2E76B

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e76B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76B01
4OGQB 1Q90D 4I7ZB 2O01J 2WPVB 4IL6X 2QJKC 2YIUC 2E75B 1VF5B 2E76B 5L8RJ 2E74B 2QSIA 4PV1B 1S5LX 2K9YA 5KKZC 2QIWA 4KT0J 1ZRTE 2WSFJ 4H0LB 2QJYC 3C8VA 4Y28J 2WSCJ 4RKUJ 3LW5J 2QJPC 4H13B 2WSEJ 2ZT9B 5KLIC 2D2CB 4H44B 1JB0J 2FYNC
chains in the Genus database with same CATH superfamily
3G71V 3TSIA 2KYVA 1IO4A 3B4SA 1LT9B 5APTA 4JI8B 1N32O 3L72D 3GWKC 5LOVB 4OVNF 5C39A 1M1JC 2LJ2A 2YSUB 3H1IJ 3L74D 1MFTA 3K5OA 1SQPE 2CK3G 3TNUA 2FYNB 3TGUD 2WTYA 4DUZB 2EILC 2VQEB 5GTHE 2P4VA 5TISH 1RSOB 1N32B 1AV1A 4B7EA 4PD4E 3T1YO 2RN9A 2UUAB 2E75C 4P9PA 1L0NJ 3CC7P 3M0DC 3ABVC 4WFBV 4UFZA 2K37A 2WLJA 3F7VC 4L8JA 3OT7A 4GZRB 1QL1A 2BEZF 4FLXA 2F4VO 1R3LC 1LTTC 1PPJE 3ASOB 3CCJV 1SESA 1N34O 1NVPD 1FXKC 1NH4A 3H1LD 4X64O 3OUFA 4IOIH 1L4AA 1KYOI 3N7NA 1H8AA 1BSNA 2QJKB 2F4VB 4KFMA 1X59A 1HWYA 1IFIA 4UUJC 1G8MA 2EIJB 1YF2A 3OTOO 4CC6A 2QM4A 2A45I 4YY3O 2Q67A 3OW2U 4H0LD 1FJGO 2Q69A 1OVVA 2R3CA 4H0LC 1BCCJ 4NPDA 3AEAC 1RSOA 1JJOA 2M6YA 1R5LA 2H88C 1Q81Q 2QSIA 2UXBO 3VQYA 1GW4A 3CCLP 2IJHA 1EN6A 4DR5O 2Q3IA 3SSUA 1JY3O 2YKPA 1HJ0A 5IY5B 5LMNO 1P84I 3H1JG 5E79Z 2CGNA 1QR9A 2UUCO 4N78D 1CPYA 2CTPA 4MW3A 3Q4HA 1KILD 1QL2A 2CUGA 5E79H 1EDJA 1KILC 3JASB 1LTJC 2WPVB 4G27B 1YTFB 3LSSA 1N8RW 4FLVA 4OWFA 5GONB 5CA0B 3L4FA 1SA0A 4EFEA 2QA4V 1S5HC 1SS1A 4K0KB 1VQNP 4GT1A 4J11A 1OCOC 2C0WA 3Q1MA 1H2GA 3EXAA 4ZI7A 2QJPC 2XKMA 2ZVOB 1SQXD 2E5YA 2IM9A 4IIJA 2KI7B 2W8ZA 5H5NA 2XTAA 2YDEA 5KHIA 2X6AA 1FD9A 1EN5A 2CTRA 2ZFCA 5H6RA 3MP7B 1G6UA 1FZCA 3H1HJ 1K73Q 5EK0A 5KAIE 4I7ZB 1KYOD 5B1AC 5IYZB 3RK3D 4CH5A 5APQA 4X62B 4LF6B 4MVQA 3RK3C 3A0BE 5L8RJ 4JPRA 3CE2A 1SQVG 4WVZA 1LJ2A 3MIWA 5LXTB 2AEFA 5EC2C 3B5NA 2PTMA 3ZBHA 1SFCB 2YIDA 5L3FA 4DR3O 3QVNA 3A5TA 3HUSA 1OWAA 2P1JA 2J59M 4D7TA 3HE5B 4JI5O 4FFKA 1NJIQ 1JOCA 1BGYD 2BE3A 2O01N 2FFDB 1Q6HA 3L70E 3CL3D 4BWNA 2O1KA 1NTZH 3V2RA 4HH2A 1NTKJ 3HTKB 4J10A 4LP8A 1H2NA 1CZQA 1KYOF 4JI5B 3B8MA 5KA5A 4CBCA 3H1KJ 2W6BA 1SQVH 1WA8A 1GTOA 3SPCA 4TV9B 2KSJA 1GTWA 5AW3B 4DRXA 4LGDE 1LWUA 5B3SB 1HR0B 4L75A 2OCCB 1BHAA 1M7LA 1SZTA 1N7SB 4U3FD 4WFGA 1IC2A 2IYPA 2WSCJ 2YMKA 1I7FA 3Q3DA 1MG1A 2NPSB 1XMOB 1JMKC 4I1LA 4W7ZA 4QPJA 1OW8A 1P7BA 1GRJA 2R9AA 1XREA 2VWJA 2GTSA 1OCZB 4QNHB 2QJ1A 1KORA 2R70A 4IFDK 4TUYB 1PP9D 2DQ3A 3BABA 3E2EA 2QTSA 3NR7A 4RO2A 3SWKA 2OTLV 3LUTB 1FYJA 2B1IA 2GUZB 2NLJC 3AE2C 4C7NB 4ZMDA 1FXVA 3IN6A 3CJHA 3UCSC 5AW5B 1P84F 3VTPC 3AE1C 1Y74A 3FAVB 3FXDA 5CCGC 3ABTA 1WPXA 2K9PA 1VQ7V 3C8VA 2YUAA 2LXBA 1P4RA 3G6EV 1PPJG 1PNKA 1NTZK 1GN6A 3RYHA 1QQCA 3BEHA 4K8ZA 4DJGA 3C90A 5GTHZ 1SQPH 1J5EO 2AHYA 4TV9A 1VF6C 1HH0A 5GTHH 4DOJA 1SQVK 1VQMP 2GHYA 1H2KA 3G80A 2BCCD 3F5WC 4DR7O 4PD4H 2WMMA 3LDEA 1PV0A 1JY3P 4EB6B 1U7JA 3QO8A 3K79A 2C0XA 3K59A 3AE8C 4B3TB 2Q7CA 1E1QG 4GKJB 2VWKA 1YEWA 5KHJA 1OCCC 3LIDA 4JF7A 5LYJA 1JO5A 3RW0A 4DV3O 1PPJH 4Z2WA 4B3MO 4RQEA 2P7JA 1FS0G 4ZKPA 3CMEP 3HD7D 4LFBB 4TV8A 4DUYO 1L0LJ 3LIEA 1KQSU 1MZFA 3OMAB 4OH8B 3FAVA 3N2KB 3A3YB 2NN4A 4FLYA 4DV3B 4D6TD 3RGUA 3CCRV 3D70A 3L73J 3SWYA 2IJKA 1ZR2A 5KLVH 4JBZA 4UCRA 1KUQA 5AVWB 4B3RB 1CP9A 2YIUB 3MAQA 1SQPK 3UKMA 3B77A 2F23A 1URQA 3JSVC 1VMGA 1QVGU 1P84E 4JASA 3HRNA 4LR3A 1MSWD 1IBMO 1NTME 1OMIA 3SPHA 1N0JA 3OGIB 3L75D 3ETDA 2RDCA 1ZP0C 1V55C 4JAVA 5AVRB 2EIMC 3E35A 4W7YA 2BTQA 4O2BB 4UCSA 1Q43A 3BCCD 3GG2A 2SPZA 2DW3A 4M3LA 1YSCA 3CCJP 1M1JB 1EC5A 2QVAA 3N2GA 2ZIMA 2ARHA 4FZ1A 2XNXA 2HPCA 3MZWB 1TA8A 1YQ4C 5CCHA 1AFOA 2EILB 2WLLA 4CC5A 5JJJB 3HE4A 5BVZA 2QR4A 3T2MA 1XMQO 1SLQA 2KZIA 1Q6UA 2E75B 2HJFC 4OX9O 1LTIC 3PP5A 2X7RB 3JD0A 5KLVK 3E89A 3L70G 1S5LX 1N33O 3APOA 5LHIA 1M56C 5KAIZ 1X0TA 5BMVA 1H2SB 3L74H 5FPRA 5KAIH 3A0BZ 4ASUG 2XOKG 1YITV 3THOA 4RJTA 4ASWA 2WLIB 5F2VO 3C3TA 3HKDB 1ZRTD 3BATA 3CRQA 1LNQA 1JM0A 4HKZH 1K33A 5CN0A 1NVPB 3S1KA 4DV6O 4MTOA 3ZHSA 1LTSC 2F43G 5LHHA 2ZNJA 2WQYC 2FKWB 2IH3C 4LFAO 1NKNA 1L4AD 3ZRXA 3IF4A 3UT5A 1ZLZA 2G8YA 1JFFB 3E22A 1L4AC 4AUWA 4DK1A 2KLVA 3O6QB 3R4YA 2D3OW 1FKAO 2N9BA 1BE3G 3LDCA 4TOIA 3RBXA 2PGDA 3EHBB 2WSEJ 4QE7A 2RNBA 1J2JB 1LTAC 1VPCA 1DD4A 3ML0A 3K04A 3UM7A 1N8RQ 4I5SA 3L71G 2K9JA 1ROPA 1KKDA 2KS1B 2LW1A 4PDRA 3CRCA 1H0TA 5B1OA 1B6QA 4FFBA 1THZA 1ZR4A 1N0NA 3VOPA 2JJ2G 1TUBA 5KJ7A 1UFIA 3K5NA 5LA6A 3OAKA 4JI3O 3GF7A 1CXZB 4HB1A 1FXKA 1KILB 1DIPA 1LTJB 1IK7A 1PGJA 5D5PA 1JOYA 1BDCA 1T3JA 2C9NY 5CBHA 2XHBA 5CA1B 1FDIA 2JKVA 5BZBA 4EIJA 1Y76A 1SS3A 5LHGA 1IBLB 4JI2B 3TK1A 5APVA 1ZUQA 2KNCB 3BRVB 2Y69C 2W6AA 1OCOB 3CMAV 3QF7A 1KFNA 1UPGA 2WA3A 4JV5O 4IL6E 2QWNB 5KLIB 4X8AA 5L3BA 2RQ6A 3CPWO 2HG5D 4I6MC 5LP6A 3EQ2A 1BL8A 5B1AB 5JQGA 1Q2NA 5JH7B 1ZSPA 2HG5C 4MTXA 4JV5B 2PUSA 1Y4MA 3RK3B 5KLVJ 2LR2A 1Y6XA 1AR5A 3Q5PA 1XQ8A 4GUNA 3CCSV 2N9YB 3G3ZA 1HVVA 1OIPA 1PGOA 1RPRA 5H6QA 1FZCC 4EYYQ 2ZNIA 1PV3A 1EQ7A 3CC4P 3VQWA 2WLKA 2EIKC 1GN4A 2V7QG 2GDSA 4P9OA 3B5NC 1RF1A 4H33A 3V4QA 2X6CA 5CB4A 3HUSC 3KHUA 2HEPA 1JY3N 4J9YB 1NTMG 2A45H 2OTLP 4O9BA 1SQQG 5JJEB 2Y0DA 1GM9A 2AGAA 2DN9A 2YI9A 3H1JD 3T97A 1TVKA 1OZ0A 4TT3G 4K35A 2XAJA 1AJNA 3KCYA 1VQ7P 3PHLA 3G6EP 