 5DJAA 4QHNB 5K9OA 4XI5C 5ISZB 3UBXB 5MP6H 2AJYL 3FN3A 5FK9A 3EYQC 5F8RC 3W5NA 5EBLB 4XP1L 5BVJA 2R9HD 4MA1B 1N7ML 2VDLL 4KK9C 4DKFL 5HJ3A 3LQAC 2YD7A 3DX7A 4HKXA 4K9EH 4XBEL 2VN7A 2LABA 1S5HA 3HZKA 3QCTH 4YFDB 1RJZA 1XIWA 3HMXA 4PJIB 4AEHH 1MJ8L 1Z2KA 3L3KB 3OKMB 2VZ1A 3OF6A 2X70B 1HNFA 3BSZL 1KFAH 1ZEAH 3L7FA 1RIUH 4D8PA 4TN9A 4PJ5E 5A3IC 1TQBC 4OZGE 4P9HL 4TUOA 1AR2A 1JNHB 3TA3C 5IHLB 5GZNC 1XGRB 4CVWA 3IRZA 3EOAB 4M93B 3PQYE 3TZVC 1FCCA 2YD6A 4KRLB 5L8JB 3S37H 3OKEA 4ODSH 1LO4L 1Z9OA 3GMMA 4W81A 3SCMD 1FFOB 2X10A 3QUYB 4HLZH 4UI2A 3WFBL 4IOFD 2X4OB 3GSXB 3ARGA 3LS5L 4KK8D 1IGJB 3O3BA 1U8PB 5BS0E 1F6FB 3A67H 4RISL 2X1WL 2QADD 4FABL 3MTRA 1EGJA 3QHFH 5M94B 1TLKA 1WFOA 4HXBH 2VITA 1GGYA 1YQVH 2A9MH 1I9RH 1BM3H 2XN9B 3IDUA 4L5FL 4YBLC 4LDEB 1WZMA 2NY0C 3B9AA 3MREA 2QLVB 4LEXL 2VISA 1RZKC 2EEBA 3GJFB 5FYKU 4BFIA 4UV7H 4NPYB 5CEZH 1GL4B 4YDLB 3SDXB 3IB4A 1T0PB 4HZLA 4Z0BH 4PRPD 3HZMA 2C26A 2VABA 3VXPA 4DGVH 3VXTB 5CJXC 5C07B 1BQHA 4P46A 3GBNH 1NAMA 5HVHB 4XP5L 5IWLA 4F3FB 1P84J 3T1FB 5D7IE 3QFJD 4D0BB 1W0VA 4JO3H 1OP3K 5GGSA 1P1ZB 5I66B 5H37G 1T22B 3VRIA 2FZ3A 3BP6B 3QJHB 2W59A 4UQ3B 3LD8B 2FIKA 4OQTL 4XX1E 5IBLC 3QQ9C 2DLHA 1INDL 5C0GB 1PG7X 5T1LA 4PLKC 3HCVA 1LO2L 2IPKB 2IGFL 3O4LB 4ZFOB 1U8OB 1KB5H 1S5IH 5FYJL 3SE3C 2LAGB 1JCKA 4L9DA 5DJ0A 4XP1H 4MB3A 1HOCA 2VDLH 3FFDA 4XCNA 5TDPB 4DKFH 4NJ9H 1T5XB 4UT9L 3B43A 4XC3L 5IW1B 3AM8C 2H8PB 4DN4L 1OAUH 2AXFA 4X99A 4M9OA 3CMOL 1YYLH 1K2DA 5I8EB 1ZGLP 1KEMH 4N0FB 3QUZD 1MHPL 1KELL 1T3FB 3MLZH 3GM8A 5CZKA 3NCEB 1MFDH 3KXFA 1Z3GL 1R3KA 2VKWA 5B8CB 4P9HH 1FH5H 3SPVA 2JJSC 5JA9A 2BJMH 1YDPA 1CE6A 1Y18A 4TNWK 1YPZA 5DRWA 5CD3A 4YHOH 5ACZB 1UB5A 3EGSA 3FAWA 5EIIB 2FECL 5SWZB 4ELMB 1NKRA 1CZ8H 1F58L 1JN6A 2R1XA 3NH7L 3MJ9L 5D5MA 4X7TA 4PJBA 3TCLA 4X6BA 4P4RA 1T7YA 4YWGL 4RISH 4EI5B 3O8XD 2KZWA 3CX2A 3FO9B 5C1MB 4FQLL 5IEKB 2P5WD 5DGRA 2F58L 3MV7D 5DEZA 