2E6ZA

Solution structure of the second kow motif of human transcription elongation factor spt5
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
GSSGSSGFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation factor SPT5
publication title Solution structure of the second KOW motif of human transcription elongation factor SPT5
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e6zA00
3J81E 2KDSA 2MWPA 3CD6A 1VQ8T 2E70A 1VQNA 3CC2T 1K8AU 2OTJA 5HY6A 3CMAA 1N8RC 1M90C 1VQKA 3I56A 1Q82C 1K9MU 5DM7R 3CCJA 1YJNT 3LH0A 1S72A 3CPWS 2OTLT 4TVRA 3I55T 1W2BS 1Q81C 1VQ8A 2QA4T 3CC2A 4X34A 1JJ2S 3CCUA 3CCQT 3JAME 1YI2T 1YJWT 2XHCA 3CCLT 1YJNA 2OTLA 3OYYA 3CCEA 1NJIC 1VQ4A 3CCQA 1YJ9T 1YJWA 1M90U 1KD1C 1QVGA 3CD6T 1VQNT 2OTJT 3CC7A 1M1KC 1VQ7T 1Q7YC 2DO3A 3CMAT 3CCJT 3CCRA 3CCST 1S72T 3J80E 1VQ5A 1VQ7A 1BKBA 3CCUT 5J26A 2JNGA 3OW2S 1VQ9T 4ZN1A 1X6OA 3CCSA 1YIJA 1KC8U 1VQ4T 3LGFA 2LQ8A 3PIOA 1VQMT 1YBYA 1M1KU 4YTLA 1Q7YU 3CXCS 3CPWA 3G4SA 1W2BA 1YHQT 1KHIA 1VQ9A 2QEXA 1JJ2A 5IT9E 3CC7T 1QVFS 2LVMA 3CXCA 1VQMA 2E6ZA 4CRIA 1YITA 3CCMA 1KQSS 3J7AF 1N8RU 3CCRT 1YHQA 1Q82U 1VQ6T 3CMET 1VQ5T 1Q81U 3CC4A 3G6EA 1YIJT 3KBGA 1VQ6A 3CMEA 1K73C 1NPRA 1NJIU 3G4ST 1UEBA 2QEXT 2JVVA 3DB3A 2MI6A 3CCVT 1KD1U 2KVQG 1EIFA 3G71T 5A2QE 4RG2A 3OW2A 5DLQE 1YITT 1K9MC 3CCMT 1VQPA 2L3RA 1VQOA 1NZ9A 3CCVA 5LL6S 1NPPA 4ZN3A 3G71A 3CPFA 3CC4T 3G6ET 1QVFA 2JUFA 2EIFA 1VQLA 2G3RA 1Q86C 1XNIA 1M1GA 1KQSA 1RL2A 2MWOA 4QQDA 3CCET 3P8BB 1XTDA 1VQPT 5IAYA 1VQOT 1K8AC 3LGLA 1SSFA 3I55A 1QVGS 2QA4A 2JOYA 1Q86U 1IZ6A 2LCLA 1KC8C 1YI2A 3DLLA 3TREA 3ER0A 3CCLA 2IG0A 2CKKA 1VQLT 3PIPA 3A5ZB 5J3BA 3DB4A 1K73U 1VQKT 5FLXE 3I56T 1YJ9A 3HKSA
chains in the Genus database with same CATH superfamily
4F14A 3QIIA 1I0CA 3CC2T 2RB6A 1VQ7Q 4C92F 3VYGA 3RKYA 3CCJA 3HL8A 1S72Q 2L89A 1M3BA 4OVAA 3CCUA 2F5TX 2YXYA 2EPDA 3CCEA 2ZCFB 4C0ZA 3E9FA 2E12A 3HRSA 1FYNA 2YSQA 2LDMA 3P8DA 1JXMA 4C0FA 4C92G 1P92A 2M51A 3L2VA 3CMAT 5KYUA 1QCFA 5CKEA 4M78D 3CCRQ 2XMFA 4BACA 4R55A 2EW3A 2DRMA 2DMOA 4KUIA 2ED1A 5GMKm 2MOXA 2XD0A 5GMKj 4M7AE 2O2OA 3GNGA 2K5FA 5GMKh 3QO3A 1YHQA 3OYKA 1RI9A 2L3QA 3AHUA 1OPLA 4PJOB 1YCYA 1JJ2P 2DLPA 1WHHA 4HT9A 2NYSA 3OYAA 2FRYA 5LJ5e 1BYMA 3GOXA 4RG2A 4XTXA 1VQOQ 1NZ9A 1K9AA 3RNJA 2EYXA 4J6WA 2E65A 4BDYA 4ELZC 4PJOA 2ENMA 1V29B 2KRMA 1M8MA 3OS1A 1RL2A 4M7DD 3QDFA 1AWXA 1JRIA 1XTDA 2EQJA 3S6WA 3PNWC 5GANj 1UECA 3CCEQ 3I55A 1LPLA 3HFNA 5GANh 2RMOA 4XK8E 2DM1A 5CO7A 2M9UA 2YUOA 4C5EA 3MO8A 2YHTA 3H8ZA 1X75C 2DXBA 3LYIA 4M78C 4ELYC 1N8RR 1R0BG 1ZHIA 1SEMA 1Q81C 2X9HA 2XIDA 2ZPBB 1MGQA 3H0FA 3JAME 3OYEA 1WXUA 2LJ0A 3LW5E 2HDAA 4R56A 2RI5A 5HKCA 4PLIA 4GY5A 3JCMW 3J80E 1WI7A 5CKHA 1JB0E 4M75D 4E7JA 2F69A 2CZ6B 3MP8A 4FYWB 2LX7A 1X6GA 2K7AA 3JCMc 3PIOA 4QT7A 2EJFA 1SKUB 2DTIA 3OMGA 5LJ5d 5IT9E 2RJDA 3M53A 5IHNA 2V8JA 3VYHB 4ME7A 1R77A 4HVVA 4J8OA 4X9CA 1GFDA 8ATCB 5FW9A 3CC4Q 3G6EQ 4FL6A 1WZOA 1K73C 2LC4A 3G71T 1WX6A 4JJNK 4DOVA 2R5AA 2PZ1A 1LJOA 2EJ9A 4FYYB 4XTUA 3QBYA 4PFOA 2DD5A 2AT1B 1NLPC 4PJMA 1A0NB 4DOWA 2A3LA 4PJLA 2LTOA 1Y57A 1RAGB 3ASKA 2L0AA 2QA4A 2BZYA 5GAOn 1SG5A 4AFUC 2Y90A 3PIPA 1TUCA 4FYXB 4OB0B 1PCXA 2PTKA 3LH5A 3MEWA 5GANf 3GIBA 1G5VA 1C1AA 2JW4A 4QKUA 3JB9I 5DM7R 1H641 4M75C 4FT2A 3CC2A 5FU6B 1UFFA 1X6BA 2F1LA 2KROA 1IHWA 2QQRA 1B07A 1QWEA 2P0PA 1HD3A 2OI3A 4C8QC 1T3SA 2K2MA 2HQHA 2OTJT 1RLQC 1Q7YR 4RTZA 1TUGB 2J6FA 3QJ6A 2HBWA 2L8DA 3CCST 1V76A 2PQWA 4OMOA 2KQWA 3HFOA 4PJOG 1Q82R 2LNVA 2K79A 4ZN1A 5L23A 1B34A 2NUTB 2LQ8A 4Z02A 2DTHA 2K3YA 1MMAA 2X4XA 2G6FX 2KSSA 4L59A 1MMGA 4WF2A 5GAN2 2K5IA 1M8VA 3FEOA 2DIQA 3EGXB 4JLGA 5LJ5g 4A4HA 2NUTA 4AFSC 3G4ST 4HKEA 1WLPB 4RTTA 4JS5A 4M78F 2LRQA 3DB3A 2BZ8A 4HCCA 1VQPA 2FVUA 3EG0A 1KG1A 1MV0B 3BE3A 4GBQA 3EG3A 2CSIA 3EGXA 3A8LB 1W4SA 1WQ7A 2SEMA 4DEYA 2O31A 4M78G 4PK4A 1VIEA 1WJQA 2O01E 3CC2Q 2DETA 3FIFA 2VGNA 1UGPB 1R0CB 1TOVA 4RTUA 3OMCA 2HL5C 4DQ2A 4MMKA 5GAN6 2VASA 4LD6A 5LJ3e 2ZAEA 2LJ3A 4PFPA 3CD6A 2QTXA 4AG1C 9ATCB 3CMAQ 3QHSA 2QTVA 2RQUA 1IO6A 4C8QE 4BE2A 3DLMA 2D9TA 3OS0A 2GGRA 5GAMh 3CCQT 3R6OA 3CCLT 2J06A 1SSHA 4M7DF 1T0JA 1XQHA 2B8AA 2RNAA 2C06A 3CC7A 1M1KR 2DO3A 3CCJT 2XU8A 3GP8A 3VS7A 4PJJA 3CCUT 4V2SA 2DYIA 1SF9A 3OW2S 4M7DG 3NPFA 2BIVA 3NHNA 4M77D 5IHIA 1RACB 1M27C 5A0DA 2X3WD 1K76A 2KGTA 4E7KA 4E47A 4ESRA 2DF6A 1YITA 2X4YA 3CCMA 1VOMA 1G2BA 4E6RA 3QUIA 4XTZA 5KCHA 2DJQA 1WDXA 1UJ0A 5FWBA 3JCMh 1IB8A 5GANd 4HCKA 4J9IA 4B9WA 5CR2A 5I11A 4CC7A 1G3SA 2KR3A 2QGGA 1NEBA 4M75F 1RI0A 2DILA 2M1HA 3G71A 4EMKB 2PU9B 2K5LA 4QVCA 4IUPA 4RTVA 3LWHA 3ULRB 4QQDA 4D6WA 4VUBA 4M75G 5EC7A 4Q5WA 1RUWA 2P4TA 3SD4A 2DJZA 3M56A 3QKJA 4AMCA 2D0QB 1UTIA 1D1CA 3CBOA 4OMFB 4EMKA 2E1HA 4J9HA 5LJ5j 4PNOA 4C5HA 2EYZA 2FL7A 2KDSA 2H8HA 3QJYA 5KYWB 2KNBB 1QCNA 3I56Q 1Q82C 1YJNT 3I55T 2RHUA 2AZSA 3WVEB 3PT9A 3OYJA 2JXBA 1ZX6A 2HBPA 3HRUA 2JS2A 1E7OA 4M77C 1JQQA 2LT1A 4JRKA 4BI8B 5IH2A 4LDVA 5KYWA 3PGGA 3ME9A 1VQ5A 2NUPB 1VQ9T 3CCSA 1QVGP 2C0IA 2AIRB 1V1CA 1GCQC 2JT4A 2ATCB 1NLOC 3BW1A 1JU5C 2P4RA 5DLOA 5CQYA 2K57A 3G71Q 4RKUE 2LNHB 5A0GA 1OOTA 3M4YA 2YWWA 5I2MA 1E6GA 3L2QA 2QASA 2GTJA 4DBRA 2RJCA 3CPWP 1NPRA 2ESWA 2QQAA 4DBQA 4C92E 2JM8A 3OYNA 3CCVT 4BY6C 3GPLA 1ZUKA 2V1RA 2CP2A 2AK5A 4J6XA 2CT4A 1I5OB 4QVDA 2DEQA 2HCKA 1G8XA 4N0AA 3CXCP 2O9SA 1PRMC 2E6NA 1GBRA 1BCMA 1X43A 2DXCA 4HVWA 4HXJA 4HA8A 1WXBA 5GAMe 4XU0A 3JB9D 4J6YA 2MPXC 2EQKA 3QG1A 1VQKT 4M7AB 2E10A 3HKSA 5J39A 2OTJQ 1K8AU 4PJOD 3R6NA 1M90R 1DJ7B 3TQ7P 5LJ5f 2VB6A 4TVRA 1W2BS 2QA4T 4X34A 1BB9A 4KGVB 2YUQA 3PMTA 4P5NA 2RM4A 3CQTA 1PSFA 1GBQA 3CCQA 2MAMA 5D6XA 4M7AA 1SPKA 2KYBA 2QDYB 2EKHA 4O6JA 1N5ZA 1UHFA 2IVWA 3IQLA 5D7UA 1QP3A 5KYUB 5J26A 4OGEA 1NE8A 3WVDB 2D8HA 2RQWA 5I2SA 3JCMe 1YFNA 1YBYA 1IGUA 2WSFE 3G4SQ 1KHIA 3RKXA 1KIKA 2PVGB 3EH1A 2C0TA 2RO0A 2AKKA 1Q95G 2E6ZA 3X25B 1TUDA 1KQSS 1OZ3A 3CMET 2QQBA 1BU1A 2DA9A 1Q81U 2DL8A 4Y92A 4X9DA 2KEAA 1OEBA 3EG2A 1WHGA 1UJYA 4B6MA 1TSFA 3G1JA 1M5Q1 1EFNA 3X28B 2FEIA 1RAHB 1TH7A 3V7SA 3V7CA 4XU2A 1I1JA 3UA6A 3L2ZA 2CUBA 2O88A 4ORZA 1VYVA 1D1AA 4M77F 5GAMd 4LUDA 2EIFA 4LUEA 3NTIA 2WSCE 3I5SA 4XAXB 2XG8D 1OZ2A 2KT8A 4PJOC 4BI4A 1I5LA 1VQPT 1K8AC 2YUNA 2DRKA 4F7UF 3TSWA 4J7IA 1HXDA 1Z9QA 4M77G 1KC8C 5KCOA 3CCLQ 2CH4A 1LVKA 4OB1B 1K73U 3OA6A 2FPFA 5CVIA 5FLXE 1M1FA 1RADB 2RK2A 4J9CA 1OI1A 2PVDB 1U5SA 3PE0A 4E7HA 2EQIA 4F7UG 5EG2A 3CCJQ 1MV3A 3RESA 3CCUQ 1NG2A 1IGQA 4LN2A 2O9VA 2R5MA 1JBMA 1SHGA 4OMQA 1YJNA 1PKTA 4E2FB 3OSVA 4OMLA 3JCMd 2FYKA 1IXDA 3CD6T 4II1A 3FLGA 3RERA 2KK4A 