2E73A

Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase c gamma
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
77
structure length
77
Chain Sequence
b'GSSGSSGHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C gamma type
publication title Solution structure of the phorbol esters/diacylglycerol binding domain of protein kinase C gamma
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 4
structure length 77
sequence length 77
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.20 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2e73A01
3UGLA 2B8TA 2E73A 5FUWA 2ORVA 1FARA 4UXIA 3UEYA 1W4RA 1Y8FA 1RFHA 3UGIA 2VRWB 3UGDA 5FUXA 3UEJA 4UXHA 4B6DA 2YUUA 2ROWA 3CXLA 4L9MA 1KBFA 1XA6A 1TBOA 2WVJA 1XBTA 2QQ0A 3BJIA 2GVIA 3KY9A 2J87A 2FNFX 3UFFA 2ENNA 2ORWA 4UXJA 1R79A 2DB6A 2QQEA 3E2IA 2JA1A 2J9RA 2UZ3A 1XX6A 2ENZA 1FAQA 4FKDA 1PTQA 2ELIA 1TBNA 1KBEA 5FUYA 2QPOA 5FUVA 1PTRA
chains in the Genus database with same CATH superfamily
3SGBI 1CGII 3UGLA 2QQDA 5JHWC 1FY7A 2KMQA 9WGAA 3TO6A 1CT4I 3B4VC 4A24A 1FARA 1NUBA 1TBRR 3R5CA 1CE3A 2M5XA 1YU6C 1Y1CA 2A20A 3QWPA 3TOAA 3UGIA 3VDUA 2NU4I 3UEJA 2Y0MA 1BMOA 3CXLA 4L9MA 1KBFA 2KMOA 1LR7A 1HDLA 1MJBA 1P9ZA 2E5RA 2L8EA 1VDDA 1MJAA 2GVIA 1K7UA 2ERWA 1CT0I 2ENNA 4UXJA 4E1PA 2DB6A 3TJQA 4OVOA 2N17A 3TO7A 2JA1A 1UVGA 2UZ3A 1SGDI 1UUCA 1M8CA 2ENZA 3MEKA 1SGQI 2JXDA 1TBQR 1OVOA 2SGFI 4FKDA 3OVOA 1TBNA 1KBEA 2ARPF 2XRCA 4HGUA 5E3RA 1PTRA 2N71A 2V1CA 2X3TA 1HEVA 1YTPA 2B8TA 4MPIA 3GOXA 5HI7A 1DS2I 1NXUA 1K7VA 2N1AB 2GIVA 4UXIA 1SGYI 1IY5A 1H0ZA 1Y8FA 4DNCA 3FSXA 2N52A 2ODDA 2BUSA 1PCEA 1IW4A 1ULNA 1LR8A 2YUUA 2NU3I 1UHAA 2UVOA 1TBOA 2OU2A 3QTLD 3TO9A 2B0UC 1CT2I 1ULMA 2J87A 2P6AC 3HH2C 3KY9A 2NU0I 3D00A 2W0TA 2DKVA 1OYVI 1W3SA 2J9RA 3FSYA 3OXFA 2KMRA 2OZUA 1IY6A 1XX6A 1UVFA 1N13A 2ELIA 1DS3I 1FYBA 2CJSC 1PJUA 2KCXA 2CWHA 1HPTA 2QPOA 5FUVA 4AMLA 1U5KA 1Q9BA 5E3QA 2WGCA 2E73A 2LUYA 1MJ9A 1P9GA 5CCMA 3UOEA 1M8BA 2SGPI 1K7TA 5E3PA 2F3CI 2VRWB 3UGDA 5FUXA 1SGEI 1CGJI 1S20A 1Y1BA 2ROWA 1WTJA 3QAHA 2OVOA 3FC3A 1WKXA 2WVJA 3R5BA 1Z2IA 2NU1I 4E1RA 2K9HA 1TOTA 3UFFA 3PDNA 2ORWA 1BUSA 1R79A 4WP4A 3E2IA 3TOBA 1OMTA 1X4SA 2L7XA 1SGNI 1Z7KB 2JZMA 1V1HA 5J8FA 3VDPA 4GI3C 2LB7A 2OD1A 1FAQA 3SEKC 1CSOI 5FUWA 5EX3A 3R5AA 1TUSA 3OXLA 3R5DA 2WCYA 3OXGA 1LR9A 2ORVA 3VE5A 2DIPA 1TIHA 2CWGA 2PQ8A 1R0RI 2NU2I 2X52A 3OL0A 