3PL6C 5I16B 1U8MA 2XN9E 4NRYB 5SV3A 4O5LL 1IGFL 1R3IH 5E4EC 1FNEB 4QXWA 2AQ2A 1NCTA 1KCVL 4J3VA 3O3EB 3U1SH 4Z77A 3UAJC 1S9KC 5D96B 3F7RA 1HYSC 3EOYG 5DQJB 3SDXE 1RMFH 1YEHL 2BHZA 5TPWL 3P4MA 2YSSB 5I1AA 3PNWB 3ZDYF 3C60D 4XP5H 5IF0B 5D5MF 3UROR 4QWWD 1BVLB 4N5UA 2ORBH 2WLYA 3OAZK 4WWKD 4C59B 1I8KB 5LQBH 2Z8VC 4QNPF 1P5UA 3VW3L 4L29B 1KLGA 4OQTH 3DBXB 5F88B 3MRJB 2V7NB 3Q3GA 4KPHH 4ODHL 3V6ZB 3MODL 5C71A 4IHOB 5E99H 1LO2H 3A0OA 2IGFH 3BPOC 3O9WD 5IMOB 1J88A 3RNKA 3TN0A 1HI6B 3GRWH 3DGCR 2B1AL 3ZKQD 1M6OA 1JMZA 1G7PB 1SY6A 1TJHH 1ED3A 2BVUA 4MA3A 5IB4A 2BHUA 5JDSA 3V0AC 5LWYL 1HXMB 3GJEA 2VXVH 1CD1B 1DCLA 2DTML 3JTTA 3RTQB 2GT9B 4RRPG 1ZHKB 2A6DA 2F54A 1EO8L 3E2HB 3EJJX 1SEBA 1MHPH 1KELH 4LOUD 4I2XE 4KXZI 4PJ5A 3F12B 1DZBA 3T0ED 4S10A 5FYLL 5JA8B 3L7EA 2IADA 2RQ8A 2B1HH 4L8SC 3EDEA 1L6ZA 3BN9D 1TTUA 3FFCD 5CWSA 5D7LD 1BZ9A 1EFQA 3HNTL 1CYGA 2VSDA 5BMFH 1EFXA 4N8PA 3P0YL 2I5YL 1CQKA 1F58H 3C8KA 4U7MA 5SWZE 3NH7H 3MJ9H 4LCCA 1HSBA 3QB7C 2GHWB 3BDBA 4LBEB 5C3TA 1WAAA 4YWGH 4GAYB 5F71A 3S6CA 5GGRB 1BREA 3SDDA 1E6JL 1YY9C 1Q0YL 1VEMA 4ZXBA 5IFAL 5AZ2H 5J1AA 3VXSA 1I1YA 3CH8A 5L88L 4XCFL 2HLFC 1NFDB 4LVOC 5D2NB 4U0QB 4LNRA 3MRNB 1KJVA 1WGOA 4JZJB 4O5LH 5JOPD 1IGFH 4OZGF 4KDWA 1OP5H 5EG6C 4GRLD 1KCVH 3PHOA 3B3IA 3E8UH 3HLAA 1VB9A 5T3XL 1IC7H 1F4WL 3U4BL 1N6UA 2NNAA 2O5YL 3BKJL 3KPSD 1YEHH 4WTZG 3HE7D 3BUYB 4G7YH 3N9GH 1GAFH 4X5LA 3AS3A 5FCSH 1FFRA 1G7LA 4NUGL 4YXKL 5I6XB 5CEZD 3MRGA 2Y36H 4HULB 3WYRA 4OFYD 3KPQB 4KK6D 3VW3H 1N3NB 3GMQB 1JE6A 3VDBA 3H3PH 1T1WB 2D7NA 1U8LB 1XGYH 4ZD3L 2X5PA 5HDBF 1FVCB 2Z8WC 4U1LB 1P9MA 1KTLA 1L6XA 5IESH 3QULA 3CIQA 1K4DB 3SCMB 3QXAB 1A14L 1EV2E 2B1AH 2DIJA 4AJ0A 1QSFA 1DFBL 3D0VB 4W4OC 5J13B 5LWYH 2J12B 1MUJB 2DTMH 5D7IF 4I3RL 2LE9A 2QADB 2NY6C 1ZVSA 2BP3A 1AHWA 3VFVB 1EO8H 1WWCA 1MQ8A 2CK0L 2R4RL 1T4KB 5L7XL 5DSCA 4NQXB 1MCPL 4DGYH 5ENWB 3IFLL 4JGUA 1Z0MA 3NN8B 