2E6ZA

Solution structure of the second kow motif of human transcription elongation factor spt5
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
GSSGSSGFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation factor SPT5
publication title Solution structure of the second KOW motif of human transcription elongation factor SPT5
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e6zA00
2OTJT 1NZ9A 4X34A 3G6EA 1K9MU 1VQLT 1K73C 3CC7A 2G3RA 3CCVA 3J80E 1SSFA 3I56A 1KQSS 4CRIA 3I55A 3ER0A 3CPFA 1S72T 1KQSA 3CMET 1QVGS 3CD6T 1N8RC 3CCST 1QVGA 1VQ5T 3CC2T 1VQOA 3CCUT 3CCJA 1KD1U 3G4ST 1X6OA 3LH0A 5A2QE 1YJ9A 1YITA 1VQ4A 1NPPA 3KBGA 3CMAT 1UEBA 5DM7R 3G71T 1YBYA 1M90C 1YIJA 2MWPA 1XTDA 3OW2S 1YHQA 4RG2A 2OTLT 1Q81U 2DO3A 2JUFA 1YI2A 5J26A 1VQ7A 1VQMA 3CC4T 1M1KC 3CCQA 3TREA 3CPWS 1YJWT 2MWOA 5FLXE 1Q7YU 1VQ6A 3CCEA 2CKKA 1YJNT 3CPWA 1Q86U 1XNIA 1VQKT 1VQPA 3I55T 2QEXT 1KD1C 5DLQE 1Q82C 1VQNA 4QQDA 1NJIC 3CCMA 2JVVA 2QA4A 1EIFA 1VQ9T 3DB3A 3LGLA 4TVRA 2KDSA 2OTJA 1Q81C 2E70A 1VQLA 3CCRT 2LQ8A 1VQ8A 1K9MC 1QVFA 3PIPA 1S72A 3CXCS 3CMEA 2IG0A 1Q7YC 3CD6A 3CXCA 3G6ET 1VQ5A 3CC2A 3HKSA 3CCUA 1W2BS 3CC7T 3G4SA 3CCVT 2JOYA 1W2BA 3I56T 4ZN1A 2KVQG 1N8RU 3CMAA 3G71A 1K8AU 2L3RA 3P8BB 1BKBA 3DB4A 2EIFA 1VQOT 1JJ2S 2OTLA 3CCJT 2MI6A 5HY6A 5LL6S 3CCLA 1JJ2A 1YJ9T 1KC8U 2LVMA 1YITT 1VQ4T 5J3BA 1IZ6A 3CC4A 3J81E 4ZN3A 1KHIA 1YIJT 1QVFS 2XHCA 5IAYA 2LCLA 1YHQT 1YJWA 1VQ8T 4YTLA 3PIOA 1YJNA 1VQKA 1YI2T 1K73U 1M1KU 2QEXA 1VQ7T 1M1GA 1VQMT 3CCSA 1Q86C 3CCQT 2JNGA 1K8AC 1RL2A 3LGFA 3J7AF 3A5ZB 1Q82U 1VQ6T 1VQ9A 3JAME 3CCET 1VQPT 1NJIU 1VQNT 3DLLA 3CCRA 1KC8C 5IT9E 2E6ZA 1NPRA 3OYYA 3CCMT 2QA4T 1M90U 3CCLT 3OW2A
chains in the Genus database with same CATH superfamily
5IN1A 4M78A 2CP6A 3HHTB 5GAMg 2H8HA 5FU6B 3SWNA 1UGQB 2VASA 1WDXA 2KRNA 3X26B 4FW2A 1UEBA 2DETA 1TWBA 2DK3A 1WHHA 4C0ZA 4RTZA 4M78E 1N27A 3KXTA 1UTIA 3A8OB 4LUDA 3CC4T 3OA6A 1LCKA 3TREA 4JRIA 1GFDA 3CCEA 3OYMA 1UG1A 3VYHB 4F16A 1Q82C 1VQNA 1B34B 2F5KA 4XU3A 3H41A 3M57A 3FIFA 1OU8A 4LE9A 3UWNA 2LT1A 4BUGA 4LD9K 4XTWA 2CP3A 1VQLA 2P4TA 3LX7A 2LCCA 2VKNA 3L2WA 2RQRA 3BDUA 4CC3A 1EZZB 4DBRA 1G5VA 2JTMA 4JRQA 2VXFA 1YWOA 4J9GA 3WVEB 4X1VA 1N8RU 5CVIA 4B9WA 1A0NB 1K8AU 1VQ8Q 4KH0B 3M53A 2K5FA 4QVCA 2LX7A 3OB9A 4LDUA 2HZYA 2XD0A 3OSVA 2AT1B 4XAXB 4AFQC 1HJDA 1UHCA 1TS9A 1K73U 5KYWA 3BY7A 2YWWA 1YNZA 1MGQA 2GQIA 4E7IA 1QVPA 3REAB 1VQ9A 4AFSC 2KYBA 3CCET 1C0MA 1NYFA 2QTXA 2CSQA 1VQNT 1BIBA 3JSCA 4J9HA 1KC8C 2CP2A 1NPRA 3JCMQ 4M75A 2RI2A 1NZ9A 2QI2A 4WTOB 1VQLT 1G3YA 2RHXA 3CC7A 2QTVA 2DTIA 3M54A 1O9SA 1SHGA 3I55A 2XDPA 1HXDA 2O2OA 4DBHA 1TG0A 2K5IA 3Q1JA 3O5ZA 3WVDB 3GP8A 2AHJB 2RO0A 1YJ9A 3EGDB 1UHFA 5GAOr 2QQSA 3EHQA 4M75E 1QVFP 4OB1B 1BI1A 4HCZA 1Q81U 5I2SA 1IXDA 1KJWA 4R0KA 1RI9A 1VQ7A 4OF1A 1YFNA 3A8LB 3M0TA 1CKAA 3CPWS 3SDZA 1ABQA 2W10A 4OMFB 1GL5A 4XU1A 1FMWA 3EG1A 3L1AA 2D8HA 1Q86R 1EIFA 4DBQA 1VQ9T 1K8AR 3QZ9B 4FYYB 4AFUC 4OGCA 2WSEE 2CGHA 3H8ZA 3LYIA 4BD3A 5LJ3j 4HVWA 2O31A 2V8IA 3PIPA 1W1FA 3CC2A 3CC7T 2FL7A 1S1NA 1K73R 3JB9G 2BKDN 3S3OA 4OMPA 1DJ7B 1YN8A 2C0IA 4J9IA 5LL6S 1YJ9T 3OYKA 3RERA 2EYYA 4JPBW 1KQ1A 1U1SA 3H0IA 4B9XA 1WGSA 2BZ8A 1WXTA 1D1CA 4BB7A 1YJWA 2J7IA 4KRTA 1QCFA 3DKMA 5LJ3e 1VQ7T 2EAYA 3G1JA 1WHKA 4M7AD 4M77A 3OYFA 4EMHA 3ZFJA 3MHXA 4VUBA 3P8DA 2RJFA 1B34A 2JS2A 2KMTA 3URGA 2YHTA 1BCOA 3CD6Q 2M51A 5FRNA 3MCAB 5GANj 1Q81R 2G3RA 4LDWA 3H0HA 3OYBA 3QDFA 3ER0A 3X20B 3VV0A 2DD4A 3CC2T 2LQNA 2EQJA 4HCBA 1NEBA 2DXUA 2D0NA 4HVUA 3UATA 1VOMA 2MWPA 2NLUA 2BTTA 4PFOA 4KUDK 1M8MA 1MV0B 2EJGA 1GBQA 2O4XA 2FPEA 1Y7XA 1RABB 1V29B 2ABLA 2EKOA 1YJWT 1WA7A 1BI0A 1M2OA 4QQ6A 1JQQA 5CKEA 3VKIA 3LWHA 1JEGA 4F14A 2FG0A 2AK5A 3CQTA 3A8MB 3CCLT 1LOJA 1H3HA 2E70A 1T3LA 1M9SA 2CREA 4MMKA 1K0XA 4Y91A 1G3SA 2EGAA 1P92A 2CH4W 3SD4A 4AG2C 4BI4A 2OI3A 4FCYA 3CXCA 1FYNA 4RUGA 4ZN1A 5LJ5j 2CP0A 1KFZA 1X6GA 4J9CA 2E3HA 1JBMA 4PJOC 2X3XD 1YCSB 1AWOA 3EGDA 9ATCB 3J81E 2JM8A 4DQ2A 4C92C 2DE0X 1BYMA 1UGVA 1YJNA 4C8QG 4RTTA 1ARKA 4F7UG 3GBQA 3VJPA 2OAWA 1RL2A 3LGFA 4OVAA 1Q82U 2CT4A 3VYGA 5CCAA 2MK5A 2E65A 2MYSA 2EJ9A 1YCYA 3PGGA 2PZ1A 4F17A 1J3TA 3JCMV 4Y28E 1WZOA 1K76A 2EQIA 3CMAQ 3PVQA 2DERA 3IQLA 2LP5A 4MZTA 4A53A 5FU7C 2GFUA 2OAUA 4Q5WA 2PVOB 4HCCA 2DXCA 2DEUA 1ZSZB 4QKUA 4IUVA 4RG2A 2LDMA 5FWBA 1QCNA 4PJOF 1AZGB 1JB0E 3M0RA 2ZPBB 2QQBA 1UDLA 4PJMA 4ATOA 3CBMA 2K57A 3ME9A 4M7AG 4C92F 1ZUKA 1YJNT 3M0PA 4HVVA 4BE0A 4E7LA 1BB9A 2BUDA 1SG5A 4TVRA 1Y96B 3C94A 1PRMC 4E7ZA 2R5MA 4JJBA 3A98A 4JJCA 4M7DC 2VGNA 4J7IA 2VV5A 4C8QB 2LNVA 3VU3C 4O5VA 4F7UB 4N0AA 3CCUA 2LQKA 4A4GA 2DM1A 2OTJQ 2DFUA 1AHJB 4KT0E 4B6MA 2MI6A 4FSSA 4FW1A 3SFMA 4KGXB 4JLGA 2AKLA 3ZBDA 1RAAB 4JS5A 2QEXA 1AD5A 2P0PA 7AT1B 3G71Q 1QP3A 4J9EA 2BE7D 3ZL7C 4LXCA 5IXFA 1D0YA 2ROLA 2OX7A 1M1KR 2IPOB 2CS7A 2CH4A 1GXIE 4OMQA 3EG0A 2DILA 2GTOA 4OB0B 2JS0A 5GMKe 4PJNA 4A63B 1M90U 5GAN2 2L3SA 1CKBA 3OW2A 1RADB 3OYDA 3RESA 2SRCA 1XJWB 3CPFA 2QAZA 4M7DF 2RN8A 1PSEA 4R56A 3CCUT 3M0QA 3QXEB 1ZUYA 1X43A 1OI1A 1OX8A 1GCQA 3KBGA 1G2BA 5DM7R 1YBYA 4LDVA 5KYYB 1BIAA 2QQRA 4CC4B 1YI2A 2RHYA 2JW4A 2X3WD 2L3QA 2ZPFB 4GLKA 2E1HA 3MEAA 3MEWA 3GPLA 3CPWA 1VQ4Q 2QEXT 1ABOA 3A8HB 3V7RA 2SEMA 1JXMA 5CO7A 1WIEA 5ECAA 2X51A 2KDSA 2RJCA 2KGTA 5KE3A 4M78C 1G8XA 2CZ6B 3QHSA 5CIUA 3CCVQ 1MMAA 4XTZA 4EMKC 3SWNC 2OJ2A 5KYUA 1S72A 2FRYA 4BACA 1Q7YC 1VQ5A 2M0YA 1YITQ 2ZPIB 4ANJA 4Y92A 1W70A 3CCLA 2M02A 2LVMA 3O8VA 3UA6A 1YP5A 2HDAA 1I8FA 1WJQA 5D7UA 3L2VA 1UGPB 3G4SQ 1M90R 2FZKB 1SF9A 4YTLA 1VQKA 3BW1A 1YI2T 4FU6A 2M1HA 4D8DA 3FLGA 2JNGA 2I0NA 2LRQA 1GFCA 2DZCA 2JTFA 1OPLA 4KGZB 1I81A 3PE0A 4WF2A 2HBPA 1G83A 3AT1B 3OBWA 1AWXA 2IIMA 2VC8A 3CXCP 3CCSQ 1NBEB 2QXFA 3TEEA 2KXDA 2CP7A 4QQGA 3HPWA 1U5SA 1QLYA 1S72T 4C8QA 1KIKA 1PHTA 3MPUB 1VQ5T 2KRMA 4F7UA 2J05A 4BE2A 4NOYA 2X35A 1IGUA 3JB9J 2KT8A 2WACA 4RKUE 2BZYA 4FYXB 1NYGA 2DL4A 1IO6A 4PJOD 4K11A 1MNDA 1TU0B 2EGEA 1YHQA 3BE3A 4FSXA 1I5OB 1UJ0A 1VYUA 4C92D 4C8QE 3CCJQ 4F7UE 4NL3A 1PG5B 1VQKT 2LJ3A 4LNPA 3EFOB 2D1XA 2NYSA 4QVDA 1PKSA 1ZQ1A 2HSPA 2QA4A 2AZSA 3PNWC 2KQWA 2K7AA 4JZ4A 2DL5A 4M75C 3KFVA 4C0DB 1MUZA 2RF0A 5AT1B 4Z89A 2EGCA 2QASA 1K9MC 2DA9A 3GNGA 2EJFA 4FM4B 4KUIA 3OYIA 2LQWA 2ZCFB 2XIDA 2DYBA 1M8VA 1PD1A 1W2BS 4M77B 4AG1C 1SKUB 2DYIA 5I2MA 4M7AA 2O88A 2V8KA 4DOWA 2CYZB 5GAMe 3PFSA 2A3LA 2OTLA 3QBYA 5HKCA 3F70A 2EWNA 3ULRB 3R6OA 6AT1B 1IZ6A 4XU2A 1IRXA 4RTUA 4ZGEB 5KYYA 1YHQT 1VQ8T 4KH1B 4M7AE 2KAFA 5D6XA 2KE9A 2RB6A 1MMDA 2KT1A 2DLPA 4D8KA 2DVEA 3M4GA 3CC4Q 1OV3A 