1YTZI 2JK5C 1JA8A 3DSQA 5FLXN 3BY6A 3OUSA 5GW7A 5ITZB 5IT9N 1KECA 3ZMVA 3VBBA 1LP1A 1B04A 1LWUC 4JYCA 1NQTA 1KB9E 1P84H 2H43A 3L72J 2F95B 5AW1B 1I94O 1NTMH 1N86A 3ABLC 2E74D 4JPZB 2ADPA 1S72V 4X66O 1J1EC 4U3FH 3L74J 4C7UA 2E74C 1WP8A 3TGUJ 1NTZD 2O01H 4JZ2A 3GMAA 3H1IG 4UB8E 5LMUO 2HODA 2LFRA 1MMMA 1M4UA 1EFRG 1F51A 3PJSK 4KXRA 1PFIA 2WAMA 4UXNA 1SQVD 3ZRWB 2WT7A 2YEVA 4LNUA 2R9RB 2K9YA 1D5AA 2A79B 2CTWA 3LSQA 4HAMA 4X1KB 1W0KG 1OCRC 1YVWA 2Q7HA 2Q7GA 2PGGA 4I55B 4JZGA 5IJ0B 5BR8B 2Y48A 1DK1A 1PIXA 2OARA 4PA3A 3CCRP 1RE4A 1FZGA 3H01A 1Z5WA 3H1LJ 5APUA 2GUSA 1GL2A 1EXJA 1GK4A 1BT8A 1DGSA 1K8AW 1OCCB 3RFRA 5KTBA 4DR2B 5KHGA 2YC0A 3PRJA 4MVMA 3PN1A 4DT0A 1PL0A 2P10A 2BCCH 5JWPA 2PI4A 1NTMK 3I5DA 5B1BB 2A9HA 4X9QA 4F6RA 2AZ0A 1YQ3C 1ZAUA 4GDOA 4X1IB 2E76D 2B87B 5FPOA 2E76C 3APQA 2ITAA 1EZJA 1SQPD 3KQGA 2LW7A 1NZ6A 2XAGA 1ORQC 2ZYAA 3U1CA 3KKYA 2OT5A 2PI5A 4I55A 2OWOA 3IFXA 1VF6A 3DC6A 1IBKB 1GN3A 1LTGC 1R6NA 2MW2B 5EBLC 3DGEA 3JD3A 1IURA 2R5BA 1RH5B 1XOUA 5AVVB 3RYCA 3U0ZA 1WLEA 4R4MA 4ZOLA 5H2FE 1K92A 4C46A 1PPJD 4U7OA 1NH2B 1IFDA 3IFMA 2JR8A 5AVZB 1NKZB 5EYPB 4LBEC 3ZMUA 1HP8A 5KMGB 1XNRB 1V55B 1XHXA 1FXHA 2ZE8A 1FAFA 2EJRA 1YITP 3S9OA 3SYOA 1NAYA 1X8YA 4I50A 4BIOA 4DXWA 4I4TB 4JI0O 4AHCA 2Z0AA 1SQXJ 1YJWV 3HD7A 2Z3YA 3FXEA 4QJFB 3IGAC 2P4KA 2M5AB 2Q6QA 1DEBA 2A3QA 1Y9BA 3I56V 3L75H 1F4NA 4JYBA 1RFYA 4DV1B 2IBZE 1QBZA 4U3JA 4IL6Z 1PNMA 1CSBA 2PYLA 1QX8A 3H1HG 1FFXA 2WPSA 3E83A 5CCHD 4UVCA 3VP8A 4IL6H 3AG4C 1VQ5V 5CCHC 1DF4A 3TNUB 2M7WA 1M56B 4DR4O 3FKSG 1FDOA 2MK3A 1HF9A 1EDLA 3TYYA 1HNZB 3RVZA 3P3PA 2CE4A 1RPOA 3E8BA 3EVKA 5EZYA 1BGYJ 1WMKA 1IK9A 2CPSA 3WMM0 3EWKA 4MVOA 1BS3A 1FZFA 4DR4B 3SFDC 4YXDC 3DC5A 5L3GA 2A0LA 4P30A 4IHJA 1MA1A 4TWKA 1FE6A 4TSFG 4JI8O 1R73A 1WT6A 4FM1A 4IYIA 2ADQB 3O65A 4DZOA 3JAWA 3ABMC 4LWSA 3H1KG 1KP2A 2I1KA 1L4AB 3QWOC 4U3FJ 1Q3EA 3R65A 2ZR3A 4MTFA 5KUMA 3JC22 2VQEO 1COWG 1LT1A 4JGSA 3R66A 2UUAO 1S0VA 1AVYA 2QWQB 1PP9J 1Z5VA 3S3XA 1U96A 4PDLA 5J2TB 2IW5A 1KQLA 4FIPC 4DK0A 1Q7YW 1R3IC 2YXHA 2ETNA 3JD1A 3HKCA 1KB9H 3BRTB 1X79B 2UXDB 3IC7A 2ZCEA 4X65B 5KA6A 5KJ7D 1N36B 3P32A 3VMZA 2I8DA 1H8HG 3L70D 1RM1C 5KJ7C 3CEIA 3Q4HB 3CCUV 2AW9A 3FWNA 4GX2A 2XV5A 4G2KA 1VQOV 2CK3H 2BCCJ 3ICXA 1TU3F 3AG3C 5IJ9A 5JVDA 2M0BA 1GK6A 2RH0A 4JQ0D 1GM8A 1K4DC 4O4LA 1BHBA 1SA0B 4AYCA 4RUFA 2N74A 1URFA 2ZXWC 3H25A 3CPWU 3SYAA 4NPEA 4ZI7B 5APSA 4MVUA 3II6A 2O57A 4IIJB 2JS3A 5J2TA 5LGUA 5AVYB 2FBWC 1NU1E 4BR6A 2R3SA 4KT0J 3ZHTA 4KL1A 1FS0E 1FZCB 3CP1A 2V4HA 2IJJA 5LP6C 3VMAA 1YJ9V 4NXNB 4N23A 1SC5B 4GCZA 1T5EA 2WLHA 4D6TJ 2EIKB 4MVSA 2KB7P 3TF5A 4BW5A 1L2PA 2A06G 2E43A 5KAFE 3K9SA 3B5NB 2CTQA 1SKVA 1J95A 1J1DC 2Y0EA 2IU0A 3UIAA 4DV2B 1SERA 4CS3A 1IX9A 3WU2E 2EZPA 3HUSB 3EFGA 4GOEA 1S72P 1FJKA 1RHZB 4K0KO 1NBMG 3BVHA 2QSAA 3ETEA 5IYBO 1RF1C 3M06A 4NXMO 2XUMA 3FYEB 2YO2A 3LW5H 2E42A 4BIZA 1O9GA 3DTUB 5KX5A 1ZWIC 2O3JA 2QEXV 3U10A 1PKXA 3L75J 2L5GB 3JCUE 3S4RA 3ZHUA 3OE7G 1WA8B 2WPRA 4NXMB 2E5LB 4X62O 4LF6O 3S3WA 4DRXB 1LWUB 2XZRA 5H2FZ 1B3QA 3H1JH 2HHHO 3BCCJ 1CW5A 4XBFA 2IBZG 1IFJA 2QG4A 5H2FH 1KU9A 3GB7C 3ABLB 2OYHA 4B08A 1J1EB 4HZ3A 4DYLA 4XE5B 3JCZA 1JUNA 1WN7A 1HNWB 2AHZA 1K7DA 1PGPA 3VQXA 1NOHA 2HHHB 2AEMA 4OGQD 2OYOA 2ZKOA 3CCEV 3AEBC 1H2LA 3Q5SA 4OGQC 4RWUA 1BMFG 4LF5B 2FXMA 1YI2P 5IDJA 3CJHB 1K8AQ 1TAEA 5KHHA 1NR7A 2FYZA 1Y74B 1OCRB 4RESB 4DR6B 1QHTA 2QWOB 2N1TA 1HW7A 3K5LA 1HR0O 3NMDA 3QH9A 4NPFX 5CMUA 3RYHB 2EZOA 2KSDA 4YJ2A 1XMOO 1P84D 2X6BA 3OMNB 1KKCA 3ZRVA 4EEQA 1NTMD 3SYCA 2K88A 4LF7B 1PNLA 4YPCA 2UXCO 1RE4C 4IFFA 5L3EA 3OJAB 4GX0A 4KHPB 2HFED 1GL2D 2HFEC 5C8YB 4OPHA 4UVAA 1JEKA 1GL2C 1JX9A 4O4JA 4FLZA 4NTYA 1FZBA 2P2UA 2QTOA 4TQFA 3CI9A 2UXCB 5LBQA 3F89A 4L73A 5LYJB 4KP4A 2PYJA 3ZDMA 1HWTC 2E76B 2HLOA 3MGNA 1BE3E 5AVUB 4TV8B 3M99B 1Q82Q 4U7NA 3AK2A 2ZXEB 1M9NA 1YJWP 3D3QA 1QLED 3L71E 3TXQA 4WFEA 5JCOA 1QLEC 3CCQV 1Y66A 3KDPB 4U7JA 4GKKB 3P8CE 3CXHE 4AQYO 2PZSA 3MUDC 3JAKA 1TGOA 3I55V 4B3TO 3IAYA 4GKJO 1VQ5P 1K9MW 2Q4PA 1URQB 3OR6C 1QR8A 2Z5UA 1AI5A 3T1HO 2R32A 4WB4A 1WP7A 3AEIA 1S5LE 4AQYB 2JWDA 1KBHA 2N05A 5C8YA 2FB5A 4LFBO 2LGQA 1K5SA 2HLDG 1IJDB 1WAZA 1W0JG 4UB6E 3RT3C 1DX7A 1HJBA 2ZDIA 3USSA 1BSMA 3T1HB 1NU1G 1IXBA 4IGGA 3H9VA 3RVYA 4YJ3A 5K5GB 2N04A 3SWFA 2BTQB 2DWEC 1Q8IA 3HD7C 1SRYA 5CMZA 2CAZC 1XDCA 3N2GB 3G9RA 4B3RO 5DJUB 2HPCB 4EFBA 2O1JA 2FYUE 3V2PA 3CWBE 2WLLB 3HE4B 4FM0A 3G71P 1AJPA 2P06A 4L87A 5AG2A 1H89A 2JWAA 2NZ2A 2Y4UA 4GKGA 3B40A 2P6JA 2DYSC 3AE4C 3RL0D 1XILA 3FD9A 1NU1H 3OM3B 4DV4B 3KXDA 3RL0C 4CPGA 1I5YA 5BMVB 4TQDA 1KD1W 1W2EA 1F4MA 1SZXA 2OQQA 2OIEA 2W6JG 5KAFZ 3AG7A 1D7MA 5L3DA 3VQVA 1KZUB 3TJTA 2IFNA 3H1JJ 4H13D 4HYTB 1O9HA 1SQBG 5KAFH 4I0XA 2OTJV 1SQQE 4H13C 2Q3EA 3WU2Z 3ABMB 1KB9I 1VQ8V 4FK5C 4Y99B 1Q7YQ 1K05A 3WU2H 2WSSG 1Q86W 4AQRD 2C2AA 4MTGA 1JPXA 1JTHA 1GAXA 4FLUA 2OGUA 3OA7A 3AE7C 2E3CA 3UT5B 1VQOP 3E22B 3RYIA 1JB0J 3A0RA 2JEEA 2HR3A 3W7UA 4ZKIA 3JCUZ 1EDKA 3K3WA 3AEFC 3L72G 2IFMA 1NS1A 5M1BA 2A7WA 1NTZJ 4ABMA 3FB5C 3NXSA 4CZZA 3GW6A 5KKZC 1JJ2U 3TGUG 4BWAA 1YIJV 3K5BA 3BA9A 3KG2A 2K9JB 4YHHB 4DR1O 3H1IE 2IJIA 4DV7B 4F4LA 1IFPA 3FWLA 1QVFO 1H0TB 2WSSH 