2E73A

Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase c gamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
77
structure length
77
Chain Sequence
GSSGSSGHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase C gamma
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein kinase C gamma type
total genus 4
structure length 77
sequence length 77
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2e73A01
5FUVA 2B8TA 4FKDA 1XA6A 3UFFA 2J87A 3CXLA 2DB6A 3UEYA 2WVJA 3BJIA 1XX6A 2ORVA 2VRWB 1KBEA 1TBOA 2ENZA 2FNFX 1RFHA 3UGLA 2QPOA 4UXJA 2J9RA 1XBTA 2JA1A 2ROWA 4B6DA 4L9MA 3E2IA 3KY9A 5FUYA 3UGDA 2ELIA 2QQEA 4UXIA 1Y8FA 1FARA 1PTQA 4UXHA 5FUXA 1R79A 1W4RA 2YUUA 5FUWA 1KBFA 1TBNA 2ENNA 2ORWA 2QQ0A 2GVIA 2UZ3A 2E73A 3UEJA 1PTRA 1FAQA 3UGIA
chains in the Genus database with same CATH superfamily
5HQ8A 2CWFA 2DKVA 3RU0A 2RIJA 3TO7A 1SGRI 1TGSI 1LR8A 3FSYA 1WTJA 2V53A 1ULKA 5EX3A 1XX6A 4DNCA 1K7VA 2F3CI 2NU0I 3R5CA 2N52A 2GKRI 2J9RA 7WGAA 2E5RA 1FYBA 2N1AB 3SEKC 4L9MA 3UOEA 4WP4A 4B6DA 1ULMA 3D00A 1YU6C 1H0ZA 1OMUA 5EX0A 2P6AC 2B0UC 5FUYA 1UHAA 4E1RA 1DS3I 4UXIA 1FY7A 1IW4A 1OVOA 1Y8FA 2OU2A 2Y0MA 5FUXA 2M5XA 1SGYI 2YUUA 1VDDA 2ENNA 2JYYA 2SGFI 1CT2I 1N13A 1K7UA 1PTRA 3MEKA 4E1PA 1FAQA 5FUVA 1X74A 1UUCA 4OVOA 1CE3A 1K7TA 5JHWC 2J87A 2V1CA 1CT0I 1SGQI 1OYVI 2KCXA 2ORVA 2QQDA 3BJIA 1TBOA 1YTPA 3FSXA 2CWGA 5E3QA 3UGLA 1S20A 2QPOA 4UXJA 1P9GA 2SGEI 3VDUA 1M8CA 3OVOA 1KMAA 1MJAA 2NU2I 1TURA 1MJBA 2ROWA 2L7XA 3E2IA 3QAHA 2XRCA 3E59A 1CT4I 3R5AA 2PQ8A 2WGCA 2ERWA 1R79A 1CHOI 2ARPF 3TOAA 1BMOA 1UVGA 1CGII 2E73A 1HEVA 1WKXA 1Z2IA 2KMRA 1BUSA 9WGAA 3R5BA 3R5DA 5HI7A 2V1CC 2NU4I 1SGEI 2OZUA 3TO6A 1SGPI 3UGIA 2KMQA 2B8TA 2YQPA 4FKDA 1IY6A 1TIHA 1X4SA 5CCMA 2LB7A 5J8CA 3GOXA 5DAEA 3CXLA 2DB6A 5E3RA 3UEYA 2GKVA 1W3SA 1RFHA 2W0TA 1UVFA 2WCYA 1PJUA 2RC4A 1MT1A 2UVOA 2JA1A 1SGNI 5E3PA 2JW6A 1AN1I 1R0RI 1LR9A 1ULNA 2NU3I 2ODDA 2OD1A 1WGCA 2SGDI 2KMOA 4GI3C 3TOBA 2N17A 3UGDA 2ELIA 1FARA 1LR7A 3VE5A 1Y1BA 1Z7KB 2L8EA 2GIVA 2SGPI 5FUWA 1TBNA 1KBFA 3SGBI 2UZ3A 3VDPA 2X52A 1HJAI 1U5KA 1M8BA 3UEJA 1HPTA 3QWPA 1CGJI 3SGQI 1MJ9A 2N71A 3OXLA 3OXGA 1DS2I 2CJSC 2BUSA 1XA6A 3FC3A 1PPFI 1OMTA 3UFFA 2KMPA 4MPIA 1HDLA 1NXUA 5J8FA 2LEOA 2WVJA 3TO9A 2JXDA 1Y1CA 2VRWB 4AMLA 1KBEA 2ENZA 1P9ZA 2FNFX 1NUBA 2NU1I 1V1IA 1Q9BA 2LUYA 2A20A 1PCEA 1TUSA 1XBTA 4JCVE 3OL0A 2DIPA 4HGUA 3HH2C 2GKTI 4SGBI 1SGDI 2OVOA 2JZMA 2QQCA 3KY9A 3QTLD 2QQEA 2X3TA 1IY5A 1PTQA 1TBRR 4UXHA 3B4VC 1W4RA 2QQ0A 2SGQI 2ORWA 1V1HA 2GVIA 1WGTA 1TBQR 3OXFA 2K9HA 4A24A 2CWHA 3TJQA 3PDNA 5CCLA 1CSOI 1TOTA