4IUUA 3DLLA 4C5EA 1X6BA 2E6ZA 2LMJA 2O4XB 2XI9A 2JZ2A 4RTXA 2QA4T 3QPHA 2EW3A 5LJ3f 3G6EA 3MEVA 4M75F 5FU6C 4M7DD 3J80E 3EGXA 3X25B 3I56A 3EGUA 3GNFB 2EYQA 1TUGB 4J6XA 4ZNXA 1BI3A 3TQ7P 2MCNA 2A28A 2F2XA 2EQUA 1JU5C 3OW2S 3L2ZA 2OTLT 4FL6A 2JUFA 3QZ5B 5GMKh 2GGRA 1PSFA 3CBPA 5FW9A 3VS6A 2RJDA 2X4WA 2EYXA 2K2VA 4GLMA 2VWFA 3VS4A 1SEMA 4BY6B 1VQ6A 3NFCA 1RAHB 5GAN7 2KEAA 1PCXA 2V1QA 1LJOA 3EFSA 5I22A 1NJIC 2XK0A 3WXMB 2L89A 1OZ3A 2P0KA 5CQXA 3FRNA 4HCKA 2RH2A 2O9SA 3JCMd 3HP9A 5DY9A 3CCEQ 3HFOA 2ED1A 5GANf 1SHFA 1QW1A 5L8RE 3CD6A 1VQNQ 3G6ET 2KSSA 1UGSB 3I56T 3TU4K 2QGFB 3D7SB 1OOTA 1TSFA 4PJOG 3OYLA 1PWTA 2KR3A 1ZX6A 3QSUA 2F5TX 1N8RR 4RCCA 1IB8A 5IH2A 2DX1A 4C92G 3CCQQ 5IAYA 2L8DA 3JCMh 2RMOA 2MIOA 1K1ZA 1M3CA 1M1GA 4QVZA 4ORZA 2CUBA 1ZA2B 1VQ6T 1R0CB 1W4SA 2LC4A 4RG8A 3HRSA 5LJ3g 3UPUA 3EFOA 2ZAEA 3QYHB 1UJYA 2CZ1B 1WJRA 5DLOA 4OMOA 2AKKA 2RNAA 2V1RA 2Y4XA 4BY6C 1VQ9Q 3M58A 1QVGS 3HRTA 2F2WA 3CD6T 5LJ5f 1D0XA 3LWIA 3C12A 3A1PA 2DL3A 2RQVA 5GAOn 2XKOC 1HYOA 3QKJA 3CC7Q 3E9GA 1I5LA 2PQWA 3I55Q 1NEGA 5IXBA 1EX4A 1VQMA 1ZA1B 3RMSA 2JXBA 2MWOA 1YJ9Q 1NLPC 2QQAA 2XDBA 2FHDA 4M77E 1KD1C 2G6FX 2LJ0A 2HSEB 4A4FA 1WXUA 3CCMA 2KY9A 1N9RA 5GANg 1GBRA 1SPKA 2LQ8A 2O9VA 3QJ6A 4M7DG 4BI8B 4PJJA 5GJWB 4J7FA 3L42A 3CMEA 3OBYA 3JB9H 1QMCA 2K2MA 2K3XA 1HK9A 2GF7A 1AT1B 3CMAA 5GAMd 1WLPB 2WSCE 1JJ2S 1E6HA 4XTYA 3GOXA 4E2FB 5CR2A 2QDLA 3META 5D6WA 2J06A 2EYWA 2KYMA 3CC2Q 2XHCA 1SRLA 4ME7A 5KE2A 1G3TA 1VQMT 3MKDA 4ELZC 1IGQA 2AIRB 3MP8A 1T3SA 2E3IA 2DJQA 2DTOA 5GAMh 3CCMT 3EG3A 4GBQA 1U1TA 4FIBA 1ZLMA 4M75D 1UUEA 1R77A 3C0CA 4N0AC 5LJ5g 1K9MU 3GF5A 2EYZA 4HT8A 3V8LA 3V8KA 1KSWA 2DZ9A 3EFRA 2FZCB 5A0LA 3HL8A 3TVTA 3CMET 3OYHA 3OS2A 1M30A 1VQOA 2DD5A 2PVGB 4V2SA 2DXBA 3QUIA 4KULA 1WI7A 4JUVA 2H3EB 2X4YA 3CMAT 1QQJA 2MOXA 4D6WA 2PUOB 2VB6A 5FRMA 4EPCA 5KYUB 1O75A 2HQHA 5FROA 5A0DA 1VA7A 1U06A 4CC7A 3A8GB 3L2UA 3M5AA 1NM7A 2H3JA 1VQPA 4OB3B 1I07A 1M4ZA 2KI7A 4P5NA 4ZTJA 2D6FA 4JS4A 1AWJA 2K3BA 1U8RA 4A4EA 2HKQB 3NTHA 3LGLA 2HCKA 2RK1A 1M3BA 3E1SA 3BDLA 1T0JA 5KCOA 5I21A 1W2BA 1IHVA 1GCQC 2KVQG 1PM3A 5HK3A 2DJZA 4RTYA 1MNEA 2A0FB 3OS5A 1VQOT 3JCMc 1KC8U 4LDXA 2JMAA 4JZ3A 1JO8A 2LCLA 5I11A 2CZ0B 2L3PA 1XOVA 3PIOA 1X69A 2GNCA 2MF2A 5CKHA 1YWPA 1Q86C 3M0UA 4RMOA 1K8AC 4OMMA 5KYNA 4DOVA 3MP6A 1VQPT 1NJIU 2HMAA 1V76A 3CCRA 5GMKj 1VIFA 2COZA 1Y57A 4PJOA 2FRWA 1Q82R 2YRVA 1YJNQ 2KROA 2HBWA 5C6SA 1X01A 4J8OA 5GAN3 4ZGJB 4XTUA 1K73C 3E9FA 3CCVA 2HNIA 3EG2A 1FMKA 4Z88A 4PFZA 1Q95G 3VUZA 3VS5A 1AOJA 1CSKA 1BCMA 1X6OA 1QWEA 1YITA 3S6WA 1T0HA 2D0QB 1ZSZC 1U3OA 3EG9A 2K79A 2LJ1A 2M16A 2IVWA 1JXOA 2LT4A 3MP1A 4M7AB 5CQYA 1WHMA 4WCIA 5DLQE 2FPDA 4QQDA 2L2PA 1IHWA 1WFWA 3JCMW 3MJXA 4M75G 1Q81C 4J9BA 4PNOA 5GAN4 1V1CA 1MHNA 3CCRT 1TUDA 3DLMA 2GBQA 2EBPA 1QVFA 1KC8R 4FT2A 3FDRA 4JLIA 4C8QC 4HXJA 3RKWA 2XU8A 3CCVT 1G3WA 2JOYA 2DTHA 1D1BA 1M2VA 4DBFA 5KYXA 2DNUA 1K4US 2CP5A 3HRUA 4EIKA 3VRYA 1YIJQ 2E5QA 3P8BB 2EIFA 2D8JA 2E41A 3RNJA 3PMTA 1YITT 2ATCB 2DAQA 1OEBA 4MMLA 3M4YA 3JCMe 3CCUQ 2DXTA 3EGXB 2HL3A 1RLPC 3PTAA 1GCPA 2P0QA 4M7DA 3HSBA 2AZVA 2C06A 1H92A 1VIEA 4PLLA 4N4GA 1Z9ZA 2PNIA 2DL8A 1WXBA 2FYKA 2DRKA 1HD3A 3TSZA 4C5GA 2JN0A 5CKDA 4OMNA 5KH6A 4QT7A 2CDTA 2QEXQ 4M7DE 2K6DA 1RUWA 1KQSS 4M7AC 2YUPA 1UB4A 2HKNA 3CCST 4O6JA 1QVGA 3CEYA 3VRZA 5A2QE 3OYGA 3JCMX 1UECA 1SRMA 3UF4A 1X2QA 4QW2A 3QIIA 1LNXA 2RQWA 1B3QA 2EVRA 3S3MA 5KCHA 2KRSA 3QJYA 1OQKA 4M78F 5IHIA 1XNIA 2A08A 2DBMA 3FJPA 2EQMA 1H3ZA 3JV3A 1YI2Q 3DB3A 2C0TA 4PFPA 2K9GA 4E7JA 4XQ3A 1UGRB 2RI5A 1VQ8A 4ZGDB 2J6FA 4ZTFA 4AFZC 4PKCC 3QDRB 3HKSA 3LLRA 5GAMj 3HTRA 5CKFA 2CUDA 1X75C 5D6YA 4JRPA 1OPKA 3DB4A 2E6NA 1JJ2A 1S72Q 3PMIA 2HQEA 1B7TA 4NL2A 5J3BA 4J5YA 1VQ5Q 4AMCA 2RJEA 1M3AA 4EMKA 3NPFA 1K0SA 3OYCA 2FPFA 4IIMA 2ZGWA 2EKHA 4KBMB 3CCLQ 3JB9D 5IHKA 3VS2A 3L2RA 5IT9E 3T9NA 1I0CA 4LUEA 4FT4A 3I35A 3UA7A 1VQKQ 2RQUA 2LCSA 1C6VX 2ZPGB 3OQ5A 1W2BP 3VS3A 3M56A 2M0OA 1SSFA 1VUBA 3S3NA 3I5RA 3UT1A 2MAMA 2ESWA 5AYFA 2F69A 2K5LA 3U23A 3QWXX 3P8HA 1TTHB 4IKFA 2VXEA 2E64A 5A0GA 1WQWA 1XTDA 2P4RA 2EPDA 4FYWB 3ZEHA 1LPLA 1TXQA 2DMOA 2HAXA 1M1KC 1QCOA 3CCQA 4X9DA 1OU9A 1QWFA 1WNLA 5FLXE 1KG1A 2CKKA 2FB7A 1WHGA 3H9NA 1Q86U 3RKYA 2NUPB 3VS0A 3KUFA 1YHQQ 2JVVA 2ZPHB 4L5GA 3OS0A 4OMLA 4C0DC 4E7HA 1TH7A 3OMGA 2GCXA 3EH1A 3NGPA 3RR6A 2DVJA 1R8OB 2ENMA 2ZZDA 4LN2A 1C1AA 4M77C 2JMCA 3QG1A 2QA4Q 2LTOA 2J6KA 1MV3A 2KK4A 1MMNA 4IURA 2L3RA 3OW2P 3INZA 4II1A 1AVZC 2YXYA 1I4K1 1KHCA 5CAIA 1QVFS 2XG8D 2X9HA 2RQTA 4HA8A 4E47A 2YUNA 4HKEA 2KXCA 4E7SA 4RTVA 4DEYA 3CCQT 2OTLQ 3AHUA 1W6XA 2E4HA 1VQLQ 4EDUA 2DL7A 3OS1A 2A7YA 2DIQA 2DPPB 1EFNA 2Z0WA 2RM4A 5GAOl 4FYVB 4F04B 3JCMJ 5GAN5 3CPWP 1Y71A 4Z8AA 1WPYA 2E5KA 4CRIA 4C8QD 2K3YA 1X27A 2DKGA 2BE9B 4J6WA 1OZ2A 4M77F 3JCMb 3H0FA 1M90C 3G6EQ 2ED0A 2LX9A 1BBZA 4PJLA 2FZGB 1NLOC 3I56Q 4M78D 1PKTA 4Z02A 2HL5C 1D3BB 2QDYB 1Q7YU 1F1BB 2M9UA 5J39A 1UFFA 1NG2A 3I55T 2C0OA 3UDCA 1WHJA 5GAOp 3OYAA 2PVDB 1VYTA 3I9QA 4M4ZA 1VQ6Q 2VUBA 1UE9A 3JB9I 1QVGP 1VYVA 4AT1B 4C0FA 2PTKA 4IIOA 5HK0A 3EH2A 1ZBJA 1WX6A 4PJOB 3L2QA 5IHNA 4DA4A 3E2UA 1VQ7Q 2CZ7B 1ACMB 1KK7A 2RHIA 4C92B 2PU9B 3GIBA 2L5QA 3SB2A 3QWYA 1JRIA 1E6GA 3FEOA 3JAME 3FJ5A 2YLCA 5CK9A 4CI0C 2NUPA 3EG9B 1H8KA 3SEMA 4J9FA 4XTXA 2F1LA 2B8AA 2LZ6B 1QKXA 2GTJA 2MPXC 1M5Q1 2QQ9A 5GANe 3NMZC 3EAEA 5GMKl 1KQSA 3THKA 1I1JA 3E19A 3REBB 2JJ9A 1JJ2P 5FU7B 4J6YA 3MO8A 1WHLA 3C95A 4JDSA 1Q7YR 3LH0A 1RLQC 2CSIA 2R58A 1PNJA 1WJSA 3BFMA 3JCMP 5GAN8 1YJWQ 1IREB 3V7CA 2RPNA 2ROTA 4OP0A 2RD1A 1ZHIA 1M2VB 3OSSC 3V8JA 1BK2A 5KYXB 1RI0A 3X28B 3QO3A 3RIRA 4L59A 4PL6A 2KBTA 2XDDA 3PVLA 1TOVA 2P84A 4ELYC 1FWZA 1WQ7A 2YSQA 4IUQA 2OTJA 1VQMQ 1MMGA 4XK8E 1KQ2A 3OYJA 4M7DB 4RTWA 3M9QA 1WYXA 4XTVA 1D09B 3M55A 1NE8A 2K4YA 3CCMQ 1N6AA 4JJDA 2DEQA 5EG2A 2L0AA 5LJ5e 3I5SA 3G71A 4MZMA 1BKBA 2GQVA 1RAFB 4PLIA 3FB9A 1H641 2ECZA 3CMEQ 3SHWA 4M78G 2CT3A 2V8JA 2MMPA 2COWA 2E10A 2XMFA 3RBBB 3RUXA 1M1KU 5M9OA 4C5IA 4CC2A 2DBKA 1D3BA 3CBOA 1AWWA 3A5ZB 1TUCA 1PC0A 2I2LA 3H6ZA 3G7ZA 2NUTB 3JCMf 1PRLC 4GY5A 2VYTA 1M27C 3TSWA 4BE1A 5HCKA 1FXXA 5CKBA 2OTJT 4X34A 8ATCB 2J6OA 4ESRA 3RDVA 2QG9B 4OGEA 1XQHA 2DF6A 4N4HA 1K9MR 2ZPEB 1AZEA 1N8RC 1OULA 2A36A 2XICA 4X9CA 2PUKB 4M77D 4MDWA 2EFIA 1GRIA 1RAEB 4C5HA 1VQ4A 4IUTA 3VS7A 3G71T 1YIJA 3JB9F 5EC7A 4N4IA 4E7KA 2COYA 3R6NA 4IUPA 5J26A 2YUOA 2E12A 3RKXA 4C92A 1VQOQ 2FEIA 4KGVB 1BI2A 1AEYA 2F2VA 3LH5A 3NHNA 4DEXA 5GAN6 4RCBA 2HQXA 3NTKA 4PJOE 2NWMA 3VS1A 2YRDA 4MZPA 2RA2A 4PK4A 2RHUA 4M78B 5FWCA 3M0SA 