3RJDA 1CD0A 2FR4A 3F58H 1R3LB 5HYJD 2B2XL 1TVDA 1MHEB 1BGXL 3H9SD 2A6IA 3MACH 1XR8A 1UVQA 2HFEB 4DK6A 5SWSD 1RZKL 3RWJB 4ZFFA 5D71L 4NRZA 3GEWB 4HHAB 1M71B 3L5XH 3P0YH 1U3HC 5MEOB 4POZC 3NIDE 3QFJB 2DM3A 5CJOL 4I0PD 3G04A 4UB0H 3CFCL 2FGWL 1JBJA 1OT2A 2H6PA 5I1HL 4PP2A 3MNVB 3BP5B 4D9RE 3RZWA 1NFKA 3HMWL 5EPMB 2H2PD 1E6OL 1Q0YH 5IFAH 2FYYA 1LDSA 1CG9A 1LE9B 3BQUA 1NFDE 2X42A 4PR5A 1KB9J 3DXAD 4M4PA 1MAJA 3AC0A 4ZDHA 3D0LB 5CSZB 4CN1A 3E6HA 3SGKC 4OIIH 2AJSH 5L2KA 1F4WH 4NN5C 3TJHD 3MO1A 2O5YH 5LXGL 1U8HA 1LO3H 1F90L 4P3WA 3LQAH 5F7UA 4WHTB 1QLRB 1H3WM 5CGYC 2DLFL 4YXKH 2CDGB 4M7ZB 4R8WL 4PRDB 3QUZB 5FKAA 4TPRL 3O6FA 2BSED 3QG7L 3STLA 2BSRA 2VDQH 1Z9LA 4ZD3H 3V2AR 2J6EA 3PP3K 5EU6A 4OQ1A 3QEHA 1ZSDB 3RWCB 5J8OA 3B6SB 3MRCA 5CBEA 2PXYD 3MV9A 1A6AB 1B0GB 2EXWD 2HTLD 2IEPA 1A14H 3KYOA 3O3AB 3KLSA 1ZANL 3SDXF 4WV1C 2X4QA 4RMSA 5KW9L 4Y2DD 4P3CH 2QQKH 5A40E 3U48A 3RBGA 3O8XB 4RFEB 1ZMYA 1PYWB 2P5WB 2Y6SD 3BXNB 1ORQB 2PTUA 4GW5A 1R0AL 3MV7B 1OGAD 3CX5J 5EC1B 3B5TA 1DEEB 2I24N 3NCYP 2HYMA 2QQQA 1MCPH 4LPUA 3CK0H 4YQXH 5I71C 1KG0B 4DEPC 1YEDA 2J5LC 4GG8B 5CEYB 1FNGA 2FJFB 2B2XH 3BP4B 3K0WA 2HJLA 5IBUG 1BGXH 5M7QA 3F8UB 4P5MB 2FB4L 1RZKH 4YHYC 1UJTA 2R2HB 4MDIB 5EZLA 5FDWA 5GRXG 1F8TL 5D71H 2O61A 5ALBL 3VWJD 4G8FB 4R97B 3DGGA 2I9TB 3C60B 4HFWB 2GFBB 3QH3B 2ITDB 1ZLUH 4GAJL 5CJOH 1R3JB 4NHUA 3BGFB 4BA8A 1FSKC 5C0EA 2FGWH 4YHLL 3QFJE 1MRDL 4WWKB 5FO8A 5I1HH 1FZKB 4AT6A 4OD3L 4YR6A 1IEAB 4NO3A 3LEYL 1E6OH 3D6GA 4P4KD 1D5MB 2OP4H 3TO4A 4P99A 2Q87A 2EDDA 4KZEL 4KHXH 5L9DL 3WUWB 5L8LB 1T89C 4L1DA 1K6QH 1FL5A 3AXLA 3O9WB 4HUVA 4HUUA 3HPJB 1JGEA 4QT5A 4D0DA 1U2CA 4OUUA 1DL7L 2H2SC 5I74B 4GBXC 3OMZA 1EUTA 5ICYB 5LXGH 2GJZA 1DE4B 2BSSA 3JWOC 1D5ZA 1F90H 4M8QA 4I18A 3BZDA 3IDYB 4UDUA 3STZB 2D7MA 2DLFH 3FKUS 4IOIA 4OCMC 3RP1A 4YGVA 4ONFL 4NC1C 3ZT7A 4TPRH 3T0XA 4N0RA 1F11B 5F1IA 1VGKB 1LDPH 4HKJB 1A2YB 