1KMAA 1AN1I 1W4RA 2SGDI 1RFHA 2SGEI 1TURA 4UXHA 1PPFI 4B6DA 1TGSI 4SGBI 7WGAA 2JYYA 1HJAI 1X74A 1OMUA 2SGQI 2YQPA 1XA6A 1WGTA 1XBTA 2GKVA 2QQ0A 1WGCA 3BJIA 5DAEA 5EX0A 2QQCA 5CCLA 2FNFX 4JCVE 3SGQI 2GKTI 3E59A 2V1CC 2V53A 2QQEA 1V1IA 2JW6A 5HQ8A 2GKRI 1SGRI 3RU0A 1MT1A 2CWFA 2KMPA 1PTQA 2LEOA 1ULKA 2RC4A 2RIJA 1SGPI 5FUYA 3UEYA 1CHOI 5J8CA
chains in the Genus database with same CATH topology
3SGBI 1CGII 3UGLA 2QQDA 5JHWC 2KMQA 1CT4I 3B4VC 4A24A 1FARA 1NUBA 1TBRR 1CE3A 2M5XA 1YU6C 1Y1CA 2A20A 3QWPA 3UGIA 3VDUA 2NU4I 3UEJA 1BMOA 3CXLA 4L9MA 1KBFA 2KMOA 1LR7A 1HDLA 2E5RA 2L8EA 1VDDA 2GVIA 2ERWA 1CT0I 2ENNA 4UXJA 4E1PA 2DB6A 3TJQA 4OVOA 2N17A 2JA1A 1UVGA 2UZ3A 1SGDI 1UUCA 1M8CA 2ENZA 3MEKA 1SGQI 2JXDA 1TBQR 1OVOA 2SGFI 4FKDA 3OVOA 1TBNA 1KBEA 2ARPF 2XRCA 4HGUA 1PTRA 2N71A 2V1CA 1YTPA 2B8TA 3GOXA 5HI7A 1DS2I 2N1AB 1IY5A 4UXIA 1SGYI 1H0ZA 1Y8FA 2N52A 2ODDA 2BUSA 1PCEA 1IW4A 1LR8A 2YUUA 2NU3I 1TBOA 3QTLD 2B0UC 1CT2I 2J87A 2P6AC 3HH2C 3KY9A 2NU0I 3D00A 2W0TA 1OYVI 1W3SA 2J9RA 3OXFA 2KMRA 1IY6A 1XX6A 1UVFA 1N13A 2ELIA 1DS3I 1FYBA 2CJSC 1PJUA 2KCXA 2QPOA 1HPTA 5FUVA 1U5KA 2E73A 2LUYA 5CCMA 1M8BA 2SGPI 2F3CI 2VRWB 3UGDA 5FUXA 1SGEI 1CGJI 1Y1BA 3FC3A 2ROWA 2OVOA 2WVJA 4E1RA 2NU1I 2K9HA 1TOTA 3UFFA 3PDNA 2ORWA 1BUSA 1R79A 3E2IA 1OMTA 1X4SA 2L7XA 1SGNI 1Z7KB 2JZMA 1V1HA 1FAQA 3VDPA 4GI3C 2OD1A 3SEKC 1CSOI 5FUWA 5EX3A 1TUSA 3OXLA 2WCYA 3OXGA 1LR9A 2ORVA 3VE5A 2DIPA 1TIHA 1KMAA 1R0RI 2NU2I 3OL0A 1AN1I 1W4RA 2SGDI 1RFHA 2SGEI 1TURA 4UXHA 1PPFI 4B6DA 1TGSI 4SGBI 2JYYA 1HJAI 1X74A 1OMUA 2SGQI 2YQPA 1XA6A 2GKVA 1XBTA 2QQ0A 5DAEA 3BJIA 5EX0A 2QQCA 5CCLA 2FNFX 4JCVE 3SGQI 2GKTI 3E59A 2V1CC 2V53A 2QQEA 1V1IA 2JW6A 5HQ8A 2GKRI 1SGRI 3RU0A 1MT1A 2KMPA 2LEOA 1PTQA 1SGPI 5FUYA 3UEYA 1CHOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGL A;  2B8T A;  2E73 A;  5FUW A;  2ORV A;  1FAR A;  4UXI A;  3UEY A;  1W4R A;  1Y8F A;  1RFH A;  3UGI A;  2VRW B;  3UGD A;  5FUX A;  3UEJ A;  4UXH A;  4B6D A;  2YUU A;  2ROW A;  3CXL A;  4L9M A;  1KBF A;  1XA6 A;  1TBO A;  2WVJ A;  1XBT A;  2QQ0 A;  3BJI A;  2GVI A;  3KY9 A;  2J87 A;  2FNF X;  3UFF A;  2ENN A;  2ORW A;  4UXJ A;  1R79 A;  2DB6 A;  2QQE A;  3E2I A;  2JA1 A;  2J9R A;  2UZ3 A;  1XX6 A;  2ENZ A;  1FAQ A;  4FKD A;  1PTQ A;  2ELI A;  1TBN A;  1KBE A;  5FUY A;  2QPO A;  5FUV A;  1PTR A; 
#chains in the Genus database with same CATH topology
