2E73A

Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase c gamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
77
structure length
77
Chain Sequence
GSSGSSGHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C gamma type
publication title Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase C gamma
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 4
structure length 77
sequence length 77
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2e73A01
1RFHA 2E73A 3UGLA 2B8TA 2UZ3A 2ENNA 1PTQA 2ORWA 1W4RA 2J87A 2WVJA 1Y8FA 1XA6A 5FUWA 4UXJA 4UXHA 3UEYA 3UGIA 2ORVA 2QQ0A 3UFFA 1FAQA 3BJIA 2DB6A 5FUYA 2J9RA 1KBFA 1TBNA 1PTRA 2ELIA 2GVIA 3CXLA 3KY9A 5FUXA 2VRWB 2QPOA 1TBOA 1XBTA 2ENZA 4L9MA 4FKDA 4UXIA 5FUVA 4B6DA 2ROWA 1KBEA 2QQEA 3E2IA 2FNFX 1XX6A 2YUUA 3UEJA 2JA1A 1FARA 3UGDA 1R79A
chains in the Genus database with same CATH superfamily
5J8CA 1YU6C 1WGCA 2UVOA 2ENNA 3SGBI 1WGTA 2E5RA 5E3QA 2RIJA 1UVGA 5HI7A 1W4RA 2CJSC 1TGSI 2WCYA 2X3TA 1S20A 4E1PA 1ULMA 1WTJA 2W0TA 1YTPA 2M5XA 4JCVE 3TO9A 2KMPA 2DB6A 3TJQA 1CT2I 5JHWC 5FUYA 1N13A 2ERWA 1PTRA 2ELIA 2N1AB 3OL0A 2L8EA 3SGQI 4OVOA 1TBRR 1Z7KB 2NU3I 1TBQR 4FKDA 4UXIA 4E1RA 4AMLA 1HJAI 3VDPA 2ROWA 1CT0I 5E3PA 5E3RA 2FNFX 2XRCA 2YUUA 2V1CC 5CCLA 4HGUA 3OXLA 2WGCA 3R5AA 3UGDA 1MT1A 1V1IA 2SGFI 2V53A 1ULKA 3SEKC 1LR7A 2B8TA 1PPFI 1SGYI 1PTQA 2CWGA 1TURA 2ORWA 3R5CA 3TOBA 4DNCA 1CGJI 1XA6A 2JXDA 2RC4A 1W3SA 3RU0A 2QQ0A 1BUSA 3UFFA 2DKVA 1FAQA 4SGBI 1CT4I 2KMOA 1CGII 2NU1I 1K7UA 1MJBA 1TIHA 1NXUA 2J9RA 2SGDI 1SGPI 3VDUA 2B0UC 3CXLA 5FUXA 2NU0I 2LB7A 2LUYA 1XBTA 1SGRI 1SGEI 1Z2IA 4L9MA 1X74A 5FUVA 4B6DA 3GOXA 1V1HA 1CHOI 2SGQI 1XX6A 3UEJA 2OU2A 1M8CA 2X52A 2OZUA 1MJ9A 3OVOA 3OXFA 3UOEA 2CWHA 2JW6A 1SGDI 3TO7A 2UZ3A 1H0ZA 7WGAA 2A20A 1NUBA 2WVJA 1BMOA 1Y8FA 4MPIA 5DAEA 4UXJA 3UGIA 4A24A 1Y1BA 3TO6A 3QAHA 2ARPF 1P9ZA 1LR9A 3B4VC 3BJIA 1OVOA 2SGPI 3FC3A 2GKTI 2F3CI 1KMAA 1TBNA 3QWPA 1TOTA 2VRWB 1DS2I 2ENZA 2YQPA 1UUCA 1R0RI 1Y1CA 2KCXA 3E59A 1IY5A 1CE3A 5CCMA 5EX0A 9WGAA 1OYVI 2P6AC 3PDNA 4WP4A 1Q9BA 3HH2C 2QQDA 1AN1I 1HDLA 2OD1A 1R79A 1ULNA 2GIVA 1IY6A 2DIPA 1RFHA 2N71A 1WKXA 1CSOI 2SGEI 2E73A 1LR8A 2KMRA 3R5BA 2NU4I 1HPTA 3UGLA 1TUSA 1P9GA 1SGQI 1DS3I 1HEVA 1OMTA 2ODDA 3OXGA 2OVOA 2J87A 1OMUA 2KMQA 4GI3C 2V1CA 5FUWA 3UEYA 2QQCA 2NU2I 4UXHA 1FYBA 1PJUA 2N52A 2ORVA 2JZMA 1PCEA 2CWFA 5EX3A 2LEOA 1MJAA 1KBFA 1UHAA 3R5DA 2GVIA 2JYYA 2PQ8A 1X4SA 3MEKA 3KY9A 2QPOA 1TBOA 2N17A 1VDDA 2K9HA 1K7TA 3QTLD 2GKVA 1UVFA 3VE5A 2L7XA 5J8FA 1SGNI 1FY7A 2Y0MA 1KBEA 2QQEA 3D00A 3E2IA 1M8BA 2BUSA 1FARA 1K7VA 2JA1A 3FSXA 3TOAA 5HQ8A 1U5KA 2GKRI 1IW4A 3FSYA