chains in the Genus database with same CATH topology
5HQ8A 3RU0A 1SGRI 1TGSI 1LR8A 5EX3A 2V53A 1XX6A 2F3CI 2NU0I 2N52A 2GKRI 2J9RA 2E5RA 1FYBA 2N1AB 3SEKC 4L9MA 4B6DA 3D00A 1YU6C 1H0ZA 1OMUA 5EX0A 2P6AC 2B0UC 5FUYA 4E1RA 3FC3A 1DS3I 4UXIA 1IW4A 1OVOA 1Y8FA 5FUXA 2M5XA 1SGYI 2YUUA 1VDDA 2ENNA 2JYYA 2SGFI 1CT2I 1N13A 1PTRA 3MEKA 4E1PA 1FAQA 5FUVA 1X74A 1UUCA 4OVOA 1CE3A 5JHWC 2J87A 2V1CA 1CT0I 1SGQI 1OYVI 2KCXA 2ORVA 2QQDA 3BJIA 1TBOA 1YTPA 3UGLA 2QPOA 4UXJA 3VDUA 2SGEI 1M8CA 3OVOA 1KMAA 2ROWA 2NU2I 1TURA 2L7XA 3E2IA 2XRCA 3E59A 1CT4I 2ERWA 1R79A 1CHOI 2ARPF 1BMOA 1UVGA 1CGII 2E73A 2KMRA 1BUSA 5HI7A 2V1CC 2NU4I 1SGEI 1SGPI 3UGIA 2KMQA 2B8TA 2YQPA 4FKDA 1IY6A 1TIHA 1X4SA 5CCMA 3GOXA 5DAEA 3CXLA 2DB6A 3UEYA 2GKVA 1W3SA 1RFHA 2W0TA 1UVFA 2WCYA 1PJUA 1MT1A 2JA1A 1SGNI 2JW6A 1AN1I 1R0RI 1LR9A 2NU3I 2OD1A 2ODDA 2SGDI 4GI3C 2KMOA 2N17A 3UGDA 2ELIA 1FARA 1LR7A 3VE5A 1Y1BA 1Z7KB 2L8EA 2SGPI 5FUWA 1KBFA 1TBNA 3SGBI 2UZ3A 3VDPA 1HJAI 1U5KA 1M8BA 3UEJA 1HPTA 3QWPA 1CGJI 3SGQI 2N71A 3OXLA 3OXGA 1DS2I 2CJSC 2BUSA 1XA6A 1PPFI 1OMTA 3UFFA 2KMPA 1HDLA 2LEOA 2WVJA 2JXDA 1Y1CA 2VRWB 1KBEA 2ENZA 2FNFX 2NU1I 1NUBA 1V1IA 2LUYA 2A20A 1PCEA 1TUSA 1XBTA 4JCVE 3OL0A 2DIPA 4HGUA 3HH2C 2GKTI 4SGBI 1SGDI 2OVOA 2JZMA 2QQCA 3KY9A 3QTLD 2QQEA 1IY5A 1PTQA 1TBRR 4UXHA 3B4VC 1W4RA 2QQ0A 2SGQI 2ORWA 1V1HA 2GVIA 3OXFA 1TBQR 2K9HA 4A24A 3TJQA 5CCLA 3PDNA 1CSOI 1TOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUV A;  2B8T A;  4FKD A;  1XA6 A;  3UFF A;  2J87 A;  3CXL A;  2DB6 A;  3UEY A;  2WVJ A;  3BJI A;  1XX6 A;  2ORV A;  2VRW B;  1KBE A;  1TBO A;  2ENZ A;  2FNF X;  1RFH A;  3UGL A;  2QPO A;  4UXJ A;  2J9R A;  1XBT A;  2JA1 A;  2ROW A;  4B6D A;  4L9M A;  3E2I A;  3KY9 A;  5FUY A;  3UGD A;  2ELI A;  2QQE A;  4UXI A;  1Y8F A;  1FAR A;  1PTQ A;  4UXH A;  5FUX A;  1R79 A;  1W4R A;  2YUU A;  5FUW A;  1KBF A;  1TBN A;  2ENN A;  2ORW A;  2QQ0 A;  2GVI A;  2UZ3 A;  2E73 A;  3UEJ A;  1PTR A;  1FAQ A;  3UGI A; 
#chains in the Genus database with same CATH topology