 3SGB I;  1CGI I;  3UGL A;  2QQD A;  5JHW C;  1FY7 A;  2KMQ A;  9WGA A;  3TO6 A;  1CT4 I;  3B4V C;  4A24 A;  1FAR A;  1NUB A;  1TBR R;  3R5C A;  1CE3 A;  2M5X A;  1YU6 C;  1Y1C A;  2A20 A;  3QWP A;  3TOA A;  3UGI A;  3VDU A;  2NU4 I;  3UEJ A;  2Y0M A;  1BMO A;  3CXL A;  4L9M A;  1KBF A;  2KMO A;  1LR7 A;  1HDL A;  1MJB A;  1P9Z A;  2E5R A;  2L8E A;  1VDD A;  1MJA A;  2GVI A;  1K7U A;  2ERW A;  1CT0 I;  2ENN A;  4UXJ A;  4E1P A;  2DB6 A;  3TJQ A;  4OVO A;  2N17 A;  3TO7 A;  2JA1 A;  1UVG A;  2UZ3 A;  1SGD I;  1UUC A;  1M8C A;  2ENZ A;  3MEK A;  1SGQ I;  2JXD A;  1TBQ R;  1OVO A;  2SGF I;  4FKD A;  3OVO A;  1TBN A;  1KBE A;  2ARP F;  2XRC A;  4HGU A;  5E3R A;  1PTR A;  2N71 A;  2V1C A;  2X3T A;  1HEV A;  1YTP A;  2B8T A;  4MPI A;  3GOX A;  5HI7 A;  1DS2 I;  1NXU A;  1K7V A;  2N1A B;  2GIV A;  4UXI A;  1SGY I;  1IY5 A;  1H0Z A;  1Y8F A;  4DNC A;  3FSX A;  2N52 A;  2ODD A;  2BUS A;  1PCE A;  1IW4 A;  1ULN A;  1LR8 A;  2YUU A;  2NU3 I;  1UHA A;  2UVO A;  1TBO A;  2OU2 A;  3QTL D;  3TO9 A;  2B0U C;  1CT2 I;  1ULM A;  2J87 A;  2P6A C;  3HH2 C;  3KY9 A;  2NU0 I;  3D00 A;  2W0T A;  2DKV A;  1OYV I;  1W3S A;  2J9R A;  3FSY A;  3OXF A;  2KMR A;  2OZU A;  1IY6 A;  1XX6 A;  1UVF A;  1N13 A;  2ELI A;  1DS3 I;  1FYB A;  2CJS C;  1PJU A;  2KCX A;  2CWH A;  1HPT A;  2QPO A;  5FUV A;  4AML A;  1U5K A;  1Q9B A;  5E3Q A;  2WGC A;  2E73 A;  2LUY A;  1MJ9 A;  1P9G A;  5CCM A;  3UOE A;  1M8B A;  2SGP I;  1K7T A;  5E3P A;  2F3C I;  2VRW B;  3UGD A;  5FUX A;  1SGE I;  1CGJ I;  1S20 A;  1Y1B A;  2ROW A;  1WTJ A;  3QAH A;  2OVO A;  3FC3 A;  1WKX A;  2WVJ A;  3R5B A;  1Z2I A;  2NU1 I;  4E1R A;  2K9H A;  1TOT A;  3UFF A;  3PDN A;  2ORW A;  1BUS A;  1R79 A;  4WP4 A;  3E2I A;  3TOB A;  1OMT A;  1X4S A;  2L7X A;  1SGN I;  1Z7K B;  2JZM A;  1V1H A;  5J8F A;  3VDP A;  4GI3 C;  2LB7 A;  2OD1 A;  1FAQ A;  3SEK C;  1CSO I;  5FUW A;  5EX3 A;  3R5A A;  1TUS A;  3OXL A;  3R5D A;  2WCY A;  3OXG A;  1LR9 A;  2ORV A;  3VE5 A;  2DIP A;  1TIH A;  2CWG A;  2PQ8 A;  1R0R I;  2NU2 I;  2X52 A;  3OL0 A;  1KMA A;  1AN1 I;  1W4R A;  2SGD I;  1RFH A;  2SGE I;  1TUR A;  4UXH A;  1PPF I;  4B6D A;  1TGS I;  4SGB I;  7WGA A;  2JYY A;  1HJA I;  1X74 A;  1OMU A;  2SGQ I;  2YQP A;  1XA6 A;  1WGT A;  1XBT A;  2GKV A;  2QQ0 A;  1WGC A;  3BJI A;  5DAE A;  5EX0 A;  2QQC A;  5CCL A;  2FNF X;  4JCV E;  3SGQ I;  2GKT I;  3E59 A;  2V1C C;  2V53 A;  2QQE A;  1V1I A;  2JW6 A;  5HQ8 A;  2GKR I;  1SGR I;  3RU0 A;  1MT1 A;  2CWF A;  2KMP A;  1PTQ A;  2LEO A;  1ULK A;  2RC4 A;  2RIJ A;  1SGP I;  5FUY A;  3UEY A;  1CHO I;  5J8C A; 