chains in the Genus database with same CATH topology
1YU6C 2ENNA 3SGBI 2E5RA 1UVGA 5HI7A 1W4RA 2CJSC 1TGSI 2WCYA 4E1PA 2W0TA 1YTPA 2M5XA 4JCVE 2KMPA 2DB6A 3TJQA 1CT2I 5JHWC 5FUYA 1N13A 2ERWA 1PTRA 2ELIA 2N1AB 3OL0A 2L8EA 3SGQI 4OVOA 1TBRR 1Z7KB 2NU3I 1TBQR 4FKDA 4UXIA 4E1RA 1HJAI 3VDPA 2ROWA 1CT0I 5CCLA 2FNFX 2XRCA 2YUUA 2V1CC 4HGUA 3OXLA 3UGDA 1MT1A 1V1IA 2SGFI 2V53A 3SEKC 1LR7A 2B8TA 1PPFI 1SGYI 1PTQA 1TURA 2ORWA 1CGJI 1XA6A 2JXDA 1W3SA 3RU0A 2QQ0A 1BUSA 3UFFA 1FAQA 4SGBI 1CT4I 2KMOA 1CGII 2NU1I 2SGDI 1TIHA 2J9RA 1SGPI 3VDUA 2B0UC 3CXLA 5FUXA 2NU0I 2LUYA 1XBTA 1SGRI 1SGEI 4L9MA 1X74A 5FUVA 4B6DA 3GOXA 1V1HA 1CHOI 2SGQI 1XX6A 3UEJA 1M8CA 3OVOA 3OXFA 2JW6A 1SGDI 2UZ3A 1H0ZA 2A20A 1NUBA 2WVJA 1BMOA 1Y8FA 5DAEA 3UGIA 4UXJA 4A24A 1Y1BA 2ARPF 1LR9A 3B4VC 3BJIA 1OVOA 2SGPI 3FC3A 2GKTI 2F3CI 1KMAA 1TBNA 3QWPA 1TOTA 2VRWB 1DS2I 2ENZA 2YQPA 1UUCA 1R0RI 1Y1CA 2KCXA 3E59A 1IY5A 1CE3A 5CCMA 5EX0A 1OYVI 2P6AC 3PDNA 3HH2C 2QQDA 1AN1I 1HDLA 2OD1A 1R79A 1IY6A 2DIPA 1RFHA 2N71A 2SGEI 1CSOI 2E73A 1LR8A 2KMRA 3UGLA 2NU4I 1HPTA 1TUSA 1SGQI 1DS3I 1OMTA 2ODDA 3OXGA 2OVOA 2J87A 1OMUA 2KMQA 4GI3C 2V1CA 5FUWA 3UEYA 2QQCA 2NU2I 4UXHA 1FYBA 1PJUA 2N52A 2ORVA 2JZMA 1PCEA 5EX3A 2LEOA 1KBFA 2GVIA 2JYYA 1X4SA 3MEKA 3KY9A 2QPOA 1TBOA 2N17A 1VDDA 2K9HA 3QTLD 2GKVA 1UVFA 3VE5A 2L7XA 1SGNI 3D00A 1KBEA 2QQEA 3E2IA 1M8BA 2BUSA 1FARA 2JA1A 5HQ8A 1U5KA 2GKRI 1IW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFH A;  2E73 A;  3UGL A;  2B8T A;  2UZ3 A;  2ENN A;  1PTQ A;  2ORW A;  1W4R A;  2J87 A;  2WVJ A;  1Y8F A;  1XA6 A;  5FUW A;  4UXJ A;  4UXH A;  3UEY A;  3UGI A;  2ORV A;  2QQ0 A;  3UFF A;  1FAQ A;  3BJI A;  2DB6 A;  5FUY A;  2J9R A;  1KBF A;  1TBN A;  1PTR A;  2ELI A;  2GVI A;  3CXL A;  3KY9 A;  5FUX A;  2VRW B;  2QPO A;  1TBO A;  1XBT A;  2ENZ A;  4L9M A;  4FKD A;  4UXI A;  5FUV A;  4B6D A;  2ROW A;  1KBE A;  2QQE A;  3E2I A;  2FNF X;  1XX6 A;  2YUU A;  3UEJ A;  2JA1 A;  1FAR A;  3UGD A;  1R79 A; 
#chains in the Genus database with same CATH topology