1EEZB 1JV5A 2EH7H 1JZ6A 3HUJA 4XTRC 4WU5A 3MV8D 4WU7B 2YC1A 3T0EB 3TT3L 5KVDH 2EYRB 4GRWF 4I77H 3NZHH 3OGOE 4JZNB 4WI5A 2FJGB 3FFCB 4PJ9A 5BXFB 5GJSH 4JFPB 5D7LB 4Y4KC 1DQLL 3D18A 1HYRC 4X5WB 5I1CH 4G43A 1FFNA 4HIEB 4GSDH 1A1OB 3MRLB 4G6AD 1RURL 3QEQD 4F80A 3Q5YA 3UX9B 2ZCHL 4MGXA 4MD0B 3WBDA 4YK4C 3I6LE 4JM2C 2EDKA 4FQ2L 5C8JA 3MLTB 3Q6FB 2K7QA 2A0LD 2A6KA 4K07A 4JAMB 1D5IL 3QIWD 3MOAL 1MI5D 3GSUA 3S96A 3MV7E 2D31A 2WP3T 2VQTA 4I4WB 4OGZA 2ERJB 2R23B 4X7FC 4K3EH 2BOCB 4H25B 4GRLB 4MB4A 5KS9E 4U05A 5ADPL 1X5AA 1T1ZB 1RUML 3QDMA 4ZS7L 3CXDL 1FAIL 4UIKH 1D5BA 4M1DL 3EYFA 3KPSB 2NTFB 4M6AA 2UWEA 3HE7B 1F8TH 4XGZB 5ALBH 1IGYA 5DQ9B 1WFTA 1NGXA 3P77A 4UZGA 4GAJH 3TIDB 1QR1B 1A0QL 1Q1JL 4YHLH 3RWFB 3FQRB 2WW8A 1MRDH 4CGTA 4X7DC 4O2FB 4XCYB 3QA3A 3U0PB 5SX5H 1OD7A 1RJLA 1M7IA 5EBWB 1M7DB 3BWAB 3LEYH 4R0LC 3WNNA 1GH7A 1X4YA 3ARUA 3VFUA 5L9DH 3O2DA 4CVUA 4NJAH 3CVHA 1FYHB 3RI5F 2RB8A 5EO0B 3S3PA 1KEGH 2KPNA 1KN4L 4YDKL 1CLYH 5DVMA 3MLYH 2IALA 5IK3A 5A16A 1CN4A 2FWOB 4Y4FA 2Z9TA 5F7WC 1DL7H 3QUMA 2H3NB 3VFOA 1XF2B 5IMKB 3GHBL 4F58L 4GKSA 2NR6D 3EUUA 1OAKH 4NZDA 4C56A 5I2IA 1BEYH 1AR1D 2BX5A 1KB5B 3BIBX 2Y25A 2BNRD 3NIDF 3W9EA 3BGAA 4Z0XA 1PSKH 4XI5D 2C1OB 4HGWB 4OZFG 5IKCA 3CC5A 3BMVA 2WIIA 4ZUUB 4JHWL 4S1QH 3U30C 4ONFH 3EYQD 3RKPA 4MZ2A 3BEVB 3G5VB 3UPRA 3GNML 1U3ZA 1EEQA 4H0HB 3T8XB 1GGCH 3VFMB 4BZ2L 5EWIH 5I73B 1EHNA 3SGDH 3TT3H 3CFJA 5HYJB 5KG9B 3NCYS 3JXAA 4WNQB 1BWWA 1NFDF 4WUUE 2ZCKL 3H9SB 2GW5A 1MY7A 4IIQA 4O51A 5SWSB 4Q97A 3FFCE 3CDGA 3GSVA 1M1SA 5D7LE 5I0ZA 3MLSL 4JGJA 5TH2B 4D2NA 5HHMD 2RAMA 3SE4A 5F7YC 4CW1B 1JHLH 2BNQE 1JGUL 3F7VA 2OJEA 4HIIB 4PRHD 4PY8I 3LDBC 4LKXB 1ZHLA 4I0PB 5JIKA 1MFBH 1RUPH 2Y5TA 1Q38A 5KVEH 1HCVA 1QLFB 5GGSY 3U4EA 4TSAL 4XVSH 3UEZA 3OR6A 4KGJA 4P5TA 4FQ2H 4PJ8A 4MNQA 3ALXA 4LQFL 4UQ2B 1B90A 4OFDA 1D5IH 4XP6L 4X80L 2ICWJ 3KYKL 4LCIL 3D2UD 1MY5A 4HFUH 5E8OB 4ACPA 