1SQVJ 4FFBB 1PD3A 1JCCA 2L6LA 2JDIG 5J2UA 2B9BA 2ZYGA 5CJ4A 1TUBB 4R7CA 1RM1B 3A0BH 1HTLC 5LA6B 1BSHA 1YJ9P 3IR9A 4OPAA 3VOUA 1Z56A 4DR1B 3VN0A 2Q6AA 1FXKB 3AG3B 4FVMA 1EBOA 5AW8B 5DM6V 3A2AA 2K1EA 1R3JC 4JI7O 3K0DA 3M9HA 2H3OA 1Y76B 3SGIA 3MTUE 2NRGA 1I08A 1XTCC 1E79G 3H1LG 4B86A 3L70H 4I9WA 3STZC 3WB0A 4H0LB 2FKXA 2OYIA 4JI7B 1YHQV 2LO1A 3U11A 1GU4A 1S76D 2JGDA 4PV1D 3CRMA 4MT8A 4UCTA 4PV1C 4PDVA 2QA4P 2Z5IA 1KB9D 1HNXO 4JYAB 5LP6B 3CX5I 4NR1A 4QMAA 5JQGB 4BRYA 2QEXP 4ZHQA 4RQFA 1LTBC 3T4ZA 3WFVA 2EJ7A 5DECA 3RYFA 1SQPJ 3K5MA 5AW7B 2D2CD 1BCCE 1J1DB 1ZX3A 3JSNA 2KZJA 2D2CC 1HNXB 4WY4A 2RMZA 1JCHA 2CGOA 3QO5A 3CC2V 1IBLO 4JI2O 3HPLC 4WBNA 4PJ0E 4CS4A 4EKWA 1K04A 3NTNA 2BSKA 2PF4E 1AR4A 1K97A 2UXXA 2PP6A 4O2AA 2FTKA 1SQGA 3CB2A 1RF1B 1BE3H 1RF0A 3CCEP 4LF8O 5CB4B 1MNGA 4LCUC 1Y8AA 1KB9F 4TLFA 3FFQA 1GK9A 3L71H 2W6IG 2WSFH 1IDSA 2QJPB 3T97B 1TVKB 4J7KA 3OAAG 4PA7A 1N4CA 4LF8B 2L35A 2WLNA 1VQ6V 4W80A 3CXHH 2IBZI 4JTDB 4Z1MG 4UV8A 2EINC 1XNQB 3HR0A 1SQXG 1EDIA 2FYUG 5AVTB 1FBMA 3CWBG 1LP1B 1S5LZ 3OFNG 1Q6IA 1AI4A 1M93A 2BTOA 1S5LH 4UB6Z 4X1YA 1OHHG 4OGQB 1FJPA 2OYHC 1P7GA 4UB6H 1A02J 2JGUA 4QIWF 4FM2A 4PA9A 3H1HE 4Z1VA 3OW2O 2Z4EA 3CXCU 3CC7V 1YYCA 2HODB 2QIWA 2YXLA 3JARA 4FJCC 4Q20A 2ZR2A 3BA8A 4Z1MH 3AG2C 3J7AU 2H8PD 2JS5A 3JALA 1JCDA 2A06D 2WT7B 1SQFA 2QWPB 1T6AA 2H8PC 2YEVB 4LNUB 4LFCO 2UU9B 4JI4O 2FYUH 3LDDA 3CWBH 1DF5A 4B7KA 1GKFA 5A9GA 1CI6A 2N1TD 4JTCB 2N1TC 1NWQA 1QEXA 3CCQP 1AP5A 2LP7A 1BQ0A 4PI2A 2PAJA 5HFLA 4LFCB 4JI4B 1XI1A 2YS8A 4OXSA 2PY5A 4IFMA 2CH7A 1QGKB 2OIGA 2V7QH 1NTKE 3RN4A 2ILMA 1IZNB 3ZHVA 1GL2B 3ZRSA 3I55P 5B5EE 1N7LA 1R1BA 2OCHA 3H1KE 1YTFD 3P3NA 3CX5F 1GO3F 3W68A 4JI6B 4NVPA 3IJ4A 1SQQH 4NYKA 1QCEA 2QKAA 2KXPB 1K9MQ 1AVMA 1JR9A 4AI8A 1S5JA 2GSMB 2IBZD 3E86A 4F6RB 5TISE 3K58A 2QRXA 4TT3H 1PP9G 1YJNV 5BR8O 4LH7A 1HDJA 1QLEB 3D6YA 3E8FA 4MN4C 3ZHQA 1YXBA 2XNDG 4H44D 3LNNA 2IZ1A 2M3BA 1L0NG 4H44C 1AI7A 1OVUA 1ZMEC 2FYUK 5JCOC 2FXPA 4O4HA 3L70J 4DR2O 3TXSA 2P7TC 3N27A 1WB7A 4R4LA 1P49A 3SR2C 4GYCB 3RYCB 5AW9B 4ZOLB 3H1IH 1GD2E 1MABG 1XL4A 3OR7C 1QLNA 1OV9A 1N73A 1VQNV 4ZNCA 2UXNA 1HGVA 1FAVA 4GODA 3V2QA 3M9BA 1H38A 2IPPA 2XNDH 2KB1A 2QE7G 4XDLA 5CJ0A 4I50B 4JAAA 1PZQA 2Q5UA 3HD7B 1ZW0A 4X20B 1SQQK 1LUWA 5EIBD 3VMYA 2ZDIC 2OTJP 1KD1Q 1G1IA 2RKLA 3ZX6A 3BASA 1VQ8P 1BCCG 4W4LA 1OW7A 3HKEA 1IXMA 4WF9V 1IBKO 4WBAA 4XA4A 3SFEC 2AXCA 2KOGA 2L91A 2Q1KA 4X89A 1N7SD 1KFMA 4U3JB 1WB8A 5B66E 3AE9C 2DMXA 1UJWB 3M8AA 1FFXB 2NPSD 3T1CA 3CX5E 2PFXA 3MUDA 2DYSB 1L0LE 1NYHA 2NPSC 2ZT9D 3TETA 1Q86Q 3MHVA 3PLNA 3O8ZA 1AILA 5FNVA 2A06E 2ZT9C 3RL0B 4A5UB 1XNRO 1OCZC 3K57A 1R5SA 1W2BO 2BOBC 5APYA 1AVOA 1AJQA 3L73E 5EZYB 2CPBA 2Q8VA 4HYOA 1HGZA 4J80A 1YTZT 1FDMA 1Q82W 4H13B 4Q6GA 1BCCH 1Q5OA 3AK1A 2J58A 3MHHC 2JRIA 1S9KE 1JY2N 4K3AA 4PJ0Z 1QNMA 2EIMB 3OEHG 1JMBA 4IHJB 1G2CA 4PJ0H 4DV1O 4RAIA 3B8EB 1HBWA 2Y0IA 2EULA 2DYRC 4UVBA 4X20A 3JAWB 4LWSB 2DW4A 4GX5A 2GM4A 2V4DA 3E7KA 1ZOYC 3IC9A 3AEEC 1OXZA 1MZEA 5EFWB 3BCCG 1US6A 3M0AA 2Y0PA 1VF5D 3KZIE 1YCIA 1NU1D 1VF5C 1HNZO 1S4XA 2MKVA 5KKZB 4A7PA 2QGNA 3D8CA 2W0XA 1YHQP 4PA4A 3RBZA 5BXZA 1FU1A 3C3SA 1JVMA 5CBOA 3JATA 3D36A 4UCVA 3HKBA 5LGNA 5J9PC 1S1CX 2ZJSE 1FOSE 3HKCB 3JYCA 1KQSO 3GHGA 2Q7EA 4UCUA 4J7JA 4KJMA 1JNMA 4DW0A 2V7QJ 3FB8C 2QJYC 3STLC 3WB1A 2YXRB 1LUVA 2KKWA 3ZHRA 4J41A 4NB5A 3H1HH 1NTKG 1NTMJ 5IWAB 4MVZA 1K34A 3B8NA 2P5OA 3OMIB 3H32A 3G67A 5JVDB 5IJ9B 1B06A 2O01J 1YBKA 4O4LB 1SQBD 3ASNC 4R8CA 1QVGO 4PV1B 3PH0A 3RL0g 4IT5A 5DN6G 1YDXA 2ZM6O 5K1PA 2R72A 2HVKC 3LNMB 3CMAP 1EZVE 2OYIC 4DV5O 4EDFA 2UXDO 1WRGA 4X65O 1VQ6P 4CH4A 2B88A 1M5IA 5B5EZ 4O4IA 3CXHI 1G4YB 2BOCC 1NTKH 1N36O 1FZEA 2BEQD 2WZ7A 2YO3A 3CRRA 2ZM6B 3C1LA 1ZL8A 1MV8A 5B5EH 1NHLA 2DE0X 4LF4B 4W4KA 3H1KH 5AW6B 3X2QC 4DV5B 4XDJA 2QDOA 3EFFK 2KG7A 3D6ZA 3SDLA 4WY4D 2XASA 3B09A 4HJGH 3CCSP 3JD4A 4DV0O 4UB8Z 4WY4C 5TISZ 2WSCH 5TJHA 3QO7A 2LGWA 5AVQB 3C9IA 4UB8H 2XT9A 5AW0B 2Y69B 4MSWC 2E75D 1M1KW 1I5XA 2DJVA 2CDYA 2POHA 4HNAA 3W7TA 2XU6A 2XAQA 2G38A 4DV0B 2P90A 1RF0C 3FB7C 1MOFA 2ZE7A 1XUQA 5KX5B 2XAHA 2EINB 1VF7A 4E4EA 4NTWA 4PI0A 3P30A 3T1YB 4NXNO 1K5QA 2VRZA 3ZMZA 3CCVV 2Q5ZA 3SPGA 2KK7A 4GLXA 1U7MA 3V5BA 1GMJA 1NR1A 4NKGB 3DXRA 4DV2O 1KTMA 2OYHB 2OTKE 1L0LG 1NTKK 1LT9A 1BE3D 2R44A 5LOVA 2ODMA 1N34B 2JVDA 2EX3A 2ZQMA 4J7ZA 4JYYA 2Q0AA 4X64B 5KLVE 3L73G 1F23A 3L71D 2VRSA 3AG2B 2YXQB 1MUUA 2ZE5A 3OTOB 4YY3B 1LGHB 3P8CD 3CXHD 2R9IA 1FJGB 2WA4A 5B66Z 2E5LO 1YJNP 2N1TB 2ZXXA 3JSLA 4J9ZB 4CH6A 5B66H 1VARA 1KN7A 3ABKC 3CX5H 1GH6A 1L0LH 4YJ2B 4PDMA 2UXBB 1FC2C 2A06H 1SQBE 4LC1A 3AE6C 1HNWO 2VQFO 3I5CA 4DR5B 1PGQA 2B9ZA 3U1AA 3L73H 5LGTA 5LMNB 1PL5A 1AP6A 2GTAA 4LF5O 1NI8A 2E74B 2UUCB 5B1NA 2JEUA 4O4JB 4I2LC 2VQFB 4RUEA 1EXIA 3CXHF 3MDSA 2KSEA 2QM8A 4DR6O 4GOFA 3V2NA 2ZYDA 2RN0A 2KIKA 3D3IA 2FYUD 3CWBD 3L72E 5APWA 1VQPV 1NTZG 5KLIC 4PELA 2F1MA 4EI2A 1KC8W 4H44B 5EBWC 3FGAD 3L74E 3TGUE 1E1RG 3KZIZ 3LSUA 2IBZH 3R2PA 1H2MA 1WJZA 4LF7O 2UWJE 3KZIH 5CBGA 3A8TA 4KHPO 1OX3A 3KPEA 1GW3A 3G4SV 1GDTA 3MHSC 3SPJA 5IYDO 1DD3A 3JAKB 1L0LK 3GLMA 2X0LA 1ZLLA 3AK3A 3A0HE 3SJBC 1V54C 3J81N 1DEEG 2C9LY 4BW9A 