 5J8C A;  1YU6 C;  1WGC A;  2UVO A;  2ENN A;  3SGB I;  1WGT A;  2E5R A;  5E3Q A;  2RIJ A;  1UVG A;  5HI7 A;  1W4R A;  2CJS C;  1TGS I;  2WCY A;  2X3T A;  1S20 A;  4E1P A;  1ULM A;  1WTJ A;  2W0T A;  1YTP A;  2M5X A;  4JCV E;  3TO9 A;  2KMP A;  2DB6 A;  3TJQ A;  1CT2 I;  5JHW C;  5FUY A;  1N13 A;  2ERW A;  1PTR A;  2ELI A;  2N1A B;  3OL0 A;  2L8E A;  3SGQ I;  4OVO A;  1TBR R;  1Z7K B;  2NU3 I;  1TBQ R;  4FKD A;  4UXI A;  4E1R A;  4AML A;  1HJA I;  3VDP A;  2ROW A;  1CT0 I;  5E3P A;  5E3R A;  2FNF X;  2XRC A;  2YUU A;  2V1C C;  5CCL A;  4HGU A;  3OXL A;  2WGC A;  3R5A A;  3UGD A;  1MT1 A;  1V1I A;  2SGF I;  2V53 A;  1ULK A;  3SEK C;  1LR7 A;  2B8T A;  1PPF I;  1SGY I;  1PTQ A;  2CWG A;  1TUR A;  2ORW A;  3R5C A;  3TOB A;  4DNC A;  1CGJ I;  1XA6 A;  2JXD A;  2RC4 A;  1W3S A;  3RU0 A;  2QQ0 A;  1BUS A;  3UFF A;  2DKV A;  1FAQ A;  4SGB I;  1CT4 I;  2KMO A;  1CGI I;  2NU1 I;  1K7U A;  1MJB A;  1TIH A;  1NXU A;  2J9R A;  2SGD I;  1SGP I;  3VDU A;  2B0U C;  3CXL A;  5FUX A;  2NU0 I;  2LB7 A;  2LUY A;  1XBT A;  1SGR I;  1SGE I;  1Z2I A;  4L9M A;  1X74 A;  5FUV A;  4B6D A;  3GOX A;  1V1H A;  1CHO I;  2SGQ I;  1XX6 A;  3UEJ A;  2OU2 A;  1M8C A;  2X52 A;  2OZU A;  1MJ9 A;  3OVO A;  3OXF A;  3UOE A;  2CWH A;  2JW6 A;  1SGD I;  3TO7 A;  2UZ3 A;  1H0Z A;  7WGA A;  2A20 A;  1NUB A;  2WVJ A;  1BMO A;  1Y8F A;  4MPI A;  5DAE A;  4UXJ A;  3UGI A;  4A24 A;  1Y1B A;  3TO6 A;  3QAH A;  2ARP F;  1P9Z A;  1LR9 A;  3B4V C;  3BJI A;  1OVO A;  2SGP I;  3FC3 A;  2GKT I;  2F3C I;  1KMA A;  1TBN A;  3QWP A;  1TOT A;  2VRW B;  1DS2 I;  2ENZ A;  2YQP A;  1UUC A;  1R0R I;  1Y1C A;  2KCX A;  3E59 A;  1IY5 A;  1CE3 A;  5CCM A;  5EX0 A;  9WGA A;  1OYV I;  2P6A C;  3PDN A;  4WP4 A;  1Q9B A;  3HH2 C;  2QQD A;  1AN1 I;  1HDL A;  2OD1 A;  1R79 A;  1ULN A;  2GIV A;  1IY6 A;  2DIP A;  1RFH A;  2N71 A;  1WKX A;  1CSO I;  2SGE I;  2E73 A;  1LR8 A;  2KMR A;  3R5B A;  2NU4 I;  1HPT A;  3UGL A;  1TUS A;  1P9G A;  1SGQ I;  1DS3 I;  1HEV A;  1OMT A;  2ODD A;  3OXG A;  2OVO A;  2J87 A;  1OMU A;  2KMQ A;  4GI3 C;  2V1C A;  5FUW A;  3UEY A;  2QQC A;  2NU2 I;  4UXH A;  1FYB A;  1PJU A;  2N52 A;  2ORV A;  2JZM A;  1PCE A;  2CWF A;  5EX3 A;  2LEO A;  1MJA A;  1KBF A;  1UHA A;  3R5D A;  2GVI A;  2JYY A;  2PQ8 A;  1X4S A;  3MEK A;  3KY9 A;  2QPO A;  1TBO A;  2N17 A;  1VDD A;  2K9H A;  1K7T A;  3QTL D;  2GKV A;  1UVF A;  3VE5 A;  2L7X A;  5J8F A;  1SGN I;  1FY7 A;  2Y0M A;  1KBE A;  2QQE A;  3D00 A;  3E2I A;  1M8B A;  2BUS A;  1FAR A;  1K7V A;  2JA1 A;  3FSX A;  3TOA A;  5HQ8 A;  1U5K A;  2GKR I;  1IW4 A;  3FSY A; 