4R55A 2R5AA 4C92E 3SWNB 4EMKB 4J9DA 4LD6A 2HEQA 3OY9A 5LJ3d 1VQPQ 2IG0A 2WSFE 1HSQA 4MDXA 2RHZA 3G4SA 4A4KA 1SSHA 5GAOm 1BU1A 1RAGB 3HFNA 5HY6A 4LDYA 4HT9A 1E7OA 1QKWA 2RK2A 1VQ4T 1ZBXA 3N5BB 1KHIA 1YIJT 2Y90A 3GLXA 2YDLA 2A37A 1R0BG 2LNHB 3OMCA 1FMVA 3ASKA 1M1FA 3CCSA 4JJNK 5LJ3h 5GMKi 3PT9A 3JCMg 2NUZA 3J7AF 3C4SA 3QYGB 2D9TA 4A54A 3MEUA 1D1AA 1NJIR 1K9AA 1PD0A 2JT4A 2O01E 2Y4YA 5GANd 2B86A 2FO0A 4JRKA 5C0MA 2EQKA 5GJVB 3CCRQ 3FC3A 2BZXA 5GAMf 1D0ZA 3CCJA 3V7SA 1KD1U 3G4ST 2QK0A 3RMQA 1NPPA 4J83A 2DO3A 2VGMA 2YUQA 5KYWB 3LW5E 2BIVA 2HD0A 5GAOq 2FVUA 1B07A 2KNBB 5GANh 4C8QF 2V26A 4F7UF 4M75B 1Y07A 2JM9A 1Y0MA 1OX9A 3VUBA 4BI3A 1Z9QA 2NUTA 1ZSZA 1KQSP 2VVKA 4XU0A 1N5ZA 3CXCS 4E6RA 4OB2B 1N9SA 4M77G 4A4HA 3EHRA 3OYNA 4BDYA 2RI3A 1QP2A 5LJ5d 4L6V5 4NS5A 5L23A 3CCJT 8AT1B 3TCJA 2QGGA 1RACB 2R57A 1LVKA 3CC4A 1ZSGA 4ZN3A 1Y96A 5GMKm 4UC4A 4EMGA 2YLBA 2W0ZA 2YT6A 1FX7A 4C0GA 2X4JA 3X24B 1RAIB 2YRCA 3JRZA 2X4XA 1ZUUA 2DIGA 2QYZA 1X2KA 1OYXA 2GFAA 4M7AF 3M59A 5LJ5h 3NTIA 3OYYA 2JTEA 4BDZA 1KD1R 3OYEA 2DRMA
chains in the Genus database with same CATH topology
4M75D 2XDBA 5IN1A 3OYDA 4N0AC 5LJ5g 1K9MU 4M78A 3JCMJ 3GF5A 3HHTB 5GAMg 5GAN5 4HT8A 3V8LA 1Y71A 5FU6B 1WPYA 3RESA 3V8KA 3SWNA 4CRIA 2DZ9A 3EFRA 5A0LA 1UGQB 3CPFA 3HL8A 4C8QD 3CMET 4M7DF 2K3YA 1PSEA 3OYHA 3OS2A 1VQOA 2DKGA 4R56A 3CCUT 2DD5A 2PVGB 4J6WA 1OZ2A 4V2SA 2DXBA 3QXEB 3X26B 3QUIA 4KULA 1OI1A 4JUVA 2X4YA 3KBGA 4M77F 3CMAT 1UEBA 3JCMb 5DM7R 1YBYA 1M90C 2DK3A 4LDVA 4C0ZA 4D6WA 2LX9A 2PUOB 5FRMA 4EPCA 4M78E 1BIAA 1N27A 3KXTA 1O75A 2QQRA 1YI2A 3A8OB 2RHYA 5FROA 5A0DA 4M78D 3CC4T 3OA6A 4Z02A 1D3BB 3TREA 2QDYB 2ZPFB 3A8GB 4JRIA 3L2UA 3M5AA 1Q7YU 2M9UA 4GLKA 5J39A 2E1HA 3MEAA 2H3JA 3MEWA 3VYHB 3OYMA 4OB3B 3I55T 1M4ZA 3A8HB 4P5NA 3UDCA 2QEXT 1VQPA 3V7RA 4ZTJA 1Q82C 4JS4A 1B34B 1VQNA 2D6FA 2F5KA 5CO7A 5GAOp 4XU3A 1U8RA 4A4EA 3M57A 3FIFA 3NTHA 3LGLA 3OYAA 3UWNA 2KDSA 2LT1A 2PVDB 4BUGA 4LD9K 2RJCA 4XTWA 5KE3A 4M78C 2CZ6B 1VQLA 2P4TA 3LX7A 3QHSA 5CIUA 2LCCA 4XTZA 4EMKC 3SWNC 2RK1A 2VUBA 3JB9I 3L2WA 1S72A 4BACA 3E1SA 4C0FA 1Q7YC 3BDUA 3BDLA 1VQ5A 1G5VA 2JTMA 4JRQA 2VXFA 5HK0A 1W2BA 5KCOA 3WVEB 2ZPIB 5I21A 2KVQG 1N8RU 5CVIA 5HK3A 4B9WA 2DJZA 1K8AU 4PJOB 3OS5A 3L2QA 1VQOT 3M53A 2K5FA 4DA4A 4QVCA 3CCLA 3CC2T 3JCMc 3OB9A 1KC8U 2LVMA 2CZ7B 3O8VA 4LDUA 2RHIA 2XD0A 3OSVA 4LDXA 1I8FA 1WJQA 4C92B 4XAXB 3L2VA 1UGPB 2LCLA 2CZ0B 2PU9B 4YTLA 1XOVA 3PIOA 1VQKA 3BW1A 1YI2T 1K73U 3GIBA 2MF2A 3BY7A 4FU6A 1MGQA 5CKHA 1Q86C 2M1HA 3FLGA 2L5QA 4RMOA 2JNGA 1K8AC 3SB2A 4E7IA 4DOVA 2LRQA 1QVPA 1JRIA 3FEOA 1VQ9A 3JAME 3CCET 2DZCA 2JTFA 3MP6A 2YLCA 5CK9A 2QTXA 4CI0C 1VQPT 1NJIU 1BIBA 3JSCA 1VQNT 3CCRA 5GMKj 1I81A 1VIFA 1KC8C 4WF2A 1NPRA 2HBPA 4PJOA 3JCMQ 3OBWA 2YRVA 2VC8A 5C6SA 1X01A 4M75A 4J8OA 4XTXA 2RI2A 1NZ9A 5GAN3 2QI2A 4ZGJB 1VQLT 4XTUA 1K73C 1G3YA 2B8AA 2RHXA 3E9FA 3CC7A 2DTIA 2QXFA 3TEEA 3M54A 3CCVA 1M5Q1 2HNIA 4QQGA 1O9SA 1KG1A 2QQ9A 3HPWA 5GANe 2XDPA 3I55A 5GMKl 3EAEA 1HXDA 1S72T 3OW2A 4C8QA 1KQSA 3VUZA 3E19A 1VQ5T 4F7UA 4BE2A 4NOYA 2K5IA 4J6YA 3MO8A 3Q1JA 5FU7B 3C95A 2X35A 4JDSA 3WVDB 1X6OA 2AHJB 3LH0A 2RO0A 3JB9J 1YJ9A 2WACA 4RKUE 1YITA 2R58A 3S6WA 5GAOr 1WJSA 2QQSA 3BFMA 3JCMP 4M75E 4PJOD 2D0QB 5GAN8 4OB1B 1YHQA 1BI1A 4HCZA 1Q81U 1IREB 3V7CA 5I2SA 4FSXA 1VQ7A 2M16A 4OP0A 2IVWA 2RD1A 4OF1A 2LT4A 4C92D 3MP1A 4C8QE 3A8LB 1ZHIA 3OSSC 3V8JA 4F7UE 4M7AB 1RI0A 4NL3A 3CPWS 3X28B 5CQYA 3SDZA 3QO3A 3RIRA 1VQKT 4L59A 4OMFB 5DLQE 4PL6A 2XDDA 4XU1A 4ELYC 1FWZA 4QQDA 4QVDA 3L1AA 1WQ7A 1ZQ1A 3JCMW 2QA4A 3PNWC 1EIFA 2KQWA 1VQ9T 4M75G 4IUQA 4M75C 2OTJA 1Q81C 4C0DB 3QZ9B 4PNOA 5GAN4 1MHNA 4XK8E 3CCRT 4OGCA 1KQ2A 3DLMA 2WSEE 2CGHA 3OYJA 3H8ZA 1K9MC 4M7DB 3GNGA 3LYIA 4BD3A 5LJ3j 3M9QA 2EJFA 1QVFA 4FM4B 4KUIA 2V8IA 3FDRA 4FT2A 4JLIA 3PIPA 3OYIA 4XTVA 4C8QC 3M55A 2ZCFB 1NE8A 2XIDA 3RKWA 3CC2A 1M8VA 2K4YA 1W2BS 2FL7A 3CC7T 4M77B 2XU8A 3CCVT 1G3WA 2JOYA 2DTHA 5I2MA 1N6AA 3JB9G 4M7AA 2BKDN 3S3OA 2V8KA 2DEQA 1DJ7B 5EG2A 3HRUA 4DOWA 5LJ5e 3G71A 2CYZB 4MZMA 5GAMe 2E5QA 3PFSA 3P8BB 1BKBA 2A3LA 2EIFA 2GQVA 2E41A 2OTLA 3QBYA 3PMTA 4PLIA 5HKCA 5LL6S 3F70A 2EWNA 3FB9A 1H641 3OYKA 3R6OA 1YJ9T 1YITT 3RERA 2DAQA 1IZ6A 4XU2A 1KQ1A 1U1SA 4M78G 4B9XA 2V8JA 4MMLA 3M4YA 2MMPA 1WGSA 3JCMe 4ZGEB 2DXTA 2E10A 4BB7A 1YHQT 1YJWA 1VQ8T 3DKMA 3PTAA 4M7DA 2P0QA 3RUXA 1M1KU 5M9OA 5LJ3e 1VQ7T 4M7AE 2KAFA 2EAYA 4C5IA 5D6XA 3HSBA 2C06A 1VIEA 4PLLA 1D3BA 3CBOA 4N4GA 4M7AD 2RB6A 3A5ZB 4M77A 3OYFA 4EMHA 2DVEA 3ZFJA 3M4GA 3MHXA 4VUBA 3P8DA 2FYKA 2RJFA 3CPWA 4IUUA 3DLLA 4C5GA 2JN0A 2I2LA 3H6ZA 1B34A 2KMTA 2E6ZA 3G7ZA 4C5EA 5CKDA 3URGA 5KH6A 3JCMf 4GY5A 2VYTA 2O4XB 2XI9A 2JZ2A 2YHTA 2QA4T 3QPHA 4BE1A 1FXXA 5CKBA 4M7DE 2OTJT 5FRNA 4X34A 5LJ3f 3G6EA 3MEVA 4M75F 3MCAB 5GANj 5FU6C 2G3RA 4M7DD 3J80E 3X25B 4LDWA 3I56A 1KQSS 4OGEA 4M7AC 3OYBA 1XQHA 4N4HA 1UB4A 3ER0A 2ZPEB 3X20B 3GNFB 3VV0A 1N8RC 2DD4A 2EYQA 2XICA 4O6JA 4X9CA 3CCST 1QVGA 3CEYA 2EQJA 2PUKB 4J6XA 4M77D 4MDWA 1BI3A 2EFIA 5A2QE 4HCBA 3OYGA 4C5HA 2DXUA 3JCMX 1VQ4A 4IUTA 4QW2A 3G71T 3QIIA 1YIJA 3JB9F 2MWPA 2EQUA 2NLUA 4N4IA 3OW2S 3L2ZA 1LNXA 2OTLT 4FL6A 4E7KA 2JUFA 4KUDK 3QZ5B 2EJGA 2O4XA 4IUPA 5J26A 2E12A 5GMKh 1PSFA 3S3MA 1Y7XA 3CBPA 3RKXA 5KCHA 2RJDA 2X4WA 3QJYA 2K2VA 4C92A 2EKOA 1V29B 4M78F 1YJWT 4BY6B 1BI2A 1VQ6A 1BI0A 1XNIA 4QQ6A 3NFCA 5CKEA 3FJPA 3VKIA 5GAN7 5GAN6 4RCBA 2HQXA 2EQMA 3LWHA 3NTKA 1LJOA 3EFSA 1NJIC 1H3ZA 4PJOE 2XK0A 3WXMB 2L89A 1OZ3A 2P0KA 5CQXA 3A8MB 3DB3A 3FRNA 4MZPA 3GPLA 3CCLT 2RA2A 2RH2A 4E7JA 1LOJA 4XQ3A 2RHUA 4M78B 2E70A 1UGRB 1M9SA 3JCMd 4MMKA 2RI5A 1VQ8A 4ZGDB 4R55A 2R5AA 4C92E 3SWNB 4EMKB 4ZTFA 4LD6A 4Y91A 3HP9A 5DY9A 1G3SA 3HFOA 3OY9A 1P92A 3SD4A 5LJ3d 5GANf 4BI4A 1QW1A 2IG0A 2WSFE 5L8RE 3CD6A 4PKCC 3CXCA 3G6ET 3QDRB 4MDXA 2KSSA 1UGSB 3HKSA 3LLRA 2RHZA 3G4SA 4A4KA 3I56T 3TU4K 4ZN1A 5LJ5j 5GAMj 5CKFA 5GAOm 1JBMA 1X75C 4PJOG 5D6YA 4JRPA 3OYLA 4PJOC 3QSUA 3HFNA 3DB4A 2F5TX 2E6NA 5HY6A 4LDYA 1JJ2A 4HT9A 4RCCA 2RK2A 1VQ4T 1ZBXA 2HQEA 3PMIA 3N5BB 4NL2A 5J3BA 3J81E 4J5YA 4DQ2A 1KHIA 4C92C 4C92G 1YIJT 2Y90A 3GLXA 1BYMA 5IAYA 3GP8A 3CCEA 2L8DA 2RJEA 3JCMh 4EMKA 1YJNA 4C8QG 3OMCA 1M1GA 3ASKA 1M1FA 4QVZA 3VJPA 4F7UG 3CCSA 5LJ3h 3OYCA 4JJNK 5GMKi 3PT9A 3JCMg 1RL2A 2ZGWA 4KBMB 3LGFA 4OVAA 3J7AF 1Q82U 1VQ6T 1W4SA 2LC4A 3JB9D 3C4SA 4RG8A 3HRSA 5LJ3g 3VYGA 3QYGB 3L2RA 3UPUA 2D9TA 4A54A 5IT9E 3T9NA 5CCAA 4FT4A 3QYHB 2CZ1B 1WJRA 3MEUA 2E65A 2EJ9A 1YCYA 2O01E 2ZPGB 3OQ5A 3PGGA 5DLOA 2Y4YA 3JCMV 3M56A 2M0OA 1SSFA 2Y4XA 1VUBA 5GANd 4Y28E 4BY6C 