2E6ZA

Solution structure of the second kow motif of human transcription elongation factor spt5
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
b'GSSGSSGFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation factor SPT5
molecule tags Transcription
source organism Homo sapiens
publication title Solution structure of the second KOW motif of human transcription elongation factor SPT5
rcsb
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e6zA00
3CCSA 1VQ5T 3CCST 1VQ7A 2OTJA 1VQ7T 3LGFA 3TREA 1Q86C 2OTJT 1X6OA 3J80E 3G71T 1KC8U 3P8BB 2OTLA 1YJ9T 2E6ZA 1YJWT 2KDSA 1VQLT 1RL2A 1M1KU 2QA4A 1UEBA 3CMAA 1YJNA 2LVMA 3CCRA 1YJNT 1VQMA 1YHQA 3CMAT 3G4ST 1M1KC 3JAME 2DO3A 1YBYA 3CCQA 3LH0A 3CC4A 3CC7T 1QVGA 3CCJA 1VQ4A 3I55A 1NJIU 1YI2A 1YI2T 4RG2A 5J26A 1VQPA 1N8RU 3CCUA 5HY6A 3CCUT 5A2QE 1XTDA 2LQ8A 2KVQG 1KHIA 1NJIC 1W2BS 3CPWA 2JUFA 1Q81C 1VQ8T 4TVRA 1VQKA 2IG0A 1KC8C 3KBGA 3CPWS 1K73C 1VQ9T 1VQ5A 2JVVA 3CCVA 3CCVT 5IT9E 3CCLT 3CCLA 4ZN3A 1S72A 1S72T 1K8AU 3OW2S 1VQ6T 2OTLT 3CPFA 3CCEA 2CKKA 2QEXA 2QEXT 1VQLA 3DB3A 2JNGA 1K8AC 3CD6T 1K9MC 1W2BA 2XHCA 3CD6A 4X34A 5FLXE 2QA4T 3CCRT 1VQMT 1VQPT 2L3RA 3A5ZB 1NPPA 3OYYA 4CRIA 3CXCA 3CMEA 3CMET 3CCMT 1VQOT 3CCMA 1VQOA 2LCLA 1M90C 1VQNT 1N8RC 2E70A 3J81E 3I56A 1KQSA 3CCQT 5IAYA 3LGLA 4ZN1A 3HKSA 3CCJT 1YIJA 3DB4A 3I55T 2EIFA 3G6ET 1Q81U 1Q86U 3OW2A 4YTLA 1Q82U 3G71A 3DLLA 1YITA 1YITT 1YJ9A 1YJWA 1M90U 1KQSS 2MI6A 1NPRA 1M1GA 1Q7YC 1QVFS 3CXCS 1XNIA 1YHQT 1JJ2A 5LL6S 3G4SA 1KD1U 1Q82C 1K9MU 5DLQE 1QVFA 1VQ6A 3J7AF 3CCET 3CC4T 3CC7A 2G3RA 1KD1C 1VQ4T 1NZ9A 3PIPA 1Q7YU 3CC2A 1JJ2S 3CC2T 4QQDA 5DM7R 1BKBA 2MWOA 1SSFA 1EIFA 1VQNA 1IZ6A 3ER0A 1VQ8A 2JOYA 1VQKT 3I56T 5J3BA 2MWPA 3PIOA 1QVGS 1K73U 1YIJT 1VQ9A 3G6EA
chains in the Genus database with same CATH superfamily
3EFSA 2F69A 1QMCA 4NOYA 2KK4A 2EFIA 2LNVA 5CVIA 2XK0A 3T9NA 2DL4A 4HVVA 1Q82R 4JRPA 1BCOA 2LQKA 2RD1A 4E7HA 2OTJQ 3Q1JA 2G6FX 4UC4A 1SPKA 5D6WA 3QJYA 1KG1A 1U3OA 4AT1B 2ZPBB 4XU3A 1YITQ 2QQ9A 2AT1B 1H8KA 1XJWB 3CPWA 2KY9A 4M77E 2EW3A 1UGRB 2J6FA 1GXIE 1JB0E 2DA9A 1M8VA 3A8OB 1O9SA 2RJFA 2L3SA 4O6JA 3VUBA 2YLCA 2PZ1A 4OB0B 4M7DB 2HBWA 1BCMA 3MP1A 1PSEA 2QEXQ 3JCMd 2LC4A 2FPFA 2DBKA 1VIEA 4BB7A 1YFNA 4XTXA 1ZSZC 1T0JA 2E70A 3TEEA 3JCMc 3RR6A 4J9EA 2ROLA 2FB7A 3QBYA 1M2VB 2K3XA 1K4US 3OYLA 1SSHA 2XG8D 4M7DF 4C8QA 4PJOD 2RI3A 1AT1B 2JZ2A 2BZXA 2LT1A 4BDZA 3HPWA 3JCMP 1JJ2A 2E5QA 2GQIA 3G4SA 4QKUA 4RTYA 3QWYA 3I5RA 4RTUA 5LJ3d 1U1TA 1WHHA 2CZ0B 2VGMA 1U06A 3JB9F 3LH5A 4BI8B 4MZPA 1NEGA 1K1ZA 1QCNA 3CC7Q 2IIMA 2SRCA 4WF2A 4QW2A 1HJDA 1Y96B 2A37A 3UA6A 1K73R 5CKDA 2ZGWA 3JCMg 3E9FA 4A4FA 4LDYA 3BE3A 2A36A 2EYWA 2AHJB 3OA6A 3QYHB 1RI0A 1FWZA 4M78E 1WXTA 2AKLA 2CP0A 5KE2A 3CC4A 1WIEA 2EWNA 3UWNA 5LJ3g 5LJ5d 1X75C 3P8DA 5FWCA 2RQTA 3QDFA 2ATCB 3MEUA 1NEBA 3QZ5B 4LUEA 3OYHA 1ZSGA 2JS2A 4J8OA 2QI2A 1IHVA 2D9TA 3SD4A 1VQ6T 1IXDA 2LJ3A 2QEXT 3LW5E 1CSKA 4F17A 2QDLA 2DX1A 1J3TA 2OTLQ 1T3SA 2H3EB 3H0FA 3CMET 2FEIA 2H8HA 2M02A 1BBZA 2O01E 2VXEA 4ZN1A 5D7UA 5IXBA 3N5BB 4PFZA 1QWEA 2LQNA 1G3TA 3BY7A 1WFWA 4FSXA 1AWOA 1YITT 2OX7A 1MV0B 5KYYB 2AK5A 2CH4W 5CCAA 1Q7YC 2DYIA 1UGSB 1MMNA 1G83A 1MV3A 1BI1A 3OSSC 1RAIB 2MYSA 4EPCA 5GAN4 1JJ2S 3C4SA 3R6OA 2GTJA 1AEYA 1W4SA 3FLGA 2CGHA 5IHIA 4OMPA 4XK8E 2ESWA 4LDWA 5GAMj 2OI3A 1F1BB 3OYAA 2DXBA 1AZEA 2HSEB 1K9MR 1CKAA 1OI1A 5GJVB 5HK0A 3L42A 4L5GA 4E2FB 4DQ2A 3L1AA 3CMAT 1VQMA 2DERA 2DZCA 1WLPB 4Z88A 2EYQA 1IRXA 4F16A 2YWWA 3M0RA 2RNAA 2V8IA 2QQBA 2V8KA 2R58A 4CC3A 3M58A 4E7JA 3EH2A 1N8RU 2ENMA 5CKBA 1ZQ1A 3UF4A 2J6OA 4OF1A 3CC4Q 4QT7A 4OMNA 4EMGA 3A8HB 3VS5A 2EQKA 3OS2A 2DL8A 3EG2A 3TCJA 3QJ6A 3V7CA 2PVGB 3I9QA 2ZPIB 4OMLA 4JRQA 4R0KA 2HEQA 5CQXA 3CCLT 4ZN3A 1K76A 2YRCA 3PNWC 1I81A 5LJ5g 2KYMA 2RPNA 2XHCA 2F5KA 3CCRT 1M90C 3O5ZA 4E7ZA 3EG9A 2GTOA 3OBYA 5LJ5f 1Q81U 2F2VA 1VUBA 4FIBA 4N4GA 4K11A 1LNXA 5L8RE 5C6SA 3FIFA 3L2UA 2M1HA 3MJXA 2JMCA 2ED0A 4QVCA 4BD3A 3PGGA 4DA4A 2MIOA 2X3XD 4HCKA 2CDTA 5FRMA 1AWXA 4PK4A 2J05A 3EG9B 2BZ8A 4RMOA 2ZPHB 3CD6Q 4M75C 3GLXA 2KT8A 3ER0A 2CT4A 5J3BA 3L2QA 3VS2A 1D1BA 4PKCC 2JM8A 1PHTA 3JCMh 2NUTA 5KYUB 1PNJA 2WACA 1OX8A 1YNZA 2RQVA 4WCIA 1UFFA 1ZA1B 3CEYA 2PTKA 1MMAA 3EHQA 2EJGA 4ATOA 2QTVA 4OVAA 4HT9A 1XTDA 4C8QE 2ABLA 1KHIA 3NGPA 3M0TA 2YRDA 2O9VA 3H0HA 1D0YA 3BDLA 4II1A 5A0LA 1VYTA 3KBGA 4WTOB 3BDUA 1RAAB 1GFDA 1PCXA 2NUZA 1V76A 2HKNA 4BI3A 3CCLA 4M7DC 2EQJA 3X26B 1S72T 4PJOA 2JTFA 3CBMA 2RJCA 4M7AD 1TUGB 2QEXA 2K6DA 4A4KA 1GCPA 2DRMA 2FZGB 3JB9G 2HQHA 3DB3A 1NLPC 4E7IA 4HXJA 1M3AA 2FG0A 3X28B 3PTAA 1VQPA 4KUDK 3CMEA 4ORZA 1VQ4Q 3VUZA 1JU5C 2D1XA 3CCLQ 4A53A 1KQSA 2ZPEB 2YT6A 3HKSA 3G6ET 1KC8R 4M78D 4LDVA 3NMZC 5KCHA 3C12A 1M4ZA 2PVDB 5KE3A 1LVKA 5AYFA 2MI6A 1W6XA 2RJDA 3URGA 2DZ9A 3THKA 1WZOA 4A54A 2NUPB 4FYYB 3M4GA 3L2RA 3CMAQ 1TSFA 4D8DA 2B86A 2D0QB 2BE9B 3JSCA 3MKDA 3M0SA 3A8MB 3LX7A 2QK0A 5FU7B 1NYGA 2RM4A 3MHXA 3EG0A 1M30A 1M2OA 2DRKA 2M16A 3GNGA 1WHKA 4C5HA 2KBTA 1X69A 4GBQA 4XTVA 3GOXA 1R77A 4ELYC 3JV3A 2L3QA 4M78A 1Z9ZA 2LTOA 2QAZA 3OS5A 5GAOq 4PJOB 4MZMA 3S3MA 1R8OB 2QQSA 1NJIU 1PWTA 5HY6A 3EGDA 2EYYA 1W2BS 1NJIC 1WNLA 2VB6A 1VQ8T 4TVRA 1YJWQ 2X9HA 2IG0A 5LJ3e 3M0PA 3CPWS 1RACB 5IH2A 3UT1A 2J06A 4L6V5 1X6BA 1K8AR 2RH2A 2RQUA 1TU0B 3I56Q 3OYIA 2OTLT 4ZGJB 2BE7D 2CS7A 2MCNA 5FLXE 1G2BA 2E10A 2SEMA 1VQOT 2DETA 2MF2A 1IHWA 3VJPA 1JRIA 1B34A 1WDXA 5GANh 3I56A 2CP5A 2KSSA 1SG5A 2ZZDA 3MEVA 3DB4A 4Z8AA 1X2KA 4M78F 1Z9QA 3G71A 3DLLA 4OMQA 2FRYA 4AFQC 1QCFA 2CP2A 3HTRA 2DVEA 2X4YA 1KQSS 1M1KR 1A0NB 2R57A 2K5LA 3OBWA 1Q82C 4LN2A 1K9MU 4LDXA 2CSQA 4J7IA 3TSZA 2DD4A 4DOVA 2RMOA 3EH1A 2VUBA 2JT4A 1VQNA 4B6MA 1VQKT 2COZA 4FL6A 3PIOA 5KYNA 2PUKB 4OMFB 1YWPA 1VQ5T 4C92B 1ABQA 1ZBXA 1OYXA 3C0CA 3G71T 3ULRB 2V26A 1GRIA 1VQLT 4NL3A 3JB9H 5CIUA 2AZSA 3JCMJ 4JUVA 4N4HA 4MDXA 1OX9A 1U5SA 2CREA 2O31A 2PQWA 3LH0A 1IREB 1QVGA 3CBOA 3G4SQ 3C94A 2P4RA 2EAYA 2P84A 3CCUA 5A2QE 4XTWA 3NHNA 2AKKA 2F5TX 2CP6A 3M4YA 1UHFA 2E12A 3HSBA 3FDRA 3H8ZA 4ME7A 3FRNA 1SHGA 4ESRA 4MZTA 3D7SB 2JTEA 1R0BG 2DPPB 1QP3A 2DL7A 3A8GB 1QW1A 3GP8A 2VV5A 4CRIA 4FYVB 1KD1R 4JZ3A 1I5LA 4A63B 3G6EQ 3OYDA 4V2SA 2KXDA 3OB9A 3I55T 1Q86U 2KRNA 1N8RR 2HNIA 3QIIA 4N0AC 4OB3B 3MPUB 5KH6A 3WVDB 2RQWA 3H41A 4E7LA 1YHQT 1KHCA 3EFOB 7AT1B 1KD1U 5DLQE 2DL5A 2O4XA 2I2LA 4FT4A 4A4GA 1IO6A 1KD1C 2DM1A 2CP7A 3VS3A 4B9WA 4AFZC 1KQSP 1NZ9A 2DE0X 3EGUA 3OQ5A 1SSFA 1EIFA 4ZTJA 4QVDA 1MNDA 4DBQA 1RADB 4J5YA 1Q95G 4KGZB 4XU0A 1PKSA 2MWPA 4NS5A 1OQKA 1YIJT 3CCSA 2CZ7B 1ARKA 2MPXC 3RMSA 