1RZIA 4FP8L 2DQEL 2C3VA 5EFIA 3REVA 4HCRH 1KLUB 3RFZC 2GJ6D 5JOPE 2VZOA 3ZHDA 5ADPH 4KI5D 2YS4A 1VFAA 1RUMH 1QFUH 1O7SA 1UB6B 3MC0A 4DW2L 2ZOKA 2MKWA 1IGML 2CRMA 3KPSE 1VGEH 5IBTL 2A2QT 4X7CC 1N64L 3OQ3B 3IJSA 1M4KA 2R1YA 1Q1JH 1JMXA 2NY0D 4ZUWA 4G9DA 5CEZE 3TNNA 2ESVA 2MQ3A 4OKVA 4RZCA 3UBXG 5GZOC 2OL3A 1HHIB 3RVWD 2HN7B 5E8NA 3W81A 4KRPC 3BPNC 1ZAGA 3QO0A 4FZ8L 5KSVA 1KN4H 2QEJA 1A1MA 5L8KB 1A7PL 3FCTA 2BVOB 5DRZA 4TOYH 2PXYB 1MFAL 2BVQB 3GHBH 3I02B 5DEFB 2W92A 5FF6B 1ZGLM 2CK2A 2Q3ZA 1OW0A 4Y2DB 1QFOA 1RU9H 3VFTA 5GS1C 5IBLD 5F3HA 1PY9A 3QQ9D 4M61A 2FDBP 4OJFL 3TFKC 1TZGL 3VFNB 4PLKD 2ADIB 1OGAB 3HPLB 4GW4A 4XAWL 5T1KA 1KB9K 1A9BA 4WRLA 3CCHA 1Q0XL 5CD5D 3GNMH 2O5ZL 4MX7A 4WJ5A 1JZ8A 5EORH 1P2CA 5DJ2B 4BZ2H 5ICZA 1RI8A 3EYSL 4OZ4B 4JRXA 2ZCKH 1JGLL 4NC0B 4UINH 1YQ2A 3H9SE 4Z7VA 1ZGLA 1KIRA 3VWJB 5F21B 1XEDA 3BPCA 3FQTB 1NGPL 3LIZL 3MBEC 3GZKA 3V4PL 3MA7A 1C8PA 5IVXE 3IFNH 1J1OH 1I9IH 4HH9A 5JHDA 3DUHA 2YKLH 3G5YA 5IB5A 5H35B 4P4KB 1WZ1L 1DANT 4LQFH 2D7TL 4M02A 2E9IA 3TBTA 1NSNL 2G60L 3KYKH 5ANMB 4D9LH 3H9ZA 3P9WB 4LVNC 2DQEH 5B38A 5LKNA 4XPHL 3UZEA 1XF1A 1LO0L 3D25B 2GCYA 4JQXC 2V2TA 5TE4H 4PUBL 4ZTPL 1PQZB 5I1IH 1FE8H 4KTDH 4MQ7A 3BIAX 3KVQA 4Y4HC 1NCCL 4MQTB 2X4PB 1I7RA 4HIJB 4JR9L 3TYFA 1AO7A 4J3XA 1IGMH 2P24B 1JGDB 4GG6A 3CZFA 2QSTA 3PWVA 1EHLL 5IBTH 4NFDA 1JYVA 4EI6B 2XTJC 4XMLH 2QR0A 5T3ZL 4HKBA 3JWOL 1N4XL 2NY2C 2YD2A 2YUWA 3VXRE 2EEDA 5EBMB 5I1EL 4JFFE 3ECBA 4PLJC 3QFDA 2PKDA 1RZGB 4H5SB 3BIKB 1B3JA 3O6KH 4I48A 5B39A 3MV8B 3P9LB 3GSWB 5A2JH 1HYSD 4MMXC 4NHCL 2R0ZL 1F3DJ 3TGXA 3MR9B 2BC4B 4XCEB 1VPOL 2WK2A 4GRMA 3UC0H 4IJ3C 5KS9F 3T0VA 3GSRB 4LFHD 3HNVH 2PO6C 1N5AA 4CMMA 3H6JA 2RCSL 1C5DA 4AL8L 2XXMB 4AIZA 4OCWH 3L3GB 3O11B 3QEQB 2VXTH 1BJMA 4GG6F 3DV6A 5ID1A 5D7KE 4FQHB 4Z76B 3UJIL 1L7IH 3AVEA 5ESAA 1H15A 3GK8H 4M4RA 1WEJL 1P7QA 2OSLA 3NA4A 3QIWB 1MI5B 4YHIA 3KJ4C 4MD5B 2ED7A 