3UT1A 3S3NA 2MAMA 4JRKA 5C0MA 3M58A 5AYFA 2EQKA 2F69A 2K5LA 3HRTA 1QVGS 3CD6T 5LJ5f 3FC3A 4MZTA 5GAMf 4A53A 5FU7C 3LWIA 3CCJA 3P8HA 3V7SA 3C12A 3G4ST 1KD1U 2GFUA 2OAUA 4Q5WA 2PVOB 2VXEA 3RMQA 4IKFA 5GAOn 1NPPA 2XKOC 4HCCA 2E64A 2DXCA 5A0GA 3QKJA 1WQWA 3E9GA 4J83A 1XTDA 1I5LA 4IUVA 4RG2A 2LDMA 2DO3A 4PJOF 2VGMA 2PQWA 1JB0E 3ZEHA 3LW5E 2ZPBB 2HAXA 1VQMA 1M1KC 2QQBA 3RMSA 4ATOA 3CBMA 3CCQA 2BIVA 2K57A 3ME9A 4M7AG 2MWOA 1WNLA 4X9DA 4C92F 5FLXE 2QQAA 2CKKA 2FB7A 2HD0A 5GAOq 2FHDA 2FVUA 4M77E 3RKYA 1YJNT 1Q86U 1KD1C 5GANh 4BE0A 3KUFA 4C8QF 4A4FA 3CCMA 2JVVA 4E7LA 2KY9A 4F7UF 2BUDA 2ZPHB 4L5GA 1N9RA 4M75B 1Y07A 4TVRA 5GANg 1Y96B 3OS0A 4C0DC 4E7HA 1TH7A 3C94A 3VUBA 2R5MA 3QJ6A 2LQ8A 3OMGA 4BI3A 4M7DC 4BI8B 4M7DG 2GCXA 2VGNA 4J7IA 4XU0A 4J7FA 2VV5A 3L42A 4C8QB 3CXCS 3CMEA 1R8OB 3OBYA 2LNVA 4OB2B 3VU3C 3JB9H 4O5VA 4F7UB 1N9SA 4N0AA 2ZZDA 3CCUA 2LQKA 2K3XA 3QG1A 4M77G 1HK9A 4M77C 4A4HA 2GF7A 4A4GA 3OYNA 4BDYA 2LTOA 2RI3A 3CMAA 1QP2A 5LJ5d 1AHJB 2KK4A 4L6V5 5GAMd 4IURA 4NS5A 2WSCE 2L3RA 3INZA 4KT0E 4II1A 1JJ2S 4XTYA 3CCJT 2MI6A 3TCJA 3GOXA 1I4K1 5CR2A 2R57A 3SFMA 3META 1KHCA 3CC4A 5D6WA 4JLGA 4ZN3A 1Y96A 5CAIA 5GMKm 4UC4A 2XHCA 1QVFS 4EMGA 2YLBA 2XG8D 1FX7A 3ZBDA 4ME7A 4HA8A 2X4JA 4C0GA 3X24B 5KE2A 4JS5A 4E47A 3JRZA 2QEXA 1G3TA 2P0PA 1VQMT 1QP3A 2X4XA 2DIGA 4HKEA 3AHUA 3CCQT 1OYXA 2CS7A 4ELZC 1GXIE 2GFAA 3MP8A 4M7AF 3M59A 2DTOA 4EDUA 5LJ5h 3NTIA 2A7YA 3OYYA 3OS1A 2DIQA 4OB0B 5GAMh 3OYEA 2DPPB 3CCMT 4BDZA 5GMKe 2RM4A 1U1TA 1M90U 5GAOl 5GAN2 4FIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ T;  1NZ9 A;  4X34 A;  3G6E A;  1K9M U;  1VQL T;  1K73 C;  3CC7 A;  2G3R A;  3CCV A;  3J80 E;  1SSF A;  3I56 A;  1KQS S;  4CRI A;  3I55 A;  3ER0 A;  3CPF A;  1S72 T;  1KQS A;  3CME T;  1QVG S;  3CD6 T;  1N8R C;  3CCS T;  1QVG A;  1VQ5 T;  3CC2 T;  1VQO A;  3CCU T;  3CCJ A;  1KD1 U;  3G4S T;  1X6O A;  3LH0 A;  5A2Q E;  1YJ9 A;  1YIT A;  1VQ4 A;  1NPP A;  3KBG A;  3CMA T;  1UEB A;  5DM7 R;  3G71 T;  1YBY A;  1M90 C;  1YIJ A;  2MWP A;  1XTD A;  3OW2 S;  1YHQ A;  4RG2 A;  2OTL T;  1Q81 U;  2DO3 A;  2JUF A;  1YI2 A;  5J26 A;  1VQ7 A;  1VQM A;  3CC4 T;  1M1K C;  3CCQ A;  3TRE A;  3CPW S;  1YJW T;  2MWO A;  5FLX E;  1Q7Y U;  1VQ6 A;  3CCE A;  2CKK A;  1YJN T;  3CPW A;  1Q86 U;  1XNI A;  1VQK T;  1VQP A;  3I55 T;  2QEX T;  1KD1 C;  5DLQ E;  1Q82 C;  1VQN A;  4QQD A;  1NJI C;  3CCM A;  2JVV A;  2QA4 A;  1EIF A;  1VQ9 T;  3DB3 A;  3LGL A;  4TVR A;  2KDS A;  2OTJ A;  1Q81 C;  2E70 A;  1VQL A;  3CCR T;  2LQ8 A;  1VQ8 A;  1K9M C;  1QVF A;  3PIP A;  1S72 A;  3CXC S;  3CME A;  2IG0 A;  1Q7Y C;  3CD6 A;  3CXC A;  3G6E T;  1VQ5 A;  3CC2 A;  3HKS A;  3CCU A;  1W2B S;  3CC7 T;  3G4S A;  3CCV T;  2JOY A;  1W2B A;  3I56 T;  4ZN1 A;  2KVQ G;  1N8R U;  3CMA A;  3G71 A;  1K8A U;  2L3R A;  3P8B B;  1BKB A;  3DB4 A;  2EIF A;  1VQO T;  1JJ2 S;  2OTL A;  3CCJ T;  2MI6 A;  5HY6 A;  5LL6 S;  3CCL A;  1JJ2 A;  1YJ9 T;  1KC8 U;  2LVM A;  1YIT T;  1VQ4 T;  5J3B A;  1IZ6 A;  3CC4 A;  3J81 E;  4ZN3 A;  1KHI A;  1YIJ T;  1QVF S;  2XHC A;  5IAY A;  2LCL A;  1YHQ T;  1YJW A;  1VQ8 T;  4YTL A;  3PIO A;  1YJN A;  1VQK A;  1YI2 T;  1K73 U;  1M1K U;  2QEX A;  1VQ7 T;  1M1G A;  1VQM T;  3CCS A;  1Q86 C;  3CCQ T;  2JNG A;  1K8A C;  1RL2 A;  3LGF A;  3J7A F;  3A5Z B;  1Q82 U;  1VQ6 T;  1VQ9 A;  3JAM E;  3CCE T;  1VQP T;  1NJI U;  1VQN T;  3DLL A;  3CCR A;  1KC8 C;  5IT9 E;  2E6Z A;  1NPR A;  3OYY A;  3CCM T;  2QA4 T;  1M90 U;  3CCL T;  3OW2 A; 
#chains in the Genus database with same CATH topology
 5IN1 A;  4M78 A;  2CP6 A;  3HHT B;  5GAM g;  2H8H A;  5FU6 B;  3SWN A;  1UGQ B;  2VAS A;  1WDX A;  2KRN A;  3X26 B;  4FW2 A;  1UEB A;  2DET A;  1TWB A;  2DK3 A;  1WHH A;  4C0Z A;  4RTZ A;  4M78 E;  1N27 A;  3KXT A;  1UTI A;  3A8O B;  4LUD A;  3CC4 T;  3OA6 A;  1LCK A;  3TRE A;  4JRI A;  1GFD A;  3CCE A;  3OYM A;  1UG1 A;  3VYH B;  4F16 A;  1Q82 C;  1VQN A;  1B34 B;  2F5K A;  4XU3 A;  3H41 A;  3M57 A;  3FIF A;  1OU8 A;  4LE9 A;  3UWN A;  2LT1 A;  4BUG A;  4LD9 K;  4XTW A;  2CP3 A;  1VQL A;  2P4T A;  3LX7 A;  2LCC A;  2VKN A;  3L2W A;  2RQR A;  3BDU A;  4CC3 A;  1EZZ B;  4DBR A;  1G5V A;  2JTM A;  4JRQ A;  2VXF A;  1YWO A;  4J9G A;  3WVE B;  4X1V A;  1N8R U;  5CVI A;  4B9W A;  1A0N B;  1K8A U;  1VQ8 Q;  4KH0 B;  3M53 A;  2K5F A;  4QVC A;  2LX7 A;  3OB9 A;  4LDU A;  2HZY A;  2XD0 A;  3OSV A;  2AT1 B;  4XAX B;  4AFQ C;  1HJD A;  1UHC A;  1TS9 A;  1K73 U;  5KYW A;  3BY7 A;  2YWW A;  1YNZ A;  1MGQ A;  2GQI A;  4E7I A;  1QVP A;  3REA B;  1VQ9 A;  4AFS C;  2KYB A;  3CCE T;  1C0M A;  1NYF A;  2QTX A;  2CSQ A;  1VQN T;  1BIB A;  3JSC A;  4J9H A;  1KC8 C;  2CP2 A;  1NPR A;  3JCM Q;  4M75 A;  2RI2 A;  1NZ9 A;  2QI2 A;  4WTO B;  1VQL T;  1G3Y A;  2RHX A;  3CC7 A;  2QTV A;  2DTI A;  3M54 A;  1O9S A;  1SHG A;  3I55 A;  2XDP A;  1HXD A;  2O2O A;  4DBH A;  1TG0 A;  2K5I A;  3Q1J A;  3O5Z A;  3WVD B;  3GP8 A;  2AHJ B;  2RO0 A;  1YJ9 A;  3EGD B;  1UHF A;  5GAO r;  2QQS A;  3EHQ A;  4M75 E;  1QVF P;  4OB1 B;  1BI1 A;  4HCZ A;  1Q81 U;  5I2S A;  1IXD A;  1KJW A;  4R0K A;  1RI9 A;  1VQ7 A;  4OF1 A;  1YFN A;  3A8L B;  3M0T A;  1CKA A;  3CPW S;  3SDZ A;  1ABQ A;  2W10 A;  4OMF B;  1GL5 A;  4XU1 A;  1FMW A;  3EG1 A;  3L1A A;  2D8H A;  1Q86 R;  1EIF A;  4DBQ A;  1VQ9 T;  1K8A R;  3QZ9 B;  4FYY B;  4AFU C;  4OGC A;  2WSE E;  2CGH A;  3H8Z A;  3LYI A;  4BD3 A;  5LJ3 j;  4HVW A;  2O31 A;  2V8I A;  3PIP A;  1W1F A;  3CC2 A;  3CC7 T;  2FL7 A;  1S1N A;  1K73 R;  3JB9 G;  2BKD N;  3S3O A;  4OMP A;  1DJ7 B;  1YN8 A;  2C0I A;  4J9I A;  5LL6 S;  1YJ9 T;  3OYK A;  3RER A;  2EYY A;  4JPB W;  1KQ1 A;  1U1S A;  3H0I A;  4B9X A;  1WGS A;  2BZ8 A;  1WXT A;  1D1C A;  4BB7 A;  1YJW A;  2J7I A;  4KRT A;  1QCF A;  3DKM A;  5LJ3 e;  1VQ7 T;  2EAY A;  3G1J A;  1WHK A;  4M7A D;  4M77 A;  3OYF A;  4EMH A;  3ZFJ A;  3MHX A;  4VUB A;  3P8D A;  2RJF A;  1B34 A;  2JS2 A;  2KMT A;  3URG A;  2YHT A;  1BCO A;  3CD6 Q;  2M51 A;  5FRN A;  3MCA B;  5GAN j;  1Q81 R;  2G3R A;  4LDW A;  3H0H A;  3OYB A;  3QDF A;  3ER0 A;  3X20 B;  3VV0 A;  2DD4 A;  3CC2 T;  2LQN A;  2EQJ A;  4HCB A;  1NEB A;  2DXU A;  2D0N A;  4HVU A;  3UAT A;  1VOM A;  2MWP A;  2NLU A;  2BTT A;  4PFO A;  4KUD K;  1M8M A;  1MV0 B;  2EJG A;  1GBQ A;  2O4X A;  2FPE A;  1Y7X A;  1RAB B;  1V29 B;  2ABL A;  2EKO A;  1YJW T;  1WA7 A;  1BI0 A;  1M2O A;  4QQ6 A;  1JQQ A;  5CKE A;  3VKI A;  3LWH A;  1JEG A;  4F14 A;  2FG0 A;  2AK5 A;  3CQT A;  3A8M