1YJ9T 5EC7A 2XD0A 1BB9A 3MO8A 3TVTA 1T0HA 4Y91A 4BY6B 1HSQA 2QA4A 2P0PA 2F2WA 4M75G 2HCKA 4KT0E 4M75F 2XMFA 2X4XA 3JCMb 4D6WA 3V8LA 3OSVA 3CCUT 5LJ3f 3RKWA 3ME9A 3CC2Q 2YUPA 3JCMQ 1KC8C 3OMGA 2FPEA 3TU4K 2BUDA 2KYBA 4XTYA 3OYJA 4BE1A 4RTWA 2YLBA 1C1AA 2MMPA 4ELZC 1QKWA 2DILA 1ZHIA 1PKTA 1HXDA 3H9NA 2L3RA 3CXCA 4EDUA 4ZGEB 1K9AA 4VUBA 1N9RA 2XICA 3LWIA 1NYFA 2JMAA 3VS0A 1UGQB 2DXUA 2I0NA 4M7DG 1D3BB 3PMTA 3CCRQ 2L5QA 1RABB 4IUPA 1QVFS 1NBEB 4AFSC 3MCAB 4R56A 3NTIA 4N0AA 3PIPA 3M54A 2K79A 4KGXB 2AIRB 5GAN7 3CC2T 1GCQC 4QQDA 4E7SA 2J7IA 1VQ8A 1WJSA 4KRTA 3CQTA 9ATCB 2RK2A 4DBRA 4LD6A 4M77F 4PL6A 2EYZA 3GBQA 1MUZA 1UUEA 1X01A 4HT8A 4QQ6A 4XAXB 5GAN5 2LX7A 1M3BA 4BY6C 1IGQA 2K3YA 2COYA 1UJ0A 3QXEB 2KRMA 4PLIA 1VQKQ 2DTOA 4M7DA 3LWHA 4M75D 5D6YA 3CC7T 2FVUA 5I22A 3CCJA 3X24B 3M9QA 5LJ5h 1X27A 2EGAA 1NG2A 1BI2A 3AHUA 3A98A 1KFZA 2YUQA 1TG0A 4E6RA 2KE9A 1B3QA 4IURA 3L2VA 1SEMA 1YHQQ 3E1SA 4PLLA 2LCSA 1WHMA 4JZ4A 1I4K1 2IPOB 1W2BP 4L59A 2HMAA 2YXYA 1G3WA 5I21A 2GF7A 1Y7XA 4HA8A 3A1PA 2C0OA 3VS4A 3NFCA 3EAEA 3OW2A 2HL5C 5GJWB 3HRUA 3SB2A 1TH7A 2Z0WA 2LZ6B 2W10A 3VKIA 4M7DD 5GMKj 3MEAA 1BU1A 3HP9A 1XNIA 5D6XA 5GAN6 3EGXB 1X43A 2DIGA 2PNIA 2NUPA 1LCKA 4KBMB 4OMMA 4EMHA 2L3PA 4AG1C 3NTKA 1HYOA 1YCYA 4Q5WA 1G5VA 3EFOA 3S3OA 2GBQA 4XTZA 5KYXB 5A0DA 5GAN3 2EPDA 2QTXA 1Q86C 2EYXA 3E2UA 1JQQA 1SRLA 4JLIA 1KQ1A 1YCSB 4DOWA 2VGNA 1UB4A 4J9GA 3IQLA 2FL7A 2D6FA 2VYTA 1Y96A 1M1KU 1QVPA 5IHKA 1UJYA 4IUVA 1ABOA 4J83A 1H641 1M1KC 2D8HA 2HQXA 1I0CA 5FRNA 4HVWA 1VQ5Q 1QLYA 2HD0A 5IXFA 2FZKB 4RG2A 2DEQA 4FW1A 2AZVA 2NYSA 2DD5A 5CAIA 8ATCB 2PUOB 1PM3A 4JPBW 4MMLA 1M1FA 5IT9E 1S72A 4J9BA 1K8AU 4C5GA 3C95A 2QA4Q 4PFOA 4HKEA 3VYHB 1Q86R 1WGSA 3EFRA 2DTHA 4M7AA 1K8AC 5AT1B 3JCMe 1GL5A 2XIDA 1M5Q1 3OYYA 1VQOA 3OYBA 3CCMT 2L8DA 4RCBA 4ZTFA 3J81E 4PJOG 3JCMW 3U23A 2ECZA 4XTUA 3V7SA 1Y0MA 3EHRA 4FT2A 1VQOQ 4C92A 3JB9J 2JTMA 4C8QF 2XDPA 1RUWA 1HK9A 4C5IA 1TUDA 4M7DE 1VQ6A 2A08A 2LDMA 2VC8A 3RESA 1N9SA 1AWJA 3CC2A 2COWA 3L2ZA 4KULA 2KQWA 4ZGDB 2LCCA 4M75B 5FW9A 5GAOl 1LJOA 1OULA 2CUBA 4BUGA 2X35A 3GIBA 5GMKm 1UE9A 2P0QA 2HAXA 1EZZB 3QDRB 1ZLMA 2CZ1B 1BI0A 2ZAEA 1WPYA 1SF9A 4XU1A 5GAOm 3OYCA 2OAWA 4JRIA 1TXQA 4OB1B 1BI3A 3JB9D 1B34B 1KK7A 4JDSA 4JJCA 5LJ3h 1WHGA 4CC7A 1VQ4A 1YI2T 4IIOA 4LE9A 2C06A 3ZFJA 2KVQG 2KGTA 5L23A 4M75E 2BZYA 5LJ5e 1M27C 4J7FA 4M78G 1KSWA 2DK3A 2K5FA 4JJDA 3CCVA 2RHIA 3CCMQ 4X9CA 4M77D 4EMKB 1AHJB 2VVKA 2HL3A 2A3LA 2JNGA 5DY9A 1M9SA 5GMKi 3QZ9B 2QGFB 3WVEB 2YRVA 3CCJQ 3OYGA 3CCMA 4M78B 1OZ3A 2EGEA 4KUIA 1N8RC 2FPDA 3BFMA 1VQ9Q 3LGLA 2EKHA 3RIRA 2EBPA 3PT9A 1Q82U 4LNPA 1PD1A 3RNJA 2DIQA 3A8LB 2EQUA 3OYMA 1N6AA 4JS5A 1V1CA 3I55Q 1AD5A 1NE8A 3QPHA 3HHTB 5GANd 4NL2A 3CC4T 2G3RA 3REAB 2E1HA 2K2MA 2KT1A 2DF6A 3ZEHA 4BE0A 3SWNB 4C8QC 5A0GA 2FO0A 1QWFA 1I1JA 2E6NA 3MEWA 1WI7A 3UA7A 4D8KA 1ZUUA 1G3SA 4M7AF 1ZA2B 1TTHB 4O5VA 3CCST 2RN8A 3LGFA 3F70A 3G1JA 5IN1A 3RDVA 2KDSA 2PVOB 3CBPA 3QUIA 5J39A 4GLMA 1FMKA 4HCZA 3H6ZA 1YI2Q 3PVLA 4FU6A 2GCXA 2ZCFB 2DYBA 2JS0A 1VQ7Q 2E3HA 2KMTA 1UTIA 1I5OB 5GMKh 3M59A 4FW2A 1SRMA 1D1CA 4BI4A 2BIVA 3HFNA 2XU8A 1MNEA 2K3BA 2LMJA 4N4IA 2XDDA 3G71Q 3QKJA 2LRQA 2LNHB 1WYXA 3CCVT 3VS1A 3S3NA 4XQ3A 4F7UA 5FU6C 4CI0C 4F7UF 4EMKA 4J9CA 2OAUA 5GAOr 4HCCA 4X34A 1WX6A 3A5ZB 5GAN8 1GFCA 4RTXA 1VQNQ 2EIFA 1LOJA 2KEAA 1TWBA 1ZSZA 2JM9A 2M0YA 2RHXA 3I5SA 2ZPGB 4IIMA 2K57A 3DKMA 8AT1B 3G7ZA 1IGUA 2E64A 4MMKA 1ZX6A 1DJ7B 1MHNA 2R5AA 2C0TA 1S1NA 1KQ2A 2L0AA 4C0ZA 1QVFA 2CUDA 2HKQB 3I35A 2QXFA 1RAHB 4J9DA 4C0FA 3RKYA 3RERA 4JLGA 4FYWB 3SHWA 2JJ9A 2QGGA 5DM7R 3QG1A 2H3JA 3GPLA 3HL8A 4AMCA 4PJMA 3VV0A 2LT4A 1QVGS 2JW4A 3G6EA 3TREA 1NLOC 3J80E 1AOJA 1YJWT 4LD9K 4JJNK 1UHCA 2WSEE 1M3CA 1VA7A 2E65A 2RHZA 4Z02A 5FWBA 4C0DC 3CCRA 5GANf 3SFMA 3RBBB 3QHSA 3V7RA 3CCQA 4PNOA 1FMWA 4RKUE 2GFUA 1YI2A 2FHDA 2DBMA 2W0ZA 2XDBA 1M8MA 2KAFA 2JUFA 2K4YA 6AT1B 3UPUA 1Q81C 3VRZA 1MGQA 4F7UE 4E7KA 2QYZA 2CZ6B 1K0XA 3OYKA 4F04B 3OYEA 1H3ZA 2QG9B 2HDAA 3RUXA 5CR2A 4F14A 1Y07A 2X3WD 4LUDA 1I8FA 3VS7A 2RHYA 4RTZA 2D0NA 3E19A 2LCLA 3SWNA 2L89A 1M2VA 3CCQT 3JCMV 3NTHA 4PFPA 1RAFB 2DNUA 3FJ5A 2RB6A 4QQGA 2CH4A 4ZNXA 3M5AA 2X51A 2O9SA 2DJZA 2EJ9A 4C0DB 2E4HA 5LL6S 1R0CB 1VQ6Q 5GAMd 4JS4A 3AT1B 4OGEA 1QP2A 1SHFA 4EMKC 1AWWA 5GMKl 5GANe 3RMQA 1VQ4T 1BKBA 2RHUA 1PG5B 1B7TA 2DFUA 2JOYA 1S72Q 3FJPA 2EQIA 4B9XA 4A4EA 1PD0A 2NLUA 2OTJA 4RTVA 1U8RA 2E5KA 3E9GA 1VOMA 4ANJA 2M9UA 3HFOA 3X20B 4BDYA 1ZUYA 2BTTA 3PFSA 3HRSA 3EGXA 1OEBA 1QVGP 4RTTA 4C8QG 1G8XA 4PJOF 1YBYA 3INZA 1M90R 2JXBA 4AG2C 1GCQA 2LJ0A 4RG8A 5J26A 1EFNA 2K5IA 4M77A 2LQ8A 3M56A 1TOVA 4IKFA 2QASA 5CKHA 1YN8A 2CT3A 4BE2A 1JEGA 1H3HA 1VQ9T 1WJQA 1VQ5A 2CSIA 5FROA 1IB8A 4C8QB 5I2MA 3PE0A 1O75A 4OGCA 4Y28E 3CPFA 4RUGA 4C0GA 5FU7C 1FYNA 2ED1A 2ROTA 1VYVA 1MMDA 3CD6T 1W2BA 4C92C 4F7UB 5LJ5j 5I11A 2BKDN 3CCQQ 1OU9A 4M78C 2RF0A 2KI7A 4PJNA 5I2SA 1TS9A 1VQPQ 1WQ7A 2RA2A 2P0KA 4C92E 2LX9A 3CXCP 3M57A 2QQAA 5KYWA 3M55A 4PJOC 3DLMA 1NPRA 2K9GA 3EG3A 4CC2A 2V1QA 2A0FB 3WXMB 3CXCS 2GGRA 3VRYA 5C0MA 3J7AF 3CCET 2NWMA 2RK1A 1G3YA 3OYFA 3V8JA 5CO7A 1VQLQ 1LPLA 1Q7YU 2HZYA 5CQYA 1KIKA 4J6XA 2DMOA 4KH1B 2VASA 4LXCA 3OYNA 5GAMg 1K73U 2CYZB 1XQHA 1X6GA 2OTJT 4X9DA 2MOXA 4CC4B 4OMOA 1PRMC 1KJWA 3P8BB 2OTLA 3M53A 3GNFB 5GAMf 4C92D 3CCUQ 2XKOC 2O4XB 2V1RA 1YHQA 2LVMA 3PVQA 1YJNT 2P4TA 2Y90A 5LJ3j 1Q7YR 3MP8A 1NJIR 1K0SA 4PJLA 1RLPC 2VKNA 1AZGB 1NM7A 3KUFA 1D0ZA 3OMCA 1BIBA 1ACMB 3QO3A 2RI2A 2RI5A 1YJ9Q 2DL3A 1QVFP 4PJOE 2K2VA 5CK9A 1W1FA 3REBB 1N27A 1U1SA 1OOTA 1WHJA 3BW1A 1OZ2A 1WXUA 4DEYA 5M9OA 5GAOn 5CKFA 2Y4XA 5HK3A 1K9MC 3QWXX 3CD6A 2QA4T 2O88A 2RJEA 4GLKA 3VS6A 2VXFA 1VQNT 1MMGA 2C0IA 1ZUKA 3R6NA 4KGVB 1ZSZB 2L2PA 1PC0A 1QCOA 1PRLC 4J6WA 3L2WA 1UDLA 2EJFA 1TUCA 2DEUA 1GBQA 1YITA 2M0OA 1VQMQ 1YJWA 1M90U 2LQWA 4QVZA 1WQWA 2Y4YA 5GANg 4M4ZA 2FRWA 3V8KA 4EIKA 3VYGA 1EX4A 5EG2A 2KR3A 1WHLA 3FEOA 2ZPFB 1Y71A 5FU6B 1RAGB 4BACA 2X4WA 1OPKA 3OS1A 3CMEQ 4GY5A 2QDYB 3MP6A 1UG1A 1RLQC 1OU8A 2KROA 2RO0A 1IZ6A 1UGVA 3KFVA 3LLRA 2FZCB 4HCBA 2WSCE 2F1LA 4LDUA 3UDCA 1VQ7A 4A4HA 1X6OA 1RI9A 2XI9A 5DLOA 1OPLA 4J9HA 1UGPB 2YUNA 3KXTA 1D1AA 2VWFA 1QQJA 1RL2A 3CMAA 3CCSQ 1JXOA 1FX7A 1E6HA 1YWOA 2X4JA 3G4ST 2M51A 1B07A 1BIAA 4C92G 2DO3A 2CP3A 3I55A 4DBFA 4HVUA 4PJJA 1SKUB 2B8AA 2DTIA 4J9IA 3OW2P 5ECAA 3EG1A 4R55A 4C5EA 2V8JA 1BYMA 1JXMA 2GNCA 2YSQA 1WXBA 2JVVA 3SWNC 2FYKA 4IUUA 1N5ZA 1Y57A 2DLPA 4RCCA 3NPFA 1VYUA 4KH0B 1W70A 1BK2A 4J6YA 1FMVA 2YUOA 4MDWA 5IAYA 3OS0A 3CCJT 1YIJA 4DBHA 5GAN2 2EQMA 1V29B 