3NMZC 2CP5A 2L3SA 2ROTA 1Z9ZA 2J6OA 2XKOC 4XU3A 1QKWA 2ED0A 3SHWA 4RG8A 2DTOA 1N9SA 1CKAA 1VQMT 4CC4B 2RHZA 2W10A 1VQ9A 3MEAA 2A0FB 1NJIR 2MIOA 5LJ3h 3CC7T 1QVFS 2LVMA 3CBMA 2LP5A 2M16A 2L3PA 1KD1R 3A8MB 3M58A 4OGCA 4XTWA 2E5KA 1YHQQ 3M9QA 2JM9A 2RF0A 1F1BB 3L1AA 5FRNA 4LDWA 5KYXB 1N6AA 4ZNXA 1PNJA 4FT4A 2DL3A 3G7ZA 3DKMA 2CP0A 2MI6A 4BUGA 5C6SA 1RAIB 1K0XA 1WGSA 1YITT 3CCMT 2MK5A 4AG2C 3EGUA 1KSWA 3CCVA 3HTRA 5GMKi 3M0UA 5A0LA 5KYXA 1Q86R 3A1PA 3QSUA 1ZSZC 3MEVA 3OYBA 1U8RA 1K1ZA 2HSEB 2VUBA 2FZCB 2YLBA 1BCOA 2VXEA 2RHXA 4M7DC 3M5AA 8AT1B 2QG9B 5IAYA 5GAMg 1YJNQ 3I55Q 3I35A 1PD1A 2CKKA 1Y0MA 4HT8A 2KXCA 1YJ9A 2V8IA 1X27A 4C0GA 4QW2A 4RCCA 1VQNA 2EAYA 1VQKA 3EHQA 2X35A 2OTLT 3MPUB 1JJ2S 2D1XA 2YDLA 2V1QA 2HQXA 1UGRB 4M78E 1PHTA 2XDDA 2X3XD 2VGMA 4CC3A 4A54A 1KJWA 1UGQB 4A4KA 1W70A 2RH2A 3V8JA 4ZTJA 2KE9A 3JB9F 3D7SB 1GCPA 3JCMg 2JNGA 4FYVB 2DZCA 4E7ZA 1U1SA 4J9FA 4YTLA 4JJBA 1I4K1 4PJOF 1M3AA 1B34B 5FU6C 3M0TA 5CAIA 5AYFA 3GBQA 3JB9G 1AOJA 4EMGA 1VQ5T 1T3LA 1VA7A 4EPCA 4E7IA 4Z8AA 2DL4A 2I2LA 1B3QA 3BDUA 3CMEA 2XI9A 4OB2B 4UC4A 4BE1A 3V8LA 1TTHB 2OJ2A 2JTFA 2RQRA 4OB3B 4ZGDB 3OW2A 4C8QB 2CYZB 1ABOA 1HJDA 4FSXA 3JCMb 2ZGWA 3UF4A 1NPPA 1RABB 3HRTA 3P8HA 3CPFA 5FROA 3M0SA 4M7DE 3EH2A 2DPPB 4HVUA 2XICA 1VQKQ 1QVPA 2JMAA 4LXCA 1G3TA 7AT1B 1IREB 1AWOA 4C8QA 1YWOA 2QA4Q 3PVQA 1K0SA 3M59A 2QYZA 4NOYA 2LJ1A 1RLPC 1G83A 3RKWA 1PSEA 2A36A 2RD1A 1BBZA 2FPDA 3L2WA 2YLCA 2K9GA 1U1TA 2DIGA 3EAEA 5HY6A 3FC3A 1N8RC 1FMKA 1AZEA 3I9QA 2FB7A 2EBPA 1UB4A 2O4XB 2RPNA 2XHCA 2OAUA 3VUZA 1NJIC 1VQ4A 2LQWA 2F2WA 5GAN3 1ZBJA 2PUKB 3KXTA 1KD1C 2W0ZA 1QWFA 4JZ3A 4EDUA 4M75E 4D8KA 2DAQA 4PL6A 4BB7A 5CQXA 5KYYB 3UWNA 1QQJA 5GAMj 2O4XA 2GQVA 1X6OA 2AHJB 1YIJA 1UUEA 1Q7YU 3OYFA 2QEXA 3FDRA 2K3BA 2FG0A 2RJEA 3C95A 1VQMA 2X4JA 4MZPA 3NTKA 3J7AF 2EQMA 4XTVA 4AT1B 1Q82U 2V8KA 6AT1B 2LMJA 1X01A 1Y07A 4A63B 5KYYA 2QGFB 2DNUA 4D8DA 3GNFB 3EG9A 1FXXA 2YT6A 1M2OA 2ZPGB 1U3OA 3INZA 1JEGA 2YRCA 3SB2A 4QVZA 1SRMA 5D6YA 2DBMA 2DFUA 4QQGA 2XDBA 4FCYA 5FU7B 2XK0A 1VQPQ 3M0RA 1PM3A 4IIOA 4JDSA 1TWBA 3E2UA 5LL6S 2VVKA 4IUQA 2MYSA 3FRNA 1M4ZA 2MCNA 2BTTA 1VQLA 1XNIA 2K2VA 2F2XA 1H92A 3QXEB 3VS4A 1RAAB 2JN0A 3OYCA 3P8BB 4A4FA 1MMNA 1D0ZA 2A37A 5GAOr 1K9MR 2M02A 3ER0A 3RDVA 2RQTA 3CD6Q 1X69A 2SRCA 5LJ3d 2LQKA 3FJ5A 4JZ4A 3QZ5B 2YRDA 4OF1A 1QW1A 1NEGA 1YJWT 4JRPA 2VC8A 2OTLA 2KRNA 1OQKA 4OMPA 2KYMA 4C92B 3O5ZA 3CC7Q 1Q7YC 1UE9A 2BZXA 2L2PA 4KUDK 2DL7A 3ZBDA 1FWZA 1YP5A 2HZYA 2DZ9A 4PJNA 5GJVB 4AFQC 4JRIA 1PG5B 4BE0A 5I22A 1M1KU 4C92A 1W2BA 2DYBA 5GAMf 3HHTB 1GFCA 3QDRB 4L6V5 2COWA 2ROLA 2GFAA 3CCMQ 1YITQ 1S1NA 1JO8A 4M7AD 3ZFJA 3E1SA 1BK2A 3H41A 4KT0E 2FHDA 1TG0A 2HQEA 2CSQA 3C0CA 2JMCA 1SRLA 2ZPHB 3S3NA 2QAZA 1W6XA 2QQSA 3NFCA 2KRSA 3VKIA 4J7FA 5CIUA 4LE9A 4RTXA 3O8VA 5HK3A 4OMMA 3C12A 2HEQA 1BI2A 2AKLA 5ECAA 1UDLA 2P84A 4MZTA 1H3HA 2P0QA 2JUFA 3A98A 2HAXA 2L5QA 1KQSA 3JCMV 5CCAA 2D6FA 1WJRA 1HK9A 3EFRA 3JCMf 2FZGB 2EVRA 3TVTA 2GTOA 2R58A 3NGPA 3EGDB 1JXOA 4KBMB 1AWWA 1YI2A 1UGSB 3TREA 3OYIA 3JV3A 4Y91A 3A8HB 2LX9A 1VQ8T 1GCQA 2QXFA 2DK3A 1FMWA 2KI7A 1S72A 1YWPA 2DXTA 5KE2A 1AHJB 3EGDA 3H6ZA 3SWNB 1QCOA 3C4SA 2CGHA 3OY9A 1PWTA 2A08A 5LJ3g 1YJ9T 2DXUA 2EQUA 5IN1A 1VQNT 4FSSA 1M1KC 2J05A 4FW2A 2C0OA 1FMVA 3MJXA 4ANJA 4M7AC 3CCRA 3VUBA 4FM4B 1VQ5Q 4M77E 2QI2A 4N4HA 3SWNA 1MUZA 1W1FA 3OB9A 1KC8U 3CCSQ 3UATA 1U06A 3LGFA 2AZVA 4MDWA 4C0DC 1PC0A 3MEUA 2J6KA 3CXCA 4F7UE 4R0KA 3URGA 5D6WA 4PFZA 4A4EA 1VIFA 4EMHA 4RCBA 1QMCA 4LD9K 2E3HA 1LOJA 2KVQG 2FRWA 1EIFA 1K9MC 4IURA 1ZBXA 2XDPA 2E4HA 1VQOA 3UDCA 3RUXA 1WQWA 2GFUA 2JS0A 3HSBA 2DX1A 2RA2A 1QVFA 4O5VA 2KBTA 3OQ5A 2G3RA 3CEYA 4N4GA 5GAOl 2M0OA 1KK7A 2GNCA 4N4IA 2WSEE 3SEMA 1OX9A 2EFIA 1AVZC 1QVGS 2JOYA 2EYWA 3DLLA 1VYTA 2JTMA 1EX4A 2PNIA 2X51A 3CBPA 2BUDA 4FIBA 3PMIA 2MWPA 2RJFA 2COZA 1WHMA 2NWMA 3CPWS 1PRLC 4Z89A 1VUBA 1SHFA 4IIMA 1WJSA 2EKOA 3PFSA 3RR6A 2DL5A 4WTOB 1OULA 3CCQQ 1YJWA 1ZA2B 1M90U 3LWIA 2CP7A 2KAFA 3A8GB 2K6DA 1HYOA 2D0NA 4ZGJB 2EGCA 1PKSA 3UPUA 1BKBA 3M55A 3Q1JA 3MHXA 4ZGEB 3TCJA 1VQ4T 2RI3A 1UHCA 4Y28E 5L8RE 1YN8A 3CXCS 5CKDA 1JJ2A 2WACA 1G3WA 1BIAA 2FO0A 1VQ6T 4XTYA 4K11A 1YNZA 1D3BB 2BE7D 3CC4A 1X2QA 3G6EA 1YIJT 2BKDN 2E41A 2HD0A 5FWCA 3QWYA 2QEXT 4C5GA 4CI0C 5LJ3j 3V7RA 4PKCC 4BD3A 3BY7A 5DLQE 2CZ1B 2PUOB 3THKA 3EHRA 4JPBW 2H3EB 4ZTFA 3VJPA 1D3BA 5KH6A 3OYMA 1WA7A 4M78B 2Z0WA 1R8OB 1E6HA 1OPKA 1WFWA 3X24B 1TXQA 4Z88A 1WIEA 4M7AF 5HK0A 2FPEA 3X20B 2DVEA 3LLRA 2IIMA 2P0KA 4E7SA 2LCLA 3VV0A 2Y4YA 1YJWQ 2HKNA 2HL3A 1AZGB 1VQLT 3TU4K 5IXBA 4PJOE 3JB9J 4M78A 3VS2A 4MDXA 3I56T 4FW1A 3UA7A 4M7AG 4A53A 1M90C 1ZA1B 4JRQA 5C0MA 2K3XA 3U23A 1VQ8A 4X1VA 5CK9A 4M4ZA 3OYLA 4C8QD 1D1BA 2VV5A 2LZ6B 1LNXA 2F2VA 2GF7A 2NLUA 1O75A 1ZSZB 2OX7A 2LT4A 5M9OA 1AT1B 2CP3A 3EG1A 3MKDA 4M7DB 3VS5A 3QZ9B 4A4GA 1BI0A 1ARKA 2YRVA 1VQ9Q 1QLYA 3L42A 2K4YA 1ZSZA 3MP6A 3E9GA 1T0HA 1XOVA 1N8RU 4F17A 1ZSGA 1CSKA 3REAB 5GAN8 4M7DA 4B9XA 4ATOA 1QKXA 2E5QA 1NJIU 4EIKA 2X4WA 1UEBA 2CS7A 1WHKA 1KD1U 2KY9A 5A2QE 3ZEHA 1AD5A 1NYFA 1WXTA 3CCVQ 4NS5A 1UG1A 1D0YA 3JCMX 5LJ3f 3UT1A 1GRIA 3OW2P 1OU8A 3LX7A 4M75B 2CUDA 2PVOB 4JJDA 1VQ8Q 4LDUA 1WHLA 3META 3BFMA 5CKBA 2HNIA 2CZ7B 4RTYA 4DBHA 1Q86U 2IG0A 2LCCA 3M54A 5J3BA 1YJ9Q 4LDXA 1Y7XA 4KH1B 5GMKe 4M75A 2D8JA 1VQNQ 1ZUYA 4KULA 5GMKl 3CMAA 2LCSA 1TS9A 3LH0A 1M30A 3H0HA 4J9GA 3TEEA 2EYYA 4GLMA 1YI2T 2RK1A 4L5GA 1WNLA 1MMDA 1NBEB 4BDZA 2CREA 1J3TA 3C94A 5I21A 2DVJA 4F04B 1Y96B 2ZPEB 1VQ7T 2LQNA 1MHNA 4J9BA 1I81A 1S72T 4IUTA 1UGVA 2DE0X 3FJPA 1MNEA 3VS0A 3MCAB 3VS1A 1GL5A 4DBFA 3L2RA 3AT1B 3H9NA 2COYA 4DA4A 1ACMB 1Y96A 4JS4A 3RMSA 4DEXA 1O9SA 1I8FA 3MP1A 4JLIA 3CCRT 4KH0B 5CKFA 5GANe 3GLXA 5GAOp 1Y71A 1QP2A 5GAN7 2QQ9A 2HSPA 2DD4A 2VWFA 1BI1A 3CMEQ 1VQ6A 3A8OB 3ZL7C 1H8KA 2EYQA 3EG9B 1C0MA 1IRXA 2V26A 3M0QA 2CH4W 3RIRA 3QWXX 1XJWB 2EGAA 1M2VB 1OYXA 4C92D 1N27A 1X2KA 2JTEA 2ZZDA 2H3JA 3OYGA 1CKBA 1Q86C 3VS6A 2Y4XA 2CT3A 2IPOB 4JJCA 3KFVA 2ZPIB 1VQOT 2EJGA 1M2VA 2RI2A 1ZUUA 5HCKA 5FU7C 4C5IA 1IZ6A 2MF2A 1HSQA 1NM7A 4BI3A 1MNDA 4OMNA 4LDYA 1FX7A 3DB4A 4J5YA 2ABLA 4PLLA 2E70A 3PVLA 3I56A 2BE9B 3CCET 3JB9H 4OP0A 3EFOB 5GAOm 4NL3A 1RAEB 3QYGB 5GAN5 4QQ6A 1EZZB 3VRYA 3SFMA 1VQ4Q 2JZ2A 3FB9A 5IHKA 2E64A 2RHIA 4MMLA 1LCKA 1NYGA 3N5BB 2DERA 1VQ6Q 4EMKC 3EFOA 1K4US 3T9NA 2QDLA 1YIJQ 2QK0A 4KGXB 4HCZA 5DY9A 2VYTA 5KYNA 3RBBB 1YHQT 4JUVA 2QEXQ 3VU3C 3OYHA 1H3ZA 4LNPA 1VQMQ 3S3MA 4C92C 2VXFA 1M9SA 4C8QF 3OBWA 2GCXA 1W2BP 1M3CA 2RN8A 3BDLA 3SDZA 2A28A 4KRTA 2YUPA 2MMPA 3EFSA 