1SQQD 3JASA 4MVRA 2NNUA 3WUVA 4GX1A 5CA0A 5FL7G 5GONA 4DR3B 1IVSA 1EZVG 4ASVA 3G6BA 3H1LE 1N73C 1SETA 2Q68A 2HP8A 1H8EG 4YJ3B 3SJCC 2ZD9A 1ZXGA 3SJQC 1USDA 1RY3A 3WUUA 1G1XB 4GKKO 3CCMV 1VQLV 3CC4V 1XL6A 5IYZA 2IYOA 4LH6A 2RCVA 2ZT9B 1SQPG 1Y67A 1W5CE 2Q0OC 3I56P 3H1ID 1X22A 1L1FA 5LXTA 1ZN5A 1AQ5A 1EZVH 1SFCA 1JY2O 1W2BU 4NTXA 3K08A 3L36A 1IFMA 2W0FC 1I0HA 5JJNB 5CCGD 3HE5A 1L0ND 2JJ1G 2FFDA 4LF9O 3WG7C 2WSEH 3UO3A 3JAMN 4N78E 2DWDC 1AROP 1KILE 2W83C 4I0XB 2DYRB 3HTKA 2H7HA 4FZ0A 2QKCA 4CH3A 1JQ0A 1S3JA 2B5UA 3ITKA 1VIBA 2K1AA 5AVSB 4LF9B 1OVRA 4IYHA 3NFQA 1JTHB 4RO0A 4E2LA 5CBFA 1N7SA 1U97A 3L9DA 3K9AA 4MS2A 1VF5B 2YI8A 2IU3A 3AG4B 3RYIB 1J5EB 4QE9A 1SQXE 2I1JA 2DQ0A 2AEJA 2NPSA 3VP9A 5KLVG 4DV4O 3AEGC 2AZ2A 3M91A 2ITCC 1VQ9V 1IZ3A 1CEZA 4UCOA 3GF3A 1VQ4V 1KV4A 4DR7B 4TUYA 2WPQA 4QGPA 3LW5J 1KYOE 1BCCD 1JMMA 3RK3E 2GUZA 4C7NA 5E1AC 4YXWG 2K3RA 5GTIE 1GMGA 5BY1A 5B1BC 2YIBA 1RQUA 2QJYB 2ZIOA 1BDDA 3E1IA 5J2UB 3ZS8C 4MW8A 3D36C 4B3MB 1XEQA 1LR1A 3VMXA 1ENVA 3ZMTA 1NAFA 2HYNA 3V4WA 4DUYB 5BU8B 1M90Q 5KUKA 3GHGC 1BGYE 1K3EA 2WVRA 1UIXA 1HUCA 1VDFA 1RE3A 1R8EA 5DJTB 3ASNB 3FX0A 3CCUP 1OFCX 3HB3B 3GWOA 2HVJC 4EB6A 4YXWH 3Q2YA 2FY8A 2Y4TA 3K06A 1E5WA 1NH2D 1XBLA 4CS2A 2OYIB 4YHHO 2JEXA 4DV7O 3W7XA 2JGDB 4U3FE 2ATKC 4DO2A 4BXLA 2W6JH 3JCUH 1M1KQ 1R6KA 1SQBH 4BRYB 3ETQA 4R50A 3L74G 4ZHQB 1IBMB 4L76A 3X2QB 3M9QA 1BQZA 3RYFB 4X88A 3CCVP 3H1HD 1NU1K 1PP9E 3N2KA 1WNSA 1DLBA 4JI1O 4WY4B 2JP3A 2G3AA 5EBMC 4WBNB 1D5NA 2AXTE 4KHXA 1L0NE 3U59A 4EOTA 2Y9ZA 1M57D 2BSKB 3CD6V 3QNEA 4O2AB 1M57C 3ZEDA 5APXA 5CBNA 1R3KC 1M56D 3L72H 4JI1B 3FB6C 2ZXWB 2P58A 4ZBMA 4YIOA 1T3UA 2ITDC 1KQFB 4H37A 3TGUH 1EN4A 1XMQB 4JYAO 4LLHA 4Y28J 1IFNA 4OX9B 4BAYA 1NTKD 1JY2P 1N33B 2UUBO 2BCCE 3BHPA 2R5DA 1GM7A 3RK2D 1K4CC 2JDIH 3BAAA 3RK2C 3H1KD 3A0HZ 4HBNA 1VP7A 3A0HH 4O2BA 2WLMA 3CSXA 1SQBK 2YICA 1MKMA 4L74A 2UUBB 4WFFA 2LQTA 2IH1C 1M1JA 2QM7A 3AG1C 3SJAC 4X1YB 3BVOA 4DV6B 1T8ZA 1RQVA 3KCXA 3H1LH 3ZN1A 1E79H 3ZCCA 1LT9C 5C93A 2YXYA 2KQXA 4RKUJ 1Y47A 1VQKV 4LFAB 4XFJA 4D6TE 3N4XA 4ICGA 3JARB 3M0DA 2FYNC 4WWIA 3JALB 5AVXB 3E8GA 3ABKB 1XNQO 1U57A 3F5HA 1VQPP 3A7OA 4XDKA 1CI6B 2FXOA 2ZAEB 3ZMSA 1AJYA 2JIZG 1OJHA 2WLIA 2HJDA 3HKDA 2Q9IA 3CHXA 2Q9LA 2YIAA 3W7WA 1KC8Q 3O9OA 1NVOA 1A32A 2P67A 3FX7A 2GA1A 5DEDA 5IE9A 5IYCO 3QTCA 2CH7B 1BZKA 3G4SP 5EC1C 5H9CA 3ASOC 3ZN0A 4JI3B 3L75E 1NT2B 5L3CA 1ZTEA 3SYQA 1QU7A 1JFFA 1AI6A 1NU1J 3O6QA 2QJKC 3BCCE 2YNYA 1NKDA 3W7SA 3F7YC 3E1RA 4YTPC 2EIJC 2UU9O 5BU5A 1GZLA 1XTGB 2A45G 4JF3A 2J5UA 2F93B 2RJZA 3CX5D 1USEA 3T4DA 1L0LD 4AILC 1L8DA 5CA3A 2KS1A 4QPKA 3B2EE 2GUVA 1SQXH 2DOSA 2LXCB 3D71A 4K8XA 1BGYG 3CCMP 1VQLP 4FMTA 1GN2A 1AR1B 3J80N 3L73D 1VEWA 2E5TA 3AECC 1V54B 4O4HB 1W59A 4C7RA 4R6ZA 2VS0A 4ZIBA 1KILA 3ZIAG 1LTJA 3B5ND 1KYOH 5IY5C 3W67A 2NR5A 5GTIZ 1S77D 4JI6O 2RMKB 2M3EA 1S9KD 3ETGA 1AB3A 1EZVI 5GTIH 1ZRTE 5CA1A 2W27A 2Y0CA 4FLWA 4N21A 4DCKA 1N73B 2KNCA 1Q81W 2M8RA 1SQBJ 3H6PA 4U3FG 2HKOA 1YZBA 1Z2GA 4P2ZA 3TCUA 4BIUA 2WITA 3K0GA 1NO4A 1BGYH 3OEEG 2IDBA 5HFMA 1GU5A 3WUTA 3SYPA 3CCLV 2YMYA 4F6EA 3HKEB 5JH7A 1M8OB 1D2DA 1V9PA 2H89C 2ZINA 2KLUA 3Q5RA 4D7SA 3K03A 4PD4I 2GBOA 2FL4A 4I7ZC 2W90A 4UV9A 1SQXK 4ZKUA 2WPDG 5FNVB 1KP3A 1FFTB 3RWRD 2QWRB 1VQ9P 1SFCD 1VQ4P 3WG7B 1N2DC 1SFCC 5CHXA 1I94B 2XAFA 1ZV8A 2JJLA 2V1DA 4X66B 4IL6X 1UIIA 1PP9H 3CS5A 2BCCG 4JAUA 3F5TA 2YKQA 2XDJA 3L37A 1K73W 5LMUB 2AXTZ 3BFRA 2FFDC 3FYIB 2F66C 3ZJZA 1G2CB 2AXTH 1L0NH 1X9VA 4FLTA 1AA0A 3IAOA 3PTZA 5K1XA 3P7KA 4WFHA 3P8MC 1F7YA 5EIBC 1FOSF 1PM9A 1SF9A 5ITZA 2OYQA 2P22C 1EZVD 1VL2A 1OW6A 4B3SO 2Q73A 5B3SC 3KYQA 2OCCC 3A2FA 1NJIW 1BE3J 1G1JA 1MZ9A 1N7SC 2H94A 3UQ8A 1XHZA 4D6TG 2QKSA 1YI2V 1T2KD 1FZAA 4PHZA 4YIPA 4I9QA 1T2KC 3L71J 4B3SB 5E79E 2WSFJ 3TDKA 2KP8A 5CCGA 1NGMB 2QE7H 1KQGB 3UO2A 2PRRA 3JATB 2IX7C 3GVMA 3HKBB 4WCEV 4PA6A 2WWWA 3V6IA 3VYIA 3BRCA 2YIBD 1R6TA 3ZRWA 1YIJP 5AW2B 3GHGB 1H88A 2Y9YA 4X1KA 1SVFA 1Q90D 4PD4D 5IJ0A 2FMLA 1TUEB 5D5QA 3MD0A 3ABUA 5KHKA 4D6TH 3L75G 1L0NK 3OGCC 3CYOA 5A2QN 3H1JE 3H32B 2LFSA 2LKMA 3B71A 5AW4B 3CD6P 1URQD 1RE3C 1URQC 1AQTA 4N6JA 4FPPA 2ZE6A 1OZHA 2JO1A 4DW1A 2B89A 1DH3A 4J42A 2MJZA 2FYUJ 3SPIA 1SP4A 3CWBJ 3OTFA 4PD4F 1QVFU 4O4IB 4X1IA 1KMIZ 1WPBA 3CLQA 2B87A 2BASA 5KLVD 1ZL8B 1NTZE 4JI0B 1RP3B 3CRAA 5IWAO 2IZ0A 3AE3C 1DTOA 3WB2A 4KUMA 3L35A 2KG7B 2ZVNB 1M57B 2EBOA 3BCCH 1VQMV 3OD4A 2B1GA 1SQVE 3CC2P 3M7MX 1S2EA 1SQQJ 1VQKP 4HNAB 2YIUC 1FPOA 1PL4A 2GV9A 3JD2A 5LL6Y 5EYPA 5KMGA 1EM1A 3RK2B 4GIFA 3CMEV 4WFAV 4LF4O 2KUBA 3RGBA 3E8HA 4I4TA 3QG5A 1M90W 2YKOA 2Z5HA 3AE5C 3BPZA 1MFZA 1A02F 2M5AA 3AEDC 4N3YB 4JTAB 4Y99C 3AG1B 2D2CB 1MSDA 1X4TA 3DXRB 4G28B 4DUZO
chains in the Genus database with same CATH topology