2MK5A 4YTLA 1Q81R 4AFUC 2KXCA 1JO8A 3EGDB 1JJ2P 5GANj 1YJ9A 2RQRA 2PU9B 4XU2A 4M75A 3H0IA 4JRKA 4IUQA 1E6GA 1M1GA 2E3IA 4IUTA 2LP5A 4Y92A 1FXXA 2QQRA 3ASKA 4FYXB 1D0XA 1D3BA 5GAMe 4Z89A 3GF5A 3CCVQ 3O8VA 1HD3A 1ZBJA 5HCKA 2KNBB 3JB9I 1WJRA 2MWOA 4P5NA 2DAQA 3PMIA 4M77C 4OP0A 3I56T 5KYXA 2K7AA 2LJ1A 1I07A 2JN0A 2R5MA 1VQ9A 1YJNQ 3QSUA 3JCMX 1VQ7T 1KC8U 1C6VX 3ZBDA 2HBPA 2E6ZA 1VQ8Q 3RKXA 2DJQA 2HSPA 2WSFE 4FM4B 4M77G 1UEBA 1YJNA 4M7AC 1QKXA 4M7AB 4X1VA 1P92A 1UECA 3FC3A 1OV3A 3JAME 3M0UA 4C92F 2D8JA 2E41A 3QYGB 2HQEA 4FCYA 1XOVA 4FSSA 2IVWA 3M0QA 3CCEQ 2F2XA 1VQKA 3UATA 2YDLA 4E47A 2NUTB 1K73C 1JBMA 2EVRA 2DKGA 2A7YA 3OW2S 1WA7A 4F7UG 3CCEA 2YHTA 1AVZC 2CKKA 1VQLA 3HRTA 2MAMA 2EKOA 3S6WA 2EGCA 2GQVA 3TSWA 1VQMT 1VQPT 4M7AE 5KYWB 1NPPA 5IHNA 1D09B 3LYIA 3FB9A 3META 4J9FA 4OB2B 5CKEA 2J6KA 5GAOp 3JCMf 1YP5A 1C0MA 4C8QD 5KCOA 2OJ2A 4DEXA 1GBRA 3SEMA 5KYYA 2A28A 5HKCA 2O2OA 5GAMh 1T3LA 3SDZA 3P8HA 1VIFA 3CC7A 2DXTA 4JJBA 5GMKe 1CKBA 2KRSA 2GFAA 1H92A 5KYUA 3X25B 3VU3C 2DXCA 3CPWP 4M7AG 1E7OA 3TQ7P 1RAEB 4M77B 3ZL7C 3OY9A 1X2QA 1YIJQ 1PSFA 2DVJA 3JRZA
chains in the Genus database with same CATH topology
3EFSA 5GAN3 2F69A 2NLUA 3MHXA 2OTJA 4NOYA 2QTXA 2KK4A 1Q86C 1U8RA 4JLIA 3E9GA 2M16A 2EFIA 1KQ1A 2LNVA 2M9UA 3GNGA 3HFOA 5CVIA 3X20B 4C5HA 4DOWA 2VGNA 4BDYA 2XK0A 1UB4A 3PFSA 3T9NA 2FL7A 2D6FA 2VYTA 1Y96A 3HRSA 4XTVA 3GOXA 1M1KU 4JRPA 1QVPA 4ELYC 2LQKA 4M7DB 4IUVA 4J83A 1H641 4C8QG 4M78A 2RD1A 4E7HA 2LTOA 1M1KC 2HQXA 4PJOF 3OS5A 5GAOq 3Q1JA 5FRNA 1YBYA 4PJOB 3INZA 4MZMA 2HD0A 4UC4A 5D6WA 3S3MA 1R8OB 3QJYA 2QQSA 1NJIU 1KG1A 4RG2A 4RG8A 5J26A 2DEQA 2ZPBB 4XU3A 5HY6A 2K5IA 4M77A 2LQ8A 2QQ9A 3M56A 1NJIC 1W2BS 1WNLA 3CPWA 2DD5A 2KY9A 4IKFA 5CAIA 1VQ8T 4M77E 2PUOB 4TVRA 1UGRB 5CKHA 1GXIE 2IG0A 5LJ3e 4BE2A 1JB0E 3CPWS 1M8VA 1VQ9T 1WJQA 4MMLA 3UT1A 3A8OB 1VQ5A 4L6V5 1O9SA 2RJFA 1M1FA 5FROA 5IT9E 4O6JA 3VUBA 4C8QB 2YLCA 5I2MA 1S72A 2RH2A 4OB0B 1K8AU 1O75A 4OGCA 4Y28E 4C5GA 2OTLT 3OYIA 3CPFA 3C95A 4HKEA 3VYHB 4ZGJB 4C0GA 5FU7C 1WGSA 3MP1A 3EFRA 2DTHA 4M7AA 1K8AC 1PSEA 3CD6T 3JCMe 1W2BA 2CS7A 4C92C 4F7UB 5FLXE 5LJ5j 2XIDA 3JCMd 2LC4A 2BKDN 1M5Q1 2E10A 3OYYA 4BB7A 1VIEA 2MF2A 3OYBA 1VQOT 3CCMT 2L8DA 4RCBA 3VJPA 4XTXA 1JRIA 1B34A 4ZTFA 5GANh 2E70A 4M78C 3TEEA 3J81E 3I56A 5I2SA 4PJOG 2KSSA 3JCMW 3JCMc 2ZZDA 3MEVA 3DB4A 1WQ7A 2RA2A 4XTUA 3V7SA 2P0KA 2FB7A 3QBYA 4C92E 2LX9A 2K3XA 4M78F 4FT2A 3G71A 3DLLA 3M57A 2QQAA 4C92A 3OYLA 2DVEA 2X4YA 2XG8D 3M55A 2JTMA 3JB9J 1KQSS 3DLMA 4M7DF 4PJOC 4C8QA 1NPRA 2RI3A 4PJOD 4C8QF 2JZ2A 2LT1A 4BDZA 3WXMB 3CXCS 2XDPA 3HPWA 1HK9A 3JCMP 1JJ2A 2E5QA 2R57A 3G4SA 4C5IA 2K5LA 3OBWA 1Q82C 1K9MU 4LDXA 4M7DE 1VQ6A 5LJ3d 5C0MA 1U1TA 2CZ0B 2LDMA 2VGMA 2RK1A 4J7IA 1G3YA 2DD4A 2VC8A 3OYFA 3RESA 4DOVA 1N9SA 3V8JA 5CO7A 2VUBA 3JB9F 1Q7YU 3CC2A 4KULA 3L2ZA 4J6XA 2KQWA 5CQYA 4MZPA 4BI8B 4ZGDB 1VQNA 2LCCA 4M75B 3OYNA 5GAOl 1LJOA 4WF2A 1VQKT 4FL6A 4QW2A 5GAMg 4BUGA 1K73U 3PIOA 2CYZB 2PUKB 2X35A 1XQHA 4OMFB 1VQ5T 3GIBA 5GMKm 4C92B 2OTJT 1ZBXA 4X9DA 2P0QA 1Y96B 1OYXA 3J7AF 3G71T 2HAXA 3P8BB 2OTLA 3QDRB 5CKDA 2CZ1B 2ZGWA 1BI0A 3M53A 4NL3A 3JCMg 1VQLT 3GNFB 5CIUA 3E9FA 5GAMf 1WPYA 4XU1A 4LDYA 4A4FA 4C92D 3JCMJ 5GAOm 4JUVA 3OYCA 4JRIA 2XKOC 2O4XB 4N4HA 1YHQA 4MDXA 2LVMA 1YJNT 4OB1B 1BI3A 2AHJB 1B34B 3OA6A 3JB9D 3QYHB 1RI0A 4JDSA 1FWZA 4M78E 5LJ3h 2P4TA 2Y90A 5LJ3j 3MP8A 2PQWA 3LH0A 5KE2A 1IREB 1QVGA 2EWNA 3CBOA 3CC4A 1VQ4A 3UWNA 3C94A 5LJ3g 1YI2T 3KUFA 2EAYA 3CCUA 2C06A 5A2QE 4XTWA 3OMCA 3ZFJA 5LJ5d 1X75C 2KVQG 1BIBA 3P8DA 3QO3A 4M75E 5LJ5e 2F5TX 2RI2A 2RI5A 3MEUA 4PJOE 3QZ5B 3OYHA 4J7FA 2K2VA 3M4YA 4M78G 2DK3A 5CK9A 2K5FA 4J8OA 2QI2A 2D9TA 3CCVA 3SD4A 2E12A 1N27A 1U1SA 2RHIA 3FDRA 3H8ZA 4ME7A 4X9CA 4M77D 3HSBA 3FRNA 4EMKB 3BW1A 1OZ2A 1VQ6T 1AHJB 4MZTA 5M9OA 5GAOn 5CKFA 3LW5E 2QEXT 2A3LA 2JNGA 2Y4XA 5DY9A 1M9SA 5GMKi 5HK3A 1K9MC 2DPPB 3CD6A 1QP3A 3QZ9B 3A8GB 1QW1A 2RJEA 3GP8A 4GLKA 2VV5A 2QA4T 3WVEB 4CRIA 2YRVA 2VXFA 1VQNT 3OYGA 3CMET 3CCMA 3CCET 4M78B 1I5LA 1OZ3A 4KUIA 1N8RC 3BFMA 2O01E 2VXEA 3LGLA 4ZN1A 3OYDA 3RIRA 3N5BB 4V2SA 3OB9A 3I55T 4J6WA 1Q86U 3PT9A 1G3TA 3BY7A 1Q82U 3L2WA 4FSXA 2EJFA 2HNIA 3QIIA 1YITA 4N0AC 2M0OA 4OB3B 1YITT 1YJWA 1M90U 2DIQA 4QVZA 5KH6A 1WQWA 3A8LB 2Y4YA 3WVDB 2EQUA 5CCAA 5GANg 3V8KA 3OYMA 4E7LA 1N6AA 1Q7YC 3VYGA 1YHQT 5EG2A 1KHCA 4JS5A 1KD1U 1NE8A 3FEOA 2ZPFB 1UGSB 5DLQE 2O4XA 3QPHA 2I2LA 3HHTB 5GANd 4FT4A 4A4GA 4NL2A 1Y71A 5FU6B 2G3RA 3CC4T 4BACA 1KD1C 1BI1A 2X4WA 3OS1A 4B9WA 2E1HA 4GY5A 1NZ9A 3OSSC 2QDYB 4BE0A 3OQ5A 3ZEHA 4EPCA 3SWNB 4C8QC 3MP6A 5A0GA 5GAN4 1JJ2S 3C4SA 1SSFA 1EIFA 3R6OA 2E6NA 2RO0A 4ZTJA 3MEWA 4QVDA 1IZ6A 3LLRA 4J5YA 1W4SA 4XU0A 4HCBA 3FLGA 2MWPA 2CGHA 4NS5A 4XK8E 1G3SA 2WSCE 1YIJT 4M7AF 4LDWA 4LDUA 3CCSA 4O5VA 2CZ7B 3UDCA 5GAMj 3CCST 3LGFA 1VQ7A 3F70A 4A4HA 2DXBA 1X6OA 3OYAA 2XI9A 5DLOA 5IN1A 1OI1A 1UGPB 3KXTA 3RMSA 1YJ9T 2KDSA 5HK0A 3L42A 2XD0A 4L5GA 2PVOB 3MO8A 3CBPA 3QUIA 4Y91A 5J39A 1RL2A 4DQ2A 4BY6B 3L1AA 2QA4A 2P0PA 4M75G 4HCZA 3CMAA 1VQMA 3CMAT 2DZCA 3H6ZA 1FX7A 2X4JA 4FU6A 3G4ST 2GCXA 1BIAA 2EYQA 2ZCFB 4C92G 2DO3A 4KT0E 4M75F 2V8IA 2X4XA 2QQBA 2V8KA 3JCMb 2R58A 2KMTA 3M58A 4D6WA 3I55A 4E7JA 5GMKh 3V8LA 3OSVA 1N8RU 3M59A 5CKBA 3CCUT 2B8AA 5LJ3f 2DTIA 4BI4A 1ZQ1A 2BIVA 4OF1A 3RKWA 3HFNA 3ME9A 2XU8A 4R55A 4EMGA 3A8HB 4C5EA 2V8JA 4N4IA 2EQKA 3OS2A 1BYMA 2XDDA 3JCMQ 3TCJA 3OMGA 3QJ6A 3QKJA 3V7CA 2LRQA 2PVGB 1KC8C 2ZPIB 3TU4K 2BUDA 2JVVA 4JRQA 5CQXA 3SWNC 2FYKA 3CCVT 3CCLT 4IUUA 4XTYA 3OYJA 4ZN3A 4BE1A 3S3NA 3PNWC 4XQ3A 4F7UA 5FU6C 4CI0C 4F7UF 1VQOA 1I81A 4RCCA 5LJ5g 2YLBA 4EMKA 2MMPA 2OAUA 1KQSA 4ELZC 5GAOr 2XHCA 4HCCA 1ZHIA 2F5KA 4X34A 1HXDA 3CCRT 2L3RA 3A5ZB 3CXCA 4EDUA 1M90C 4J6YA 4ZGEB 4VUBA 1N9RA 2XICA 3LWIA 5GAN8 4MDWA 5IAYA 1UGQB 3OBYA 5LJ5f 3OS0A 3CCJT 1YIJA 2DXUA 2EIFA 5GAN2 1Q81U 2EQMA 1LOJA 1V29B 4M7DG 4YTLA 1D3BB 3PMTA 1VUBA 2RHXA 4FIBA 5GANj 4N4GA 1YJ9A 2ZPGB 2L5QA 2PU9B 4XU2A 1LNXA 4M75A 5L8RE 5C6SA 2K57A 3DKMA 4IUPA 3FIFA 3L2UA 4JRKA 3G7ZA 2M1HA 4IUQA 1M1GA 2E64A 4IUTA 4MMKA 1QVFS 1DJ7B 1FXXA 2QQRA 3ASKA 1MHNA 2R5AA 3MCAB 4R56A 1D3BA 1KQ2A 5GAMe 4QVCA 3GF5A 3NTIA 4BD3A 3PGGA 4C0ZA 3O8VA 4DA4A 1QVFA 2QXFA 4N0AA 4C0FA 3RKYA 5FRMA 3RERA 4JLGA 3PIPA 3M54A 4RMOA 3JB9I 5GAN7 1WJRA 3CC2T 4QQDA 2ZPHB 5DM7R 2MWOA 4M75C 3QG1A 4P5NA 2DAQA 2H3JA 3PMIA 3GLXA 4M77C 3ER0A 1VQ8A 4OP0A 1WJSA 3GPLA 3I56T 3HL8A 5J3BA 3VV0A 2LT4A 3L2QA 1QVGS 2RK2A 4PKCC 1VQ9A 2R5MA 2JN0A 3G6EA 3QSUA 4LD6A 4M77F 3JCMX 1VQ7T 3TREA 3JCMh 3J80E 4PL6A 1KC8U 3ZBDA 2HBPA 