4F16A 1PD0A 1D09B 2L3RA 1IHVA 4C8QG 4ZN3A 3OS5A 1OU9A 3CC4T 2F5KA 3G6ET 1I07A 3JCMP 2E3IA 1VQLQ 1M1GA 5LJ5h 4RMOA 3JSCA 3V8KA 3X26B 1KQ2A 2KMTA 3M4GA 2CZ0B 1N9RA 3QPHA 1K8AR 3LGLA 4M77B 3HPWA 1SSFA 4IKFA 1KQSP 1KC8R 1AEYA 3REBB 1OX8A 1ABQA 2KT1A 1WHJA 4RUGA 2DBKA 1ZQ1A 3J81E 2OTJA 1B7TA 5GAOq 4F7UB 2JJ9A 1YCSB 3TSZA 1K9MU 1WPYA 4M77A 2DEUA 3VRZA 4FU6A 3GF5A 3PTAA 2OTLQ 3OYYA 4N0AC 3WXMB 4IUUA 4XU1A 4XQ3A 3M0PA 1QVGA 1RAFB 3OYDA 5KE3A 4F7UA 3M57A 1ZLMA 2NUPA 1OV3A 2KXDA 1VQ7A 4RTWA 2CP6A 1VYUA 3VS3A 4AFZC 2J7IA 3F70A 2RQVA 4BY6B 1Q81R 1TU0B 2HMAA 3HP9A 3S3OA 3I5RA 3SWNC 3CPWA 3G4SA 5GJWB 1C6VX 1WYXA 5GANg 1KHCA 5GAN4 4J83A 4KGZB 4CRIA 3RMQA 3L2UA 2I0NA 1GXIE 4HCBA 1G3YA 1BIBA 4NL2A 4J9EA 2ZPFB 3OS2A 2EWNA 3KBGA 2GBQA 2FZKB 1AWJA 2JVVA 3JCMQ 3KUFA 2EGEA 3E19A 3JCMJ 3QYHB 2DKGA 1KFZA 1BI3A 4E7LA 1D0XA 3OBYA 4IUVA 2GQIA 4CC2A 2ECZA 2M0YA 5AT1B 4MZMA 3OSSC 2MWOA 1K73R 2A7YA 2OAWA 3JRZA 2R57A 4GLKA 2B86A 3H0IA 2VKNA 4C0DB 1KQ1A 3NTHA 1QVFP 5IXFA 4J9DA 2NUZA 4WCIA 1YI2Q 3CCLA 2RHYA 2HKQB 5FRMA 3A5ZB 2CDTA
chains in the Genus database with same CATH topology
1U1TA 2FL7A 2DIGA 2KDSA 3QIIA 4M7AG 3EAEA 4A53A 3CC2T 2RB6A 4C92F 5HY6A 3VYGA 3RKYA 3QJYA 3FC3A 1N8RC 1M90C 1Q82C 3CCJA 3HL8A 4JRQA 5C0MA 2L89A 1YJNT 2K3XA 3I55T 2FB7A 2RHUA 1VQ8A 3WVEB 1UB4A 3PT9A 4OVAA 3CCUA 3OYJA 2F5TX 2O4XB 2XHCA 5CK9A 2HBPA 2OAUA 3VUZA 3OYLA 3CCEA 1NJIC 3HRUA 4C8QD 2ZCFB 4C0ZA 2VV5A 3E9FA 4M77C 1VQ4A 2E12A 3HRSA 1LNXA 2NLUA 2GF7A 5GAN3 2LT1A 2PUKB 3KXTA 4JRKA 2LDMA 3P8DA 4C0FA 1KD1C 4BI8B 4C92G 4EDUA 1O75A 1P92A 4M75E 3L2VA 3CMAT 4LDVA 2LT4A 5CKEA 2DAQA 4M78D 3PGGA 5M9OA 4PL6A 4BB7A 5CQXA 3ME9A 1VQ5A 3UWNA 4M7DB 5GAMj 4BACA 4R55A 1VQ9T 3QZ9B 2O4XA 4A4GA 2GQVA 1BI0A 1X6OA 2AHJB 3CCSA 1YIJA 4KUIA 5GMKm 2YRVA 1Q7YU 3OYFA 2XD0A 5GMKj 2QEXA 4M7AE 3FDRA 3L42A 3BW1A 3GNGA 5DLOA 2RJEA 2K5FA 2K4YA 2K57A 3C95A 2X4JA 5CQYA 1VQMA 3MP6A 4RKUE 4MZPA 3E9GA 3NTKA 3QO3A 1XOVA 2EQMA 4XTVA 5A0GA 5GMKh 1YHQA 1Q82U 1N8RU 2V8KA 3M4YA 5I2MA 1X01A 1Y07A 3OYKA 3L2QA 3GNFB 5GAN8 1FXXA 3AHUA 4M7DA 2RJCA 2ZPGB 4B9XA 3INZA 4PJOB 4ATOA 1YCYA 3SB2A 2E5QA 1NPRA 1NJIU 4HT9A 2X4WA 4QVZA 3OYAA 5D6YA 2QQAA 5LJ5e 1UEBA 3GOXA 1BYMA 4QQGA 2CS7A 4C92E 3OYNA 3CCVT 1KD1U 2XDBA 5FU7B 4BY6C 2KY9A 2XK0A 5A2QE 4RG2A 3GPLA 3ZEHA 4XTXA 4JDSA 1NZ9A 5LL6S 4NS5A 4IUQA 3FRNA 4J6WA 1M4ZA 2E65A 5LJ3f 3JCMX 4BDYA 4ELZC 3UT1A 4PJOA 4J6XA 1V29B 1VQLA 1XNIA 4QVDA 2K2VA 2DEQA 3OS1A 1RL2A 3LX7A 3QXEB 4M75B 4M7DD 2PVOB 3OYCA 2JN0A 3P8BB 1JRIA 4N0AA 4A4FA 1XTDA 2EQJA 4LDUA 3S6WA 3PNWC 5GANj 3META 2E6NA 3BFMA 5CKBA 2HNIA 3I55A 5GAOr 2CZ7B 2DXCA 1Q86U 4HA8A 3HFNA 5GAMe 5GANh 4XU0A 3ER0A 3JB9D 2IG0A 4J6YA 2LCCA 4XK8E 2EQKA 3M54A 3QG1A 5J3BA 1VQKT 5CO7A 2E10A 2M9UA 3HKSA 4M7AB 4LDXA 4C5EA 1Y7XA 5J39A 5GMKe 3MO8A 4M75A 2YHTA 3H8ZA 1K8AU 1X75C 2DXBA 4PJOD 4KULA 3LYIA 4M78C 5LJ3d 4ELYC 5GMKl 3CMAA 2LQKA 1ZHIA 1DJ7B 3LH0A 5LJ5f 3QZ5B 4TVRA 1W2BS 1Q81C 2QA4T 2XIDA 4OF1A 4X34A 2ZPBB 1MGQA 3TEEA 1QW1A 3JAME 1YI2T 1YJWT 4PJOE 2RK1A 3OYEA 4L5GA 1WNLA 2VC8A 4JRPA 2OTLA 3PMTA 4P5NA 2RM4A 1PSFA 4BDZA 3CCQA 2MAMA 3LW5E 4C92B 4R56A 5D6XA 4M7AA 3C94A 5I21A 2RI5A 1Y96B 2ZPEB 2QDYB 1VQ7T 4O6JA 1Q7YC 1MHNA 5HKCA 1I81A 4PLIA 4GY5A 3JCMW 1S72T 4IUTA 2IVWA 3J80E 4KUDK 3ZBDA 1QP3A 5CKHA 5J26A 1JB0E 1FWZA 4M75D 4OGEA 1NE8A 3WVDB 4E7JA 2DZ9A 3FJPA 2F69A 2CZ6B 3MP8A 5I2SA 4JRIA 3MCAB 4BE0A 3JCMc 3JCMe 3PIOA 1YBYA 1M1KU 2WSFE 2EJFA 4C92A 2DTIA 1KHIA 3OMGA 3RKXA 2PVGB 5LJ5d 3L2RA 1W2BA 5GAMf 3HHTB 5IT9E 4DA4A 1Y96A 3QDRB 4JS4A 2RO0A 4L6V5 3RMSA 2E6ZA 1O9SA 1I8FA 2RJDA 3M53A 2GFAA 2V8JA 3MP1A 4JLIA 3VYHB 3X25B 3CCRT 1OZ3A 1KQSS 3CMET 4ME7A 5CKFA 5GANe 4M7AD 2QQBA 3ZFJA 3E1SA 3GLXA 4J8OA 4KT0E 4X9CA 5GAOp 1Y71A 1Q81U 2FHDA 1QP2A 2HQEA 5GAN7 2QQ9A 4FL6A 4X9DA 2DD4A 1VQ6A 1BI1A 3A8OB 2ZPHB 1K73C 2EYQA 3S3NA 2QQSA 2LC4A 3NFCA 3VKIA 3RIRA 1M5Q1 4J7FA 5CIUA 3G71T 3X28B 4JJNK 1TH7A 4DOVA 3V7SA 2R5AA 3O8VA 3V7CA 5HK3A 1LJOA 1OYXA 2EJ9A 3C12A 4XU2A 1BI2A 4C92D 3L2ZA 1N27A 2ZZDA 4M77F 2H3JA 4MZTA 3OYGA 5GAMd 2P0QA 2JUFA 2EIFA 3NTIA 2WSCE 1Q86C 2HAXA 2Y4XA 2L5QA 4XAXB 4XTUA 1KQSA 3QBYA 2XG8D 1OZ2A 2DD5A 3JCMV 5CCAA 4PJOC 4DOWA 2A3LA 2ZPIB 4BI4A 2D6FA 1WJRA 1HK9A 1I5LA 3EFRA 1VQPT 2LTOA 3JCMf 1VQOT 1K8AC 3ASKA 2R58A 2EJGA 2RI2A 4F7UF 2QA4A 4J7IA 5FU7C 1HXDA 4C5IA 5GAOn 1IZ6A 4M77G 4KBMB 1KC8C 1YI2A 2MF2A 5KCOA 1UGSB 3TREA 4BI3A 4OB1B 2Y90A 3PIPA 5GANf 3OYIA 4LDYA 4OB0B 1FX7A 3DB4A 3MEWA 3OA6A 4J5YA 5CVIA 3A8HB 4PLLA 4Y91A 5FLXE 3GIBA 1G5VA 1M1FA 2LX9A 1VQ8T 2E70A 2RK2A 1OI1A 2PVDB 2QXFA 2DK3A 3I56A 3JB9I 5DM7R 4E7HA 4F7UG 1H641 5EG2A 1S72A 3CCET 3JB9H 2DXTA 4M75C 4FT2A 4OP0A 3CC2A 5KE2A 1AHJB 3RESA 5GAOm 3H6ZA 3SWNB 4NL3A 3QYGB 5GAN5 2R5MA 1JBMA 4QQ6A 1YJNA 5FU6B 3C4SA 2CGHA 3SFMA 3OY9A 3OSVA 2QQRA 5LJ3g 3JCMd 2P0PA 1YJ9T 2DXUA 2EQUA 4C8QC 2FYKA 3CD6T 5IN1A 4II1A 3FLGA 1VQNT 2JZ2A 1M1KC 3FB9A 3RERA 2OTJT 2KK4A 3QJ6A 2E64A 2RHIA 4MMLA 4M7AC 2L8DA 3N5BB 3CCRA 3VUBA 3CCST 2PQWA 4FM4B 4EMKC 2KQWA 3HFOA 4M77E 4PJOG 2QI2A 4N4HA 3SWNA 2LNVA 3T9NA 4XU3A 2XKOC 4ZN1A 3OB9A 1KC8U 4RG8A 1B34A 2DTOA 3LGFA 1N9SA 2LQ8A 4Z02A 1VQMT 2DTHA 2RHZA 4HCZA 2K3YA 2VYTA 4MDWA 5DY9A 1VQ9A 3MEAA 4C0DC 4JUVA 1YHQT 3VU3C 2X4XA 5LJ3h 3OYHA 3CC7T 2KSSA 1QVFS 4L59A 1H3ZA 4WF2A 2LVMA 3CBMA 3MEUA 5GAN2 3CXCA 3S3MA 2M16A 2K5IA 4F7UE 1M8VA 3A8MB 3M58A 4OGCA 2VXFA 4XTWA 4C92C 3FEOA 3URGA 5D6WA 1M9SA 3M9QA 4C8QF 2DIQA 3OBWA 3L1AA 5FRNA 2GCXA 4LDWA 4JLGA 4A4EA 1VIFA 5LJ5g 1N6AA 4EMHA 4A4HA 4RCBA 3BDLA 4FT4A 3SDZA 4LD9K 3G7ZA 3G4ST 1LOJA 3DKMA 4HKEA 4JS5A 4M78F 2LRQA 3DB3A 2MI6A 4BUGA 5C6SA 2KVQG 3EFSA 1WGSA 2MMPA 4HCCA 1EIFA 1K9MC 4IURA 1ZBXA 2XDPA 1YITT 3CCMT 1VQPA 2FVUA 2L3RA 1VQOA 3UDCA 4C8QG 3CCVA 4ZN3A 1KG1A 3OS5A 5GMKi 3RUXA 1WQWA 2GFUA 3HSBA 3CC4T 2F5KA 3G6ET 2RA2A 1W4SA 3A8LB 1QVFA 4O5VA 3JCMP 1WQ7A 3OQ5A 5A0LA 2G3RA 3CEYA 3QSUA 4N4GA 1M1GA 5LJ5h 5GAOl 2M0OA 4RMOA 3MEVA 3JSCA 4M78G 3OYBA 1U8RA 2VUBA 3V8KA 1VIEA 1WJQA 3X26B 2YLBA 2O01E 1KQ2A 2VXEA 2KMTA 2RHXA 3FIFA 4N4IA 3M4GA 2VGNA 2WSEE 3M5AA 4M7DC 5IAYA 1UGPB 2CZ0B 1N9RA 3QPHA 5GAMg 3LGLA 4M77B 2EFIA 3HPWA 1SSFA 3OMCA 4IKFA 1QVGS 2JOYA 4DQ2A 3DLLA 4MMKA 2CKKA 5GAN6 2JTMA 4LD6A 5LJ3e 4HT8A 3CBPA 1YJ9A 2V8IA 2BUDA 4FIBA 4C0GA 1ZQ1A 3PMIA 4QW2A 2MWPA 4RCCA 3J81E 3CD6A 2RJFA 1VQNA 2OTJA 2QTXA 5GAOq 4F7UB 2EAYA 3J7AF 1VQKA 3QHSA 1K9MU 2X35A 4C8QE 2OTLT 4BE2A 1WPYA 3CPWS 3DLMA 2D9TA 4M77A 3OS0A 1VUBA 1JJ2S 5GAMh 3CCQT 3R6OA 1WJSA 3CCLT 2EKOA 3GF5A 3PFSA 4FU6A 3OYYA 3PTAA 4M7DF 2HQXA 1UGRB 1XQHA 