4I7ZB 1HF9A 3O6QA 2QJKC 1WMKA 5L8RJ 4YTPC 2K9YA 3EWKA 3D70A 3SFDC 1GMJA 2J5UA 4YXDC 1ZOYC 3GF7A 2WSFJ 1PIXA 3AEEC 1NGMB 1KTMA 1DIPA 1KQGB 4H0LB 1IK7A 1VF5D 2E75C 1VF5C 4PV1D 2MKVA 2ZT9B 3ABVC 4PV1C 1FDIA 3D71A 2JP3A 2G3AA 1EXJA 4TT3H 3AECC 1Q90D 1OMIA 2BEZF 3G9RA 3D6YA 1S1CX 2D2CD 2P10A 3Q2YA 4H44D 1ZP0C 2D2CC 1ZRTE 4H44C 4OGQD 1KQFB 3B71A 1YQ3C 3AEBC 2V7QJ 3Q5SA 2NZ2A 1KILE 4OGQC 1ZMEC 2QJYC 4Y28J 4GDOA 2E76D 2WSCJ 1K04A 2FXPA 2YMKA 3Q3DA 2E76C 3AE4C 4R4LA 2JO1A 3Q5PA 1OW8A 1YQ4C 3AE6C 4H0LD 1PV3A 1KORA 2OQQA 2IDBA 4H0LC 2O01J 1PL5A 4H13D 2E75B 1VF5B 1MKMA 3AEAC 3AE2C 3T97B 1KMIZ 2H88C 4H13C 2E74B 3IN6A 2QSIA 4PV1B 1S5LX 3RL0g 1EXIA 3AEGC 3AE1C 1K05A 2H89C 4R4MA 1RQVA 3Q5RA 3GF3A 1TU3F 3AE3C 3C8VA 4I7ZC 1HJ0A 4RKUJ 3LW5J 3RK3E 4XFJA 1OW7A 3SFEC 5KLIC 3AE7C 2BEQD 3H25A 4H44B 1JB0J 3FGAD 2FYNC 3S9OA 3AE9C 1RQUA 4OGQB 3AEFC 1U57A 4IL6X 2WPVB 2WQYC 1NYHA 5M1BA 2YIUC 2ZT9D 2E76B 3D6ZA 2FBWC 1AJYA 2ZT9C 5KKZC 2QIWA 4KT0J 1Y9BA 1DD3A 3AE8C 2G8YA 3GLMA 4Z1MH 2E75D 3R4YA 1UIXA 3IAOA 1R8EA 3Q1MA 2E74D 2QJPC 4H13B 2E74C 2WSEJ 3AE5C 3AEDC 1DD4A 3GMAA 4U7JA 2D2CB 1VL2A 1OW6A 1FDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ B;  1Q90 D;  4I7Z B;  2O01 J;  2WPV B;  4IL6 X;  2QJK C;  2YIU C;  2E75 B;  1VF5 B;  2E76 B;  5L8R J;  2E74 B;  2QSI A;  4PV1 B;  1S5L X;  2K9Y A;  5KKZ C;  2QIW A;  4KT0 J;  1ZRT E;  2WSF J;  4H0L B;  2QJY C;  3C8V A;  4Y28 J;  2WSC J;  4RKU J;  3LW5 J;  2QJP C;  4H13 B;  2WSE J;  2ZT9 B;  5KLI C;  2D2C B;  4H44 B;  1JB0 J;  2FYN C; 
#chains in the Genus database with same CATH topology
 3G71 V;  3TSI A;  2KYV A;  1IO4 A;  3B4S A;  1LT9 B;  5APT A;  4JI8 B;  1N32 O;  3L72 D;  3GWK C;  5LOV B;  4OVN F;  5C39 A;  1M1J C;  2LJ2 A;  2YSU B;  3H1I J;  3L74 D;  1MFT A;  3K5O A;  1SQP E;  2CK3 G;  3TNU A;  2FYN B;  3TGU D;  2WTY A;  4DUZ B;  2EIL C;  2VQE B;  5GTH E;  2P4V A;  5TIS H;  1RSO B;  1N32 B;  1AV1 A;  4B7E A;  4PD4 E;  3T1Y O;  2RN9 A;  2UUA B;  2E75 C;  4P9P A;  1L0N J;  3CC7 P;  3M0D C;  3ABV C;  4WFB V;  4UFZ A;  2K37 A;  2WLJ A;  3F7V C;  4L8J A;  3OT7 A;  4GZR B;  1QL1 A;  2BEZ F;  4FLX A;  2F4V O;  1R3L C;  1LTT C;  1PPJ E;  3ASO B;  3CCJ V;  1SES A;  1N34 O;  1NVP D;  1FXK C;  1NH4 A;  3H1L D;  4X64 O;  3OUF A;  4IOI H;  1L4A A;  1KYO I;  3N7N A;  1H8A A;  1BSN A;  2QJK B;  2F4V B;  4KFM A;  1X59 A;  1HWY A;  1IFI A;  4UUJ C;  1G8M A;  2EIJ B;  1YF2 A;  3OTO O;  4CC6 A;  2QM4 A;  2A45 I;  4YY3 O;  2Q67 A;  3OW2 U;  4H0L D;  1FJG O;  2Q69 A;  1OVV A;  2R3C A;  4H0L C;  1BCC J;  4NPD A;  3AEA C;  1RSO A;  1JJO A;  2M6Y A;  1R5L A;  2H88 C;  1Q81 Q;  2QSI A;  2UXB O;  3VQY A;  1GW4 A;  3CCL P;  2IJH A;  1EN6 A;  4DR5 O;  2Q3I A;  3SSU A;  1JY3 O;  2YKP A;  1HJ0 A;  5IY5 B;  5LMN O;  1P84 I;  3H1J G;  5E79 Z;  2CGN A;  1QR9 A;  2UUC O;  4N78 D;  1CPY A;  2CTP A;  4MW3 A;  3Q4H A;  1KIL D;  1QL2 A;  2CUG A;  5E79 H;  1EDJ A;  1KIL C;  3JAS B;  1LTJ C;  2WPV B;  4G27 B;  1YTF B;  3LSS A;  1N8R W;  4FLV A;  4OWF A;  5GON B;  5CA0 B;  3L4F A;  1SA0 A;  4EFE A;  2QA4 V;  1S5H C;  1SS1 A;  4K0K B;  1VQN P;  4GT1 A;  4J11 A;  1OCO C;  2C0W A;  3Q1M A;  1H2G A;  3EXA A;  4ZI7 A;  2QJP C;  2XKM A;  2ZVO B;  1SQX D;  2E5Y A;  2IM9 A;  4IIJ A;  2KI7 B;  2W8Z A;  5H5N A;  2XTA A;  2YDE A;  5KHI A;  2X6A A;  1FD9 A;  1EN5 A;  2CTR A;  2ZFC A;  5H6R A;  3MP7 B;  1G6U A;  1FZC A;  3H1H J;  1K73 Q;  5EK0 A;  5KAI E;  4I7Z B;  1KYO D;  5B1A C;  5IYZ B;  3RK3 D;  4CH5 A;  5APQ A;  4X62 B;  4LF6 B;  4MVQ A;  3RK3 C;  3A0B E;  5L8R J;  4JPR A;  3CE2 A;  1SQV G;  4WVZ A;  1LJ2 A;  3MIW A;  5LXT B;  2AEF A;  5EC2 C;  3B5N A;  2PTM A;  3ZBH A;  1SFC B;  2YID A;  5L3F A;  4DR3 O;  3QVN A;  3A5T A;  3HUS A;  1OWA A;  2P1J A;  2J59 M;  4D7T A;  3HE5 B;  4JI5 O;  4FFK A;  1NJI Q;  1JOC A;  1BGY D;  2BE3 A;  2O01 N;  2FFD B;  1Q6H A;  3L70 E;  3CL3 D;  4BWN A;  2O1K A;  1NTZ H;  3V2R A;  4HH2 A;  1NTK J;  3HTK B;  4J10 A;  4LP8 A;  1H2N A;  1CZQ A;  1KYO F;  4JI5 B;  3B8M A;  5KA5 A;  4CBC A;  3H1K J;  2W6B A;  1SQV H;  1WA8 A;  1GTO A;  3SPC A;  4TV9 B;  2KSJ A;  1GTW A;  5AW3 B;  4DRX A;  4LGD E;  1LWU A;  5B3S B;  1HR0 B;  4L75 A;  2OCC B;  1BHA A;  1M7L A;  1SZT A;  1N7S B;  4U3F D;  4WFG A;  1IC2 A;  2IYP A;  2WSC J;  2YMK A;  1I7F A;  3Q3D A;  1MG1 A;  2NPS B;  1XMO B;  1JMK C;  4I1L A;  4W7Z A;  4QPJ A;  1OW8 A;  1P7B A;  1GRJ A;  2R9A A;  1XRE A;  2VWJ A;  2GTS A;  1OCZ B;  4QNH B;  2QJ1 A;  1KOR A;  2R70 A;  4IFD K;  4TUY B;  1PP9 D;  2DQ3 A;  3BAB A;  3E2E A;  2QTS A;  3NR7 A;  4RO2 A;  3SWK A;  2OTL V;  3LUT B;  1FYJ A;  2B1I A;  2GUZ B;  2NLJ C;  3AE2 C;  4C7N B;  4ZMD A;  1FXV A;  3IN6 A;  3CJH A;  3UCS C;  5AW5 B;  1P84 F;  3VTP C;  3AE1 C;  1Y74 A;  3FAV B;  3FXD A;  5CCG C;  3ABT A;  1WPX A;  2K9P A;  1VQ7 V;  3C8V A;  2YUA A;  2LXB A;  1P4R A;  3G6E V;  1PPJ G;  1PNK A;  1NTZ K;  1GN6 A;  3RYH A;  1QQC A;  3BEH A;  4K8Z A;  4DJG A;  3C90 A;  5GTH Z;  1SQP H;  1J5E O;  2AHY A;  4TV9 A;  1VF6 C;  1HH0 A;  5GTH H;  4DOJ A;  1SQV K;  1VQM P;  2GHY A;  1H2K A;  3G80 A;  2BCC D;  3F5W C;  4DR7 O;  4PD4 H;  2WMM A;  3LDE A;  1PV0 A;  1JY3 P;  4EB6 B;  1U7J A;  3QO8 A;  3K79 A;  2C0X A;  3K59 A;  3AE8 C;  4B3T B;  2Q7C A;  1E1Q G;  4GKJ B;  2VWK A;  1YEW A;  5KHJ A;  1OCC C;  3LID A;  4JF7 A;  5LYJ A;  1JO5 A;  3RW0 A;  4DV3 O;  1PPJ H;  4Z2W A;  4B3M O;  4RQE A;  2P7J A;  1FS0 G;  4ZKP A;  3CME P;  3HD7 D;  4LFB B;  4TV8 A;  4DUY O;  1L0L J;  3LIE A;  1KQS U;  1MZF A;  