2E6ZA 2WACA 1YJWT 4LD9K 1X01A 3RKXA 4JJNK 4HT8A 2WSEE 2E65A 4QQ6A 2RHZA 2WSFE 4FM4B 4M77G 4XAXB 5GAN5 4BY6C 1UEBA 4Z02A 4C0DC 1YJNA 2K3YA 3CCRA 5GANf 4M7AC 4M7AB 1P92A 3CEYA 3SFMA 3QXEB 3QHSA 2EJGA 4PLIA 3FC3A 4ATOA 3JAME 4C92F 2DTOA 3V7RA 3CCQA 4M7DA 4PNOA 3LWHA 4OVAA 4M75D 5D6YA 3CC7T 2E41A 3QYGB 2FVUA 3CCJA 4RKUE 2GFUA 3X24B 4PJOA 1YI2A 4HT9A 2FHDA 2HQEA 3M9QA 1XOVA 1XTDA 4C8QE 2XDBA 1KHIA 2IVWA 5LJ5h 2KAFA 2JUFA 2K4YA 3JB9H 3UPUA 1Q81C 1VQKA 3BDLA 4II1A 5A0LA 4E47A 1BI2A 3AHUA 3KBGA 3BDUA 1K73C 1JBMA 1MGQA 4F7UE 4E7KA 2CZ6B 3OYKA 4M7DC 4BI3A 3OYEA 3CCLA 1H3ZA 2DKGA 2A7YA 2EQJA 3X26B 3OW2S 2JTFA 4IURA 3CBMA 2RJCA 1S72T 4F7UG 3L2VA 4M7AD 3CCEA 2YHTA 2CKKA 3E1SA 4PLLA 4A4KA 2QEXA 1VQLA 3RUXA 5CR2A 3HRTA 3JB9G 2MAMA 3DB3A 4E7IA 1Y07A 2EKOA 1I8FA 1I4K1 3S6WA 3X28B 2GQVA 3PTAA 1VQMT 1VQPT 4M7AE 2RHYA 1VQPA 1NPPA 3CMEA 4KUDK 4L59A 3E19A 3VUZA 2LCLA 3SWNA 3LYIA 1G3WA 2L89A 4A53A 3CCQT 2ZPEB 3FB9A 2GF7A 3JCMV 1Y7XA 4HA8A 3META 5I21A 3NTHA 3HKSA 3G6ET 2RB6A 4OB2B 3NFCA 3EAEA 5CKEA 3OW2A 4QQGA 4M78D 4LDVA 3HRUA 3SB2A 1TH7A 3C12A 3JCMf 5KCHA 5GAOp 1M4ZA 2PVDB 4C8QD 5KE3A 3M5AA 5KCOA 3VKIA 5AYFA 4M7DD 2MI6A 2DJZA 2EJ9A 4C0DB 5GMKj 2RJDA 3MEAA 5D6XA 3HP9A 1XNIA 5HKCA 3URGA 2DZ9A 5LL6S 4A54A 5GAMd 5GAN6 4JS4A 5GAMh 4OGEA 1QP2A 3M4GA 3SDZA 3P8HA 3L2RA 4EMKC 1VIFA 2DIGA 3CC7A 2DXTA 5GMKl 5GANe 3RMQA 1VQ4T 2D0QB 3JSCA 5GMKe 4KBMB 2GFAA 3X25B 4EMHA 3A8MB 2DXCA 3VU3C 1BKBA 4M7AG 3LX7A 2RHUA 3NTKA 1YCYA 4Q5WA 1G5VA 4M77B 3OY9A 2JOYA 3S3OA 4XTZA 3FJPA 4B9XA 4A4EA 5FU7B 1PSFA 5A0DA 2RM4A 3JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS A;  1VQ5 T;  3CCS T;  1VQ7 A;  2OTJ A;  1VQ7 T;  3LGF A;  3TRE A;  1Q86 C;  2OTJ T;  1X6O A;  3J80 E;  3G71 T;  1KC8 U;  3P8B B;  2OTL A;  1YJ9 T;  2E6Z A;  1YJW T;  2KDS A;  1VQL T;  1RL2 A;  1M1K U;  2QA4 A;  1UEB A;  3CMA A;  1YJN A;  2LVM A;  3CCR A;  1YJN T;  1VQM A;  1YHQ A;  3CMA T;  3G4S T;  1M1K C;  3JAM E;  2DO3 A;  1YBY A;  3CCQ A;  3LH0 A;  3CC4 A;  3CC7 T;  1QVG A;  3CCJ A;  1VQ4 A;  3I55 A;  1NJI U;  1YI2 A;  1YI2 T;  4RG2 A;  5J26 A;  1VQP A;  1N8R U;  3CCU A;  5HY6 A;  3CCU T;  5A2Q E;  1XTD A;  2LQ8 A;  2KVQ G;  1KHI A;  1NJI C;  1W2B S;  3CPW A;  2JUF A;  1Q81 C;  1VQ8 T;  4TVR A;  1VQK A;  2IG0 A;  1KC8 C;  3KBG A;  3CPW S;  1K73 C;  1VQ9 T;  1VQ5 A;  2JVV A;  3CCV A;  3CCV T;  5IT9 E;  3CCL T;  3CCL A;  4ZN3 A;  1S72 A;  1S72 T;  1K8A U;  3OW2 S;  1VQ6 T;  2OTL T;  3CPF A;  3CCE A;  2CKK A;  2QEX A;  2QEX T;  1VQL A;  3DB3 A;  2JNG A;  1K8A C;  3CD6 T;  1K9M C;  1W2B A;  2XHC A;  3CD6 A;  4X34 A;  5FLX E;  2QA4 T;  3CCR T;  1VQM T;  1VQP T;  2L3R A;  3A5Z B;  1NPP A;  3OYY A;  4CRI A;  3CXC A;  3CME A;  3CME T;  3CCM T;  1VQO T;  3CCM A;  1VQO A;  2LCL A;  1M90 C;  1VQN T;  1N8R C;  2E70 A;  3J81 E;  3I56 A;  1KQS A;  3CCQ T;  5IAY A;  3LGL A;  4ZN1 A;  3HKS A;  3CCJ T;  1YIJ A;  3DB4 A;  3I55 T;  2EIF A;  3G6E T;  1Q81 U;  1Q86 U;  3OW2 A;  4YTL A;  1Q82 U;  3G71 A;  3DLL A;  1YIT A;  1YIT T;  1YJ9 A;  1YJW A;  1M90 U;  1KQS S;  2MI6 A;  1NPR A;  1M1G A;  1Q7Y C;  1QVF S;  3CXC S;  1XNI A;  1YHQ T;  1JJ2 A;  5LL6 S;  3G4S A;  1KD1 U;  1Q82 C;  1K9M U;  5DLQ E;  1QVF A;  1VQ6 A;  3J7A F;  3CCE T;  3CC4 T;  3CC7 A;  2G3R A;  1KD1 C;  1VQ4 T;  1NZ9 A;  3PIP A;  1Q7Y U;  3CC2 A;  1JJ2 S;  3CC2 T;  4QQD A;  5DM7 R;  1BKB A;  2MWO A;  1SSF A;  1EIF A;  1VQN A;  1IZ6 A;  3ER0 A;  1VQ8 A;  2JOY A;  1VQK T;  3I56 T;  5J3B A;  2MWP A;  3PIO A;  1QVG S;  1K73 U;  1YIJ T;  1VQ9 A;  3G6E A; 
#chains in the Genus database with same CATH topology
 3EFS A;  2F69 A;  1QMC A;  4NOY A;  2KK4 A;  2EFI A;  2LNV A;  5CVI A;  2XK0 A;  3T9N A;  2DL4 A;  4HVV A;  1Q82 R;  4JRP A;  1BCO A;  2LQK A;  2RD1 A;  4E7H A;  2OTJ Q;  3Q1J A;  2G6F X;  4UC4 A;  1SPK A;  5D6W A;  3QJY A;  1KG1 A;  1U3O A;  4AT1 B;  2ZPB B;  4XU3 A;  1YIT Q;  2QQ9 A;  2AT1 B;  1H8K A;  1XJW B;  3CPW A;  2KY9 A;  4M77 E;  2EW3 A;  1UGR B;  2J6F A;  1GXI E;  1JB0 E;  2DA9 A;  1M8V A;  3A8O B;  1O9S A;  2RJF A;  2L3S A;  4O6J A;  3VUB A;  2YLC A;  2PZ1 A;  4OB0 B;  4M7D B;  2HBW A;  1BCM A;  3MP1 A;  1PSE A;  2QEX Q;  3JCM d;  2LC4 A;  2FPF A;  2DBK A;  1VIE A;  4BB7 A;  1YFN A;  4XTX A;  1ZSZ C;  1T0J A;  2E70 A;  3TEE A;  3JCM c;  3RR6 A;  4J9E A;  2ROL A;  2FB7 A;  3QBY A;  1M2V B;  2K3X A;  1K4U S;  3OYL A;  1SSH A;  2XG8 D;  4M7D F;  4C8Q A;  4PJO D;  2RI3 A;  1AT1 B;  2JZ2 A;  2BZX A;  2LT1 A;  4BDZ A;  3HPW A;  3JCM P;  1JJ2 A;  2E5Q A;  2GQI A;  3G4S A;  4QKU A;  4RTY A;  3QWY A;  3I5R A;  4RTU A;  5LJ3 d;  1U1T A;  1WHH A;  2CZ0 B;  2VGM A;  1U06 A;  3JB9 F;  3LH5 A;  4BI8 B;  4MZP A;  1NEG A;  1K1Z A;  1QCN A;  3CC7 Q;  2IIM A;  2SRC A;  4WF2 A;  4QW2 A;  1HJD A;  1Y96 B;  2A37 A;  3UA6 A;  1K73 R;  5CKD A;  2ZGW A;  3JCM g;  3E9F A;  4A4F A;  4LDY A;  3BE3 A;  2A36 A;  2EYW A;  2AHJ B;  3OA6 A;  3QYH B;  1RI0 A;  1FWZ A;  4M78 E;  1WXT A;  2AKL A;  2CP0 A;  5KE2 A;  3CC4 A;  1WIE A;  2EWN A;  3UWN A;  5LJ3 g;  5LJ5 d;  1X75 C;  3P8D A;  5FWC A;  2RQT A;  3QDF A;  2ATC B;  3MEU A;  1NEB A;  3QZ5 B;  4LUE A;  3OYH A;  1ZSG A;  2JS2 A;  4J8O A;  2QI2 A;  1IHV A;  2D9T A;  3SD4 A;  1VQ6 T;  1IXD A;  2LJ3 A;  2QEX T;  3LW5 E;  1CSK A;  4F17 A;  2QDL A;  2DX1 A;  1J3T A;  2OTL Q;  1T3S A;  2H3E B;  3H0F A;  3CME T;  2FEI A;  2H8H A;  2M02 A;  1BBZ A;  2O01 E;  2VXE A;  4ZN1 A;  5D7U A;  5IXB A;  3N5B B;  4PFZ A;  1QWE A;  2LQN A;  1G3T A;  3BY7 A;  1WFW A;  4FSX A;  1AWO A;  1YIT T;  2OX7 A;  1MV0 B;  5KYY B;  2AK5 A;  2CH4 W;  5CCA A;  1Q7Y C;  2DYI A;  1UGS B;  1MMN A;  1G83 A;  1MV3 A;  1BI1 A;  3OSS C;  1RAI B;  2MYS A;  4EPC A;  5GAN 4;  1JJ2 S;  3C4S A;  3R6O A;  2GTJ A;  1AEY A;  1W4S A;  3FLG A;  2CGH A;  5IHI A;  4OMP A;  4XK8 E;  2ESW A;  4LDW A;  5GAM j;  2OI3 A;  1F1B B;  3OYA A;  2DXB A;  1AZE A;  2HSE B;  1K9M R;  1CKA A;  1OI1 A;  5GJV B;  5HK0 A;  3L42 A;  4L5G A;  4E2F B;  4DQ2 A;  3L1A A;  3CMA T;  1VQM A;  2DER A;  2DZC A;  1WLP B;  4Z88 A;  2EYQ A;  1IRX A;  4F16 A;  2YWW A;  3M0R A;  2RNA A;  2V8I A;  2QQB A;  2V8K A;  2R58 A;  4CC3 A;  3M58 A;  4E7J A;  3EH2 A;  1N8R U;  2ENM A;  5CKB A;  1ZQ1 A;  3UF4 A;  2J6O A;  4OF1 A;  3CC4 Q;  4QT7 A;  4OMN A;  4EMG A;  3A8H B;  3VS5 A;  2EQK A;  3OS2 A;  2DL8 A;  3EG2 A;  3TCJ A;  3QJ6 A;  3V7C A;  2PVG B;  3I9Q A;  2ZPI B;  4OML A;  4JRQ A;  4R0K A;  2HEQ A;  5CQX A;  3CCL T;  4ZN3 A;  1K76 A;  2YRC A;  3PNW C;  1I81 A;  5LJ5 