B;  3CCL T;  1LOJ A;  1H3H A;  2E70 A;  1T3L A;  1M9S A;  2CRE A;  4MMK A;  1K0X A;  4Y91 A;  1G3S A;  2EGA A;  1P92 A;  2CH4 W;  3SD4 A;  4AG2 C;  4BI4 A;  2OI3 A;  4FCY A;  3CXC A;  1FYN A;  4RUG A;  4ZN1 A;  5LJ5 j;  2CP0 A;  1KFZ A;  1X6G A;  4J9C A;  2E3H A;  1JBM A;  4PJO C;  2X3X D;  1YCS B;  1AWO A;  3EGD A;  9ATC B;  3J81 E;  2JM8 A;  4DQ2 A;  4C92 C;  2DE0 X;  1BYM A;  1UGV A;  1YJN A;  4C8Q G;  4RTT A;  1ARK A;  4F7U G;  3GBQ A;  3VJP A;  2OAW A;  1RL2 A;  3LGF A;  4OVA A;  1Q82 U;  2CT4 A;  3VYG A;  5CCA A;  2MK5 A;  2E65 A;  2MYS A;  2EJ9 A;  1YCY A;  3PGG A;  2PZ1 A;  4F17 A;  1J3T A;  3JCM V;  4Y28 E;  1WZO A;  1K76 A;  2EQI A;  3CMA Q;  3PVQ A;  2DER A;  3IQL A;  2LP5 A;  4MZT A;  4A53 A;  5FU7 C;  2GFU A;  2OAU A;  4Q5W A;  2PVO B;  4HCC A;  2DXC A;  2DEU A;  1ZSZ B;  4QKU A;  4IUV A;  4RG2 A;  2LDM A;  5FWB A;  1QCN A;  4PJO F;  1AZG B;  1JB0 E;  3M0R A;  2ZPB B;  2QQB A;  1UDL A;  4PJM A;  4ATO A;  3CBM A;  2K57 A;  3ME9 A;  4M7A G;  4C92 F;  1ZUK A;  1YJN T;  3M0P A;  4HVV A;  4BE0 A;  4E7L A;  1BB9 A;  2BUD A;  1SG5 A;  4TVR A;  1Y96 B;  3C94 A;  1PRM C;  4E7Z A;  2R5M A;  4JJB A;  3A98 A;  4JJC A;  4M7D C;  2VGN A;  4J7I A;  2VV5 A;  4C8Q B;  2LNV A;  3VU3 C;  4O5V A;  4F7U B;  4N0A A;  3CCU A;  2LQK A;  4A4G A;  2DM1 A;  2OTJ Q;  2DFU A;  1AHJ B;  4KT0 E;  4B6M A;  2MI6 A;  4FSS A;  4FW1 A;  3SFM A;  4KGX B;  4JLG A;  2AKL A;  3ZBD A;  1RAA B;  4JS5 A;  2QEX A;  1AD5 A;  2P0P A;  7AT1 B;  3G71 Q;  1QP3 A;  4J9E A;  2BE7 D;  3ZL7 C;  4LXC A;  5IXF A;  1D0Y A;  2ROL A;  2OX7 A;  1M1K R;  2IPO B;  2CS7 A;  2CH4 A;  1GXI E;  4OMQ A;  3EG0 A;  2DIL A;  2GTO A;  4OB0 B;  2JS0 A;  5GMK e;  4PJN A;  4A63 B;  1M90 U;  5GAN 2;  2L3S A;  1CKB A;  3OW2 A;  1RAD B;  3OYD A;  3RES A;  2SRC A;  1XJW B;  3CPF A;  2QAZ A;  4M7D F;  2RN8 A;  1PSE A;  4R56 A;  3CCU T;  3M0Q A;  3QXE B;  1ZUY A;  1X43 A;  1OI1 A;  1OX8 A;  1GCQ A;  3KBG A;  1G2B A;  5DM7 R;  1YBY A;  4LDV A;  5KYY B;  1BIA A;  2QQR A;  4CC4 B;  1YI2 A;  2RHY A;  2JW4 A;  2X3W D;  2L3Q A;  2ZPF B;  4GLK A;  2E1H A;  3MEA A;  3MEW A;  3GPL A;  3CPW A;  1VQ4 Q;  2QEX T;  1ABO A;  3A8H B;  3V7R A;  2SEM A;  1JXM A;  5CO7 A;  1WIE A;  5ECA A;  2X51 A;  2KDS A;  2RJC A;  2KGT A;  5KE3 A;  4M78 C;  1G8X A;  2CZ6 B;  3QHS A;  5CIU A;  3CCV Q;  1MMA A;  4XTZ A;  4EMK C;  3SWN C;  2OJ2 A;  5KYU A;  1S72 A;  2FRY A;  4BAC A;  1Q7Y C;  1VQ5 A;  2M0Y A;  1YIT Q;  2ZPI B;  4ANJ A;  4Y92 A;  1W70 A;  3CCL A;  2M02 A;  2LVM A;  3O8V A;  3UA6 A;  1YP5 A;  2HDA A;  1I8F A;  1WJQ A;  5D7U A;  3L2V A;  1UGP B;  3G4S Q;  1M90 R;  2FZK B;  1SF9 A;  4YTL A;  1VQK A;  3BW1 A;  1YI2 T;  4FU6 A;  2M1H A;  4D8D A;  3FLG A;  2JNG A;  2I0N A;  2LRQ A;  1GFC A;  2DZC A;  2JTF A;  1OPL A;  4KGZ B;  1I81 A;  3PE0 A;  4WF2 A;  2HBP A;  1G83 A;  3AT1 B;  3OBW A;  1AWX A;  2IIM A;  2VC8 A;  3CXC P;  3CCS Q;  1NBE B;  2QXF A;  3TEE A;  2KXD A;  2CP7 A;  4QQG A;  3HPW A;  1U5S A;  1QLY A;  1S72 T;  4C8Q A;  1KIK A;  1PHT A;  3MPU B;  1VQ5 T;  2KRM A;  4F7U A;  2J05 A;  4BE2 A;  4NOY A;  2X35 A;  1IGU A;  3JB9 J;  2KT8 A;  2WAC A;  4RKU E;  2BZY A;  4FYX B;  1NYG A;  2DL4 A;  1IO6 A;  4PJO D;  4K11 A;  1MND A;  1TU0 B;  2EGE A;  1YHQ A;  3BE3 A;  4FSX A;  1I5O B;  1UJ0 A;  1VYU A;  4C92 D;  4C8Q E;  3CCJ Q;  4F7U E;  4NL3 A;  1PG5 B;  1VQK T;  2LJ3 A;  4LNP A;  3EFO B;  2D1X A;  2NYS A;  4QVD A;  1PKS A;  1ZQ1 A;  2HSP A;  2QA4 A;  2AZS A;  3PNW C;  2KQW A;  2K7A A;  4JZ4 A;  2DL5 A;  4M75 C;  3KFV A;  4C0D B;  1MUZ A;  2RF0 A;  5AT1 B;  4Z89 A;  2EGC A;  2QAS A;  1K9M C;  2DA9 A;  3GNG A;  2EJF A;  4FM4 B;  4KUI A;  3OYI A;  2LQW A;  2ZCF B;  2XID A;  2DYB A;  1M8V A;  1PD1 A;  1W2B S;  4M77 B;  4AG1 C;  1SKU B;  2DYI A;  5I2M A;  4M7A A;  2O88 A;  2V8K A;  4DOW A;  2CYZ B;  5GAM e;  3PFS A;  2A3L A;  2OTL A;  3QBY A;  5HKC A;  3F70 A;  2EWN A;  3ULR B;  3R6O A;  6AT1 B;  1IZ6 A;  4XU2 A;  1IRX A;  4RTU A;  4ZGE B;  5KYY A;  1YHQ T;  1VQ8 T;  4KH1 B;  4M7A E;  2KAF A;  5D6X A;  2KE9 A;  2RB6 A;  1MMD A;  2KT1 A;  2DLP A;  4D8K A;  2DVE A;  3M4G A;  3CC4 Q;  1OV3 A;  4IUU A;  3DLL A;  4C5E A;  1X6B A;  2E6Z A;  2LMJ A;  2O4X B;  2XI9 A;  2JZ2 A;  4RTX A;  2QA4 T;  3QPH A;  2EW3 A;  5LJ3 f;  3G6E A;  3MEV A;  4M75 F;  5FU6 C;  4M7D D;  3J80 E;  3EGX A;  3X25 B;  3I56 A;  3EGU A;  3GNF B;  2EYQ A;  1TUG B;  4J6X A;  4ZNX A;  1BI3 A;  3TQ7 P;  2MCN A;  2A28 A;  2F2X A;  2EQU A;  1JU5 C;  3OW2 S;  3L2Z A;  2OTL T;  4FL6 A;  2JUF A;  3QZ5 B;  5GMK h;  2GGR A;  1PSF A;  3CBP A;  5FW9 A;  3VS6 A;  2RJD A;  2X4W A;  2EYX A;  2K2V A;  4GLM A;  2VWF A;  3VS4 A;  1SEM A;  4BY6 B;  1VQ6 A;  3NFC A;  1RAH B;  5GAN 7;  2KEA A;  1PCX A;  2V1Q A;  1LJO A;  3EFS A;  5I22 A;  1NJI C;  2XK0 A;  3WXM B;  2L89 A;  1OZ3 A;  2P0K A;  5CQX A;  3FRN A;  4HCK A;  2RH2 A;  2O9S A;  3JCM d;  3HP9 A;  5DY9 A;  3CCE Q;  3HFO A;  2ED1 A;  5GAN f;  1SHF A;  1QW1 A;  5L8R E;  3CD6 A;  1VQN Q;  3G6E T;  2KSS A;  1UGS B;  3I56 T;  3TU4 K;  2QGF B;  3D7S B;  1OOT A;  1TSF A;  4PJO G;  3OYL A;  1PWT A;  2KR3 A;  1ZX6 A;  3QSU A;  2F5T X;  1N8R R;  4RCC A;  1IB8 A;  5IH2 A;  2DX1 A;  4C92 G;  3CCQ Q;  5IAY A;  2L8D A;  3JCM h;  2RMO A;  2MIO A;  1K1Z A;  1M3C A;  1M1G A;  4QVZ A;  4ORZ A;  2CUB A;  1ZA2 B;  1VQ6 T;  1R0C B;  1W4S A;  2LC4 A;  4RG8 A;  3HRS A;  5LJ3 g;  3UPU A;  3EFO A;  2ZAE A;  3QYH B;  1UJY A;  2CZ1 B;  1WJR A;  5DLO A;  4OMO A;  2AKK A;  2RNA A;  2V1R A;  2Y4X A;  4BY6 C;  1VQ9 Q;  3M58 A;  1QVG S;  3HRT A;  2F2W A;  3CD6 T;  5LJ5 f;  1D0X A;  3LWI A;  3C12 A;  3A1P A;  2DL3 A;  2RQV A;  5GAO n;  2XKO C;  1HYO A;  3QKJ A;  3CC7 Q;  3E9G A;  1I5L A;  2PQW A;  3I55 Q;  1NEG A;  5IXB A;  1EX4 A;  1VQM A;  1ZA1 B;  3RMS A;  2JXB A;  2MWO A;  1YJ9 Q;  1NLP C;  2QQA A;  2XDB A;  2FHD A;  4M77 E;  1KD1 C;  2G6F X;  2LJ0 A;  2HSE B;  4A4F A;  1WXU A;  3CCM A;  2KY9 A;  1N9R A;  5GAN g;  1GBR A;  1SPK A;  2LQ8 A;  2O9V A;  3QJ6 A;  4M7D G;  4BI8 B;  4PJJ A;  5GJW B;  4J7F A;  3L42 A;  3CME A;  3OBY A;  3JB9 H;  1QMC A;  2K2M A;  2K3X A;  1HK9 A;  2GF7 A;  1AT1 B;  3CMA A;  5GAM d;  1WLP B;  2WSC E;  1JJ2 S;  1E6H A;  4XTY A;  3GOX A;  4E2F B;  5CR2 A;  2QDL A;  3MET A;  5D6W A;  2J06 A;  2EYW A;  2KYM A;  3CC2 Q;  2XHC A;  1SRL A;  4ME7 A;  5KE2 A;  1G3T A;  1VQM T;  3MKD A;  4ELZ C;  1IGQ A;  2AIR B;  3MP8 A;  1T3S A;  2E3I A;  2DJQ A;  2DTO A;  5GAM h;  3CCM T;  