4N0AC 4IUUA 2B8AA 4XU1A 3WXMB 4M78E 4XQ3A 2XDDA 2C06A 1YJWA 1M90U 1QVGA 3LWIA 2VGMA 2KAFA 3A8GB 4A54A 3OYDA 3CC7A 2DO3A 5KE3A 4F7UA 1UGQB 3M57A 4A4KA 2RH2A 3V8JA 3CCJT 2XU8A 4ZGJB 4ZTJA 3JB9F 3GP8A 1VQ7A 3UPUA 1BKBA 3M55A 3CCUT 3Q1JA 4V2SA 3MHXA 3JCMg 4ZGEB 2JNGA 3OW2S 2DZCA 3TCJA 4M7DG 3F70A 2BIVA 1U1SA 4BY6B 2RI3A 1VQ4T 4Y28E 3HP9A 5L8RE 4YTLA 4PJOF 1I4K1 4M77D 3CXCS 3SWNC 3CPWA 3G4SA 3S3OA 5A0DA 1B34B 5CKDA 1JJ2A 4E7KA 5FU6C 5GANg 1KHCA 4E47A 2WACA 4J83A 1G3WA 5GAN4 1BIAA 5CAIA 4CRIA 3RMQA 1YITA 2X4YA 3L2UA 3CCMA 1GXIE 4HCBA 5AYFA 3JB9G 1G3YA 1BIBA 4XTYA 1VQ6T 4EMGA 1VQ5T 4NL2A 3QUIA 4XTZA 4EPCA 1D3BB 2ZPFB 3OS2A 2EWNA 4E7IA 5KCHA 3CC4A 2I2LA 3BDUA 3G6EA 1YIJT 2BKDN 3KBGA 3CMEA 2XI9A 4OB2B 3JCMh 2E41A 2HD0A 5GANd 1K73U 4UC4A 4BE1A 3V8LA 4B9WA 5CR2A 2QEXT 2JVVA 4C5GA 3JCMQ 2JTFA 4CI0C 3V7RA 1G3SA 4PKCC 4BD3A 5LJ3j 3KUFA 3BY7A 4OB3B 4ZGDB 3E19A 3OW2A 5DLQE 4C8QB 2CYZB 2CZ1B 4M75F 1RI0A 3JCMJ 3QYHB 2PUOB 2M1HA 2DKGA 4FSXA 3JCMb 2ZGWA 1NPPA 1BI3A 3HRTA 4E7LA 3P8HA 3G71A 3CPFA 4ZTFA 3VJPA 1D3BA 5KH6A 5FROA 3OYMA 4M7DE 3OBYA 4EMKB 2DPPB 2PU9B 2XICA 4IUVA 2K5LA 4M78B 4QVCA 1R8OB 1QVPA 4IUPA 3X24B 4MZMA 3LWHA 3OSSC 2MWOA 4QQDA 2A7YA 1G3TA 4D6WA 4VUBA 3JRZA 4M7AF 2R57A 4M75G 4GLKA 4Q5WA 1IREB 4C0DB 1KQ1A 4C8QA 3NTHA 5HK0A 2P4TA 3X20B 3SD4A 2DJZA 2DVEA 3M56A 3LLRA 2P0KA 3M59A 3QKJA 2LCLA 4NOYA 3VV0A 2Y4YA 2D0QB 3CCLA 2RHYA 3RKWA 3CBOA 4OMFB 1PSEA 4EMKA 3TU4K 1VQLT 2E1HA 2RD1A 5FRMA 3JB9J 3A5ZB 4M78A 4PNOA 4C5HA 5LJ5j 4MDXA 3I56T 3L2WA 2YLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 E;  2KDS A;  2MWP A;  3CD6 A;  1VQ8 T;  2E70 A;  1VQN A;  3CC2 T;  1K8A U;  2OTJ A;  5HY6 A;  3CMA A;  1N8R C;  1M90 C;  1VQK A;  3I56 A;  1Q82 C;  1K9M U;  5DM7 R;  3CCJ A;  1YJN T;  3LH0 A;  1S72 A;  3CPW S;  2OTL T;  4TVR A;  3I55 T;  1W2B S;  1Q81 C;  1VQ8 A;  2QA4 T;  3CC2 A;  4X34 A;  1JJ2 S;  3CCU A;  3CCQ T;  3JAM E;  1YI2 T;  1YJW T;  2XHC A;  3CCL T;  1YJN A;  2OTL A;  3OYY A;  3CCE A;  1NJI C;  1VQ4 A;  3CCQ A;  1YJ9 T;  1YJW A;  1M90 U;  1KD1 C;  1QVG A;  3CD6 T;  1VQN T;  2OTJ T;  3CC7 A;  1M1K C;  1VQ7 T;  1Q7Y C;  2DO3 A;  3CMA T;  3CCJ T;  3CCR A;  3CCS T;  1S72 T;  3J80 E;  1VQ5 A;  1VQ7 A;  1BKB A;  3CCU T;  5J26 A;  2JNG A;  3OW2 S;  1VQ9 T;  4ZN1 A;  1X6O A;  3CCS A;  1YIJ A;  1KC8 U;  1VQ4 T;  3LGF A;  2LQ8 A;  3PIO A;  1VQM T;  1YBY A;  1M1K U;  4YTL A;  1Q7Y U;  3CXC S;  3CPW A;  3G4S A;  1W2B A;  1YHQ T;  1KHI A;  1VQ9 A;  2QEX A;  1JJ2 A;  5IT9 E;  3CC7 T;  1QVF S;  2LVM A;  3CXC A;  1VQM A;  2E6Z A;  4CRI A;  1YIT A;  3CCM A;  1KQS S;  3J7A F;  1N8R U;  3CCR T;  1YHQ A;  1Q82 U;  1VQ6 T;  3CME T;  1VQ5 T;  1Q81 U;  3CC4 A;  3G6E A;  1YIJ T;  3KBG A;  1VQ6 A;  3CME A;  1K73 C;  1NPR A;  1NJI U;  3G4S T;  1UEB A;  2QEX T;  2JVV A;  3DB3 A;  2MI6 A;  3CCV T;  1KD1 U;  2KVQ G;  1EIF A;  3G71 T;  5A2Q E;  4RG2 A;  3OW2 A;  5DLQ E;  1YIT T;  1K9M C;  3CCM T;  1VQP A;  2L3R A;  1VQO A;  1NZ9 A;  3CCV A;  5LL6 S;  1NPP A;  4ZN3 A;  3G71 A;  3CPF A;  3CC4 T;  3G6E T;  1QVF A;  2JUF A;  2EIF A;  1VQL A;  2G3R A;  1Q86 C;  1XNI A;  1M1G A;  1KQS A;  1RL2 A;  2MWO A;  4QQD A;  3CCE T;  3P8B B;  1XTD A;  1VQP T;  5IAY A;  1VQO T;  1K8A C;  3LGL A;  1SSF A;  3I55 A;  1QVG S;  2QA4 A;  2JOY A;  1Q86 U;  1IZ6 A;  2LCL A;  1KC8 C;  1YI2 A;  3DLL A;  3TRE A;  3ER0 A;  3CCL A;  2IG0 A;  2CKK A;  1VQL T;  3PIP A;  3A5Z B;  5J3B A;  3DB4 A;  1K73 U;  1VQK T;  5FLX E;  3I56 T;  1YJ9 A;  3HKS A; 
#chains in the Genus database with same CATH topology
 4F14 A;  3QII A;  1I0C A;  3CC2 T;  2RB6 A;  1VQ7 Q;  4C92 F;  3VYG A;  3RKY A;  3CCJ A;  3HL8 A;  1S72 Q;  2L89 A;  1M3B A;  4OVA A;  3CCU A;  2F5T X;  2YXY A;  2EPD A;  3CCE A;  2ZCF B;  4C0Z A;  3E9F A;  2E12 A;  3HRS A;  1FYN A;  2YSQ A;  2LDM A;  3P8D A;  1JXM A;  4C0F A;  4C92 G;  1P92 A;  2M51 A;  3L2V A;  3CMA T;  5KYU A;  1QCF A;  5CKE A;  4M78 D;  3CCR Q;  2XMF A;  4BAC A;  4R55 A;  2EW3 A;  2DRM A;  2DMO A;  4KUI A;  2ED1 A;  5GMK m;  2MOX A;  2XD0 A;  5GMK j;  4M7A E;  2O2O A;  3GNG A;  2K5F A;  5GMK h;  3QO3 A;  1YHQ A;  3OYK A;  1RI9 A;  2L3Q A;  3AHU A;  1OPL A;  4PJO B;  1YCY A;  1JJ2 P;  2DLP A;  1WHH A;  4HT9 A;  2NYS A;  3OYA A;  2FRY A;  5LJ5 e;  1BYM A;  3GOX A;  4RG2 A;  4XTX A;  1VQO Q;  1NZ9 A;  1K9A A;  3RNJ A;  2EYX A;  4J6W A;  2E65 A;  4BDY A;  4ELZ C;  4PJO A;  2ENM A;  1V29 B;  2KRM A;  1M8M A;  3OS1 A;  1RL2 A;  4M7D D;  3QDF A;  1AWX A;  1JRI A;  1XTD A;  2EQJ A;  3S6W A;  3PNW C;  5GAN j;  1UEC A;  3CCE Q;  3I55 A;  1LPL A;  3HFN A;  5GAN h;  2RMO A;  4XK8 E;  2DM1 A;  5CO7 A;  2M9U A;  2YUO A;  4C5E A;  3MO8 A;  2YHT A;  3H8Z A;  1X75 C;  2DXB A;  3LYI A;  4M78 C;  4ELY C;  1N8R R;  1R0B G;  1ZHI A;  1SEM A;  1Q81 C;  2X9H A;  2XID A;  2ZPB B;  1MGQ A;  3H0F A;  3JAM E;  3OYE A;  1WXU A;  2LJ0 A;  3LW5 E;  2HDA A;  4R56 A;  2RI5 A;  5HKC A;  4PLI A;  4GY5 A;  3JCM W;  3J80 E;  1WI7 A;  5CKH A;  1JB0 E;  4M75 D;  4E7J A;  2F69 A;  2CZ6 B;  3MP8 A;  4FYW B;  2LX7 A;  1X6G A;  2K7A A;  3JCM c;  3PIO A;  4QT7 A;  2EJF A;  1SKU B;  2DTI A;  3OMG A;  5LJ5 d;  5IT9 E;  2RJD A;  3M53 A;  5IHN A;  2V8J A;  3VYH B;  4ME7 A;  1R77 A;  4HVV A;  4J8O A;  4X9C A;  1GFD A;  8ATC B;  5FW9 A;  3CC4 Q;  3G6E Q;  4FL6 A;  1WZO A;  1K73 C;  2LC4 A;  3G71 T;  1WX6 A;  4JJN K;  4DOV A;  2R5A A;  2PZ1 A;  1LJO A;  2EJ9 A;  4FYY B;  4XTU A;  3QBY A;  4PFO A;  2DD5 A;  2AT1 B;  1NLP C;  4PJM A;  1A0N B;  4DOW A;  2A3L A;  4PJL A;  2LTO A;  1Y57 A;  1RAG B;  3ASK A;  2L0A A;  2QA4 A;  2BZY A;  5GAO n;  1SG5 A;  4AFU C;  2Y90 A;  3PIP A;  1TUC A;  4FYX B;  4OB0 B;  1PCX A;  2PTK A;  3LH5 A;  3MEW A;  5GAN f;  3GIB A;  1G5V A;  1C1A A;  2JW4 A;  4QKU A;  3JB9 I;  5DM7 R;  1H64 1;  4M75 C;  4FT2 A;  3CC2 A;  5FU6 B;  1UFF A;  1X6B A;  2F1L A;  2KRO A;  1IHW A;  2QQR A;  1B07 A;  1QWE A;  2P0P A;  1HD3 A;  2OI3 A;  4C8Q C;  1T3S A;  2K2M A;  2HQH A;  2OTJ T;  1RLQ C;  1Q7Y R;  4RTZ A;  1TUG B;  2J6F A;  3QJ6 A;  2HBW A;  2L8D A;  3CCS T;  1V76 A;  2PQW A;  4OMO A;  2KQW A;  3HFO A;  4PJO G;  1Q82 R;  2LNV A;  2K79 A;  4ZN1 A;  5L23 A;  1B34 A;  2NUT B;  2LQ8 A;  4Z02 A;  2DTH A;  2K3Y A;  1MMA A;  2X4X A;  2G6F X;  2KSS A;  4L59 A;  1MMG A;  4WF2 A;  5GAN 2;  2K5I A;  1M8V A;  3FEO A;  2DIQ A;  3EGX B;  4JLG A;  5LJ5 g;  4A4H A;  2NUT A;  4AFS C;  3G4S T;  4HKE A;  1WLP B;  4RTT A;  4JS5 A;  4M78 F;  2LRQ A;  3DB3 A;  2BZ8 A;  4HCC A;  1VQP