 5HQ8 A;  2CWF A;  2DKV A;  3RU0 A;  2RIJ A;  3TO7 A;  1SGR I;  1TGS I;  1LR8 A;  3FSY A;  1WTJ A;  2V53 A;  1ULK A;  5EX3 A;  1XX6 A;  4DNC A;  1K7V A;  2F3C I;  2NU0 I;  3R5C A;  2N52 A;  2GKR I;  2J9R A;  7WGA A;  2E5R A;  1FYB A;  2N1A B;  3SEK C;  4L9M A;  3UOE A;  4WP4 A;  4B6D A;  1ULM A;  3D00 A;  1YU6 C;  1H0Z A;  1OMU A;  5EX0 A;  2P6A C;  2B0U C;  5FUY A;  1UHA A;  4E1R A;  1DS3 I;  4UXI A;  1FY7 A;  1IW4 A;  1OVO A;  1Y8F A;  2OU2 A;  2Y0M A;  5FUX A;  2M5X A;  1SGY I;  2YUU A;  1VDD A;  2ENN A;  2JYY A;  2SGF I;  1CT2 I;  1N13 A;  1K7U A;  1PTR A;  3MEK A;  4E1P A;  1FAQ A;  5FUV A;  1X74 A;  1UUC A;  4OVO A;  1CE3 A;  1K7T A;  5JHW C;  2J87 A;  2V1C A;  1CT0 I;  1SGQ I;  1OYV I;  2KCX A;  2ORV A;  2QQD A;  3BJI A;  1TBO A;  1YTP A;  3FSX A;  2CWG A;  5E3Q A;  3UGL A;  1S20 A;  2QPO A;  4UXJ A;  1P9G A;  2SGE I;  3VDU A;  1M8C A;  3OVO A;  1KMA A;  1MJA A;  2NU2 I;  1TUR A;  1MJB A;  2ROW A;  2L7X A;  3E2I A;  3QAH A;  2XRC A;  3E59 A;  1CT4 I;  3R5A A;  2PQ8 A;  2WGC A;  2ERW A;  1R79 A;  1CHO I;  2ARP F;  3TOA A;  1BMO A;  1UVG A;  1CGI I;  2E73 A;  1HEV A;  1WKX A;  1Z2I A;  2KMR A;  1BUS A;  9WGA A;  3R5B A;  3R5D A;  5HI7 A;  2V1C C;  2NU4 I;  1SGE I;  2OZU A;  3TO6 A;  1SGP I;  3UGI A;  2KMQ A;  2B8T A;  2YQP A;  4FKD A;  1IY6 A;  1TIH A;  1X4S A;  5CCM A;  2LB7 A;  5J8C A;  3GOX A;  5DAE A;  3CXL A;  2DB6 A;  5E3R A;  3UEY A;  2GKV A;  1W3S A;  1RFH A;  2W0T A;  1UVF A;  2WCY A;  1PJU A;  2RC4 A;  1MT1 A;  2UVO A;  2JA1 A;  1SGN I;  5E3P A;  2JW6 A;  1AN1 I;  1R0R I;  1LR9 A;  1ULN A;  2NU3 I;  2ODD A;  2OD1 A;  1WGC A;  2SGD I;  2KMO A;  4GI3 C;  3TOB A;  2N17 A;  3UGD A;  2ELI A;  1FAR A;  1LR7 A;  3VE5 A;  1Y1B A;  1Z7K B;  2L8E A;  2GIV A;  2SGP I;  5FUW A;  1TBN A;  1KBF A;  3SGB I;  2UZ3 A;  3VDP A;  2X52 A;  1HJA I;  1U5K A;  1M8B A;  3UEJ A;  1HPT A;  3QWP A;  1CGJ I;  3SGQ I;  1MJ9 A;  2N71 A;  3OXL A;  3OXG A;  1DS2 I;  2CJS C;  2BUS A;  1XA6 A;  3FC3 A;  1PPF I;  1OMT A;  3UFF A;  2KMP A;  4MPI A;  1HDL A;  1NXU A;  5J8F A;  2LEO A;  2WVJ A;  3TO9 A;  2JXD A;  1Y1C A;  2VRW B;  4AML A;  1KBE A;  2ENZ A;  1P9Z A;  2FNF X;  1NUB A;  2NU1 I;  1V1I A;  1Q9B A;  2LUY A;  2A20 A;  1PCE A;  1TUS A;  1XBT A;  4JCV E;  3OL0 A;  2DIP A;  4HGU A;  3HH2 C;  2GKT I;  4SGB I;  1SGD I;  2OVO A;  2JZM A;  2QQC A;  3KY9 A;  3QTL D;  2QQE A;  2X3T A;  1IY5 A;  1PTQ A;  1TBR R;  4UXH A;  3B4V C;  1W4R A;  2QQ0 A;  2SGQ I;  2ORW A;  1V1H A;  2GVI A;  1WGT A;  1TBQ R;  3OXF A;  2K9H A;  4A24 A;  2CWH A;  3TJQ A;  3PDN A;  5CCL A;  1CSO I;  1TOT A; 