3EG3 A;  4GBQ A;  1U1T A;  4FIB A;  1ZLM A;  4M75 D;  1UUE A;  1R77 A;  3C0C A;  4N0A C;  5LJ5 g;  1K9M U;  3GF5 A;  2EYZ A;  4HT8 A;  3V8L A;  3V8K A;  1KSW A;  2DZ9 A;  3EFR A;  2FZC B;  5A0L A;  3HL8 A;  3TVT A;  3CME T;  3OYH A;  3OS2 A;  1M30 A;  1VQO A;  2DD5 A;  2PVG B;  4V2S A;  2DXB A;  3QUI A;  4KUL A;  1WI7 A;  4JUV A;  2H3E B;  2X4Y A;  3CMA T;  1QQJ A;  2MOX A;  4D6W A;  2PUO B;  2VB6 A;  5FRM A;  4EPC A;  5KYU B;  1O75 A;  2HQH A;  5FRO A;  5A0D A;  1VA7 A;  1U06 A;  4CC7 A;  3A8G B;  3L2U A;  3M5A A;  1NM7 A;  2H3J A;  1VQP A;  4OB3 B;  1I07 A;  1M4Z A;  2KI7 A;  4P5N A;  4ZTJ A;  2D6F A;  4JS4 A;  1AWJ A;  2K3B A;  1U8R A;  4A4E A;  2HKQ B;  3NTH A;  3LGL A;  2HCK A;  2RK1 A;  1M3B A;  3E1S A;  3BDL A;  1T0J A;  5KCO A;  5I21 A;  1W2B A;  1IHV A;  1GCQ C;  2KVQ G;  1PM3 A;  5HK3 A;  2DJZ A;  4RTY A;  1MNE A;  2A0F B;  3OS5 A;  1VQO T;  3JCM c;  1KC8 U;  4LDX A;  2JMA A;  4JZ3 A;  1JO8 A;  2LCL A;  5I11 A;  2CZ0 B;  2L3P A;  1XOV A;  3PIO A;  1X69 A;  2GNC A;  2MF2 A;  5CKH A;  1YWP A;  1Q86 C;  3M0U A;  4RMO A;  1K8A C;  4OMM A;  5KYN A;  4DOV A;  3MP6 A;  1VQP T;  1NJI U;  2HMA A;  1V76 A;  3CCR A;  5GMK j;  1VIF A;  2COZ A;  1Y57 A;  4PJO A;  2FRW A;  1Q82 R;  2YRV A;  1YJN Q;  2KRO A;  2HBW A;  5C6S A;  1X01 A;  4J8O A;  5GAN 3;  4ZGJ B;  4XTU A;  1K73 C;  3E9F A;  3CCV A;  2HNI A;  3EG2 A;  1FMK A;  4Z88 A;  4PFZ A;  1Q95 G;  3VUZ A;  3VS5 A;  1AOJ A;  1CSK A;  1BCM A;  1X6O A;  1QWE A;  1YIT A;  3S6W A;  1T0H A;  2D0Q B;  1ZSZ C;  1U3O A;  3EG9 A;  2K79 A;  2LJ1 A;  2M16 A;  2IVW A;  1JXO A;  2LT4 A;  3MP1 A;  4M7A B;  5CQY A;  1WHM A;  4WCI A;  5DLQ E;  2FPD A;  4QQD A;  2L2P A;  1IHW A;  1WFW A;  3JCM W;  3MJX A;  4M75 G;  1Q81 C;  4J9B A;  4PNO A;  5GAN 4;  1V1C A;  1MHN A;  3CCR T;  1TUD A;  3DLM A;  2GBQ A;  2EBP A;  1QVF A;  1KC8 R;  4FT2 A;  3FDR A;  4JLI A;  4C8Q C;  4HXJ A;  3RKW A;  2XU8 A;  3CCV T;  1G3W A;  2JOY A;  2DTH A;  1D1B A;  1M2V A;  4DBF A;  5KYX A;  2DNU A;  1K4U S;  2CP5 A;  3HRU A;  4EIK A;  3VRY A;  1YIJ Q;  2E5Q A;  3P8B B;  2EIF A;  2D8J A;  2E41 A;  3RNJ A;  3PMT A;  1YIT T;  2ATC B;  2DAQ A;  1OEB A;  4MML A;  3M4Y A;  3JCM e;  3CCU Q;  2DXT A;  3EGX B;  2HL3 A;  1RLP C;  3PTA A;  1GCP A;  2P0Q A;  4M7D A;  3HSB A;  2AZV A;  2C06 A;  1H92 A;  1VIE A;  4PLL A;  4N4G A;  1Z9Z A;  2PNI A;  2DL8 A;  1WXB A;  2FYK A;  2DRK A;  1HD3 A;  3TSZ A;  4C5G A;  2JN0 A;  5CKD A;  4OMN A;  5KH6 A;  4QT7 A;  2CDT A;  2QEX Q;  4M7D E;  2K6D A;  1RUW A;  1KQS S;  4M7A C;  2YUP A;  1UB4 A;  2HKN A;  3CCS T;  4O6J A;  1QVG A;  3CEY A;  3VRZ A;  5A2Q E;  3OYG A;  3JCM X;  1UEC A;  1SRM A;  3UF4 A;  1X2Q A;  4QW2 A;  3QII A;  1LNX A;  2RQW A;  1B3Q A;  2EVR A;  3S3M A;  5KCH A;  2KRS A;  3QJY A;  1OQK A;  4M78 F;  5IHI A;  1XNI A;  2A08 A;  2DBM A;  3FJP A;  2EQM A;  1H3Z A;  3JV3 A;  1YI2 Q;  3DB3 A;  2C0T A;  4PFP A;  2K9G A;  4E7J A;  4XQ3 A;  1UGR B;  2RI5 A;  1VQ8 A;  4ZGD B;  2J6F A;  4ZTF A;  4AFZ C;  4PKC C;  3QDR B;  3HKS A;  3LLR A;  5GAM j;  3HTR A;  5CKF A;  2CUD A;  1X75 C;  5D6Y A;  4JRP A;  1OPK A;  3DB4 A;  2E6N A;  1JJ2 A;  1S72 Q;  3PMI A;  2HQE A;  1B7T A;  4NL2 A;  5J3B A;  4J5Y A;  1VQ5 Q;  4AMC A;  2RJE A;  1M3A A;  4EMK A;  3NPF A;  1K0S A;  3OYC A;  2FPF A;  4IIM A;  2ZGW A;  2EKH A;  4KBM B;  3CCL Q;  3JB9 D;  5IHK A;  3VS2 A;  3L2R A;  5IT9 E;  3T9N A;  1I0C A;  4LUE A;  4FT4 A;  3I35 A;  3UA7 A;  1VQK Q;  2RQU A;  2LCS A;  1C6V X;  2ZPG B;  3OQ5 A;  1W2B P;  3VS3 A;  3M56 A;  2M0O A;  1SSF A;  1VUB A;  3S3N A;  3I5R A;  3UT1 A;  2MAM A;  2ESW A;  5AYF A;  2F69 A;  2K5L A;  3U23 A;  3QWX X;  3P8H A;  1TTH B;  4IKF A;  2VXE A;  2E64 A;  5A0G A;  1WQW A;  1XTD A;  2P4R A;  2EPD A;  4FYW B;  3ZEH A;  1LPL A;  1TXQ A;  2DMO A;  2HAX A;  1M1K C;  1QCO A;  3CCQ A;  4X9D A;  1OU9 A;  1QWF A;  1WNL A;  5FLX E;  1KG1 A;  2CKK A;  2FB7 A;  1WHG A;  3H9N A;  1Q86 U;  3RKY A;  2NUP B;  3VS0 A;  3KUF A;  1YHQ Q;  2JVV A;  2ZPH B;  4L5G A;  3OS0 A;  4OML A;  4C0D C;  4E7H A;  1TH7 A;  3OMG A;  2GCX A;  3EH1 A;  3NGP A;  3RR6 A;  2DVJ A;  1R8O B;  2ENM A;  2ZZD A;  4LN2 A;  1C1A A;  4M77 C;  2JMC A;  3QG1 A;  2QA4 Q;  2LTO A;  2J6K A;  1MV3 A;  2KK4 A;  1MMN A;  4IUR A;  2L3R A;  3OW2 P;  3INZ A;  4II1 A;  1AVZ C;  2YXY A;  1I4K 1;  1KHC A;  5CAI A;  1QVF S;  2XG8 D;  2X9H A;  2RQT A;  4HA8 A;  4E47 A;  2YUN A;  4HKE A;  2KXC A;  4E7S A;  4RTV A;  4DEY A;  3CCQ T;  2OTL Q;  3AHU A;  1W6X A;  2E4H A;  1VQL Q;  4EDU A;  2DL7 A;  3OS1 A;  2A7Y A;  2DIQ A;  2DPP B;  1EFN A;  2Z0W A;  2RM4 A;  5GAO l;  4FYV B;  4F04 B;  3JCM J;  5GAN 5;  3CPW P;  1Y71 A;  4Z8A A;  1WPY A;  2E5K A;  4CRI A;  4C8Q D;  2K3Y A;  1X27 A;  2DKG A;  2BE9 B;  4J6W A;  1OZ2 A;  4M77 F;  3JCM b;  3H0F A;  1M90 C;  3G6E Q;  2ED0 A;  2LX9 A;  1BBZ A;  4PJL A;  2FZG B;  1NLO C;  3I56 Q;  4M78 D;  1PKT A;  4Z02 A;  2HL5 C;  1D3B B;  2QDY B;  1Q7Y U;  1F1B B;  2M9U A;  5J39 A;  1UFF A;  1NG2 A;  3I55 T;  2C0O A;  3UDC A;  1WHJ A;  5GAO p;  3OYA A;  2PVD B;  1VYT A;  3I9Q A;  4M4Z A;  1VQ6 Q;  2VUB A;  1UE9 A;  3JB9 I;  1QVG P;  1VYV A;  4AT1 B;  4C0F A;  2PTK A;  4IIO A;  5HK0 A;  3EH2 A;  1ZBJ A;  1WX6 A;  4PJO B;  3L2Q A;  5IHN A;  4DA4 A;  3E2U A;  1VQ7 Q;  2CZ7 B;  1ACM B;  1KK7 A;  2RHI A;  4C92 B;  2PU9 B;  3GIB A;  2L5Q A;  3SB2 A;  3QWY A;  1JRI A;  1E6G A;  3FEO A;  3JAM E;  3FJ5 A;  2YLC A;  5CK9 A;  4CI0 C;  2NUP A;  3EG9 B;  1H8K A;  3SEM A;  4J9F A;  4XTX A;  2F1L A;  2B8A A;  2LZ6 B;  1QKX A;  2GTJ A;  2MPX C;  1M5Q 1;  2QQ9 A;  5GAN e;  3NMZ C;  3EAE A;  5GMK l;  1KQS A;  3THK A;  1I1J A;  3E19 A;  3REB B;  2JJ9 A;  1JJ2 P;  5FU7 B;  4J6Y A;  3MO8 A;  1WHL A;  3C95 A;  4JDS A;  1Q7Y R;  3LH0 A;  1RLQ C;  2CSI A;  2R58 A;  1PNJ A;  1WJS A;  3BFM A;  3JCM P;  5GAN 8;  1YJW Q;  1IRE B;  3V7C A;  2RPN A;  2ROT A;  4OP0 A;  2RD1 A;  1ZHI A;  1M2V B;  3OSS C;  3V8J A;  1BK2 A;  5KYX B;  1RI0 A;  3X28 B;  3QO3 A;  3RIR A;  4L59 A;  4PL6 A;  2KBT A;  2XDD A;  3PVL A;  1TOV A;  2P84 A;  4ELY C;  1FWZ A;  1WQ7 A;  2YSQ A;  4IUQ A;  2OTJ A;  1VQM Q;  1MMG A;  4XK8 E;  1KQ2 A;  3OYJ A;  4M7D B;  4RTW A;  3M9Q A;  1WYX A;  4XTV A;  1D09 B;  3M55 A;  1NE8 A;  2K4Y A;  3CCM Q;  1N6A A;  4JJD A;  2DEQ A;  5EG2 A;  2L0A A;  5LJ5 e;  3I5S A;  3G71 A;  4MZM A;  1BKB A;  2GQV A;  1RAF B;  4PLI A;  3FB9 A;  1H64 1;  2ECZ A;  3CME Q;  3SHW A;  4M78 G;  2CT3 A;  2V8J A;  2MMP