g;  2KYM A;  2RPN A;  2XHC A;  2F5K A;  3CCR T;  1M90 C;  3O5Z A;  4E7Z A;  3EG9 A;  2GTO A;  3OBY A;  5LJ5 f;  1Q81 U;  2F2V A;  1VUB A;  4FIB A;  4N4G A;  4K11 A;  1LNX A;  5L8R E;  5C6S A;  3FIF A;  3L2U A;  2M1H A;  3MJX A;  2JMC A;  2ED0 A;  4QVC A;  4BD3 A;  3PGG A;  4DA4 A;  2MIO A;  2X3X D;  4HCK A;  2CDT A;  5FRM A;  1AWX A;  4PK4 A;  2J05 A;  3EG9 B;  2BZ8 A;  4RMO A;  2ZPH B;  3CD6 Q;  4M75 C;  3GLX A;  2KT8 A;  3ER0 A;  2CT4 A;  5J3B A;  3L2Q A;  3VS2 A;  1D1B A;  4PKC C;  2JM8 A;  1PHT A;  3JCM h;  2NUT A;  5KYU B;  1PNJ A;  2WAC A;  1OX8 A;  1YNZ A;  2RQV A;  4WCI A;  1UFF A;  1ZA1 B;  3CEY A;  2PTK A;  1MMA A;  3EHQ A;  2EJG A;  4ATO A;  2QTV A;  4OVA A;  4HT9 A;  1XTD A;  4C8Q E;  2ABL A;  1KHI A;  3NGP A;  3M0T A;  2YRD A;  2O9V A;  3H0H A;  1D0Y A;  3BDL A;  4II1 A;  5A0L A;  1VYT A;  3KBG A;  4WTO B;  3BDU A;  1RAA B;  1GFD A;  1PCX A;  2NUZ A;  1V76 A;  2HKN A;  4BI3 A;  3CCL A;  4M7D C;  2EQJ A;  3X26 B;  1S72 T;  4PJO A;  2JTF A;  3CBM A;  2RJC A;  4M7A D;  1TUG B;  2QEX A;  2K6D A;  4A4K A;  1GCP A;  2DRM A;  2FZG B;  3JB9 G;  2HQH A;  3DB3 A;  1NLP C;  4E7I A;  4HXJ A;  1M3A A;  2FG0 A;  3X28 B;  3PTA A;  1VQP A;  4KUD K;  3CME A;  4ORZ A;  1VQ4 Q;  3VUZ A;  1JU5 C;  2D1X A;  3CCL Q;  4A53 A;  1KQS A;  2ZPE B;  2YT6 A;  3HKS A;  3G6E T;  1KC8 R;  4M78 D;  4LDV A;  3NMZ C;  5KCH A;  3C12 A;  1M4Z A;  2PVD B;  5KE3 A;  1LVK A;  5AYF A;  2MI6 A;  1W6X A;  2RJD A;  3URG A;  2DZ9 A;  3THK A;  1WZO A;  4A54 A;  2NUP B;  4FYY B;  3M4G A;  3L2R A;  3CMA Q;  1TSF A;  4D8D A;  2B86 A;  2D0Q B;  2BE9 B;  3JSC A;  3MKD A;  3M0S A;  3A8M B;  3LX7 A;  2QK0 A;  5FU7 B;  1NYG A;  2RM4 A;  3MHX A;  3EG0 A;  1M30 A;  1M2O A;  2DRK A;  2M16 A;  3GNG A;  1WHK A;  4C5H A;  2KBT A;  1X69 A;  4GBQ A;  4XTV A;  3GOX A;  1R77 A;  4ELY C;  3JV3 A;  2L3Q A;  4M78 A;  1Z9Z A;  2LTO A;  2QAZ A;  3OS5 A;  5GAO q;  4PJO B;  4MZM A;  3S3M A;  1R8O B;  2QQS A;  1NJI U;  1PWT A;  5HY6 A;  3EGD A;  2EYY A;  1W2B S;  1NJI C;  1WNL A;  2VB6 A;  1VQ8 T;  4TVR A;  1YJW Q;  2X9H A;  2IG0 A;  5LJ3 e;  3M0P A;  3CPW S;  1RAC B;  5IH2 A;  3UT1 A;  2J06 A;  4L6V 5;  1X6B A;  1K8A R;  2RH2 A;  2RQU A;  1TU0 B;  3I56 Q;  3OYI A;  2OTL T;  4ZGJ B;  2BE7 D;  2CS7 A;  2MCN A;  5FLX E;  1G2B A;  2E10 A;  2SEM A;  1VQO T;  2DET A;  2MF2 A;  1IHW A;  3VJP A;  1JRI A;  1B34 A;  1WDX A;  5GAN h;  3I56 A;  2CP5 A;  2KSS A;  1SG5 A;  2ZZD A;  3MEV A;  3DB4 A;  4Z8A A;  1X2K A;  4M78 F;  1Z9Q A;  3G71 A;  3DLL A;  4OMQ A;  2FRY A;  4AFQ C;  1QCF A;  2CP2 A;  3HTR A;  2DVE A;  2X4Y A;  1KQS S;  1M1K R;  1A0N B;  2R57 A;  2K5L A;  3OBW A;  1Q82 C;  4LN2 A;  1K9M U;  4LDX A;  2CSQ A;  4J7I A;  3TSZ A;  2DD4 A;  4DOV A;  2RMO A;  3EH1 A;  2VUB A;  2JT4 A;  1VQN A;  4B6M A;  1VQK T;  2COZ A;  4FL6 A;  3PIO A;  5KYN A;  2PUK B;  4OMF B;  1YWP A;  1VQ5 T;  4C92 B;  1ABQ A;  1ZBX A;  1OYX A;  3C0C A;  3G71 T;  3ULR B;  2V26 A;  1GRI A;  1VQL T;  4NL3 A;  3JB9 H;  5CIU A;  2AZS A;  3JCM J;  4JUV A;  4N4H A;  4MDX A;  1OX9 A;  1U5S A;  2CRE A;  2O31 A;  2PQW A;  3LH0 A;  1IRE B;  1QVG A;  3CBO A;  3G4S Q;  3C94 A;  2P4R A;  2EAY A;  2P84 A;  3CCU A;  5A2Q E;  4XTW A;  3NHN A;  2AKK A;  2F5T X;  2CP6 A;  3M4Y A;  1UHF A;  2E12 A;  3HSB A;  3FDR A;  3H8Z A;  4ME7 A;  3FRN A;  1SHG A;  4ESR A;  4MZT A;  3D7S B;  2JTE A;  1R0B G;  2DPP B;  1QP3 A;  2DL7 A;  3A8G B;  1QW1 A;  3GP8 A;  2VV5 A;  4CRI A;  4FYV B;  1KD1 R;  4JZ3 A;  1I5L A;  4A63 B;  3G6E Q;  3OYD A;  4V2S A;  2KXD A;  3OB9 A;  3I55 T;  1Q86 U;  2KRN A;  1N8R R;  2HNI A;  3QII A;  4N0A C;  4OB3 B;  3MPU B;  5KH6 A;  3WVD B;  2RQW A;  3H41 A;  4E7L A;  1YHQ T;  1KHC A;  3EFO B;  7AT1 B;  1KD1 U;  5DLQ E;  2DL5 A;  2O4X A;  2I2L A;  4FT4 A;  4A4G A;  1IO6 A;  1KD1 C;  2DM1 A;  2CP7 A;  3VS3 A;  4B9W A;  4AFZ C;  1KQS P;  1NZ9 A;  2DE0 X;  3EGU A;  3OQ5 A;  1SSF A;  1EIF A;  4ZTJ A;  4QVD A;  1MND A;  4DBQ A;  1RAD B;  4J5Y A;  1Q95 G;  4KGZ B;  4XU0 A;  1PKS A;  2MWP A;  4NS5 A;  1OQK A;  1YIJ T;  3CCS A;  2CZ7 B;  1ARK A;  2MPX C;  3RMS A;  1YJ9 T;  5EC7 A;  2XD0 A;  1BB9 A;  3MO8 A;  3TVT A;  1T0H A;  4Y91 A;  4BY6 B;  1HSQ A;  2QA4 A;  2P0P A;  2F2W A;  4M75 G;  2HCK A;  4KT0 E;  4M75 F;  2XMF A;  2X4X A;  3JCM b;  4D6W A;  3V8L A;  3OSV A;  3CCU T;  5LJ3 f;  3RKW A;  3ME9 A;  3CC2 Q;  2YUP A;  3JCM Q;  1KC8 C;  3OMG A;  2FPE A;  3TU4 K;  2BUD A;  2KYB A;  4XTY A;  3OYJ A;  4BE1 A;  4RTW A;  2YLB A;  1C1A A;  2MMP A;  4ELZ C;  1QKW A;  2DIL A;  1ZHI A;  1PKT A;  1HXD A;  3H9N A;  2L3R A;  3CXC A;  4EDU A;  4ZGE B;  1K9A A;  4VUB A;  1N9R A;  2XIC A;  3LWI A;  1NYF A;  2JMA A;  3VS0 A;  1UGQ B;  2DXU A;  2I0N A;  4M7D G;  1D3B B;  3PMT A;  3CCR Q;  2L5Q A;  1RAB B;  4IUP A;  1QVF S;  1NBE B;  4AFS C;  3MCA B;  4R56 A;  3NTI A;  4N0A A;  3PIP A;  3M54 A;  2K79 A;  4KGX B;  2AIR B;  5GAN 7;  3CC2 T;  1GCQ C;  4QQD A;  4E7S A;  2J7I A;  1VQ8 A;  1WJS A;  4KRT A;  3CQT A;  9ATC B;  2RK2 A;  4DBR A;  4LD6 A;  4M77 F;  4PL6 A;  2EYZ A;  3GBQ A;  1MUZ A;  1UUE A;  1X01 A;  4HT8 A;  4QQ6 A;  4XAX B;  5GAN 5;  2LX7 A;  1M3B A;  4BY6 C;  1IGQ A;  2K3Y A;  2COY A;  1UJ0 A;  3QXE B;  2KRM A;  4PLI A;  1VQK Q;  2DTO A;  4M7D A;  3LWH A;  4M75 D;  5D6Y A;  3CC7 T;  2FVU A;  5I22 A;  3CCJ A;  3X24 B;  3M9Q A;  5LJ5 h;  1X27 A;  2EGA A;  1NG2 A;  1BI2 A;  3AHU A;  3A98 A;  1KFZ A;  2YUQ A;  1TG0 A;  4E6R A;  2KE9 A;  1B3Q A;  4IUR A;  3L2V A;  1SEM A;  1YHQ Q;  3E1S A;  4PLL A;  2LCS A;  1WHM A;  4JZ4 A;  1I4K 1;  2IPO B;  1W2B P;  4L59 A;  2HMA A;  2YXY A;  1G3W A;  5I21 A;  2GF7 A;  1Y7X A;  4HA8 A;  3A1P A;  2C0O A;  3VS4 A;  3NFC A;  3EAE A;  3OW2 A;  2HL5 C;  5GJW B;  3HRU A;  3SB2 A;  1TH7 A;  2Z0W A;  2LZ6 B;  2W10 A;  3VKI A;  4M7D D;  5GMK j;  3MEA A;  1BU1 A;  3HP9 A;  1XNI A;  5D6X A;  5GAN 6;  3EGX B;  1X43 A;  2DIG A;  2PNI A;  2NUP A;  1LCK A;  4KBM B;  4OMM A;  4EMH A;  2L3P A;  4AG1 C;  3NTK A;  1HYO A;  1YCY A;  4Q5W A;  1G5V A;  3EFO A;  3S3O A;  2GBQ A;  4XTZ A;  5KYX B;  5A0D A;  5GAN 3;  2EPD A;  2QTX A;  1Q86 C;  2EYX A;  3E2U A;  1JQQ A;  1SRL A;  4JLI A;  1KQ1 A;  1YCS B;  4DOW A;  2VGN A;  1UB4 A;  4J9G A;  3IQL A;  2FL7 A;  2D6F A;  2VYT A;  1Y96 A;  1M1K U;  1QVP A;  5IHK A;  1UJY A;  4IUV A;  1ABO A;  4J83 A;  1H64 1;  1M1K C;  2D8H A;  2HQX A;  1I0C A;  5FRN A;  4HVW A;  1VQ5 Q;  1QLY A;  2HD0 A;  5IXF A;  2FZK B;  4RG2 A;  2DEQ A;  4FW1 A;  2AZV A;  