A;  2FVU A;  3EG0 A;  1KG1 A;  1MV0 B;  3BE3 A;  4GBQ A;  3EG3 A;  2CSI A;  3EGX A;  3A8L B;  1W4S A;  1WQ7 A;  2SEM A;  4DEY A;  2O31 A;  4M78 G;  4PK4 A;  1VIE A;  1WJQ A;  2O01 E;  3CC2 Q;  2DET A;  3FIF A;  2VGN A;  1UGP B;  1R0C B;  1TOV A;  4RTU A;  3OMC A;  2HL5 C;  4DQ2 A;  4MMK A;  5GAN 6;  2VAS A;  4LD6 A;  5LJ3 e;  2ZAE A;  2LJ3 A;  4PFP A;  3CD6 A;  2QTX A;  4AG1 C;  9ATC B;  3CMA Q;  3QHS A;  2QTV A;  2RQU A;  1IO6 A;  4C8Q E;  4BE2 A;  3DLM A;  2D9T A;  3OS0 A;  2GGR A;  5GAM h;  3CCQ T;  3R6O A;  3CCL T;  2J06 A;  1SSH A;  4M7D F;  1T0J A;  1XQH A;  2B8A A;  2RNA A;  2C06 A;  3CC7 A;  1M1K R;  2DO3 A;  3CCJ T;  2XU8 A;  3GP8 A;  3VS7 A;  4PJJ A;  3CCU T;  4V2S A;  2DYI A;  1SF9 A;  3OW2 S;  4M7D G;  3NPF A;  2BIV A;  3NHN A;  4M77 D;  5IHI A;  1RAC B;  1M27 C;  5A0D A;  2X3W D;  1K76 A;  2KGT A;  4E7K A;  4E47 A;  4ESR A;  2DF6 A;  1YIT A;  2X4Y A;  3CCM A;  1VOM A;  1G2B A;  4E6R A;  3QUI A;  4XTZ A;  5KCH A;  2DJQ A;  1WDX A;  1UJ0 A;  5FWB A;  3JCM h;  1IB8 A;  5GAN d;  4HCK A;  4J9I A;  4B9W A;  5CR2 A;  5I11 A;  4CC7 A;  1G3S A;  2KR3 A;  2QGG A;  1NEB A;  4M75 F;  1RI0 A;  2DIL A;  2M1H A;  3G71 A;  4EMK B;  2PU9 B;  2K5L A;  4QVC A;  4IUP A;  4RTV A;  3LWH A;  3ULR B;  4QQD A;  4D6W A;  4VUB A;  4M75 G;  5EC7 A;  4Q5W A;  1RUW A;  2P4T A;  3SD4 A;  2DJZ A;  3M56 A;  3QKJ A;  4AMC A;  2D0Q B;  1UTI A;  1D1C A;  3CBO A;  4OMF B;  4EMK A;  2E1H A;  4J9H A;  5LJ5 j;  4PNO A;  4C5H A;  2EYZ A;  2FL7 A;  2KDS A;  2H8H A;  3QJY A;  5KYW B;  2KNB B;  1QCN A;  3I56 Q;  1Q82 C;  1YJN T;  3I55 T;  2RHU A;  2AZS A;  3WVE B;  3PT9 A;  3OYJ A;  2JXB A;  1ZX6 A;  2HBP A;  3HRU A;  2JS2 A;  1E7O A;  4M77 C;  1JQQ A;  2LT1 A;  4JRK A;  4BI8 B;  5IH2 A;  4LDV A;  5KYW A;  3PGG A;  3ME9 A;  1VQ5 A;  2NUP B;  1VQ9 T;  3CCS A;  1QVG P;  2C0I A;  2AIR B;  1V1C A;  1GCQ C;  2JT4 A;  2ATC B;  1NLO C;  3BW1 A;  1JU5 C;  2P4R A;  5DLO A;  5CQY A;  2K57 A;  3G71 Q;  4RKU E;  2LNH B;  5A0G A;  1OOT A;  3M4Y A;  2YWW A;  5I2M A;  1E6G A;  3L2Q A;  2QAS A;  2GTJ A;  4DBR A;  2RJC A;  3CPW P;  1NPR A;  2ESW A;  2QQA A;  4DBQ A;  4C92 E;  2JM8 A;  3OYN A;  3CCV T;  4BY6 C;  3GPL A;  1ZUK A;  2V1R A;  2CP2 A;  2AK5 A;  4J6X A;  2CT4 A;  1I5O B;  4QVD A;  2DEQ A;  2HCK A;  1G8X A;  4N0A A;  3CXC P;  2O9S A;  1PRM C;  2E6N A;  1GBR A;  1BCM A;  1X43 A;  2DXC A;  4HVW A;  4HXJ A;  4HA8 A;  1WXB A;  5GAM e;  4XU0 A;  3JB9 D;  4J6Y A;  2MPX C;  2EQK A;  3QG1 A;  1VQK T;  4M7A B;  2E10 A;  3HKS A;  5J39 A;  2OTJ Q;  1K8A U;  4PJO D;  3R6N A;  1M90 R;  1DJ7 B;  3TQ7 P;  5LJ5 f;  2VB6 A;  4TVR A;  1W2B S;  2QA4 T;  4X34 A;  1BB9 A;  4KGV B;  2YUQ A;  3PMT A;  4P5N A;  2RM4 A;  3CQT A;  1PSF A;  1GBQ A;  3CCQ A;  2MAM A;  5D6X A;  4M7A A;  1SPK A;  2KYB A;  2QDY B;  2EKH A;  4O6J A;  1N5Z A;  1UHF A;  2IVW A;  3IQL A;  5D7U A;  1QP3 A;  5KYU B;  5J26 A;  4OGE A;  1NE8 A;  3WVD B;  2D8H A;  2RQW A;  5I2S A;  3JCM e;  1YFN A;  1YBY A;  1IGU A;  2WSF E;  3G4S Q;  1KHI A;  3RKX A;  1KIK A;  2PVG B;  3EH1 A;  2C0T A;  2RO0 A;  2AKK A;  1Q95 G;  2E6Z A;  3X25 B;  1TUD A;  1KQS S;  1OZ3 A;  3CME T;  2QQB A;  1BU1 A;  2DA9 A;  1Q81 U;  2DL8 A;  4Y92 A;  4X9D A;  2KEA A;  1OEB A;  3EG2 A;  1WHG A;  1UJY A;  4B6M A;  1TSF A;  3G1J A;  1M5Q 1;  1EFN A;  3X28 B;  2FEI A;  1RAH B;  1TH7 A;  3V7S A;  3V7C A;  4XU2 A;  1I1J A;  3UA6 A;  3L2Z A;  2CUB A;  2O88 A;  4ORZ A;  1VYV A;  1D1A A;  4M77 F;  5GAM d;  4LUD A;  2EIF A;  4LUE A;  3NTI A;  2WSC E;  3I5S A;  4XAX B;  2XG8 D;  1OZ2 A;  2KT8 A;  4PJO C;  4BI4 A;  1I5L A;  1VQP T;  1K8A C;  2YUN A;  2DRK A;  4F7U F;  3TSW A;  4J7I A;  1HXD A;  1Z9Q A;  4M77 G;  1KC8 C;  5KCO A;  3CCL Q;  2CH4 A;  1LVK A;  4OB1 B;  1K73 U;  3OA6 A;  2FPF A;  5CVI A;  5FLX E;  1M1F A;  1RAD B;  2RK2 A;  4J9C A;  1OI1 A;  2PVD B;  1U5S A;  3PE0 A;  4E7H A;  2EQI A;  4F7U G;  5EG2 A;  3CCJ Q;  1MV3 A;  3RES A;  3CCU Q;  1NG2 A;  1IGQ A;  4LN2 A;  2O9V A;  2R5M A;  1JBM A;  1SHG A;  4OMQ A;  1YJN A;  1PKT A;  4E2F B;  3OSV A;  4OML A;  3JCM d;  2FYK A;  1IXD A;  3CD6 T;  4II1 A;  3FLG A;  3RER A;  2KK4 A;  3NMZ C;  2CP5 A;  2L3S A;  2ROT A;  1Z9Z A;  2J6O A;  2XKO C;  4XU3 A;  1QKW A;  2ED0 A;  3SHW A;  4RG8 A;  2DTO A;  1N9S A;  1CKA A;  1VQM T;  4CC4 B;  2RHZ A;  2W10 A;  1VQ9 A;  3MEA A;  2A0F B;  1NJI R;  2MIO A;  5LJ3 h;  3CC7 T;  1QVF S;  2LVM A;  3CBM A;  2LP5 A;  2M16 A;  2L3P A;  1KD1 R;  3A8M B;  3M58 A;  4OGC A;  4XTW A;  2E5K A;  1YHQ Q;  3M9Q A;  2JM9 A;  2RF0 A;  1F1B B;  3L1A A;  5FRN A;  4LDW A;  5KYX B;  1N6A A;  4ZNX A;  1PNJ A;  4FT4 A;  2DL3 A;  3G7Z A;  3DKM A;  2CP0 A;  2MI6 A;  4BUG A;  5C6S A;  1RAI B;  1K0X A;  1WGS A;  1YIT T;  3CCM T;  2MK5 A;  4AG2 C;  3EGU A;  1KSW A;  3CCV A;  3HTR A;  5GMK i;  3M0U A;  5A0L A;  5KYX A;  1Q86 R;  3A1P A;  3QSU A;  1ZSZ C;  3MEV A;  3OYB A;  1U8R A;  1K1Z A;  2HSE B;  2VUB A;  2FZC B;  2YLB A;  1BCO A;  2VXE A;  2RHX A;  4M7D C;  3M5A A;  8AT1 B;  2QG9 B;  5IAY A;  5GAM g;  1YJN Q;  3I55 Q;  3I35 A;  1PD1 A;  2CKK A;  1Y0M A;  4HT8 A;  2KXC A;  1YJ9 A;  2V8I A;  1X27 A;  4C0G A;  4QW2 A;  4RCC A;  1VQN A;  2EAY A;  1VQK A;  3EHQ A;  2X35 A;  2OTL T;  3MPU B;  1JJ2 S;  2D1X A;  2YDL A;  2V1Q A;  2HQX A;  1UGR B;  4M78 E;  1PHT A;  2XDD A;  2X3X D;  2VGM A;  4CC3 A;  4A54 A;  1KJW A;  1UGQ B;  4A4K A;  1W70 A;  2RH2 A;  3V8J A;  4ZTJ A;  2KE9 A;  3JB9 F;  3D7S B;  1GCP A;  3JCM g;  2JNG A;  4FYV B;  2DZC A;  4E7Z A;  1U1S A;  4J9F A;  4YTL A;  4JJB A;  1I4K 1;  4PJO F;  1M3A A;  1B34 B;  5FU6 C;  3M0T A;  5CAI A;  5AYF A;  3GBQ A;  3JB9 G;  1AOJ A;  4EMG A;  1VQ5 T;  1T3L A;  1VA7 A;  4EPC A;  4E7I A;  4Z8A A;  2DL4 A;  2I2L A;  1B3Q A;  3BDU A;  3CME A;  2XI9 A;  4OB2 B;  4UC4 A;  4BE1 A;  3V8L A;  1TTH B;  2OJ2 A;  2JTF A;  2RQR A;  4OB3 B;  4ZGD B;  3OW2 A;  4C8Q B;  2CYZ B;  1ABO A;  1HJD A;  4FSX A;  3JCM b;  2ZGW A;  3UF4 A;  1NPP A;  1RAB B;  3HRT A;  3P8H A;  3CPF A;  5FRO A;  3M0S A;  4M7D E;  3EH2 A;  2DPP B;  4HVU A;  2XIC A;  1VQK Q;  1QVP A;  2JMA A;  4LXC A;  1G3T A;  7AT1 B;  1IRE B;  1AWO A;  4C8Q A;  1YWO A;  2QA4 Q;  3PVQ A;  1K0S A;  3M59 A;  2QYZ A;  4NOY A;  2LJ1 A;  1RLP C;  1G83 A;  3RKW A;  1PSE A;  2A36 A;  2RD1 A;  1BBZ A;  2FPD A;  3L2W A;  2YLC A;  2K9G A;  1U1T A;  2DIG A;  3EAE A;  5HY6 A;  3FC3 A;  1N8R C;  1FMK A;  1AZE A;  3I9Q A;  2FB7 A;  2EBP A;  1UB4 A;  2O4X B;  2RPN A;  2XHC A;  