#chains in the Genus database with same CATH homology
 3SGB I;  1CGI I;  3UGL A;  2QQD A;  5JHW C;  2KMQ A;  1CT4 I;  3B4V C;  4A24 A;  1FAR A;  1NUB A;  1TBR R;  1CE3 A;  2M5X A;  1YU6 C;  1Y1C A;  2A20 A;  3QWP A;  3UGI A;  3VDU A;  2NU4 I;  3UEJ A;  1BMO A;  3CXL A;  4L9M A;  1KBF A;  2KMO A;  1LR7 A;  1HDL A;  2E5R A;  2L8E A;  1VDD A;  2GVI A;  2ERW A;  1CT0 I;  2ENN A;  4UXJ A;  4E1P A;  2DB6 A;  3TJQ A;  4OVO A;  2N17 A;  2JA1 A;  1UVG A;  2UZ3 A;  1SGD I;  1UUC A;  1M8C A;  2ENZ A;  3MEK A;  1SGQ I;  2JXD A;  1TBQ R;  1OVO A;  2SGF I;  4FKD A;  3OVO A;  1TBN A;  1KBE A;  2ARP F;  2XRC A;  4HGU A;  1PTR A;  2N71 A;  2V1C A;  1YTP A;  2B8T A;  3GOX A;  5HI7 A;  1DS2 I;  2N1A B;  1IY5 A;  4UXI A;  1SGY I;  1H0Z A;  1Y8F A;  2N52 A;  2ODD A;  2BUS A;  1PCE A;  1IW4 A;  1LR8 A;  2YUU A;  2NU3 I;  1TBO A;  3QTL D;  2B0U C;  1CT2 I;  2J87 A;  2P6A C;  3HH2 C;  3KY9 A;  2NU0 I;  3D00 A;  2W0T A;  1OYV I;  1W3S A;  2J9R A;  3OXF A;  2KMR A;  1IY6 A;  1XX6 A;  1UVF A;  1N13 A;  2ELI A;  1DS3 I;  1FYB A;  2CJS C;  1PJU A;  2KCX A;  2QPO A;  1HPT A;  5FUV A;  1U5K A;  2E73 A;  2LUY A;  5CCM A;  1M8B A;  2SGP I;  2F3C I;  2VRW B;  3UGD A;  5FUX A;  1SGE I;  1CGJ I;  1Y1B A;  3FC3 A;  2ROW A;  2OVO A;  2WVJ A;  4E1R A;  2NU1 I;  2K9H A;  1TOT A;  3UFF A;  3PDN A;  2ORW A;  1BUS A;  1R79 A;  3E2I A;  1OMT A;  1X4S A;  2L7X A;  1SGN I;  1Z7K B;  2JZM A;  1V1H A;  1FAQ A;  3VDP A;  4GI3 C;  2OD1 A;  3SEK C;  1CSO I;  5FUW A;  5EX3 A;  1TUS A;  3OXL A;  2WCY A;  3OXG A;  1LR9 A;  2ORV A;  3VE5 A;  2DIP A;  1TIH A;  1KMA A;  1R0R I;  2NU2 I;  3OL0 A;  1AN1 I;  1W4R A;  2SGD I;  1RFH A;  2SGE I;  1TUR A;  4UXH A;  1PPF I;  4B6D A;  1TGS I;  4SGB I;  2JYY A;  1HJA I;  1X74 A;  1OMU A;  2SGQ I;  2YQP A;  1XA6 A;  2GKV A;  1XBT A;  2QQ0 A;  5DAE A;  3BJI A;  5EX0 A;  2QQC A;  5CCL A;  2FNF X;  4JCV E;  3SGQ I;  2GKT I;  3E59 A;  2V1C C;  2V53 A;  2QQE A;  1V1I A;  2JW6 A;  5HQ8 A;  2GKR I;  1SGR I;  3RU0 A;  1MT1 A;  2KMP A;  2LEO A;  1PTQ A;  1SGP I;  5FUY A;  3UEY A;  1CHO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...