#chains in the Genus database with same CATH homology
 1YU6 C;  2ENN A;  3SGB I;  2E5R A;  1UVG A;  5HI7 A;  1W4R A;  2CJS C;  1TGS I;  2WCY A;  4E1P A;  2W0T A;  1YTP A;  2M5X A;  4JCV E;  2KMP A;  2DB6 A;  3TJQ A;  1CT2 I;  5JHW C;  5FUY A;  1N13 A;  2ERW A;  1PTR A;  2ELI A;  2N1A B;  3OL0 A;  2L8E A;  3SGQ I;  4OVO A;  1TBR R;  1Z7K B;  2NU3 I;  1TBQ R;  4FKD A;  4UXI A;  4E1R A;  1HJA I;  3VDP A;  2ROW A;  1CT0 I;  5CCL A;  2FNF X;  2XRC A;  2YUU A;  2V1C C;  4HGU A;  3OXL A;  3UGD A;  1MT1 A;  1V1I A;  2SGF I;  2V53 A;  3SEK C;  1LR7 A;  2B8T A;  1PPF I;  1SGY I;  1PTQ A;  1TUR A;  2ORW A;  1CGJ I;  1XA6 A;  2JXD A;  1W3S A;  3RU0 A;  2QQ0 A;  1BUS A;  3UFF A;  1FAQ A;  4SGB I;  1CT4 I;  2KMO A;  1CGI I;  2NU1 I;  2SGD I;  1TIH A;  2J9R A;  1SGP I;  3VDU A;  2B0U C;  3CXL A;  5FUX A;  2NU0 I;  2LUY A;  1XBT A;  1SGR I;  1SGE I;  4L9M A;  1X74 A;  5FUV A;  4B6D A;  3GOX A;  1V1H A;  1CHO I;  2SGQ I;  1XX6 A;  3UEJ A;  1M8C A;  3OVO A;  3OXF A;  2JW6 A;  1SGD I;  2UZ3 A;  1H0Z A;  2A20 A;  1NUB A;  2WVJ A;  1BMO A;  1Y8F A;  5DAE A;  3UGI A;  4UXJ A;  4A24 A;  1Y1B A;  2ARP F;  1LR9 A;  3B4V C;  3BJI A;  1OVO A;  2SGP I;  3FC3 A;  2GKT I;  2F3C I;  1KMA A;  1TBN A;  3QWP A;  1TOT A;  2VRW B;  1DS2 I;  2ENZ A;  2YQP A;  1UUC A;  1R0R I;  1Y1C A;  2KCX A;  3E59 A;  1IY5 A;  1CE3 A;  5CCM A;  5EX0 A;  1OYV I;  2P6A C;  3PDN A;  3HH2 C;  2QQD A;  1AN1 I;  1HDL A;  2OD1 A;  1R79 A;  1IY6 A;  2DIP A;  1RFH A;  2N71 A;  2SGE I;  1CSO I;  2E73 A;  1LR8 A;  2KMR A;  3UGL A;  2NU4 I;  1HPT A;  1TUS A;  1SGQ I;  1DS3 I;  1OMT A;  2ODD A;  3OXG A;  2OVO A;  2J87 A;  1OMU A;  2KMQ A;  4GI3 C;  2V1C A;  5FUW A;  3UEY A;  2QQC A;  2NU2 I;  4UXH A;  1FYB A;  1PJU A;  2N52 A;  2ORV A;  2JZM A;  1PCE A;  5EX3 A;  2LEO A;  1KBF A;  2GVI A;  2JYY A;  1X4S A;  3MEK A;  3KY9 A;  2QPO A;  1TBO A;  2N17 A;  1VDD A;  2K9H A;  3QTL D;  2GKV A;  1UVF A;  3VE5 A;  2L7X A;  1SGN I;  3D00 A;  1KBE A;  2QQE A;  3E2I A;  1M8B A;  2BUS A;  1FAR A;  2JA1 A;  5HQ8 A;  1U5K A;  2GKR I;  1IW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...