2NYS A;  2DD5 A;  5CAI A;  8ATC B;  2PUO B;  1PM3 A;  4JPB W;  4MML A;  1M1F A;  5IT9 E;  1S72 A;  4J9B A;  1K8A U;  4C5G A;  3C95 A;  2QA4 Q;  4PFO A;  4HKE A;  3VYH B;  1Q86 R;  1WGS A;  3EFR A;  2DTH A;  4M7A A;  1K8A C;  5AT1 B;  3JCM e;  1GL5 A;  2XID A;  1M5Q 1;  3OYY A;  1VQO A;  3OYB A;  3CCM T;  2L8D A;  4RCB A;  4ZTF A;  3J81 E;  4PJO G;  3JCM W;  3U23 A;  2ECZ A;  4XTU A;  3V7S A;  1Y0M A;  3EHR A;  4FT2 A;  1VQO Q;  4C92 A;  3JB9 J;  2JTM A;  4C8Q F;  2XDP A;  1RUW A;  1HK9 A;  4C5I A;  1TUD A;  4M7D E;  1VQ6 A;  2A08 A;  2LDM A;  2VC8 A;  3RES A;  1N9S A;  1AWJ A;  3CC2 A;  2COW A;  3L2Z A;  4KUL A;  2KQW A;  4ZGD B;  2LCC A;  4M75 B;  5FW9 A;  5GAO l;  1LJO A;  1OUL A;  2CUB A;  4BUG A;  2X35 A;  3GIB A;  5GMK m;  1UE9 A;  2P0Q A;  2HAX A;  1EZZ B;  3QDR B;  1ZLM A;  2CZ1 B;  1BI0 A;  2ZAE A;  1WPY A;  1SF9 A;  4XU1 A;  5GAO m;  3OYC A;  2OAW A;  4JRI A;  1TXQ A;  4OB1 B;  1BI3 A;  3JB9 D;  1B34 B;  1KK7 A;  4JDS A;  4JJC A;  5LJ3 h;  1WHG A;  4CC7 A;  1VQ4 A;  1YI2 T;  4IIO A;  4LE9 A;  2C06 A;  3ZFJ A;  2KVQ G;  2KGT A;  5L23 A;  4M75 E;  2BZY A;  5LJ5 e;  1M27 C;  4J7F A;  4M78 G;  1KSW A;  2DK3 A;  2K5F A;  4JJD A;  3CCV A;  2RHI A;  3CCM Q;  4X9C A;  4M77 D;  4EMK B;  1AHJ B;  2VVK A;  2HL3 A;  2A3L A;  2JNG A;  5DY9 A;  1M9S A;  5GMK i;  3QZ9 B;  2QGF B;  3WVE B;  2YRV A;  3CCJ Q;  3OYG A;  3CCM A;  4M78 B;  1OZ3 A;  2EGE A;  4KUI A;  1N8R C;  2FPD A;  3BFM A;  1VQ9 Q;  3LGL A;  2EKH A;  3RIR A;  2EBP A;  3PT9 A;  1Q82 U;  4LNP A;  1PD1 A;  3RNJ A;  2DIQ A;  3A8L B;  2EQU A;  3OYM A;  1N6A A;  4JS5 A;  1V1C A;  3I55 Q;  1AD5 A;  1NE8 A;  3QPH A;  3HHT B;  5GAN d;  4NL2 A;  3CC4 T;  2G3R A;  3REA B;  2E1H A;  2K2M A;  2KT1 A;  2DF6 A;  3ZEH A;  4BE0 A;  3SWN B;  4C8Q C;  5A0G A;  2FO0 A;  1QWF A;  1I1J A;  2E6N A;  3MEW A;  1WI7 A;  3UA7 A;  4D8K A;  1ZUU A;  1G3S A;  4M7A F;  1ZA2 B;  1TTH B;  4O5V A;  3CCS T;  2RN8 A;  3LGF A;  3F70 A;  3G1J A;  5IN1 A;  3RDV A;  2KDS A;  2PVO B;  3CBP A;  3QUI A;  5J39 A;  4GLM A;  1FMK A;  4HCZ A;  3H6Z A;  1YI2 Q;  3PVL A;  4FU6 A;  2GCX A;  2ZCF B;  2DYB A;  2JS0 A;  1VQ7 Q;  2E3H A;  2KMT A;  1UTI A;  1I5O B;  5GMK h;  3M59 A;  4FW2 A;  1SRM A;  1D1C A;  4BI4 A;  2BIV A;  3HFN A;  2XU8 A;  1MNE A;  2K3B A;  2LMJ A;  4N4I A;  2XDD A;  3G71 Q;  3QKJ A;  2LRQ A;  2LNH B;  1WYX A;  3CCV T;  3VS1 A;  3S3N A;  4XQ3 A;  4F7U A;  5FU6 C;  4CI0 C;  4F7U F;  4EMK A;  4J9C A;  2OAU A;  5GAO r;  4HCC A;  4X34 A;  1WX6 A;  3A5Z B;  5GAN 8;  1GFC A;  4RTX A;  1VQN Q;  2EIF A;  1LOJ A;  2KEA A;  1TWB A;  1ZSZ A;  2JM9 A;  2M0Y A;  2RHX A;  3I5S A;  2ZPG B;  4IIM A;  2K57 A;  3DKM A;  8AT1 B;  3G7Z A;  1IGU A;  2E64 A;  4MMK A;  1ZX6 A;  1DJ7 B;  1MHN A;  2R5A A;  2C0T A;  1S1N A;  1KQ2 A;  2L0A A;  4C0Z A;  1QVF A;  2CUD A;  2HKQ B;  3I35 A;  2QXF A;  1RAH B;  4J9D A;  4C0F A;  3RKY A;  3RER A;  4JLG A;  4FYW B;  3SHW A;  2JJ9 A;  2QGG A;  5DM7 R;  3QG1 A;  2H3J A;  3GPL A;  3HL8 A;  4AMC A;  4PJM A;  3VV0 A;  2LT4 A;  1QVG S;  2JW4 A;  3G6E A;  3TRE A;  1NLO C;  3J80 E;  1AOJ A;  1YJW T;  4LD9 K;  4JJN K;  1UHC A;  2WSE E;  1M3C A;  1VA7 A;  2E65 A;  2RHZ A;  4Z02 A;  5FWB A;  4C0D C;  3CCR A;  5GAN f;  3SFM A;  3RBB B;  3QHS A;  3V7R A;  3CCQ A;  4PNO A;  1FMW A;  4RKU E;  2GFU A;  1YI2 A;  2FHD A;  2DBM A;  2W0Z A;  2XDB A;  1M8M A;  2KAF A;  2JUF A;  2K4Y A;  6AT1 B;  3UPU A;  1Q81 C;  3VRZ A;  1MGQ A;  4F7U E;  4E7K A;  2QYZ A;  2CZ6 B;  1K0X A;  3OYK A;  4F04 B;  3OYE A;  1H3Z A;  2QG9 B;  2HDA A;  3RUX A;  5CR2 A;  4F14 A;  1Y07 A;  2X3W D;  4LUD A;  1I8F A;  3VS7 A;  2RHY A;  4RTZ A;  2D0N A;  3E19 A;  2LCL A;  3SWN A;  2L89 A;  1M2V A;  3CCQ T;  3JCM V;  3NTH A;  4PFP A;  1RAF B;  2DNU A;  3FJ5 A;  2RB6 A;  4QQG A;  2CH4 A;  4ZNX A;  3M5A A;  2X51 A;  2O9S A;  2DJZ A;  2EJ9 A;  4C0D B;  2E4H A;  5LL6 S;  1R0C B;  1VQ6 Q;  5GAM d;  4JS4 A;  3AT1 B;  4OGE A;  1QP2 A;  1SHF A;  4EMK C;  1AWW A;  5GMK l;  5GAN e;  3RMQ A;  1VQ4 T;  1BKB A;  2RHU A;  1PG5 B;  1B7T A;  2DFU A;  2JOY A;  1S72 Q;  3FJP A;  2EQI A;  4B9X A;  4A4E A;  1PD0 A;  2NLU A;  2OTJ A;  4RTV A;  1U8R A;  2E5K A;  3E9G A;  1VOM A;  4ANJ A;  2M9U A;  3HFO A;  3X20 B;  4BDY A;  1ZUY A;  2BTT A;  3PFS A;  3HRS A;  3EGX A;  1OEB A;  1QVG P;  4RTT A;  4C8Q G;  1G8X A;  4PJO F;  1YBY A;  3INZ A;  1M90 R;  2JXB A;  4AG2 C;  1GCQ A;  2LJ0 A;  4RG8 A;  5J26 A;  1EFN A;  2K5I A;  4M77 A;  2LQ8 A;  3M56 A;  1TOV A;  4IKF A;  2QAS A;  5CKH A;  1YN8 A;  2CT3 A;  4BE2 A;  1JEG A;  1H3H A;  1VQ9 T;  1WJQ A;  1VQ5 A;  2CSI A;  5FRO A;  1IB8 A;  4C8Q B;  5I2M A;  3PE0 A;  1O75 A;  4OGC A;  4Y28 E;  3CPF A;  4RUG A;  4C0G A;  5FU7 C;  1FYN A;  2ED1 A;  2ROT A;  1VYV A;  1MMD A;  3CD6 T;  1W2B A;  4C92 C;  4F7U B;  5LJ5 j;  5I11 A;  2BKD N;  3CCQ Q;  1OU9 A;  4M78 C;  2RF0 A;  2KI7 A;  4PJN A;  5I2S A;  1TS9 A;  1VQP Q;  1WQ7 A;  2RA2 A;  2P0K A;  4C92 E;  2LX9 A;  3CXC P;  3M57 A;  2QQA A;  5KYW A;  3M55 A;  4PJO C;  3DLM A;  1NPR A;  2K9G A;  3EG3 A;  4CC2 A;  2V1Q A;  2A0F B;  3WXM B;  3CXC S;  2GGR A;  3VRY A;  5C0M A;  3J7A F;  3CCE T;  2NWM A;  2RK1 A;  1G3Y A;  3OYF A;  3V8J A;  5CO7 A;  1VQL Q;  1LPL A;  1Q7Y U;  2HZY A;  5CQY A;  1KIK A;  4J6X A;  2DMO A;  4KH1 B;  2VAS A;  4LXC A;  3OYN A;  5GAM g;  1K73 U;  2CYZ B;  1XQH A;  1X6G A;  2OTJ T;  4X9D A;  2MOX A;  4CC4 B;  4OMO A;  1PRM C;  1KJW A;  3P8B B;  2OTL A;  3M53 A;  3GNF B;  5GAM f;  4C92 D;  3CCU Q;  2XKO C;  2O4X B;  2V1R A;  1YHQ A;  2LVM A;  3PVQ A;  1YJN T;  2P4T A;  2Y90 A;  5LJ3 j;  1Q7Y R;  3MP8 A;  1NJI R;  1K0S A;  4PJL A;  1RLP C;  2VKN A;  1AZG B;  1NM7 A;  3KUF A;  1D0Z A;  3OMC A;  1BIB A;  1ACM B;  3QO3 A;  2RI2 A;  2RI5 A;  1YJ9 Q;  2DL3 A;  1QVF P;  4PJO E;  2K2V A;  5CK9 A;  1W1F A;  3REB B;  1N27 A;  1U1S A;  1OOT A;  1WHJ A;  3BW1 A;  1OZ2 A;  1WXU A;  4DEY A;  5M9O A;  5GAO n;  5CKF A;  2Y4X A;  5HK3 A;  1K9M C;  3QWX X;  3CD6 A;  2QA4 T;  2O88 A;  2RJE A;  4GLK A;  3VS6 A;  2VXF A;  1VQN T;  1MMG A;  2C0I A;  1ZUK A;  3R6N A;  4KGV B;  1ZSZ B;  2L2P A;  1PC0 A;  1QCO A;  1PRL C;  4J6W A;  3L2W A;  1UDL A;  2EJF A;  1TUC A;  2DEU A;  1GBQ A;  1YIT A;  2M0O A;  1VQM Q;  1YJW A;  1M90 U;  2LQW A;  4QVZ A;  1WQW A;  2Y4Y A;  5GAN g;  4M4Z A;  2FRW A;  3V8K A;  4EIK A;  3VYG A;  1EX4 A;  5EG2 A;  2KR3 A;  1WHL A;  3FEO A;  2ZPF B;  1Y71 A;  5FU6 B;  1RAG B;  4BAC A;  2X4W A;  1OPK A;  3OS1 A;  3CME