A;  2COW A;  2E10 A;  2XMF A;  3RBB B;  3RUX A;  1M1K U;  5M9O A;  4C5I A;  4CC2 A;  2DBK A;  1D3B A;  3CBO A;  1AWW A;  3A5Z B;  1TUC A;  1PC0 A;  2I2L A;  3H6Z A;  3G7Z A;  2NUT B;  3JCM f;  1PRL C;  4GY5 A;  2VYT A;  1M27 C;  3TSW A;  4BE1 A;  5HCK A;  1FXX A;  5CKB A;  2OTJ T;  4X34 A;  8ATC B;  2J6O A;  4ESR A;  3RDV A;  2QG9 B;  4OGE A;  1XQH A;  2DF6 A;  4N4H A;  1K9M R;  2ZPE B;  1AZE A;  1N8R C;  1OUL A;  2A36 A;  2XIC A;  4X9C A;  2PUK B;  4M77 D;  4MDW A;  2EFI A;  1GRI A;  1RAE B;  4C5H A;  1VQ4 A;  4IUT A;  3VS7 A;  3G71 T;  1YIJ A;  3JB9 F;  5EC7 A;  4N4I A;  4E7K A;  2COY A;  3R6N A;  4IUP A;  5J26 A;  2YUO A;  2E12 A;  3RKX A;  4C92 A;  1VQO Q;  2FEI A;  4KGV B;  1BI2 A;  1AEY A;  2F2V A;  3LH5 A;  3NHN A;  4DEX A;  5GAN 6;  4RCB A;  2HQX A;  3NTK A;  4PJO E;  2NWM A;  3VS1 A;  2YRD A;  4MZP A;  2RA2 A;  4PK4 A;  2RHU A;  4M78 B;  5FWC A;  3M0S A;  4R55 A;  2R5A A;  4C92 E;  3SWN B;  4EMK B;  4J9D A;  4LD6 A;  2HEQ A;  3OY9 A;  5LJ3 d;  1VQP Q;  2IG0 A;  2WSF E;  1HSQ A;  4MDX A;  2RHZ A;  3G4S A;  4A4K A;  1SSH A;  5GAO m;  1BU1 A;  1RAG B;  3HFN A;  5HY6 A;  4LDY A;  4HT9 A;  1E7O A;  1QKW A;  2RK2 A;  1VQ4 T;  1ZBX A;  3N5B B;  1KHI A;  1YIJ T;  2Y90 A;  3GLX A;  2YDL A;  2A37 A;  1R0B G;  2LNH B;  3OMC A;  1FMV A;  3ASK A;  1M1F A;  3CCS A;  4JJN K;  5LJ3 h;  5GMK i;  3PT9 A;  3JCM g;  2NUZ A;  3J7A F;  3C4S A;  3QYG B;  2D9T A;  4A54 A;  3MEU A;  1D1A A;  1NJI R;  1K9A A;  1PD0 A;  2JT4 A;  2O01 E;  2Y4Y A;  5GAN d;  2B86 A;  2FO0 A;  4JRK A;  5C0M A;  2EQK A;  5GJV B;  3CCR Q;  3FC3 A;  2BZX A;  5GAM f;  1D0Z A;  3CCJ A;  3V7S A;  1KD1 U;  3G4S T;  2QK0 A;  3RMQ A;  1NPP A;  4J83 A;  2DO3 A;  2VGM A;  2YUQ A;  5KYW B;  3LW5 E;  2BIV A;  2HD0 A;  5GAO q;  2FVU A;  1B07 A;  2KNB B;  5GAN h;  4C8Q F;  2V26 A;  4F7U F;  4M75 B;  1Y07 A;  2JM9 A;  1Y0M A;  1OX9 A;  3VUB A;  4BI3 A;  1Z9Q A;  2NUT A;  1ZSZ A;  1KQS P;  2VVK A;  4XU0 A;  1N5Z A;  3CXC S;  4E6R A;  4OB2 B;  1N9S A;  4M77 G;  4A4H A;  3EHR A;  3OYN A;  4BDY A;  2RI3 A;  1QP2 A;  5LJ5 d;  4L6V 5;  4NS5 A;  5L23 A;  3CCJ T;  8AT1 B;  3TCJ A;  2QGG A;  1RAC B;  2R57 A;  1LVK A;  3CC4 A;  1ZSG A;  4ZN3 A;  1Y96 A;  5GMK m;  4UC4 A;  4EMG A;  2YLB A;  2W0Z A;  2YT6 A;  1FX7 A;  4C0G A;  2X4J A;  3X24 B;  1RAI B;  2YRC A;  3JRZ A;  2X4X A;  1ZUU A;  2DIG A;  2QYZ A;  1X2K A;  1OYX A;  2GFA A;  4M7A F;  3M59 A;  5LJ5 h;  3NTI A;  3OYY A;  2JTE A;  4BDZ A;  1KD1 R;  3OYE A;  2DRM A; 
#chains in the Genus database with same CATH homology
 4M75 D;  2XDB A;  5IN1 A;  3OYD A;  4N0A C;  5LJ5 g;  1K9M U;  4M78 A;  3JCM J;  3GF5 A;  3HHT B;  5GAM g;  5GAN 5;  4HT8 A;  3V8L A;  1Y71 A;  5FU6 B;  1WPY A;  3RES A;  3V8K A;  3SWN A;  4CRI A;  2DZ9 A;  3EFR A;  5A0L A;  1UGQ B;  3CPF A;  3HL8 A;  4C8Q D;  3CME T;  4M7D F;  2K3Y A;  1PSE A;  3OYH A;  3OS2 A;  1VQO A;  2DKG A;  4R56 A;  3CCU T;  2DD5 A;  2PVG B;  4J6W A;  1OZ2 A;  4V2S A;  2DXB A;  3QXE B;  3X26 B;  3QUI A;  4KUL A;  1OI1 A;  4JUV A;  2X4Y A;  3KBG A;  4M77 F;  3CMA T;  1UEB A;  3JCM b;  5DM7 R;  1YBY A;  1M90 C;  2DK3 A;  4LDV A;  4C0Z A;  4D6W A;  2LX9 A;  2PUO B;  5FRM A;  4EPC A;  4M78 E;  1BIA A;  1N27 A;  3KXT A;  1O75 A;  2QQR A;  1YI2 A;  3A8O B;  2RHY A;  5FRO A;  5A0D A;  4M78 D;  3CC4 T;  3OA6 A;  4Z02 A;  1D3B B;  3TRE A;  2QDY B;  2ZPF B;  3A8G B;  4JRI A;  3L2U A;  3M5A A;  1Q7Y U;  2M9U A;  4GLK A;  5J39 A;  2E1H A;  3MEA A;  2H3J A;  3MEW A;  3VYH B;  3OYM A;  4OB3 B;  3I55 T;  1M4Z A;  3A8H B;  4P5N A;  3UDC A;  2QEX T;  1VQP A;  3V7R A;  4ZTJ A;  1Q82 C;  4JS4 A;  1B34 B;  1VQN A;  2D6F A;  2F5K A;  5CO7 A;  5GAO p;  4XU3 A;  1U8R A;  4A4E A;  3M57 A;  3FIF A;  3NTH A;  3LGL A;  3OYA A;  3UWN A;  2KDS A;  2LT1 A;  2PVD B;  4BUG A;  4LD9 K;  2RJC A;  4XTW A;  5KE3 A;  4M78 C;  2CZ6 B;  1VQL A;  2P4T A;  3LX7 A;  3QHS A;  5CIU A;  2LCC A;  4XTZ A;  4EMK C;  3SWN C;  2RK1 A;  2VUB A;  3JB9 I;  3L2W A;  1S72 A;  4BAC A;  3E1S A;  4C0F A;  1Q7Y C;  3BDU A;  3BDL A;  1VQ5 A;  1G5V A;  2JTM A;  4JRQ A;  2VXF A;  5HK0 A;  1W2B A;  5KCO A;  3WVE B;  2ZPI B;  5I21 A;  2KVQ G;  1N8R U;  5CVI A;  5HK3 A;  4B9W A;  2DJZ A;  1K8A U;  4PJO B;  3OS5 A;  3L2Q A;  1VQO T;  3M53 A;  2K5F A;  4DA4 A;  4QVC A;  3CCL A;  3CC2 T;  3JCM c;  3OB9 A;  1KC8 U;  2LVM A;  2CZ7 B;  3O8V A;  4LDU A;  2RHI A;  2XD0 A;  3OSV A;  4LDX A;  1I8F A;  1WJQ A;  4C92 B;  4XAX B;  3L2V A;  1UGP B;  2LCL A;  2CZ0 B;  2PU9 B;  4YTL A;  1XOV A;  3PIO A;  1VQK A;  3BW1 A;  1YI2 T;  1K73 U;  3GIB A;  2MF2 A;  3BY7 A;  4FU6 A;  1MGQ A;  5CKH A;  1Q86 C;  2M1H A;  3FLG A;  2L5Q A;  4RMO A;  2JNG A;  1K8A C;  3SB2 A;  4E7I A;  4DOV A;  2LRQ A;  1QVP A;  1JRI A;  3FEO A;  1VQ9 A;  3JAM E;  3CCE T;  2DZC A;  2JTF A;  3MP6 A;  2YLC A;  5CK9 A;  2QTX A;  4CI0 C;  1VQP T;  1NJI U;  1BIB A;  3JSC A;  1VQN T;  3CCR A;  5GMK j;  1I81 A;  1VIF A;  1KC8 C;  4WF2 A;  1NPR A;  2HBP A;  4PJO A;  3JCM Q;  3OBW A;  2YRV A;  2VC8 A;  5C6S A;  1X01 A;  4M75 A;  4J8O A;  4XTX A;  2RI2 A;  1NZ9 A;  5GAN 3;  2QI2 A;  4ZGJ B;  1VQL T;  4XTU A;  1K73 C;  1G3Y A;  2B8A A;  2RHX A;  3E9F A;  3CC7 A;  2DTI A;  2QXF A;  3TEE A;  3M54 A;  3CCV A;  1M5Q 1;  2HNI A;  4QQG A;  1O9S A;  1KG1 A;  2QQ9 A;  3HPW A;  5GAN e;  2XDP A;  3I55 A;  5GMK l;  3EAE A;  1HXD A;  1S72 T;  3OW2 A;  4C8Q A;  1KQS A;  3VUZ A;  3E19 A;  1VQ5 T;  4F7U A;  4BE2 A;  4NOY A;  2K5I A;  4J6Y A;  3MO8 A;  3Q1J A;  5FU7 B;  3C95 A;  2X35 A;  4JDS A;  3WVD B;  1X6O A;  2AHJ B;  3LH0 A;  2RO0 A;  3JB9 J;  1YJ9 A;  2WAC A;  4RKU E;  1YIT A;  2R58 A;  3S6W A;  5GAO r;  1WJS A;  2QQS A;  3BFM A;  3JCM P;  4M75 E;  4PJO D;  2D0Q B;  5GAN 8;  4OB1 B;  1YHQ A;  1BI1 A;  4HCZ A;  1Q81 U;  1IRE B;  3V7C A;  5I2S A;  4FSX A;  1VQ7 A;  2M16 A;  4OP0 A;  2IVW A;  2RD1 A;  4OF1 A;  2LT4 A;  4C92 D;  3MP1 A;  4C8Q E;  3A8L B;  1ZHI A;  3OSS C;  3V8J A;  4F7U E;  4M7A B;  1RI0 A;  4NL3 A;  3CPW S;  3X28 B;  5CQY A;  3SDZ A;  3QO3 A;  3RIR A;  1VQK T;  4L59 A;  4OMF B;  5DLQ E;  4PL6 A;  2XDD A;  4XU1 A;  4ELY C;  1FWZ A;  4QQD A;  4QVD A;  3L1A A;  1WQ7 A;  1ZQ1 A;  3JCM W;  2QA4 A;  3PNW C;  1EIF A;  2KQW A;  1VQ9 T;  4M75 G;  4IUQ A;  4M75 C;  2OTJ A;  1Q81 C;  4C0D B;  3QZ9 B;  4PNO A;  5GAN 4;  1MHN A;  4XK8 E;  3CCR T;  4OGC A;  1KQ2 A;  3DLM A;  2WSE E;  2CGH A;  3OYJ A;  3H8Z A;  1K9M C;  4M7D B;  3GNG A;  3LYI A;  4BD3 A;  5LJ3 j;  3M9Q A;  