2OAU A;  3VUZ A;  1NJI C;  1VQ4 A;  2LQW A;  2F2W A;  5GAN 3;  1ZBJ A;  2PUK B;  3KXT A;  1KD1 C;  2W0Z A;  1QWF A;  4JZ3 A;  4EDU A;  4M75 E;  4D8K A;  2DAQ A;  4PL6 A;  4BB7 A;  5CQX A;  5KYY B;  3UWN A;  1QQJ A;  5GAM j;  2O4X A;  2GQV A;  1X6O A;  2AHJ B;  1YIJ A;  1UUE A;  1Q7Y U;  3OYF A;  2QEX A;  3FDR A;  2K3B A;  2FG0 A;  2RJE A;  3C95 A;  1VQM A;  2X4J A;  4MZP A;  3NTK A;  3J7A F;  2EQM A;  4XTV A;  4AT1 B;  1Q82 U;  2V8K A;  6AT1 B;  2LMJ A;  1X01 A;  1Y07 A;  4A63 B;  5KYY A;  2QGF B;  2DNU A;  4D8D A;  3GNF B;  3EG9 A;  1FXX A;  2YT6 A;  1M2O A;  2ZPG B;  1U3O A;  3INZ A;  1JEG A;  2YRC A;  3SB2 A;  4QVZ A;  1SRM A;  5D6Y A;  2DBM A;  2DFU A;  4QQG A;  2XDB A;  4FCY A;  5FU7 B;  2XK0 A;  1VQP Q;  3M0R A;  1PM3 A;  4IIO A;  4JDS A;  1TWB A;  3E2U A;  5LL6 S;  2VVK A;  4IUQ A;  2MYS A;  3FRN A;  1M4Z A;  2MCN A;  2BTT A;  1VQL A;  1XNI A;  2K2V A;  2F2X A;  1H92 A;  3QXE B;  3VS4 A;  1RAA B;  2JN0 A;  3OYC A;  3P8B B;  4A4F A;  1MMN A;  1D0Z A;  2A37 A;  5GAO r;  1K9M R;  2M02 A;  3ER0 A;  3RDV A;  2RQT A;  3CD6 Q;  1X69 A;  2SRC A;  5LJ3 d;  2LQK A;  3FJ5 A;  4JZ4 A;  3QZ5 B;  2YRD A;  4OF1 A;  1QW1 A;  1NEG A;  1YJW T;  4JRP A;  2VC8 A;  2OTL A;  2KRN A;  1OQK A;  4OMP A;  2KYM A;  4C92 B;  3O5Z A;  3CC7 Q;  1Q7Y C;  1UE9 A;  2BZX A;  2L2P A;  4KUD K;  2DL7 A;  3ZBD A;  1FWZ A;  1YP5 A;  2HZY A;  2DZ9 A;  4PJN A;  5GJV B;  4AFQ C;  4JRI A;  1PG5 B;  4BE0 A;  5I22 A;  1M1K U;  4C92 A;  1W2B A;  2DYB A;  5GAM f;  3HHT B;  1GFC A;  3QDR B;  4L6V 5;  2COW A;  2ROL A;  2GFA A;  3CCM Q;  1YIT Q;  1S1N A;  1JO8 A;  4M7A D;  3ZFJ A;  3E1S A;  1BK2 A;  3H41 A;  4KT0 E;  2FHD A;  1TG0 A;  2HQE A;  2CSQ A;  3C0C A;  2JMC A;  1SRL A;  2ZPH B;  3S3N A;  2QAZ A;  1W6X A;  2QQS A;  3NFC A;  2KRS A;  3VKI A;  4J7F A;  5CIU A;  4LE9 A;  4RTX A;  3O8V A;  5HK3 A;  4OMM A;  3C12 A;  2HEQ A;  1BI2 A;  2AKL A;  5ECA A;  1UDL A;  2P84 A;  4MZT A;  1H3H A;  2P0Q A;  2JUF A;  3A98 A;  2HAX A;  2L5Q A;  1KQS A;  3JCM V;  5CCA A;  2D6F A;  1WJR A;  1HK9 A;  3EFR A;  3JCM f;  2FZG B;  2EVR A;  3TVT A;  2GTO A;  2R58 A;  3NGP A;  3EGD B;  1JXO A;  4KBM B;  1AWW A;  1YI2 A;  1UGS B;  3TRE A;  3OYI A;  3JV3 A;  4Y91 A;  3A8H B;  2LX9 A;  1VQ8 T;  1GCQ A;  2QXF A;  2DK3 A;  1FMW A;  2KI7 A;  1S72 A;  1YWP A;  2DXT A;  5KE2 A;  1AHJ B;  3EGD A;  3H6Z A;  3SWN B;  1QCO A;  3C4S A;  2CGH A;  3OY9 A;  1PWT A;  2A08 A;  5LJ3 g;  1YJ9 T;  2DXU A;  2EQU A;  5IN1 A;  1VQN T;  4FSS A;  1M1K C;  2J05 A;  4FW2 A;  2C0O A;  1FMV A;  3MJX A;  4ANJ A;  4M7A C;  3CCR A;  3VUB A;  4FM4 B;  1VQ5 Q;  4M77 E;  2QI2 A;  4N4H A;  3SWN A;  1MUZ A;  1W1F A;  3OB9 A;  1KC8 U;  3CCS Q;  3UAT A;  1U06 A;  3LGF A;  2AZV A;  4MDW A;  4C0D C;  1PC0 A;  3MEU A;  2J6K A;  3CXC A;  4F7U E;  4R0K A;  3URG A;  5D6W A;  4PFZ A;  4A4E A;  1VIF A;  4EMH A;  4RCB A;  1QMC A;  4LD9 K;  2E3H A;  1LOJ A;  2KVQ G;  2FRW A;  1EIF A;  1K9M C;  4IUR A;  1ZBX A;  2XDP A;  2E4H A;  1VQO A;  3UDC A;  3RUX A;  1WQW A;  2GFU A;  2JS0 A;  3HSB A;  2DX1 A;  2RA2 A;  1QVF A;  4O5V A;  2KBT A;  3OQ5 A;  2G3R A;  3CEY A;  4N4G A;  5GAO l;  2M0O A;  1KK7 A;  2GNC A;  4N4I A;  2WSE E;  3SEM A;  1OX9 A;  2EFI A;  1AVZ C;  1QVG S;  2JOY A;  2EYW A;  3DLL A;  1VYT A;  2JTM A;  1EX4 A;  2PNI A;  2X51 A;  3CBP A;  2BUD A;  4FIB A;  3PMI A;  2MWP A;  2RJF A;  2COZ A;  1WHM A;  2NWM A;  3CPW S;  1PRL C;  4Z89 A;  1VUB A;  1SHF A;  4IIM A;  1WJS A;  2EKO A;  3PFS A;  3RR6 A;  2DL5 A;  4WTO B;  1OUL A;  3CCQ Q;  1YJW A;  1ZA2 B;  1M90 U;  3LWI A;  2CP7 A;  2KAF A;  3A8G B;  2K6D A;  1HYO A;  2D0N A;  4ZGJ B;  2EGC A;  1PKS A;  3UPU A;  1BKB A;  3M55 A;  3Q1J A;  3MHX A;  4ZGE B;  3TCJ A;  1VQ4 T;  2RI3 A;  1UHC A;  4Y28 E;  5L8R E;  1YN8 A;  3CXC S;  5CKD A;  1JJ2 A;  2WAC A;  1G3W A;  1BIA A;  2FO0 A;  1VQ6 T;  4XTY A;  4K11 A;  1YNZ A;  1D3B B;  2BE7 D;  3CC4 A;  1X2Q A;  3G6E A;  1YIJ T;  2BKD N;  2E41 A;  2HD0 A;  5FWC A;  3QWY A;  2QEX T;  4C5G A;  4CI0 C;  5LJ3 j;  3V7R A;  4PKC C;  4BD3 A;  3BY7 A;  5DLQ E;  2CZ1 B;  2PUO B;  3THK A;  3EHR A;  4JPB W;  2H3E B;  4ZTF A;  3VJP A;  1D3B A;  5KH6 A;  3OYM A;  1WA7 A;  4M78 B;  2Z0W A;  1R8O B;  1E6H A;  1OPK A;  1WFW A;  3X24 B;  1TXQ A;  4Z88 A;  1WIE A;  4M7A F;  5HK0 A;  2FPE A;  3X20 B;  2DVE A;  3LLR A;  2IIM A;  2P0K A;  4E7S A;  2LCL A;  3VV0 A;  2Y4Y A;  1YJW Q;  2HKN A;  2HL3 A;  1AZG B;  1VQL T;  3TU4 K;  5IXB A;  4PJO E;  3JB9 J;  4M78 A;  3VS2 A;  4MDX A;  3I56 T;  4FW1 A;  3UA7 A;  4M7A G;  4A53 A;  1M90 C;  1ZA1 B;  4JRQ A;  5C0M A;  2K3X A;  3U23 A;  1VQ8 A;  4X1V A;  5CK9 A;  4M4Z A;  3OYL A;  4C8Q D;  1D1B A;  2VV5 A;  2LZ6 B;  1LNX A;  2F2V A;  2GF7 A;  2NLU A;  1O75 A;  1ZSZ B;  2OX7 A;  2LT4 A;  5M9O A;  1AT1 B;  2CP3 A;  3EG1 A;  3MKD A;  4M7D B;  3VS5 A;  3QZ9 B;  4A4G A;  1BI0 A;  1ARK A;  2YRV A;  1VQ9 Q;  1QLY A;  3L42 A;  2K4Y A;  1ZSZ A;  3MP6 A;  3E9G A;  1T0H A;  1XOV A;  1N8R U;  4F17 A;  1ZSG A;  1CSK A;  3REA B;  5GAN 8;  4M7D A;  4B9X A;  4ATO A;  1QKX A;  2E5Q A;  1NJI U;  4EIK A;  2X4W A;  1UEB A;  2CS7 A;  1WHK A;  1KD1 U;  2KY9 A;  5A2Q E;  3ZEH A;  1AD5 A;  1NYF A;  1WXT A;  3CCV Q;  4NS5 A;  1UG1 A;  1D0Y A;  3JCM X;  5LJ3 f;  3UT1 A;  1GRI A;  3OW2 P;  1OU8 A;  3LX7 A;  4M75 B;  2CUD A;  2PVO B;  4JJD A;  1VQ8 Q;  4LDU A;  1WHL A;  3MET A;  3BFM A;  5CKB A;  2HNI A;  2CZ7 B;  4RTY A;  4DBH A;  1Q86 U;  2IG0 A;  2LCC A;  3M54 A;  5J3B A;  1YJ9 Q;  4LDX A;  1Y7X A;  4KH1 B;  5GMK e;  4M75 A;  2D8J A;  1VQN Q;  1ZUY A;  4KUL A;  5GMK l;  3CMA A;  2LCS A;  1TS9 A;  3LH0 A;  1M30 A;  3H0H A;  4J9G A;  3TEE A;  2EYY A;  4GLM A;  1YI2 T;  2RK1 A;  4L5G A;  1WNL A;  1MMD A;  1NBE B;  4BDZ A;  2CRE A;  1J3T A;  3C94 A;  5I21 A;  2DVJ A;  4F04 B;  1Y96 B;  2ZPE B;  1VQ7 T;  2LQN A;  1MHN A;  4J9B A;  1I81 A;  1S72 T;  4IUT A;  1UGV A;  2DE0 X;  3FJP A;  1MNE A;  3VS0 A;  3MCA B;  3VS1 A;  1GL5 A;  4DBF A;  3L2R A;  3AT1 B;  3H9N A;  2COY A;  4DA4 A;  1ACM B;  1Y96 A;  4JS4 A;  3RMS A;  4DEX A;  1O9S A;  1I8F A;  3MP1 A;  4JLI A;  3CCR T;  4KH0 B;  5CKF A;  5GAN e;  3GLX A;  5GAO p;  1Y71 A;  1QP2 A;  5GAN 7;  2QQ9 A;  2HSP A;  2DD4 A;  2VWF A;  1BI1 A;  3CME Q;  1VQ6 A;  3A8O B;  3ZL7 C;  1H8K A;  2EYQ A;  3EG9 B;  1C0M A;  1IRX A;  2V26 A;  3M0Q A;  2CH4 W;  3RIR A;  3QWX X;  1XJW B;  2EGA A;  1M2V B;  1OYX A;  4C92 D;  1N27 A;  1X2K A;  2JTE A;  2ZZD A;  2H3J A;  3OYG