#chains in the Genus database with same CATH homology
 5HQ8 A;  3RU0 A;  1SGR I;  1TGS I;  1LR8 A;  5EX3 A;  2V53 A;  1XX6 A;  2F3C I;  2NU0 I;  2N52 A;  2GKR I;  2J9R A;  2E5R A;  1FYB A;  2N1A B;  3SEK C;  4L9M A;  4B6D A;  3D00 A;  1YU6 C;  1H0Z A;  1OMU A;  5EX0 A;  2P6A C;  2B0U C;  5FUY A;  4E1R A;  3FC3 A;  1DS3 I;  4UXI A;  1IW4 A;  1OVO A;  1Y8F A;  5FUX A;  2M5X A;  1SGY I;  2YUU A;  1VDD A;  2ENN A;  2JYY A;  2SGF I;  1CT2 I;  1N13 A;  1PTR A;  3MEK A;  4E1P A;  1FAQ A;  5FUV A;  1X74 A;  1UUC A;  4OVO A;  1CE3 A;  5JHW C;  2J87 A;  2V1C A;  1CT0 I;  1SGQ I;  1OYV I;  2KCX A;  2ORV A;  2QQD A;  3BJI A;  1TBO A;  1YTP A;  3UGL A;  2QPO A;  4UXJ A;  3VDU A;  2SGE I;  1M8C A;  3OVO A;  1KMA A;  2ROW A;  2NU2 I;  1TUR A;  2L7X A;  3E2I A;  2XRC A;  3E59 A;  1CT4 I;  2ERW A;  1R79 A;  1CHO I;  2ARP F;  1BMO A;  1UVG A;  1CGI I;  2E73 A;  2KMR A;  1BUS A;  5HI7 A;  2V1C C;  2NU4 I;  1SGE I;  1SGP I;  3UGI A;  2KMQ A;  2B8T A;  2YQP A;  4FKD A;  1IY6 A;  1TIH A;  1X4S A;  5CCM A;  3GOX A;  5DAE A;  3CXL A;  2DB6 A;  3UEY A;  2GKV A;  1W3S A;  1RFH A;  2W0T A;  1UVF A;  2WCY A;  1PJU A;  1MT1 A;  2JA1 A;  1SGN I;  2JW6 A;  1AN1 I;  1R0R I;  1LR9 A;  2NU3 I;  2OD1 A;  2ODD A;  2SGD I;  4GI3 C;  2KMO A;  2N17 A;  3UGD A;  2ELI A;  1FAR A;  1LR7 A;  3VE5 A;  1Y1B A;  1Z7K B;  2L8E A;  2SGP I;  5FUW A;  1KBF A;  1TBN A;  3SGB I;  2UZ3 A;  3VDP A;  1HJA I;  1U5K A;  1M8B A;  3UEJ A;  1HPT A;  3QWP A;  1CGJ I;  3SGQ I;  2N71 A;  3OXL A;  3OXG A;  1DS2 I;  2CJS C;  2BUS A;  1XA6 A;  1PPF I;  1OMT A;  3UFF A;  2KMP A;  1HDL A;  2LEO A;  2WVJ A;  2JXD A;  1Y1C A;  2VRW B;  1KBE A;  2ENZ A;  2FNF X;  2NU1 I;  1NUB A;  1V1I A;  2LUY A;  2A20 A;  1PCE A;  1TUS A;  1XBT A;  4JCV E;  3OL0 A;  2DIP A;  4HGU A;  3HH2 C;  2GKT I;  4SGB I;  1SGD I;  2OVO A;  2JZM A;  2QQC A;  3KY9 A;  3QTL D;  2QQE A;  1IY5 A;  1PTQ A;  1TBR R;  4UXH A;  3B4V C;  1W4R A;  2QQ0 A;  2SGQ I;  2ORW A;  1V1H A;  2GVI A;  3OXF A;  1TBQ R;  2K9H A;  4A24 A;  3TJQ A;  5CCL A;  3PDN A;  1CSO I;  1TOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...