4XAWH 3QZWB 1OGAE 3N1PC 3QAZB 1X5XA 2NX5A 3JV6B 5EC2A 2O5ZH 3LH2L 2PCPA 4K94H 3RUGB 3DVGB 3QJFA 4NBYB 1JGLH 1NC2A 3L95B 2P8MB 5BW7A 4J8RB 2CDEA 3GIZL 4CU7A 1PJ9A 1TPXC 2QKIA 4BQCA 5J6GB 4Y5YB 1MLCA 1TTFA 2YBRB 5HI3D 4XMKL 4KJWD 1AFVH 3DHJA 1NCBL 2Y9RT 3VFPB 1FIGH 4TYUA 5FGSA 3VJ6A 3HC3L 2VAAA 4OZHA 1AD9B 2ZUQB 2CUHA 5TQ0H 4WW1A 5MEQB 4U1JB 4KFZC 4N8CL 5C6TL 1OTSD 4KTYA 5C0DB 2JK5A 2DWDB 2G60H 2X4RB 3B9EA 1UXSA 4LNVA 5C70A 5F6HI 5I8OH 5ANME 3DX8A 3D39E 5DUBB 3G6JA 4C83A 4G42B 1S7SB 1RFDL 4JDVB 4F7PB 1A7NH 4QHLA 4XVJH 1Q9OB 5F7EL 4PUBH 4ZTPH 1F4AA 3K2UL 2E7CA 2XWBB 3U9UA 3DX9A 1C16A 1FJ1B 1KENH 3V6OC 3ARDC 3OXRA 1XF5B 1DQQA 1YY9D 2UYLB 3WIHL 5JZ7C 1JHKH 3UTOA 2YEZB 2BNRB 1BFSA 3ZTJG 3GBML 3EYOB 4WO4C 2DQTL 5T3ZH 4WFEE 3WD5H 3JWOH 4OZHF 1DEDA 3V7AE 1XH3B 3KJ6L 3LS4H 1QSZA 5DHVA 2YD3A 4LLDB 3CUPA 4WW2A 3MV8E 3GJFK 5HPMB 2VDPH 3V5DA 4LHUA 1QO3B 4ZS6C 1KC5H 3L3DB 1KJMA 3QBTB 3QPQC 5F6IB 4KTEL 3OHXA 4L9LC 4R7DA 2G5RA 2BRQA 5HHMB 3BO8A 1U3JA 3T2QA 5CLTA 1LEKA 5DD6B 1CFTA 4PRHB 3BKCL 5HY9A 3H7LA 4AL8H 2DLTA 43C9B 3VXOB 2XA8L 3FHQA 3RX5A 1YUHA 2PYED 3IFOA 3QEQE 4W4NA 1TQBB 1DN0B 4X9GA 1L0YA 3QHTC 2ATKB 1WEJH 4FTVA 3P4LA 5IVZB 1Q9LA 4K3GA 1AGCB 4OF0A 3D2UB 4LCWD 1OAXL 2CR6A 5EDXA 2J8UB 1N8ZB 5JXEC 2RIKA 1J18A 3OGCA 2YR3A 2GJ6B 3QUXC 3ILPA 2CRYA 3MQIA 1OP3H 4OLYH 3TLRA 1IKNA 3RUGE 3WFEH 4LCYB 2FLRT 4NC2B 5IMMB 4JE4B 5FECA 2UZYB 1NFIB 4POUB 3FB6B 3M07A 4ZPTB 2EDXA 1AGEA 2NY6D 1NLDL 5D1XA 4ZMAT 5FGBA 4PBVC 5D93C 3FTGA 3KPOA 1GXEA 3LKNA 1I7ZA 5ID0B 4YBLB 3EJYD 4QHKJ 2PR4H 1FO0L 2NY0B 2PW2A 2R0KL 1MH5A 4C58B 2HT3D 2EO9A 4PJEA 4JREB 3F7YA 4POYA 4GQPH 4BQ6A 3BW9A 5HGBB 1JYNA 4LLQA 4K23L 4Y5XC 4P57A 3RL1A 1MIEH 3GMPA 1URLA 3EDFA 4MSWB 4B5EA 4POZD 1QFWM 7FABL 1NQBA 5ICXA 3AY4A 3GMRB 5F7EH 4YHMH 2NLJA 3CPLA 5C0CA 1OVZA 5F9AC 3P30L 1E27A 3I50L 4JHAL 4IS6B 3SJVE 3WIHH 5DHXB 1ZT1A 3MZGB 3DI2B 4QXUH 4ZSOA 5E8EA 