A;  1CKB A;  1Q86 C;  3VS6 A;  2Y4X A;  2CT3 A;  2IPO B;  4JJC A;  3KFV A;  2ZPI B;  1VQO T;  2EJG A;  1M2V A;  2RI2 A;  1ZUU A;  5HCK A;  5FU7 C;  4C5I A;  1IZ6 A;  2MF2 A;  1HSQ A;  1NM7 A;  4BI3 A;  1MND A;  4OMN A;  4LDY A;  1FX7 A;  3DB4 A;  4J5Y A;  2ABL A;  4PLL A;  2E70 A;  3PVL A;  3I56 A;  2BE9 B;  3CCE T;  3JB9 H;  4OP0 A;  3EFO B;  5GAO m;  4NL3 A;  1RAE B;  3QYG B;  5GAN 5;  4QQ6 A;  1EZZ B;  3VRY A;  3SFM A;  1VQ4 Q;  2JZ2 A;  3FB9 A;  5IHK A;  2E64 A;  2RHI A;  4MML A;  1LCK A;  1NYG A;  3N5B B;  2DER A;  1VQ6 Q;  4EMK C;  3EFO A;  1K4U S;  3T9N A;  2QDL A;  1YIJ Q;  2QK0 A;  4KGX B;  4HCZ A;  5DY9 A;  2VYT A;  5KYN A;  3RBB B;  1YHQ T;  4JUV A;  2QEX Q;  3VU3 C;  3OYH A;  1H3Z A;  4LNP A;  1VQM Q;  3S3M A;  4C92 C;  2VXF A;  1M9S A;  4C8Q F;  3OBW A;  2GCX A;  1W2B P;  1M3C A;  2RN8 A;  3BDL A;  3SDZ A;  2A28 A;  4KRT A;  2YUP A;  2MMP A;  3EFS A;  4F16 A;  1PD0 A;  1D09 B;  2L3R A;  1IHV A;  4C8Q G;  4ZN3 A;  3OS5 A;  1OU9 A;  3CC4 T;  2F5K A;  3G6E T;  1I07 A;  3JCM P;  2E3I A;  1VQL Q;  1M1G A;  5LJ5 h;  4RMO A;  3JSC A;  3V8K A;  3X26 B;  1KQ2 A;  2KMT A;  3M4G A;  2CZ0 B;  1N9R A;  3QPH A;  1K8A R;  3LGL A;  4M77 B;  3HPW A;  1SSF A;  4IKF A;  1KQS P;  1KC8 R;  1AEY A;  3REB B;  1OX8 A;  1ABQ A;  2KT1 A;  1WHJ A;  4RUG A;  2DBK A;  1ZQ1 A;  3J81 E;  2OTJ A;  1B7T A;  5GAO q;  4F7U B;  2JJ9 A;  1YCS B;  3TSZ A;  1K9M U;  1WPY A;  4M77 A;  2DEU A;  3VRZ A;  4FU6 A;  3GF5 A;  3PTA A;  2OTL Q;  3OYY A;  4N0A C;  3WXM B;  4IUU A;  4XU1 A;  4XQ3 A;  3M0P A;  1QVG A;  1RAF B;  3OYD A;  5KE3 A;  4F7U A;  3M57 A;  1ZLM A;  2NUP A;  1OV3 A;  2KXD A;  1VQ7 A;  4RTW A;  2CP6 A;  1VYU A;  3VS3 A;  4AFZ C;  2J7I A;  3F70 A;  2RQV A;  4BY6 B;  1Q81 R;  1TU0 B;  2HMA A;  3HP9 A;  3S3O A;  3I5R A;  3SWN C;  3CPW A;  3G4S A;  5GJW B;  1C6V X;  1WYX A;  5GAN g;  1KHC A;  5GAN 4;  4J83 A;  4KGZ B;  4CRI A;  3RMQ A;  3L2U A;  2I0N A;  1GXI E;  4HCB A;  1G3Y A;  1BIB A;  4NL2 A;  4J9E A;  2ZPF B;  3OS2 A;  2EWN A;  3KBG A;  2GBQ A;  2FZK B;  1AWJ A;  2JVV A;  3JCM Q;  3KUF A;  2EGE A;  3E19 A;  3JCM J;  3QYH B;  2DKG A;  1KFZ A;  1BI3 A;  4E7L A;  1D0X A;  3OBY A;  4IUV A;  2GQI A;  4CC2 A;  2ECZ A;  2M0Y A;  5AT1 B;  4MZM A;  3OSS C;  2MWO A;  1K73 R;  2A7Y A;  2OAW A;  3JRZ A;  2R57 A;  4GLK A;  2B86 A;  3H0I A;  2VKN A;  4C0D B;  1KQ1 A;  3NTH A;  1QVF P;  5IXF A;  4J9D A;  2NUZ A;  4WCI A;  1YI2 Q;  3CCL A;  2RHY A;  2HKQ B;  5FRM A;  3A5Z B;  2CDT A; 
#chains in the Genus database with same CATH homology
 1U1T A;  2FL7 A;  2DIG A;  2KDS A;  3QII A;  4M7A G;  3EAE A;  4A53 A;  3CC2 T;  2RB6 A;  4C92 F;  5HY6 A;  3VYG A;  3RKY A;  3QJY A;  3FC3 A;  1N8R C;  1M90 C;  1Q82 C;  3CCJ A;  3HL8 A;  4JRQ A;  5C0M A;  2L89 A;  1YJN T;  2K3X A;  3I55 T;  2FB7 A;  2RHU A;  1VQ8 A;  3WVE B;  1UB4 A;  3PT9 A;  4OVA A;  3CCU A;  3OYJ A;  2F5T X;  2O4X B;  2XHC A;  5CK9 A;  2HBP A;  2OAU A;  3VUZ A;  3OYL A;  3CCE A;  1NJI C;  3HRU A;  4C8Q D;  2ZCF B;  4C0Z A;  2VV5 A;  3E9F A;  4M77 C;  1VQ4 A;  2E12 A;  3HRS A;  1LNX A;  2NLU A;  2GF7 A;  5GAN 3;  2LT1 A;  2PUK B;  3KXT A;  4JRK A;  2LDM A;  3P8D A;  4C0F A;  1KD1 C;  4BI8 B;  4C92 G;  4EDU A;  1O75 A;  1P92 A;  4M75 E;  3L2V A;  3CMA T;  4LDV A;  2LT4 A;  5CKE A;  2DAQ A;  4M78 D;  3PGG A;  5M9O A;  4PL6 A;  4BB7 A;  5CQX A;  3ME9 A;  1VQ5 A;  3UWN A;  4M7D B;  5GAM j;  4BAC A;  4R55 A;  1VQ9 T;  3QZ9 B;  2O4X A;  4A4G A;  2GQV A;  1BI0 A;  1X6O A;  2AHJ B;  3CCS A;  1YIJ A;  4KUI A;  5GMK m;  2YRV A;  1Q7Y U;  3OYF A;  2XD0 A;  5GMK j;  2QEX A;  4M7A E;  3FDR A;  3L42 A;  3BW1 A;  3GNG A;  5DLO A;  2RJE A;  2K5F A;  2K4Y A;  2K57 A;  3C95 A;  2X4J A;  5CQY A;  1VQM A;  3MP6 A;  4RKU E;  4MZP A;  3E9G A;  3NTK A;  3QO3 A;  1XOV A;  2EQM A;  4XTV A;  5A0G A;  5GMK h;  1YHQ A;  1Q82 U;  1N8R U;  2V8K A;  3M4Y A;  5I2M A;  1X01 A;  1Y07 A;  3OYK A;  3L2Q A;  3GNF B;  5GAN 8;  1FXX A;  3AHU A;  4M7D A;  2RJC A;  2ZPG B;  4B9X A;  3INZ A;  4PJO B;  4ATO A;  1YCY A;  3SB2 A;  2E5Q A;  1NPR A;  1NJI U;  4HT9 A;  2X4W A;  4QVZ A;  3OYA A;  5D6Y A;  2QQA A;  5LJ5 e;  1UEB A;  3GOX A;  1BYM A;  4QQG A;  2CS7 A;  4C92 E;  3OYN A;  3CCV T;  1KD1 U;  2XDB A;  5FU7 B;  4BY6 C;  2KY9 A;  2XK0 A;  5A2Q E;  4RG2 A;  3GPL A;  3ZEH A;  4XTX A;  4JDS A;  1NZ9 A;  5LL6 S;  4NS5 A;  4IUQ A;  3FRN A;  4J6W A;  1M4Z A;  2E65 A;  5LJ3 f;  3JCM X;  4BDY A;  4ELZ C;  3UT1 A;  4PJO A;  4J6X A;  1V29 B;  1VQL A;  1XNI A;  4QVD A;  2K2V A;  2DEQ A;  3OS1 A;  1RL2 A;  3LX7 A;  3QXE B;  4M75 B;  4M7D D;  2PVO B;  3OYC A;  2JN0 A;  3P8B B;  1JRI A;  4N0A A;  4A4F A;  1XTD A;  2EQJ A;  4LDU A;  3S6W A;  3PNW C;  5GAN j;  3MET A;  2E6N A;  3BFM A;  5CKB A;  2HNI A;  3I55 A;  5GAO r;  2CZ7 B;  2DXC A;  1Q86 U;  4HA8 A;  3HFN A;  5GAM e;  5GAN h;  4XU0 A;  3ER0 A;  3JB9 D;  2IG0 A;  4J6Y A;  2LCC A;  4XK8 E;  2EQK A;  3M54 A;  3QG1 A;  5J3B A;  1VQK T;  5CO7 A;  2E10 A;  2M9U A;  3HKS A;  4M7A B;  4LDX A;  4C5E A;  1Y7X A;  5J39 A;  5GMK e;  3MO8 A;  4M75 A;  2YHT A;  3H8Z A;  1K8A U;  1X75 C;  2DXB A;  4PJO D;  4KUL A;  3LYI A;  4M78 C;  5LJ3 d;  4ELY C;  5GMK l;  3CMA A;  2LQK A;  1ZHI A;  1DJ7 B;  3LH0 A;  5LJ5 f;  3QZ5 B;  4TVR A;  1W2B S;  1Q81 C;  2QA4 T;  2XID A;  4OF1 A;  4X34 A;  2ZPB B;  1MGQ A;  3TEE A;  1QW1 A;  3JAM E;  1YI2 T;  1YJW T;  4PJO E;  2RK1 A;  3OYE A;  4L5G A;  1WNL A;  2VC8 A;  4JRP A;  2OTL A;  3PMT A;  4P5N A;  2RM4 A;  1PSF A;  4BDZ A;  3CCQ A;  2MAM A;  3LW5 E;  4C92 B;  4R56 A;  5D6X A;  4M7A A;  3C94 A;  5I21 A;  2RI5 A;  1Y96 B;  2ZPE B;  2QDY B;  1VQ7 T;  4O6J A;  1Q7Y C;  1MHN A;  5HKC A;  1I81 A;  4PLI A;  4GY5 A;  3JCM W;  1S72 T;  4IUT A;  2IVW A;  3J80 E;  4KUD K;  3ZBD A;  1QP3 A;  5CKH A;  5J26 A;  1JB0 E;  1FWZ A;  4M75 D;  4OGE A;  1NE8 A;  3WVD B;  4E7J A;  2DZ9 A;  3FJP A;  2F69 A;  2CZ6 B;  3MP8 A;  5I2S A;  4JRI A;  3MCA B;  4BE0 A;  3JCM c;  3JCM e;  3PIO A;  1YBY A;  1M1K U;  2WSF E;  2EJF A;  4C92 A;  2DTI A;  1KHI A;  3OMG A;  3RKX A;  2PVG B;  5LJ5 d;  3L2R A;  1W2B A;  5GAM f;  3HHT B;  5IT9 E;  4DA4 A;  1Y96 A;  3QDR B;  4JS4 A;  2RO0 A;  4L6V 5;  3RMS A;  2E6Z A;  1O9S A;  1I8F A;  2RJD A;  3M53 A;  2GFA A;  2V8J A;  3MP1 A;  4JLI A;  3VYH B;  3X25 B;  3CCR T;  1OZ3 A;  1KQS S;  3CME T;  4ME7 A;  5CKF A;  5GAN e;  4M7A D;  2QQB A;  3ZFJ A;  3E1S A;  3GLX A;  4J8O A;  4KT0 E;  4X9C A;  5GAO p;  1Y71 A;  1Q81 U;  