Q;  4GY5 A;  2QDY B;  3MP6 A;  1UG1 A;  1RLQ C;  1OU8 A;  2KRO A;  2RO0 A;  1IZ6 A;  1UGV A;  3KFV A;  3LLR A;  2FZC B;  4HCB A;  2WSC E;  2F1L A;  4LDU A;  3UDC A;  1VQ7 A;  4A4H A;  1X6O A;  1RI9 A;  2XI9 A;  5DLO A;  1OPL A;  4J9H A;  1UGP B;  2YUN A;  3KXT A;  1D1A A;  2VWF A;  1QQJ A;  1RL2 A;  3CMA A;  3CCS Q;  1JXO A;  1FX7 A;  1E6H A;  1YWO A;  2X4J A;  3G4S T;  2M51 A;  1B07 A;  1BIA A;  4C92 G;  2DO3 A;  2CP3 A;  3I55 A;  4DBF A;  4HVU A;  4PJJ A;  1SKU B;  2B8A A;  2DTI A;  4J9I A;  3OW2 P;  5ECA A;  3EG1 A;  4R55 A;  4C5E A;  2V8J A;  1BYM A;  1JXM A;  2GNC A;  2YSQ A;  1WXB A;  2JVV A;  3SWN C;  2FYK A;  4IUU A;  1N5Z A;  1Y57 A;  2DLP A;  4RCC A;  3NPF A;  1VYU A;  4KH0 B;  1W70 A;  1BK2 A;  4J6Y A;  1FMV A;  2YUO A;  4MDW A;  5IAY A;  3OS0 A;  3CCJ T;  1YIJ A;  4DBH A;  5GAN 2;  2EQM A;  1V29 B;  2MK5 A;  4YTL A;  1Q81 R;  4AFU C;  2KXC A;  1JO8 A;  3EGD B;  1JJ2 P;  5GAN j;  1YJ9 A;  2RQR A;  2PU9 B;  4XU2 A;  4M75 A;  3H0I A;  4JRK A;  4IUQ A;  1E6G A;  1M1G A;  2E3I A;  4IUT A;  2LP5 A;  4Y92 A;  1FXX A;  2QQR A;  3ASK A;  4FYX B;  1D0X A;  1D3B A;  5GAM e;  4Z89 A;  3GF5 A;  3CCV Q;  3O8V A;  1HD3 A;  1ZBJ A;  5HCK A;  2KNB B;  3JB9 I;  1WJR A;  2MWO A;  4P5N A;  2DAQ A;  3PMI A;  4M77 C;  4OP0 A;  3I56 T;  5KYX A;  2K7A A;  2LJ1 A;  1I07 A;  2JN0 A;  2R5M A;  1VQ9 A;  1YJN Q;  3QSU A;  3JCM X;  1VQ7 T;  1KC8 U;  1C6V X;  3ZBD A;  2HBP A;  2E6Z A;  1VQ8 Q;  3RKX A;  2DJQ A;  2HSP A;  2WSF E;  4FM4 B;  4M77 G;  1UEB A;  1YJN A;  4M7A C;  1QKX A;  4M7A B;  4X1V A;  1P92 A;  1UEC A;  3FC3 A;  1OV3 A;  3JAM E;  3M0U A;  4C92 F;  2D8J A;  2E41 A;  3QYG B;  2HQE A;  4FCY A;  1XOV A;  4FSS A;  2IVW A;  3M0Q A;  3CCE Q;  2F2X A;  1VQK A;  3UAT A;  2YDL A;  4E47 A;  2NUT B;  1K73 C;  1JBM A;  2EVR A;  2DKG A;  2A7Y A;  3OW2 S;  1WA7 A;  4F7U G;  3CCE A;  2YHT A;  1AVZ C;  2CKK A;  1VQL A;  3HRT A;  2MAM A;  2EKO A;  3S6W A;  2EGC A;  2GQV A;  3TSW A;  1VQM T;  1VQP T;  4M7A E;  5KYW B;  1NPP A;  5IHN A;  1D09 B;  3LYI A;  3FB9 A;  3MET A;  4J9F A;  4OB2 B;  5CKE A;  2J6K A;  5GAO p;  3JCM f;  1YP5 A;  1C0M A;  4C8Q D;  5KCO A;  2OJ2 A;  4DEX A;  1GBR A;  3SEM A;  5KYY A;  2A28 A;  5HKC A;  2O2O A;  5GAM h;  1T3L A;  3SDZ A;  3P8H A;  1VIF A;  3CC7 A;  2DXT A;  4JJB A;  5GMK e;  1CKB A;  2KRS A;  2GFA A;  1H92 A;  5KYU A;  3X25 B;  3VU3 C;  2DXC A;  3CPW P;  4M7A G;  1E7O A;  3TQ7 P;  1RAE B;  4M77 B;  3ZL7 C;  3OY9 A;  1X2Q A;  1YIJ Q;  1PSF A;  2DVJ A;  3JRZ A; 
#chains in the Genus database with same CATH homology
 3EFS A;  5GAN 3;  2F69 A;  2NLU A;  3MHX A;  2OTJ A;  4NOY A;  2QTX A;  2KK4 A;  1Q86 C;  1U8R A;  4JLI A;  3E9G A;  2M16 A;  2EFI A;  1KQ1 A;  2LNV A;  2M9U A;  3GNG A;  3HFO A;  5CVI A;  3X20 B;  4C5H A;  4DOW A;  2VGN A;  4BDY A;  2XK0 A;  1UB4 A;  3PFS A;  3T9N A;  2FL7 A;  2D6F A;  2VYT A;  1Y96 A;  3HRS A;  4XTV A;  3GOX A;  1M1K U;  4JRP A;  1QVP A;  4ELY C;  2LQK A;  4M7D B;  4IUV A;  4J83 A;  1H64 1;  4C8Q G;  4M78 A;  2RD1 A;  4E7H A;  2LTO A;  1M1K C;  2HQX A;  4PJO F;  3OS5 A;  5GAO q;  3Q1J A;  5FRN A;  1YBY A;  4PJO B;  3INZ A;  4MZM A;  2HD0 A;  4UC4 A;  5D6W A;  3S3M A;  1R8O B;  3QJY A;  2QQS A;  1NJI U;  1KG1 A;  4RG2 A;  4RG8 A;  5J26 A;  2DEQ A;  2ZPB B;  4XU3 A;  5HY6 A;  2K5I A;  4M77 A;  2LQ8 A;  2QQ9 A;  3M56 A;  1NJI C;  1W2B S;  1WNL A;  3CPW A;  2DD5 A;  2KY9 A;  4IKF A;  5CAI A;  1VQ8 T;  4M77 E;  2PUO B;  4TVR A;  1UGR B;  5CKH A;  1GXI E;  2IG0 A;  5LJ3 e;  4BE2 A;  1JB0 E;  3CPW S;  1M8V A;  1VQ9 T;  1WJQ A;  4MML A;  3UT1 A;  3A8O B;  1VQ5 A;  4L6V 5;  1O9S A;  2RJF A;  1M1F A;  5FRO A;  5IT9 E;  4O6J A;  3VUB A;  4C8Q B;  2YLC A;  5I2M A;  1S72 A;  2RH2 A;  4OB0 B;  1K8A U;  1O75 A;  4OGC A;  4Y28 E;  4C5G A;  2OTL T;  3OYI A;  3CPF A;  3C95 A;  4HKE A;  3VYH B;  4ZGJ B;  4C0G A;  5FU7 C;  1WGS A;  3MP1 A;  3EFR A;  2DTH A;  4M7A A;  1K8A C;  1PSE A;  3CD6 T;  3JCM e;  1W2B A;  2CS7 A;  4C92 C;  4F7U B;  5FLX E;  5LJ5 j;  2XID A;  3JCM d;  2LC4 A;  2BKD N;  1M5Q 1;  2E10 A;  3OYY A;  4BB7 A;  1VIE A;  2MF2 A;  3OYB A;  1VQO T;  3CCM T;  2L8D A;  4RCB A;  3VJP A;  4XTX A;  1JRI A;  1B34 A;  4ZTF A;  5GAN h;  2E70 A;  4M78 C;  3TEE A;  3J81 E;  3I56 A;  5I2S A;  4PJO G;  2KSS A;  3JCM W;  3JCM c;  2ZZD A;  3MEV A;  3DB4 A;  1WQ7 A;  2RA2 A;  4XTU A;  3V7S A;  2P0K A;  2FB7 A;  3QBY A;  4C92 E;  2LX9 A;  2K3X A;  4M78 F;  4FT2 A;  3G71 A;  3DLL A;  3M57 A;  2QQA A;  4C92 A;  3OYL A;  2DVE A;  2X4Y A;  2XG8 D;  3M55 A;  2JTM A;  3JB9 J;  1KQS S;  3DLM A;  4M7D F;  4PJO C;  4C8Q A;  1NPR A;  2RI3 A;  4PJO D;  4C8Q F;  2JZ2 A;  2LT1 A;  4BDZ A;  3WXM B;  3CXC S;  2XDP A;  3HPW A;  1HK9 A;  3JCM P;  1JJ2 A;  2E5Q A;  2R57 A;  3G4S A;  4C5I A;  2K5L A;  3OBW A;  1Q82 C;  1K9M U;  4LDX A;  4M7D E;  1VQ6 A;  5LJ3 d;  5C0M A;  1U1T A;  2CZ0 B;  2LDM A;  2VGM A;  2RK1 A;  4J7I A;  1G3Y A;  2DD4 A;  2VC8 A;  3OYF A;  3RES A;  4DOV A;  1N9S A;  3V8J A;  5CO7 A;  2VUB A;  3JB9 F;  1Q7Y U;  3CC2 A;  4KUL A;  3L2Z A;  4J6X A;  2KQW A;  5CQY A;  4MZP A;  4BI8 B;  4ZGD B;  1VQN A;  2LCC A;  4M75 B;  3OYN A;  5GAO l;  1LJO A;  4WF2 A;  1VQK T;  4FL6 A;  4QW2 A;  5GAM g;  4BUG A;  1K73 U;  3PIO A;  2CYZ B;  2PUK B;  2X35 A;  1XQH A;  4OMF B;  1VQ5 T;  3GIB A;  5GMK m;  4C92 B;  2OTJ T;  1ZBX A;  4X9D A;  2P0Q A;  1Y96 B;  1OYX A;  3J7A F;  3G71 T;  2HAX A;  3P8B B;  2OTL A;  3QDR B;  5CKD A;  2CZ1 B;  2ZGW A;  1BI0 A;  3M53 A;  4NL3 A;  3JCM g;  1VQL T;  3GNF B;  5CIU A;  3E9F A;  5GAM f;  1WPY A;  4XU1 A;  4LDY A;  4A4F A;  4C92 D;  3JCM J;  5GAO m;  4JUV A;  3OYC A;  4JRI A;  2XKO C;  2O4X B;  4N4H A;  1YHQ A;  4MDX A;  2LVM A;  1YJN T;  4OB1 B;  1BI3 A;  2AHJ B;  1B34 B;  3OA6 A;  3JB9 D;  3QYH B;  1RI0 A;  4JDS A;  1FWZ A;  4M78 E;  5LJ3 h;  2P4T A;  2Y90 A;  5LJ3 j;  3MP8 A;  2PQW A;  3LH0 A;  5KE2 A;  1IRE B;  1QVG A;  2EWN A;  3CBO A;  3CC4 A;  1VQ4 A;  3UWN A;  3C94 A;  5LJ3 g;  1YI2 T;  3KUF A;  2EAY A;  3CCU A;  2C06 A;  5A2Q E;  4XTW A;  3OMC A;  3ZFJ A;  5LJ5 d;  1X75 C;  2KVQ G;  1BIB A;  3P8D A;  3QO3 A;  4M75 E;  5LJ5 e;  2F5T X;  2RI2 A;  2RI5 A;  3MEU A;  4PJO E;  3QZ5 B;  3OYH A;  4J7F A;  2K2V A;  3M4Y A;  4M78 G;  2DK3 A;  5CK9 A;  2K5F A;  4J8O A;  2QI2 A;  2D9T A;  3CCV A;  3SD4 A;  2E12 A;  1N27 A;  1U1S A;  2RHI A;  3FDR A;  3H8Z A;  4ME7 A;  4X9C A;  4M77 D;  3HSB A;  3FRN A;  4EMK B;  3BW1 A;  1OZ2 A;  1VQ6 T;  1AHJ B;  