3MUHL 2YK1H 4P0DA 5IVXF 5IQ9A 2B0SL 5K9QI 4UDTA 1CXLA 4MWFA 1MNUL 5D2LB 3NIFE 4N68A 4JFFA 4K3HA 1Z9SA 2NY4C 4X6CB 1WSST 3MCKB 2ZOLB 3NTCL 4RA3A 1H3PL 5E2UH 2C4FU 1CDUA 1FRGL 5DJYA 1MF2H 4ZFZB 5C0BA 4XAKD 5K59E 4KRNA 3F7PC 3ALWA 3MRKB 1EBPA 1QYGL 1N5YL 3VGAC 3LOWA 5TDOB 1I1AC 1JUFA 1MCIA 4GH7B 1FV1B 5CGYD 5HHME 3P9MB 3BKCH 3HHRB 4F33B 4WCYH 2QSCL 5TE6L 3VRJB 5LBSL 2XA8H 2ARJQ 5E8PA 5ERWA 5E7BA 2VDRH 5F3BB 2E7LC 3B9DA 5GRJL 4XNYL 4XPAH 4GUPB 3FT2A 4M48H 4MD4B 3FRPA 4F2MB 3S7GA 5CP7A 1KIQA 2CKBA 2V2XA 4HK0B 5T1DL 3U2SB 1OAXH 4NGHH 1N2RA 1JWSA 2W1NA 2VKXA 1G6RH 5CJ5A 1MHCB 2J8UE 2YA0A 1T7VA 4E41A 3HI5L 3B2VL 2GJ6E 3BGMB 4Q0XL 1YEJL 4NO0D 1QFPA 4MA8H 2DKSA 5FHBH 2EDJA 4KI5E 4MCYA 4HUKB 1JTOA 2A1WH 2QBWA 3SDAC 1U41A 1AXTH 3V52L 3RBSA 5C08D 1NLDH 3V8OA 4PG2A 3RVUC 3PV7A 1DSFH 1JPSH 5HGDA 2XT1B 5FO9A 4HS3B 3NCMA 4XC1L 1MLBA 2R0KH 3WXVL 2EE9A 4PRNA 4LHJB 4KVCH 3RI5K 4HD9A 3I9GH 2VWEC 3ARBC 1P7KA 2VLKD 4J1UA 4L4VE 1MPAL 4K23H 3REWB 4NQEE 3MJ8A 1HILB 2ZZUT 2EDNA 3HKFA 3MRRB 4ODWB 2MJWA 7FABH 3DYPA 2FD6L 3OX8A 1IGTA 3MBXL 3HI1A 25C8L 4P2OA 1JZ3A 2LVCA 4I3GA 3PDDA 2B39A 1NDGB 4MXWL 1J10A 5FHAH 1I3GL 3BFOA 4NQCA 2NW3A 3DMMA 1FFPB 4EIZC 1PX3A 3P73A 4IRJC 3PGFH 1MFCL 1MCHA 3HE6C 4N1CA 1ZXQA 5TDNB 5CUSH 3VD3A 1CGXA 3BPOB 2B0SH 1G1YA 3CAFA 2XKSA 4XPBH 5E94B 4JRYE 3UTZB 1MNUH 2XRAH 4XBGB 1OF2A 5E1AB 3BT2H 5DD1H 3T0BA 1D9KC 3B5GA 3V0WL 3OKDB 1CXEA 3QR2A 3NTCH 1E4WL 2WBJC 4QRSA 4GBXD 4X6CE 1RIVL 1BIIA 1CFQB 4KQ4L 3H9HA 1I1FB 3A6BL 4RIRA 5T3ZD 5E6ID 4MXQC 2Z93A 4QHMA 4OLZH 1NGWA 3ARFC 1LK3H 5DEGA 1XF4A 3P11H 1QYGH 4PB0L 5T5NF 2ZP0T 5I1EH 1DVFA 1ADQH 4EVNA 3MFFB 3HZYB 3LPFA 1WJ3A 1QBAA 2QSCH 3OKNA 1NJ9B 5CP3A 4P23A 5LBSH 5TE6H 5E24E 5D7JA 5IMLA 1RHHA 3OSKA 4PYHA 1HWHB 4LASL 2J88H 3QNXB 4XTRD 1DDHB 4XNYH 4XPTH 2CJUL 1OM3H 2FX8L 1HHKA 3BAEH 4IBLT 3SE8L 2BNUB 2CLZB 1JYXA 3K7UA 1DUZA 5IG7B 5I1DA 1I8LC 3I75A 3C09C 