2FHD A;  1QP2 A;  2HQE A;  5GAN 7;  2QQ9 A;  4FL6 A;  4X9D A;  2DD4 A;  1VQ6 A;  1BI1 A;  3A8O B;  2ZPH B;  1K73 C;  2EYQ A;  3S3N A;  2QQS A;  2LC4 A;  3NFC A;  3VKI A;  3RIR A;  1M5Q 1;  4J7F A;  5CIU A;  3G71 T;  3X28 B;  4JJN K;  1TH7 A;  4DOV A;  3V7S A;  2R5A A;  3O8V A;  3V7C A;  5HK3 A;  1LJO A;  1OYX A;  2EJ9 A;  3C12 A;  4XU2 A;  1BI2 A;  4C92 D;  3L2Z A;  1N27 A;  2ZZD A;  4M77 F;  2H3J A;  4MZT A;  3OYG A;  5GAM d;  2P0Q A;  2JUF A;  2EIF A;  3NTI A;  2WSC E;  1Q86 C;  2HAX A;  2Y4X A;  2L5Q A;  4XAX B;  4XTU A;  1KQS A;  3QBY A;  2XG8 D;  1OZ2 A;  2DD5 A;  3JCM V;  5CCA A;  4PJO C;  4DOW A;  2A3L A;  2ZPI B;  4BI4 A;  2D6F A;  1WJR A;  1HK9 A;  1I5L A;  3EFR A;  1VQP T;  2LTO A;  3JCM f;  1VQO T;  1K8A C;  3ASK A;  2R58 A;  2EJG A;  2RI2 A;  4F7U F;  2QA4 A;  4J7I A;  5FU7 C;  1HXD A;  4C5I A;  5GAO n;  1IZ6 A;  4M77 G;  4KBM B;  1KC8 C;  1YI2 A;  2MF2 A;  5KCO A;  1UGS B;  3TRE A;  4BI3 A;  4OB1 B;  2Y90 A;  3PIP A;  5GAN f;  3OYI A;  4LDY A;  4OB0 B;  1FX7 A;  3DB4 A;  3MEW A;  3OA6 A;  4J5Y A;  5CVI A;  3A8H B;  4PLL A;  4Y91 A;  5FLX E;  3GIB A;  1G5V A;  1M1F A;  2LX9 A;  1VQ8 T;  2E70 A;  2RK2 A;  1OI1 A;  2PVD B;  2QXF A;  2DK3 A;  3I56 A;  3JB9 I;  5DM7 R;  4E7H A;  4F7U G;  1H64 1;  5EG2 A;  1S72 A;  3CCE T;  3JB9 H;  2DXT A;  4M75 C;  4FT2 A;  4OP0 A;  3CC2 A;  5KE2 A;  1AHJ B;  3RES A;  5GAO m;  3H6Z A;  3SWN B;  4NL3 A;  3QYG B;  5GAN 5;  2R5M A;  1JBM A;  4QQ6 A;  1YJN A;  5FU6 B;  3C4S A;  2CGH A;  3SFM A;  3OY9 A;  3OSV A;  2QQR A;  5LJ3 g;  3JCM d;  2P0P A;  1YJ9 T;  2DXU A;  2EQU A;  4C8Q C;  2FYK A;  3CD6 T;  5IN1 A;  4II1 A;  3FLG A;  1VQN T;  2JZ2 A;  1M1K C;  3FB9 A;  3RER A;  2OTJ T;  2KK4 A;  3QJ6 A;  2E64 A;  2RHI A;  4MML A;  4M7A C;  2L8D A;  3N5B B;  3CCR A;  3VUB A;  3CCS T;  2PQW A;  4FM4 B;  4EMK C;  2KQW A;  3HFO A;  4M77 E;  4PJO G;  2QI2 A;  4N4H A;  3SWN A;  2LNV A;  3T9N A;  4XU3 A;  2XKO C;  4ZN1 A;  3OB9 A;  1KC8 U;  4RG8 A;  1B34 A;  2DTO A;  3LGF A;  1N9S A;  2LQ8 A;  4Z02 A;  1VQM T;  2DTH A;  2RHZ A;  4HCZ A;  2K3Y A;  2VYT A;  4MDW A;  5DY9 A;  1VQ9 A;  3MEA A;  4C0D C;  4JUV A;  1YHQ T;  3VU3 C;  2X4X A;  5LJ3 h;  3OYH A;  3CC7 T;  2KSS A;  1QVF S;  4L59 A;  1H3Z A;  4WF2 A;  2LVM A;  3CBM A;  3MEU A;  5GAN 2;  3CXC A;  3S3M A;  2M16 A;  2K5I A;  4F7U E;  1M8V A;  3A8M B;  3M58 A;  4OGC A;  2VXF A;  4XTW A;  4C92 C;  3FEO A;  3URG A;  5D6W A;  1M9S A;  3M9Q A;  4C8Q F;  2DIQ A;  3OBW A;  3L1A A;  5FRN A;  2GCX A;  4LDW A;  4JLG A;  4A4E A;  1VIF A;  5LJ5 g;  1N6A A;  4EMH A;  4A4H A;  4RCB A;  3BDL A;  4FT4 A;  3SDZ A;  4LD9 K;  3G7Z A;  3G4S T;  1LOJ A;  3DKM A;  4HKE A;  4JS5 A;  4M78 F;  2LRQ A;  3DB3 A;  2MI6 A;  4BUG A;  5C6S A;  2KVQ G;  3EFS A;  1WGS A;  2MMP A;  4HCC A;  1EIF A;  1K9M C;  4IUR A;  1ZBX A;  2XDP A;  1YIT T;  3CCM T;  1VQP A;  2FVU A;  2L3R A;  1VQO A;  3UDC A;  4C8Q G;  3CCV A;  4ZN3 A;  1KG1 A;  3OS5 A;  5GMK i;  3RUX A;  1WQW A;  2GFU A;  3HSB A;  3CC4 T;  2F5K A;  3G6E T;  2RA2 A;  1W4S A;  3A8L B;  1QVF A;  4O5V A;  3JCM P;  1WQ7 A;  3OQ5 A;  5A0L A;  2G3R A;  3CEY A;  3QSU A;  4N4G A;  1M1G A;  5LJ5 h;  5GAO l;  2M0O A;  4RMO A;  3MEV A;  3JSC A;  4M78 G;  3OYB A;  1U8R A;  2VUB A;  3V8K A;  1VIE A;  1WJQ A;  3X26 B;  2YLB A;  2O01 E;  1KQ2 A;  2VXE A;  2KMT A;  2RHX A;  3FIF A;  4N4I A;  3M4G A;  2VGN A;  2WSE E;  3M5A A;  4M7D C;  5IAY A;  1UGP B;  2CZ0 B;  1N9R A;  3QPH A;  5GAM g;  3LGL A;  4M77 B;  2EFI A;  3HPW A;  1SSF A;  3OMC A;  4IKF A;  1QVG S;  2JOY A;  4DQ2 A;  3DLL A;  4MMK A;  2CKK A;  5GAN 6;  2JTM A;  4LD6 A;  5LJ3 e;  4HT8 A;  3CBP A;  1YJ9 A;  2V8I A;  2BUD A;  4FIB A;  4C0G A;  1ZQ1 A;  3PMI A;  4QW2 A;  2MWP A;  4RCC A;  3J81 E;  3CD6 A;  2RJF A;  1VQN A;  2OTJ A;  2QTX A;  5GAO q;  4F7U B;  2EAY A;  3J7A F;  1VQK A;  3QHS A;  1K9M U;  2X35 A;  4C8Q E;  2OTL T;  4BE2 A;  1WPY A;  3CPW S;  3DLM A;  2D9T A;  4M77 A;  3OS0 A;  1VUB A;  1JJ2 S;  5GAM h;  3CCQ T;  3R6O A;  1WJS A;  3CCL T;  2EKO A;  3GF5 A;  3PFS A;  4FU6 A;  3OYY A;  3PTA A;  4M7D F;  2HQX A;  1UGR B;  1XQH A;  4N0A C;  4IUU A;  2B8A A;  4XU1 A;  3WXM B;  4M78 E;  4XQ3 A;  2XDD A;  2C06 A;  1YJW A;  1M90 U;  1QVG A;  3LWI A;  2VGM A;  2KAF A;  3A8G B;  4A54 A;  3OYD A;  3CC7 A;  2DO3 A;  5KE3 A;  4F7U A;  1UGQ B;  3M57 A;  4A4K A;  2RH2 A;  3V8J A;  3CCJ T;  2XU8 A;  4ZGJ B;  4ZTJ A;  3JB9 F;  3GP8 A;  1VQ7 A;  3UPU A;  1BKB A;  3M55 A;  3CCU T;  3Q1J A;  4V2S A;  3MHX A;  3JCM g;  4ZGE B;  2JNG A;  3OW2 S;  2DZC A;  3TCJ A;  4M7D G;  3F70 A;  2BIV A;  1U1S A;  4BY6 B;  2RI3 A;  1VQ4 T;  4Y28 E;  3HP9 A;  5L8R E;  4YTL A;  4PJO F;  1I4K 1;  4M77 D;  3CXC S;  3SWN C;  3CPW A;  3G4S A;  3S3O A;  5A0D A;  1B34 B;  5CKD A;  1JJ2 A;  4E7K A;  5FU6 C;  5GAN g;  1KHC A;  4E47 A;  2WAC A;  4J83 A;  1G3W A;  5GAN 4;  1BIA A;  5CAI A;  4CRI A;  3RMQ A;  1YIT A;  2X4Y A;  3L2U A;  3CCM A;  1GXI E;  4HCB A;  5AYF A;  3JB9 G;  1G3Y A;  1BIB A;  4XTY A;  1VQ6 T;  4EMG A;  1VQ5 T;  4NL2 A;  3QUI A;  4XTZ A;  4EPC A;  1D3B B;  2ZPF B;  3OS2 A;  2EWN A;  4E7I A;  5KCH A;  3CC4 A;  2I2L A;  3BDU A;  3G6E A;  1YIJ T;  2BKD N;  3KBG A;  3CME A;  2XI9 A;  4OB2 B;  3JCM h;  2E41 A;  2HD0 A;  5GAN d;  1K73 U;  4UC4 A;  4BE1 A;  3V8L A;  4B9W A;  5CR2 A;  2QEX T;  2JVV A;  4C5G A;  3JCM Q;  2JTF A;  4CI0 C;  3V7R A;  1G3S A;  4PKC C;  4BD3 A;  5LJ3 j;  3KUF A;  3BY7 A;  4OB3 B;  4ZGD B;  3E19 A;  3OW2 A;  5DLQ E;  4C8Q B;  2CYZ B;  2CZ1 B;  4M75 F;  1RI0 A;  3JCM J;  3QYH B;  2PUO B;  2M1H A;  2DKG A;  4FSX A;  3JCM b;  2ZGW A;  1NPP A;  1BI3 A;  3HRT A;  4E7L A;  3P8H A;  3G71 A;  3CPF A;  4ZTF A;  3VJP A;  1D3B A;  5KH6 A;  5FRO A;  3OYM A;  4M7D E;  3OBY A;  4EMK B;  2DPP B;  2PU9 B;  2XIC A;  4IUV A;  2K5L A;  4M78 B;  4QVC A;  1R8O B;  1QVP A;  4IUP A;  3X24 B;  4MZM A;  3LWH A;  3OSS C;  2MWO A;  4QQD A;  2A7Y A;  1G3T A;  4D6W A;  4VUB A;  3JRZ A;  4M7A F;  2R57 A;  4M75 G;  4GLK A;  4Q5W A;  1IRE B;  4C0D B;  1KQ1 A;  4C8Q A;  3NTH A;  5HK0 A;  2P4T A;  3X20 B;  3SD4 A;  2DJZ A;  2DVE A;  3M56 A;  3LLR A;  2P0K A;  3M59 A;  3QKJ A;  2LCL A;  4NOY A;  3VV0 A;  2Y4Y A;  2D0Q B;  3CCL A;  2RHY A;  3RKW A;  3CBO A;  4OMF B;  1PSE A;  4EMK A;  3TU4 K;  1VQL T;  2E1H A;  2RD1 A;  5FRM A;  3JB9 J;  3A5Z B;  4M78 A;  4PNO A;  4C5H A;  5LJ5 j;  4MDX A;  3I56 T;  3L2W A;  2YLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...