4MZT A;  5M9O A;  5GAO n;  5CKF A;  3LW5 E;  2QEX T;  2A3L A;  2JNG A;  2Y4X A;  5DY9 A;  1M9S A;  5GMK i;  5HK3 A;  1K9M C;  2DPP B;  3CD6 A;  1QP3 A;  3QZ9 B;  3A8G B;  1QW1 A;  2RJE A;  3GP8 A;  4GLK A;  2VV5 A;  2QA4 T;  3WVE B;  4CRI A;  2YRV A;  2VXF A;  1VQN T;  3OYG A;  3CME T;  3CCM A;  3CCE T;  4M78 B;  1I5L A;  1OZ3 A;  4KUI A;  1N8R C;  3BFM A;  2O01 E;  2VXE A;  3LGL A;  4ZN1 A;  3OYD A;  3RIR A;  3N5B B;  4V2S A;  3OB9 A;  3I55 T;  4J6W A;  1Q86 U;  3PT9 A;  1G3T A;  3BY7 A;  1Q82 U;  3L2W A;  4FSX A;  2EJF A;  2HNI A;  3QII A;  1YIT A;  4N0A C;  2M0O A;  4OB3 B;  1YIT T;  1YJW A;  1M90 U;  2DIQ A;  4QVZ A;  5KH6 A;  1WQW A;  3A8L B;  2Y4Y A;  3WVD B;  2EQU A;  5CCA A;  5GAN g;  3V8K A;  3OYM A;  4E7L A;  1N6A A;  1Q7Y C;  3VYG A;  1YHQ T;  5EG2 A;  1KHC A;  4JS5 A;  1KD1 U;  1NE8 A;  3FEO A;  2ZPF B;  1UGS B;  5DLQ E;  2O4X A;  3QPH A;  2I2L A;  3HHT B;  5GAN d;  4FT4 A;  4A4G A;  4NL2 A;  1Y71 A;  5FU6 B;  2G3R A;  3CC4 T;  4BAC A;  1KD1 C;  1BI1 A;  2X4W A;  3OS1 A;  4B9W A;  2E1H A;  4GY5 A;  1NZ9 A;  3OSS C;  2QDY B;  4BE0 A;  3OQ5 A;  3ZEH A;  4EPC A;  3SWN B;  4C8Q C;  3MP6 A;  5A0G A;  5GAN 4;  1JJ2 S;  3C4S A;  1SSF A;  1EIF A;  3R6O A;  2E6N A;  2RO0 A;  4ZTJ A;  3MEW A;  4QVD A;  1IZ6 A;  3LLR A;  4J5Y A;  1W4S A;  4XU0 A;  4HCB A;  3FLG A;  2MWP A;  2CGH A;  4NS5 A;  4XK8 E;  1G3S A;  2WSC E;  1YIJ T;  4M7A F;  4LDW A;  4LDU A;  3CCS A;  4O5V A;  2CZ7 B;  3UDC A;  5GAM j;  3CCS T;  3LGF A;  1VQ7 A;  3F70 A;  4A4H A;  2DXB A;  1X6O A;  3OYA A;  2XI9 A;  5DLO A;  5IN1 A;  1OI1 A;  1UGP B;  3KXT A;  3RMS A;  1YJ9 T;  2KDS A;  5HK0 A;  3L42 A;  2XD0 A;  4L5G A;  2PVO B;  3MO8 A;  3CBP A;  3QUI A;  4Y91 A;  5J39 A;  1RL2 A;  4DQ2 A;  4BY6 B;  3L1A A;  2QA4 A;  2P0P A;  4M75 G;  4HCZ A;  3CMA A;  1VQM A;  3CMA T;  2DZC A;  3H6Z A;  1FX7 A;  2X4J A;  4FU6 A;  3G4S T;  2GCX A;  1BIA A;  2EYQ A;  2ZCF B;  4C92 G;  2DO3 A;  4KT0 E;  4M75 F;  2V8I A;  2X4X A;  2QQB A;  2V8K A;  3JCM b;  2R58 A;  2KMT A;  3M58 A;  4D6W A;  3I55 A;  4E7J A;  5GMK h;  3V8L A;  3OSV A;  1N8R U;  3M59 A;  5CKB A;  3CCU T;  2B8A A;  5LJ3 f;  2DTI A;  4BI4 A;  1ZQ1 A;  2BIV A;  4OF1 A;  3RKW A;  3HFN A;  3ME9 A;  2XU8 A;  4R55 A;  4EMG A;  3A8H B;  4C5E A;  2V8J A;  4N4I A;  2EQK A;  3OS2 A;  1BYM A;  2XDD A;  3JCM Q;  3TCJ A;  3OMG A;  3QJ6 A;  3QKJ A;  3V7C A;  2LRQ A;  2PVG B;  1KC8 C;  2ZPI B;  3TU4 K;  2BUD A;  2JVV A;  4JRQ A;  5CQX A;  3SWN C;  2FYK A;  3CCV T;  3CCL T;  4IUU A;  4XTY A;  3OYJ A;  4ZN3 A;  4BE1 A;  3S3N A;  3PNW C;  4XQ3 A;  4F7U A;  5FU6 C;  4CI0 C;  4F7U F;  1VQO A;  1I81 A;  4RCC A;  5LJ5 g;  2YLB A;  4EMK A;  2MMP A;  2OAU A;  1KQS A;  4ELZ C;  5GAO r;  2XHC A;  4HCC A;  1ZHI A;  2F5K A;  4X34 A;  1HXD A;  3CCR T;  2L3R A;  3A5Z B;  3CXC A;  4EDU A;  1M90 C;  4J6Y A;  4ZGE B;  4VUB A;  1N9R A;  2XIC A;  3LWI A;  5GAN 8;  4MDW A;  5IAY A;  1UGQ B;  3OBY A;  5LJ5 f;  3OS0 A;  3CCJ T;  1YIJ A;  2DXU A;  2EIF A;  5GAN 2;  1Q81 U;  2EQM A;  1LOJ A;  1V29 B;  4M7D G;  4YTL A;  1D3B B;  3PMT A;  1VUB A;  2RHX A;  4FIB A;  5GAN j;  4N4G A;  1YJ9 A;  2ZPG B;  2L5Q A;  2PU9 B;  4XU2 A;  1LNX A;  4M75 A;  5L8R E;  5C6S A;  2K57 A;  3DKM A;  4IUP A;  3FIF A;  3L2U A;  4JRK A;  3G7Z A;  2M1H A;  4IUQ A;  1M1G A;  2E64 A;  4IUT A;  4MMK A;  1QVF S;  1DJ7 B;  1FXX A;  2QQR A;  3ASK A;  1MHN A;  2R5A A;  3MCA B;  4R56 A;  1D3B A;  1KQ2 A;  5GAM e;  4QVC A;  3GF5 A;  3NTI A;  4BD3 A;  3PGG A;  4C0Z A;  3O8V A;  4DA4 A;  1QVF A;  2QXF A;  4N0A A;  4C0F A;  3RKY A;  5FRM A;  3RER A;  4JLG A;  3PIP A;  3M54 A;  4RMO A;  3JB9 I;  5GAN 7;  1WJR A;  3CC2 T;  4QQD A;  2ZPH B;  5DM7 R;  2MWO A;  4M75 C;  3QG1 A;  4P5N A;  2DAQ A;  2H3J A;  3PMI A;  3GLX A;  4M77 C;  3ER0 A;  1VQ8 A;  4OP0 A;  1WJS A;  3GPL A;  3I56 T;  3HL8 A;  5J3B A;  3VV0 A;  2LT4 A;  3L2Q A;  1QVG S;  2RK2 A;  4PKC C;  1VQ9 A;  2R5M A;  2JN0 A;  3G6E A;  3QSU A;  4LD6 A;  4M77 F;  3JCM X;  1VQ7 T;  3TRE A;  3JCM h;  3J80 E;  4PL6 A;  1KC8 U;  3ZBD A;  2HBP A;  2E6Z A;  2WAC A;  1YJW T;  4LD9 K;  1X01 A;  3RKX A;  4JJN K;  4HT8 A;  2WSE E;  2E65 A;  4QQ6 A;  2RHZ A;  2WSF E;  4FM4 B;  4M77 G;  4XAX B;  5GAN 5;  4BY6 C;  1UEB A;  4Z02 A;  4C0D C;  1YJN A;  2K3Y A;  3CCR A;  5GAN f;  4M7A C;  4M7A B;  1P92 A;  3CEY A;  3SFM A;  3QXE B;  3QHS A;  2EJG A;  4PLI A;  3FC3 A;  4ATO A;  3JAM E;  4C92 F;  2DTO A;  3V7R A;  3CCQ A;  4M7D A;  4PNO A;  3LWH A;  4OVA A;  4M75 D;  5D6Y A;  3CC7 T;  2E41 A;  3QYG B;  2FVU A;  3CCJ A;  4RKU E;  2GFU A;  3X24 B;  4PJO A;  1YI2 A;  4HT9 A;  2FHD A;  2HQE A;  3M9Q A;  1XOV A;  1XTD A;  4C8Q E;  2XDB A;  1KHI A;  2IVW A;  5LJ5 h;  2KAF A;  2JUF A;  2K4Y A;  3JB9 H;  3UPU A;  1Q81 C;  1VQK A;  3BDL A;  4II1 A;  5A0L A;  4E47 A;  1BI2 A;  3AHU A;  3KBG A;  3BDU A;  1K73 C;  1JBM A;  1MGQ A;  4F7U E;  4E7K A;  2CZ6 B;  3OYK A;  4M7D C;  4BI3 A;  3OYE A;  3CCL A;  1H3Z A;  2DKG A;  2A7Y A;  2EQJ A;  3X26 B;  3OW2 S;  2JTF A;  4IUR A;  3CBM A;  2RJC A;  1S72 T;  4F7U G;  3L2V A;  4M7A D;  3CCE A;  2YHT A;  2CKK A;  3E1S A;  4PLL A;  4A4K A;  2QEX A;  1VQL A;  3RUX A;  5CR2 A;  3HRT A;  3JB9 G;  2MAM A;  3DB3 A;  4E7I A;  1Y07 A;  2EKO A;  1I8F A;  1I4K 1;  3S6W A;  3X28 B;  2GQV A;  3PTA A;  1VQM T;  1VQP T;  4M7A E;  2RHY A;  1VQP A;  1NPP A;  3CME A;  4KUD K;  4L59 A;  3E19 A;  3VUZ A;  2LCL A;  3SWN A;  3LYI A;  1G3W A;  2L89 A;  4A53 A;  3CCQ T;  2ZPE B;  3FB9 A;  2GF7 A;  3JCM V;  1Y7X A;  4HA8 A;  3MET A;  5I21 A;  3NTH A;  3HKS A;  3G6E T;  2RB6 A;  4OB2 B;  3NFC A;  3EAE A;  5CKE A;  3OW2 A;  4QQG A;  4M78 D;  4LDV A;  3HRU A;  3SB2 A;  1TH7 A;  3C12 A;  3JCM f;  5KCH A;  5GAO p;  1M4Z A;  2PVD B;  4C8Q D;  5KE3 A;  3M5A A;  5KCO A;  3VKI A;  5AYF A;  4M7D D;  2MI6 A;  2DJZ A;  2EJ9 A;  4C0D B;  5GMK j;  2RJD A;  3MEA A;  5D6X A;  3HP9 A;  1XNI A;  5HKC A;  3URG A;  2DZ9 A;  5LL6 S;  4A54 A;  5GAM d;  5GAN 6;  4JS4 A;  5GAM h;  4OGE A;  1QP2 A;  3M4G A;  3SDZ A;  3P8H A;  3L2R A;  4EMK C;  1VIF A;  2DIG A;  3CC7 A;  2DXT A;  5GMK l;  5GAN e;  3RMQ A;  1VQ4 T;  2D0Q B;  3JSC A;  5GMK e;  4KBM B;  2GFA A;  3X25 B;  4EMH A;  3A8M B;  2DXC A;  3VU3 C;  1BKB A;  4M7A G;  3LX7 A;  2RHU A;  3NTK A;  1YCY A;  4Q5W A;  1G5V A;  4M77 B;  3OY9 A;  2JOY A;  3S3O A;  4XTZ A;  3FJP A;  4B9X A;  4A4E A;  5FU7 B;  1PSF A;  5A0D A;  2RM4 A;  3JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...