1HH9B 4K71C 4R7NA 4YHPA 2WLZA 1JPGA 3ZYIA 4Q0XH 3OG6B 5I75C 4ODUA 5FCUL 1MWAH 5GGVH 5HXMA 5HHOE 1PZ5A 2HTKD 4ISVB 2MCPL 1IZJA 4PRAA 5JPMB 3AU1B 3GMOB 1EXUA 5BQ7A 4X6FB 4OI9A 3S34H 2GTWB 3L5WB 5IV2B 3CLEH 3GIVB 3FO1B 2DJ4A 4F9LA 3C5JB 2Q7YB 5BOZG 1AI1H 4XC1H 3WXVH 3KPMA 4LAJH 4OGAC 5HYQB 4QHNA 4UV4H 3WUWG 3GMLA 5JW5A 3BDXA 2JIXD 1E4XI 1AGBB 3UBXA 2C5DC 3NAAH 1YJDC 5KSAC 4F8TA 2EICA 3QG6A 2F74B 2NW2B 3CDCA 1HH6A 5DC0A 4I8DA 1UA6H 4HS6B 1IAOA 2XY2A 3W2DL 1TETL 1VACB 2FD6H 4JN1L 3RUGF 1AP2B 4X7SL 2IAMC 3ZSTA 2N4IA 3VE0A 1DBJL 1V5JA 3CFDB 1B0WA 1F4XH 4PJIA 3ZKNC 1ZK9A 1ND0B 2PYEB 4U6VH 3IF1B 4WFGE 3L3KA 5H94B 3QXDB 4PGDB 1DLHA 1TCRA 4TVPL 2KZ1B 3MGTA 4BQ8A 1B4RA 2ICEB 3JUZA 5ESVA 1OTTC 2PYFB 4LCWB 4RWHA 1KNOB 4ZUVB 2KH2B 4FQXA 3SKNB 3M17A 3RZCD 1E4WH 2R0WH 1YNLL 3EOAA 4CADB 3AS0A 3I3BA 3VXMD 4OLVH 1IAIM 5HGHB 3K81A 1X4XA 5IFHL 5DVNA 3A6OA 1FFOA 1U91B 2NY6B 4L8BB 4PB0H 5BCAA 3PWUB 1U8PA 3HB3C 3NACL 2X44D 2DB8A 1FVEB 3SO5A 2FEEI 4HLZG 4PJGB 3D85A 3QO1A 4O02H 5I18L 3TPKA 1D6EB 4DKDC 1O5DT 1SJEA 5CKAA 2NXZD 3NIFF 1WC7B 3NZ8B 4JPIB 4QOKD 3KS0J 3O0RL 1EX0A 1ES0B 1NCAH 2D0HA 4G7VH 4XB8A 4GO6B 1BFOB 1YNTB 4MAUL 2ADGA 2EO1A 4Z7WA 1KJ3L 4F7CA 5FCUH 3FHAA 5HGAB 1EVUA 1UM6H 5K59F 2MCPH 4H8WH 4Q9CA 3PF2A 1ZVHA 5E0QA 2Z8RA 3T1FA 3QI9C 5GGTA 2YPKB 3VH8B 2W60B 4S1DD 2KQMA 4JFXB 3EFDH 2AJ3A 2N1KA 1TNMA 5D6DA 2E6JA 5DO2D 2NY3D 1AY1H 2WQRA 5C0GA 5JLZA 1ORSB 4JVPA 1IQDB 1YEGL 3O4LA 3RA7L 1REIA 4WY7H 1YEFL 3PG2A 2J8UF 1YA5A 5TDPA 3QEGL 2RFXB 5E95B 3JBG7 4X7SH 3L6FA 2DQHL 4KI5F 1VENA 1J0ZA 2H8PA 1JP5A 2B5IB 3IJYB 1ITCA 3W82A 2VL4A 3NFPB 2Q8AL 5HD8C 1BD2E 1L9NA 1HQRB 1MOEA 2DS4A 5DLML 3EDDA 1DR9A 1T21B 3QIUD 5CILL 2XFXB 1FL3A 2FO4B 5B8CA 3VCLA 4MQXC 4LCWE 4X6EA 4XB7A 1MCRA 1PKQA 4Q74A 3FO2B 5DJXB 2CPCA 1YNLH 3DSFH 4WV1B 1RY7B 4NO0B 1NAKL 3RL2B 4KHTL 5DR5L 1ZTXH 4OF7A 4X6DB 4ELMA 3TFKD 1NMBH 2Z31A 3CFIC 5C08B 2HVJA