3OMA B;  4OH8 B;  3FAV A;  3N2K B;  3A3Y B;  2NN4 A;  4FLY A;  4DV3 B;  4D6T D;  3RGU A;  3CCR V;  3D70 A;  3L73 J;  3SWY A;  2IJK A;  1ZR2 A;  5KLV H;  4JBZ A;  4UCR A;  1KUQ A;  5AVW B;  4B3R B;  1CP9 A;  2YIU B;  3MAQ A;  1SQP K;  3UKM A;  3B77 A;  2F23 A;  1URQ A;  3JSV C;  1VMG A;  1QVG U;  1P84 E;  4JAS A;  3HRN A;  4LR3 A;  1MSW D;  1IBM O;  1NTM E;  1OMI A;  3SPH A;  1N0J A;  3OGI B;  3L75 D;  3ETD A;  2RDC A;  1ZP0 C;  1V55 C;  4JAV A;  5AVR B;  2EIM C;  3E35 A;  4W7Y A;  2BTQ A;  4O2B B;  4UCS A;  1Q43 A;  3BCC D;  3GG2 A;  2SPZ A;  2DW3 A;  4M3L A;  1YSC A;  3CCJ P;  1M1J B;  1EC5 A;  2QVA A;  3N2G A;  2ZIM A;  2ARH A;  4FZ1 A;  2XNX A;  2HPC A;  3MZW B;  1TA8 A;  1YQ4 C;  5CCH A;  1AFO A;  2EIL B;  2WLL A;  4CC5 A;  5JJJ B;  3HE4 A;  5BVZ A;  2QR4 A;  3T2M A;  1XMQ O;  1SLQ A;  2KZI A;  1Q6U A;  2E75 B;  2HJF C;  4OX9 O;  1LTI C;  3PP5 A;  2X7R B;  3JD0 A;  5KLV K;  3E89 A;  3L70 G;  1S5L X;  1N33 O;  3APO A;  5LHI A;  1M56 C;  5KAI Z;  1X0T A;  5BMV A;  1H2S B;  3L74 H;  5FPR A;  5KAI H;  3A0B Z;  4ASU G;  2XOK G;  1YIT V;  3THO A;  4RJT A;  4ASW A;  2WLI B;  5F2V O;  3C3T A;  3HKD B;  1ZRT D;  3BAT A;  3CRQ A;  1LNQ A;  1JM0 A;  4HKZ H;  1K33 A;  5CN0 A;  1NVP B;  3S1K A;  4DV6 O;  4MTO A;  3ZHS A;  1LTS C;  2F43 G;  5LHH A;  2ZNJ A;  2WQY C;  2FKW B;  2IH3 C;  4LFA O;  1NKN A;  1L4A D;  3ZRX A;  3IF4 A;  3UT5 A;  1ZLZ A;  2G8Y A;  1JFF B;  3E22 A;  1L4A C;  4AUW A;  4DK1 A;  2KLV A;  3O6Q B;  3R4Y A;  2D3O W;  1FKA O;  2N9B A;  1BE3 G;  3LDC A;  4TOI A;  3RBX A;  2PGD A;  3EHB B;  2WSE J;  4QE7 A;  2RNB A;  1J2J B;  1LTA C;  1VPC A;  1DD4 A;  3ML0 A;  3K04 A;  3UM7 A;  1N8R Q;  4I5S A;  3L71 G;  2K9J A;  1ROP A;  1KKD A;  2KS1 B;  2LW1 A;  4PDR A;  3CRC A;  1H0T A;  5B1O A;  1B6Q A;  4FFB A;  1THZ A;  1ZR4 A;  1N0N A;  3VOP A;  2JJ2 G;  1TUB A;  5KJ7 A;  1UFI A;  3K5N A;  5LA6 A;  3OAK A;  4JI3 O;  3GF7 A;  1CXZ B;  4HB1 A;  1FXK A;  1KIL B;  1DIP A;  1LTJ B;  1IK7 A;  1PGJ A;  5D5P A;  1JOY A;  1BDC A;  1T3J A;  2C9N Y;  5CBH A;  2XHB A;  5CA1 B;  1FDI A;  2JKV A;  5BZB A;  4EIJ A;  1Y76 A;  1SS3 A;  5LHG A;  1IBL B;  4JI2 B;  3TK1 A;  5APV A;  1ZUQ A;  2KNC B;  3BRV B;  2Y69 C;  2W6A A;  1OCO B;  3CMA V;  3QF7 A;  1KFN A;  1UPG A;  2WA3 A;  4JV5 O;  4IL6 E;  2QWN B;  5KLI B;  4X8A A;  5L3B A;  2RQ6 A;  3CPW O;  2HG5 D;  4I6M C;  5LP6 A;  3EQ2 A;  1BL8 A;  5B1A B;  5JQG A;  1Q2N A;  5JH7 B;  1ZSP A;  2HG5 C;  4MTX A;  4JV5 B;  2PUS A;  1Y4M A;  3RK3 B;  5KLV J;  2LR2 A;  1Y6X A;  1AR5 A;  3Q5P A;  1XQ8 A;  4GUN A;  3CCS V;  2N9Y B;  3G3Z A;  1HVV A;  1OIP A;  1PGO A;  1RPR A;  5H6Q A;  1FZC C;  4EYY Q;  2ZNI A;  1PV3 A;  1EQ7 A;  3CC4 P;  3VQW A;  2WLK A;  2EIK C;  1GN4 A;  2V7Q G;  2GDS A;  4P9O A;  3B5N C;  1RF1 A;  4H33 A;  3V4Q A;  2X6C A;  5CB4 A;  3HUS C;  3KHU A;  2HEP A;  1JY3 N;  4J9Y B;  1NTM G;  2A45 H;  2OTL P;  4O9B A;  1SQQ G;  5JJE B;  2Y0D A;  1GM9 A;  2AGA A;  2DN9 A;  2YI9 A;  3H1J D;  3T97 A;  1TVK A;  1OZ0 A;  4TT3 G;  4K35 A;  2XAJ A;  1AJN A;  3KCY A;  1VQ7 P;  3PHL A;  3G6E P;  1YTZ I;  2JK5 C;  1JA8 A;  3DSQ A;  5FLX N;  3BY6 A;  3OUS A;  5GW7 A;  5ITZ B;  5IT9 N;  1KEC A;  3ZMV A;  3VBB A;  1LP1 A;  1B04 A;  1LWU C;  4JYC A;  1NQT A;  1KB9 E;  1P84 H;  2H43 A;  3L72 J;  2F95 B;  5AW1 B;  1I94 O;  1NTM H;  1N86 A;  3ABL C;  2E74 D;  4JPZ B;  2ADP A;  1S72 V;  4X66 O;  1J1E C;  4U3F H;  3L74 J;  4C7U A;  2E74 C;  1WP8 A;  3TGU J;  1NTZ D;  2O01 H;  4JZ2 A;  3GMA A;  3H1I G;  4UB8 E;  5LMU O;  2HOD A;  2LFR A;  1MMM A;  1M4U A;  1EFR G;  1F51 A;  3PJS K;  4KXR A;  1PFI A;  2WAM A;  4UXN A;  1SQV D;  3ZRW B;  2WT7 A;  2YEV A;  4LNU A;  2R9R B;  2K9Y A;  1D5A A;  2A79 B;  2CTW A;  3LSQ A;  4HAM A;  4X1K B;  1W0K G;  1OCR C;  1YVW A;  2Q7H A;  2Q7G A;  2PGG A;  4I55 B;  4JZG A;  5IJ0 B;  5BR8 B;  2Y48 A;  1DK1 A;  1PIX A;  2OAR A;  4PA3 A;  3CCR P;  1RE4 A;  1FZG A;  3H01 A;  1Z5W A;  3H1L J;  5APU A;  2GUS A;  1GL2 A;  1EXJ A;  1GK4 A;  1BT8 A;  1DGS A;  1K8A W;  1OCC B;  3RFR A;  5KTB A;  4DR2 B;  5KHG A;  2YC0 A;  3PRJ A;  4MVM A;  3PN1 A;  4DT0 A;  1PL0 A;  2P10 A;  2BCC H;  5JWP A;  2PI4 A;  1NTM K;  3I5D A;  5B1B B;  2A9H A;  4X9Q A;  4F6R A;  2AZ0 A;  1YQ3 C;  1ZAU A;  4GDO A;  4X1I B;  2E76 D;  2B87 B;  5FPO A;  2E76 C;  3APQ A;  2ITA A;  1EZJ A;  1SQP D;  3KQG A;  2LW7 A;  1NZ6 A;  2XAG A;  1ORQ C;  2ZYA A;  3U1C A;  3KKY A;  2OT5 A;  2PI5 A;  4I55 A;  2OWO A;  3IFX A;  1VF6 A;  3DC6 A;  1IBK B;  1GN3 A;  1LTG C;  1R6N A;  2MW2 B;  5EBL C;  3DGE A;  3JD3 A;  1IUR A;  2R5B A;  1RH5 B;  1XOU A;  5AVV B;  3RYC A;  3U0Z A;  1WLE A;  4R4M A;  4ZOL A;  5H2F E;  1K92 A;  4C46 A;  1PPJ D;  4U7O A;  1NH2 B;  1IFD A;  3IFM A;  2JR8 A;  5AVZ B;  1NKZ B;  5EYP B;  4LBE C;  3ZMU A;  1HP8 A;  5KMG B;  1XNR B;  1V55 B;  1XHX A;  1FXH A;  2ZE8 A;  1FAF A;  2EJR A;  1YIT P;  3S9O A;  3SYO A;  1NAY A;  1X8Y A;  4I50 A;  4BIO A;  4DXW A;  4I4T B;  4JI0 O;  4AHC A;  2Z0A A;  1SQX J;  1YJW V;  3HD7 A;  2Z3Y A;  3FXE A;  4QJF B;  3IGA C;  2P4K A;  2M5A B;  2Q6Q A;  1DEB A;  