2EJF A;  1QVF A;  4FM4 B;  4KUI A;  2V8I A;  3FDR A;  4FT2 A;  4JLI A;  3PIP A;  3OYI A;  4XTV A;  4C8Q C;  3M55 A;  2ZCF B;  1NE8 A;  2XID A;  3RKW A;  3CC2 A;  1M8V A;  2K4Y A;  1W2B S;  2FL7 A;  3CC7 T;  4M77 B;  2XU8 A;  3CCV T;  1G3W A;  2JOY A;  2DTH A;  5I2M A;  1N6A A;  3JB9 G;  4M7A A;  2BKD N;  3S3O A;  2V8K A;  2DEQ A;  1DJ7 B;  5EG2 A;  3HRU A;  4DOW A;  5LJ5 e;  3G71 A;  2CYZ B;  4MZM A;  5GAM e;  2E5Q A;  3PFS A;  3P8B B;  1BKB A;  2A3L A;  2EIF A;  2GQV A;  2E41 A;  2OTL A;  3QBY A;  3PMT A;  4PLI A;  5HKC A;  5LL6 S;  3F70 A;  2EWN A;  3FB9 A;  1H64 1;  3OYK A;  3R6O A;  1YJ9 T;  1YIT T;  3RER A;  2DAQ A;  1IZ6 A;  4XU2 A;  1KQ1 A;  1U1S A;  4M78 G;  4B9X A;  2V8J A;  4MML A;  3M4Y A;  2MMP A;  1WGS A;  3JCM e;  4ZGE B;  2DXT A;  2E10 A;  4BB7 A;  1YHQ T;  1YJW A;  1VQ8 T;  3DKM A;  3PTA A;  4M7D A;  2P0Q A;  3RUX A;  1M1K U;  5M9O A;  5LJ3 e;  1VQ7 T;  4M7A E;  2KAF A;  2EAY A;  4C5I A;  5D6X A;  3HSB A;  2C06 A;  1VIE A;  4PLL A;  1D3B A;  3CBO A;  4N4G A;  4M7A D;  2RB6 A;  3A5Z B;  4M77 A;  3OYF A;  4EMH A;  2DVE A;  3ZFJ A;  3M4G A;  3MHX A;  4VUB A;  3P8D A;  2FYK A;  2RJF A;  3CPW A;  4IUU A;  3DLL A;  4C5G A;  2JN0 A;  2I2L A;  3H6Z A;  1B34 A;  2KMT A;  2E6Z A;  3G7Z A;  4C5E A;  5CKD A;  3URG A;  5KH6 A;  3JCM f;  4GY5 A;  2VYT A;  2O4X B;  2XI9 A;  2JZ2 A;  2YHT A;  2QA4 T;  3QPH A;  4BE1 A;  1FXX A;  5CKB A;  4M7D E;  2OTJ T;  5FRN A;  4X34 A;  5LJ3 f;  3G6E A;  3MEV A;  4M75 F;  3MCA B;  5GAN j;  5FU6 C;  2G3R A;  4M7D D;  3J80 E;  3X25 B;  4LDW A;  3I56 A;  1KQS S;  4OGE A;  4M7A C;  3OYB A;  1XQH A;  4N4H A;  1UB4 A;  3ER0 A;  2ZPE B;  3X20 B;  3GNF B;  3VV0 A;  1N8R C;  2DD4 A;  2EYQ A;  2XIC A;  4O6J A;  4X9C A;  3CCS T;  1QVG A;  3CEY A;  2EQJ A;  2PUK B;  4J6X A;  4M77 D;  4MDW A;  1BI3 A;  2EFI A;  5A2Q E;  4HCB A;  3OYG A;  4C5H A;  2DXU A;  3JCM X;  1VQ4 A;  4IUT A;  4QW2 A;  3G71 T;  3QII A;  1YIJ A;  3JB9 F;  2MWP A;  2EQU A;  2NLU A;  4N4I A;  3OW2 S;  3L2Z A;  1LNX A;  2OTL T;  4FL6 A;  4E7K A;  2JUF A;  4KUD K;  3QZ5 B;  2EJG A;  2O4X A;  4IUP A;  5J26 A;  2E12 A;  5GMK h;  1PSF A;  3S3M A;  1Y7X A;  3CBP A;  3RKX A;  5KCH A;  2RJD A;  2X4W A;  3QJY A;  2K2V A;  4C92 A;  2EKO A;  1V29 B;  4M78 F;  1YJW T;  4BY6 B;  1BI2 A;  1VQ6 A;  1BI0 A;  1XNI A;  4QQ6 A;  3NFC A;  5CKE A;  3FJP A;  3VKI A;  5GAN 7;  5GAN 6;  4RCB A;  2HQX A;  2EQM A;  3LWH A;  3NTK A;  1LJO A;  3EFS A;  1NJI C;  1H3Z A;  4PJO E;  2XK0 A;  3WXM B;  2L89 A;  1OZ3 A;  2P0K A;  5CQX A;  3A8M B;  3DB3 A;  3FRN A;  4MZP A;  3GPL A;  3CCL T;  2RA2 A;  2RH2 A;  4E7J A;  1LOJ A;  4XQ3 A;  2RHU A;  4M78 B;  2E70 A;  1UGR B;  1M9S A;  3JCM d;  4MMK A;  2RI5 A;  1VQ8 A;  4ZGD B;  4R55 A;  2R5A A;  4C92 E;  3SWN B;  4EMK B;  4ZTF A;  4LD6 A;  4Y91 A;  3HP9 A;  5DY9 A;  1G3S A;  3HFO A;  3OY9 A;  1P92 A;  3SD4 A;  5LJ3 d;  5GAN f;  4BI4 A;  1QW1 A;  2IG0 A;  2WSF E;  5L8R E;  3CD6 A;  4PKC C;  3CXC A;  3G6E T;  3QDR B;  4MDX A;  2KSS A;  1UGS B;  3HKS A;  3LLR A;  2RHZ A;  3G4S A;  4A4K A;  3I56 T;  3TU4 K;  4ZN1 A;  5LJ5 j;  5GAM j;  5CKF A;  5GAO m;  1JBM A;  1X75 C;  4PJO G;  5D6Y A;  4JRP A;  3OYL A;  4PJO C;  3QSU A;  3HFN A;  3DB4 A;  2F5T X;  2E6N A;  5HY6 A;  4LDY A;  1JJ2 A;  4HT9 A;  4RCC A;  2RK2 A;  1VQ4 T;  1ZBX A;  2HQE A;  3PMI A;  3N5B B;  4NL2 A;  5J3B A;  3J81 E;  4J5Y A;  4DQ2 A;  1KHI A;  4C92 C;  4C92 G;  1YIJ T;  2Y90 A;  3GLX A;  1BYM A;  5IAY A;  3GP8 A;  3CCE A;  2L8D A;  2RJE A;  3JCM h;  4EMK A;  1YJN A;  4C8Q G;  3OMC A;  1M1G A;  3ASK A;  1M1F A;  4QVZ A;  3VJP A;  4F7U G;  3CCS A;  5LJ3 h;  3OYC A;  4JJN K;  5GMK i;  3PT9 A;  3JCM g;  1RL2 A;  2ZGW A;  4KBM B;  3LGF A;  4OVA A;  3J7A F;  1Q82 U;  1VQ6 T;  1W4S A;  2LC4 A;  3JB9 D;  3C4S A;  4RG8 A;  3HRS A;  5LJ3 g;  3VYG A;  3QYG B;  3L2R A;  3UPU A;  2D9T A;  4A54 A;  5IT9 E;  3T9N A;  5CCA A;  4FT4 A;  3QYH B;  2CZ1 B;  1WJR A;  3MEU A;  2E65 A;  2EJ9 A;  1YCY A;  2O01 E;  2ZPG B;  3OQ5 A;  3PGG A;  5DLO A;  2Y4Y A;  3JCM V;  3M56 A;  2M0O A;  1SSF A;  2Y4X A;  1VUB A;  5GAN d;  4Y28 E;  4BY6 C;  3UT1 A;  3S3N A;  2MAM A;  4JRK A;  5C0M A;  3M58 A;  5AYF A;  2EQK A;  2F69 A;  2K5L A;  3HRT A;  1QVG S;  3CD6 T;  5LJ5 f;  3FC3 A;  4MZT A;  5GAM f;  4A53 A;  5FU7 C;  3LWI A;  3CCJ A;  3P8H A;  3V7S A;  3C12 A;  3G4S T;  1KD1 U;  2GFU A;  2OAU A;  4Q5W A;  2PVO B;  2VXE A;  3RMQ A;  4IKF A;  5GAO n;  1NPP A;  2XKO C;  4HCC A;  2E64 A;  2DXC A;  5A0G A;  3QKJ A;  1WQW A;  3E9G A;  4J83 A;  1XTD A;  1I5L A;  4IUV A;  4RG2 A;  2LDM A;  2DO3 A;  4PJO F;  2VGM A;  2PQW A;  1JB0 E;  3ZEH A;  3LW5 E;  2ZPB B;  2HAX A;  1VQM A;  1M1K C;  2QQB A;  3RMS A;  4ATO A;  3CBM A;  3CCQ A;  2BIV A;  2K57 A;  3ME9 A;  4M7A G;  2MWO A;  1WNL A;  4X9D A;  4C92 F;  5FLX E;  2QQA A;  2CKK A;  2FB7 A;  2HD0 A;  5GAO q;  2FHD A;  2FVU A;  4M77 E;  3RKY A;  1YJN T;  1Q86 U;  1KD1 C;  5GAN h;  4BE0 A;  3KUF A;  4C8Q F;  4A4F A;  3CCM A;  2JVV A;  4E7L A;  2KY9 A;  4F7U F;  2BUD A;  2ZPH B;  4L5G A;  1N9R A;  4M75 B;  1Y07 A;  4TVR A;  5GAN g;  1Y96 B;  3OS0 A;  4C0D C;  4E7H A;  1TH7 A;  3C94 A;  3VUB A;  2R5M A;  3QJ6 A;  2LQ8 A;  3OMG A;  4BI3 A;  4M7D C;  4BI8 B;  4M7D G;  2GCX A;  2VGN A;  4J7I A;  4XU0 A;  4J7F A;  2VV5 A;  3L42 A;  4C8Q B;  3CXC S;  3CME A;  1R8O B;  3OBY A;  2LNV A;  4OB2 B;  3VU3 C;  3JB9 H;  4O5V A;  4F7U B;  1N9S A;  4N0A A;  2ZZD A;  3CCU A;  2LQK A;  2K3X A;  3QG1 A;  4M77 G;  1HK9 A;  4M77 C;  4A4H A;  2GF7 A;  4A4G A;  3OYN A;  4BDY A;  2LTO A;  2RI3 A;  3CMA A;  1QP2 A;  5LJ5 d;  1AHJ B;  2KK4 A;  4L6V 5;  5GAM d;  4IUR A;  4NS5 A;  2WSC E;  2L3R A;  3INZ A;  4KT0 E;  4II1 A;  1JJ2 S;  4XTY A;  3CCJ T;  2MI6 A;  3TCJ A;  3GOX A;  1I4K 1;  5CR2 A;  2R57 A;  3SFM A;  3MET A;  1KHC A;  3CC4 A;  5D6W A;  4JLG A;  4ZN3 A;  1Y96 A;  5CAI A;  5GMK m;  4UC4 A;  2XHC A;  1QVF S;  4EMG A;  2YLB A;  2XG8 D;  1FX7 A;  3ZBD A;  4ME7 A;  4HA8 A;  2X4J A;  4C0G A;  3X24 B;  5KE2 A;  4JS5 A;  4E47 A;  3JRZ A;  2QEX A;  1G3T A;  2P0P A;  1VQM T;  1QP3 A;  2X4X A;  2DIG A;  4HKE A;  3AHU A;  3CCQ T;  1OYX A;  2CS7 A;  4ELZ C;  1GXI E;  2GFA A;  3MP8 A;  4M7A F;  3M59 A;  2DTO A;  4EDU A;  5LJ5 h;  3NTI A;  2A7Y A;  3OYY A;  3OS1 A;  2DIQ A;  4OB0 B;  5GAM h;  3OYE A;  2DPP B;  3CCM T;  4BDZ A;  5GMK e;  2RM4 A;  1U1T A;  1M90 U;  5GAO l;  5GAN 2;  4FIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...