2A3Q A;  1Y9B A;  3I56 V;  3L75 H;  1F4N A;  4JYB A;  1RFY A;  4DV1 B;  2IBZ E;  1QBZ A;  4U3J A;  4IL6 Z;  1PNM A;  1CSB A;  2PYL A;  1QX8 A;  3H1H G;  1FFX A;  2WPS A;  3E83 A;  5CCH D;  4UVC A;  3VP8 A;  4IL6 H;  3AG4 C;  1VQ5 V;  5CCH C;  1DF4 A;  3TNU B;  2M7W A;  1M56 B;  4DR4 O;  3FKS G;  1FDO A;  2MK3 A;  1HF9 A;  1EDL A;  3TYY A;  1HNZ B;  3RVZ A;  3P3P A;  2CE4 A;  1RPO A;  3E8B A;  3EVK A;  5EZY A;  1BGY J;  1WMK A;  1IK9 A;  2CPS A;  3WMM 0;  3EWK A;  4MVO A;  1BS3 A;  1FZF A;  4DR4 B;  3SFD C;  4YXD C;  3DC5 A;  5L3G A;  2A0L A;  4P30 A;  4IHJ A;  1MA1 A;  4TWK A;  1FE6 A;  4TSF G;  4JI8 O;  1R73 A;  1WT6 A;  4FM1 A;  4IYI A;  2ADQ B;  3O65 A;  4DZO A;  3JAW A;  3ABM C;  4LWS A;  3H1K G;  1KP2 A;  2I1K A;  1L4A B;  3QWO C;  4U3F J;  1Q3E A;  3R65 A;  2ZR3 A;  4MTF A;  5KUM A;  3JC2 2;  2VQE O;  1COW G;  1LT1 A;  4JGS A;  3R66 A;  2UUA O;  1S0V A;  1AVY A;  2QWQ B;  1PP9 J;  1Z5V A;  3S3X A;  1U96 A;  4PDL A;  5J2T B;  2IW5 A;  1KQL A;  4FIP C;  4DK0 A;  1Q7Y W;  1R3I C;  2YXH A;  2ETN A;  3JD1 A;  3HKC A;  1KB9 H;  3BRT B;  1X79 B;  2UXD B;  3IC7 A;  2ZCE A;  4X65 B;  5KA6 A;  5KJ7 D;  1N36 B;  3P32 A;  3VMZ A;  2I8D A;  1H8H G;  3L70 D;  1RM1 C;  5KJ7 C;  3CEI A;  3Q4H B;  3CCU V;  2AW9 A;  3FWN A;  4GX2 A;  2XV5 A;  4G2K A;  1VQO V;  2CK3 H;  2BCC J;  3ICX A;  1TU3 F;  3AG3 C;  5IJ9 A;  5JVD A;  2M0B A;  1GK6 A;  2RH0 A;  4JQ0 D;  1GM8 A;  1K4D C;  4O4L A;  1BHB A;  1SA0 B;  4AYC A;  4RUF A;  2N74 A;  1URF A;  2ZXW C;  3H25 A;  3CPW U;  3SYA A;  4NPE A;  4ZI7 B;  5APS A;  4MVU A;  3II6 A;  2O57 A;  4IIJ B;  2JS3 A;  5J2T A;  5LGU A;  5AVY B;  2FBW C;  1NU1 E;  4BR6 A;  2R3S A;  4KT0 J;  3ZHT A;  4KL1 A;  1FS0 E;  1FZC B;  3CP1 A;  2V4H A;  2IJJ A;  5LP6 C;  3VMA A;  1YJ9 V;  4NXN B;  4N23 A;  1SC5 B;  4GCZ A;  1T5E A;  2WLH A;  4D6T J;  2EIK B;  4MVS A;  2KB7 P;  3TF5 A;  4BW5 A;  1L2P A;  2A06 G;  2E43 A;  5KAF E;  3K9S A;  3B5N B;  2CTQ A;  1SKV A;  1J95 A;  1J1D C;  2Y0E A;  2IU0 A;  3UIA A;  4DV2 B;  1SER A;  4CS3 A;  1IX9 A;  3WU2 E;  2EZP A;  3HUS B;  3EFG A;  4GOE A;  1S72 P;  1FJK A;  1RHZ B;  4K0K O;  1NBM G;  3BVH A;  2QSA A;  3ETE A;  5IYB O;  1RF1 C;  3M06 A;  4NXM O;  2XUM A;  3FYE B;  2YO2 A;  3LW5 H;  2E42 A;  4BIZ A;  1O9G A;  3DTU B;  5KX5 A;  1ZWI C;  2O3J A;  2QEX V;  3U10 A;  1PKX A;  3L75 J;  2L5G B;  3JCU E;  3S4R A;  3ZHU A;  3OE7 G;  1WA8 B;  2WPR A;  4NXM B;  2E5L B;  4X62 O;  4LF6 O;  3S3W A;  4DRX B;  1LWU B;  2XZR A;  5H2F Z;  1B3Q A;  3H1J H;  2HHH O;  3BCC J;  1CW5 A;  4XBF A;  2IBZ G;  1IFJ A;  2QG4 A;  5H2F H;  1KU9 A;  3GB7 C;  3ABL B;  2OYH A;  4B08 A;  1J1E B;  4HZ3 A;  4DYL A;  4XE5 B;  3JCZ A;  1JUN A;  1WN7 A;  1HNW B;  2AHZ A;  1K7D A;  1PGP A;  3VQX A;  1NOH A;  2HHH B;  2AEM A;  4OGQ D;  2OYO A;  2ZKO A;  3CCE V;  3AEB C;  1H2L A;  3Q5S A;  4OGQ C;  4RWU A;  1BMF G;  4LF5 B;  2FXM A;  1YI2 P;  5IDJ A;  3CJH B;  1K8A Q;  1TAE A;  5KHH A;  1NR7 A;  2FYZ A;  1Y74 B;  1OCR B;  4RES B;  4DR6 B;  1QHT A;  2QWO B;  2N1T A;  1HW7 A;  3K5L A;  1HR0 O;  3NMD A;  3QH9 A;  4NPF X;  5CMU A;  3RYH B;  2EZO A;  2KSD A;  4YJ2 A;  1XMO O;  1P84 D;  2X6B A;  3OMN B;  1KKC A;  3ZRV A;  4EEQ A;  1NTM D;  3SYC A;  2K88 A;  4LF7 B;  1PNL A;  4YPC A;  2UXC O;  1RE4 C;  4IFF A;  5L3E A;  3OJA B;  4GX0 A;  4KHP B;  2HFE D;  1GL2 D;  2HFE C;  5C8Y B;  4OPH A;  4UVA A;  1JEK A;  1GL2 C;  1JX9 A;  4O4J A;  4FLZ A;  4NTY A;  1FZB A;  2P2U A;  2QTO A;  4TQF A;  3CI9 A;  2UXC B;  5LBQ A;  3F89 A;  4L73 A;  5LYJ B;  4KP4 A;  2PYJ A;  3ZDM A;  1HWT C;  2E76 B;  2HLO A;  3MGN A;  1BE3 E;  5AVU B;  4TV8 B;  3M99 B;  1Q82 Q;  4U7N A;  3AK2 A;  2ZXE B;  1M9N A;  1YJW P;  3D3Q A;  1QLE D;  3L71 E;  3TXQ A;  4WFE A;  5JCO A;  1QLE C;  3CCQ V;  1Y66 A;  3KDP B;  4U7J A;  4GKK B;  3P8C E;  3CXH E;  4AQY O;  2PZS A;  3MUD C;  3JAK A;  1TGO A;  3I55 V;  4B3T O;  3IAY A;  4GKJ O;  1VQ5 P;  1K9M W;  2Q4P A;  1URQ B;  3OR6 C;  1QR8 A;  2Z5U A;  1AI5 A;  3T1H O;  2R32 A;  4WB4 A;  1WP7 A;  3AEI A;  1S5L E;  4AQY B;  2JWD A;  1KBH A;  2N05 A;  5C8Y A;  2FB5 A;  4LFB O;  2LGQ A;  1K5S A;  2HLD G;  1IJD B;  1WAZ A;  1W0J G;  4UB6 E;  3RT3 C;  1DX7 A;  1HJB A;  2ZDI A;  3USS A;  1BSM A;  3T1H B;  1NU1 G;  1IXB A;  4IGG A;  3H9V A;  3RVY A;  4YJ3 A;  5K5G B;  2N04 A;  3SWF A;  2BTQ B;  2DWE C;  1Q8I A;  3HD7 C;  1SRY A;  5CMZ A;  2CAZ C;  1XDC A;  3N2G B;  3G9R A;  4B3R O;  5DJU B;  2HPC B;  4EFB A;  2O1J A;  2FYU E;  3V2P A;  3CWB E;  2WLL B;  3HE4 B;  4FM0 A;  3G71 P;  1AJP A;  2P06 A;  4L87 A;  5AG2 A;  1H89 A;  2JWA A;  2NZ2 A;  2Y4U A;  4GKG A;  3B40 A;  2P6J A;  2DYS C;  3AE4 C;  3RL0 D;  1XIL A;  3FD9 A;  1NU1 H;  3OM3 B;  4DV4 B;  3KXD A;  3RL0 C;  4CPG A;  1I5Y A;  5BMV B;  4TQD A;  1KD1 W;  1W2E A;  1F4M A;  1SZX A;  2OQQ A;  2OIE A;  2W6J G;  5KAF Z;  3AG7 A;  1D7M A;  5L3D A;  3VQV A;  1KZU B;  3TJT A;  2IFN A;  3H1J J;  4H13 D;  4HYT B;  1O9H A;  1SQB G;  5KAF H;  4I0X A;  2OTJ V;  1SQQ E;  4H13 C;  2Q3E A;  3WU2 Z;  3ABM B;  1KB9 I;  1VQ8 V;  4FK5 C;  4Y99 B;  1Q7Y Q;  1K05 A;  3WU2 H;  2WSS G;  1Q86 W;  4AQR D;  2C2A A;  4MTG A;  1JPX A;  1JTH A;  1GAX A;  4FLU A;  2OGU A;  3OA7 A;  3AE7 C;  2E3C A;  3UT5 B;  1VQO P;  3E22 B;  3RYI A;  1JB0 J;  3A0R A;  2JEE A;  2HR3 A;  3W7U A;  4ZKI A;  3JCU Z;  1EDK A;  3K3W A;  3AEF C;  3L72 G;  2IFM A;  1NS1 A;  5M1B A;  2A7W A;  1NTZ J;  4ABM A;  3FB5 C;  3NXS A;  4CZZ A;  3GW6 A;  5KKZ C;  1JJ2 U;  3TGU G;  4BWA A;  1YIJ V;  3K5B A;  3BA9 A;  3KG2 A;  2K9J B;  4YHH B;  4DR1 O;  3H1I E;  2IJI A;  4DV7 B;  4F4L A;  1IFP A;  3FWL A;  1QVF O;  1H0T B;  2WSS H;  1SQV J;  4FFB B;  1PD3 A;  1JCC A;  2L6L A;  2JDI G;  5J2U A;  2B9B A;  2ZYG A;  5CJ4 A;  1TUB B;  4R7C A;  1RM1 B;  3A0B H;  1HTL C;  5LA6 B;  1BSH A;  1YJ9 P;  3IR9 A;  4OPA A;  3VOU A;  1Z56 A;  4DR1 B;  3VN0 A;  2Q6A A;  1FXK B;  3AG3 B;  4FVM A;  1EBO A;  5AW8 B;  5DM6 V;  3A2A A;  2K1E A;  1R3J C;  4JI7 O;  3K0D A;  3M9H A;  2H3O A;  1Y76 B;  3SGI A;  3MTU E;  2NRG A;  1I08 A;  1XTC C;  1E79 G;  3H1L G;  4B86 A;  3L70 H;  4I9W A;  3STZ C;  3WB0 A;  4H0L B;  2FKX A;  2OYI A;  4JI7 B;  1YHQ V;  2LO1 A;  3U11 A;  1GU4 A;  1S76 D;  2JGD A;  4PV1 D;  3CRM A;  4MT8 A;  4UCT A;  4PV1 C;  4PDV A;  2QA4 P;  2Z5I A;  1KB9 D;  1HNX O;  4JYA B;  5LP6 B;  3CX5 I;  4NR1 A;  4QMA A;  5JQG B;  4BRY A;  2QEX P;  4ZHQ A;  4RQF A;  1LTB C;  3T4Z A;  3WFV A;  2EJ7 A;  5DEC A;  3RYF A;  1SQP J;  3K5M A;  5AW7 B;  2D2C D;  1BCC E;  1J1D B;  1ZX3 A;  3JSN A;  2KZJ A;  2D2C C;  1HNX B;  4WY4 A;  2RMZ A;  1JCH A;  2CGO A;  3QO5 A;  3CC2 V;  1IBL O;  4JI2 O;  3HPL C;  4WBN A;  4PJ0 E;  4CS4 A;  4EKW A;  1K04 A;  3NTN A;  2BSK A;  2PF4 E;  1AR4 A;  1K97 A;  2UXX A;  2PP6 A;  4O2A A;  2FTK A;  1SQG A;  3CB2 A;  1RF1 B;  1BE3 H;  1RF0 A;  3CCE P;  4LF8 O;  5CB4 B;  1MNG A;  4LCU C;  1Y8A A;  1KB9 F;  4TLF A;  3FFQ A;  1GK9 A;  3L71 H;  2W6I G;  2WSF H;  1IDS A;  2QJP B;  3T97 B;  1TVK B;  4J7K A;  3OAA G;  4PA7 A;  1N4C A;  4LF8 B;  2L35 A;  2WLN A;  1VQ6 V;  4W80 A;  3CXH H;  2IBZ I;  4JTD B;  4Z1M G;  4UV8 A;  2EIN C;  1XNQ B;  3HR0 A;  1SQX G;  1EDI A;  2FYU G;  5AVT B;  1FBM A;  3CWB G;  1LP1 B;  1S5L Z;  3OFN G;  1Q6I A;  1AI4 A;  1M93 A;  2BTO A;  1S5L H;  4UB6 Z;  4X1Y A;  1OHH G;  4OGQ B;  1FJP A;  2OYH C;  1P7G A;  4UB6 H;  1A02 J;  2JGU A;  4QIW F;  4FM2 A;  4PA9 A;  3H1H E;  4Z1V A;  3OW2 O;  2Z4E A;  3CXC U;  3CC7 V;  1YYC A;  2HOD B;  2QIW A;  2YXL A;  3JAR A;  4FJC C;  4Q20 A;  2ZR2 A;  3BA8 A;  4Z1M H;  3AG2 C;  3J7A U;  2H8P D;  2JS5 A;  3JAL A;  1JCD A;  2A06 D;  2WT7 B;  1SQF A;  2QWP B;  1T6A A;  2H8P C;  2YEV B;  4LNU B;  4LFC O;  2UU9 B;  4JI4 O;  2FYU H;  3LDD A;  3CWB H;  1DF5 A;  4B7K A;  1GKF A;  5A9G A;  1CI6 A;  2N1T D;  4JTC B;  2N1T C;  1NWQ A;  1QEX A;  3CCQ P;  1AP5 A;  2LP7 A;  1BQ0 A;  4PI2 A;  2PAJ A;  5HFL A;  4LFC B;  4JI4 B;  1XI1 A;  2YS8 A;  4OXS A;  2PY5 A;  4IFM A;  2CH7 A;  1QGK B;  2OIG A;  2V7Q H;  1NTK E;  3RN4 A;  2ILM A;  1IZN B;  3ZHV A;  1GL2 B;  3ZRS A;  3I55 P;  5B5E E;  1N7L A;  1R1B A;  2OCH A;  3H1K E;  1YTF D;  3P3N A;  3CX5 F;  1GO3 F;  3W68 A;  4JI6 B;  4NVP A;  3IJ4 A;  1SQQ H;  4NYK A;  1QCE A;  2QKA A;  2KXP B;  1K9M Q;  1AVM A;  1JR9 A;  4AI8 A;  1S5J A;  2GSM B;  2IBZ D;  3E86 A;  4F6R B;  5TIS E;  3K58 A;  2QRX A;  4TT3 H;  1PP9 G;  1YJN V;  5BR8 O;  4LH7 A;  1HDJ A;  1QLE B;  3D6Y A;  3E8F A;  4MN4 C;  3ZHQ A;  1YXB A;  2XND G;  4H44 D;  3LNN A;  2IZ1 A;  2M3B A;  1L0N G;  4H44 C;  1AI7 A;  1OVU A;  1ZME C;  2FYU K;  5JCO C;  2FXP A;  4O4H A;  3L70 J;  4DR2 O;  3TXS A;  2P7T C;  3N27 A;  1WB7 A;  4R4L A;  1P49 A;  3SR2 C;  4GYC B;  3RYC B;  5AW9 B;  4ZOL B;  3H1I H;  1GD2 E;  1MAB G;  1XL4 A;  3OR7 C;  1QLN A;  1OV9 A;  1N73 A;  1VQN V;  4ZNC A;  2UXN A;  1HGV A;  1FAV A;  4GOD A;  3V2Q A;  3M9B A;  1H38 A;  2IPP A;  2XND H;  2KB1 A;  2QE7 G;  4XDL A;  5CJ0 A;  4I50 B;  4JAA A;  1PZQ A;  2Q5U A;  3HD7 B;  1ZW0 A;  4X20 B;  1SQQ K;  1LUW A;  5EIB D;  3VMY A;  2ZDI C;  2OTJ P;  1KD1 Q;  1G1I A;  2RKL A;  3ZX6 A;  3BAS A;  1VQ8 P;  1BCC G;  4W4L A;  1OW7 A;  3HKE A;  1IXM A;  4WF9 V;  1IBK O;  4WBA A;  4XA4 A;  3SFE C;  2AXC A;  2KOG A;  2L91 A;  2Q1K A;  4X89 A;  1N7S D;  1KFM A;  4U3J B;  1WB8 A;  5B66 E;  3AE9 C;  2DMX A;  1UJW B;  3M8A A;  1FFX B;  2NPS D;  3T1C A;  3CX5 E;  2PFX A;  3MUD A;  2DYS B;  1L0L E;  1NYH A;  2NPS C;  2ZT9 D;  3TET A;  1Q86 Q;  3MHV A;  3PLN A;  3O8Z A;  1AIL A;  5FNV A;  2A06 E;  2ZT9 C;  3RL0 B;  4A5U B;  1XNR O;  1OCZ C;  3K57 A;  1R5S A;  1W2B O;  2BOB C;  5APY A;  1AVO A;  1AJQ A;  3L73 E;  5EZY B;  2CPB A;  2Q8V A;  4HYO A;  1HGZ A;  4J80 A;  1YTZ T;  1FDM A;  1Q82 W;  4H13 B;  4Q6G A;  1BCC H;  1Q5O A;  3AK1 A;  2J58 A;  3MHH C;  2JRI A;  1S9K E;  1JY2 N;  4K3A A;  4PJ0 Z;  1QNM A;  2EIM B;  3OEH G;  1JMB A;  4IHJ B;  1G2C A;  4PJ0 H;  4DV1 O;  4RAI A;  3B8E B;  1HBW A;  2Y0I A;  2EUL A;  2DYR C;  4UVB A;  4X20 A;  3JAW B;  4LWS B;  2DW4 A;  4GX5 A;  2GM4 A;  2V4D A;  3E7K A;  1ZOY C;  3IC9 A;  3AEE C;  1OXZ A;  1MZE A;  5EFW B;  3BCC G;  1US6 A;  3M0A A;  2Y0P A;  1VF5 D;  3KZI E;  1YCI A;  1NU1 D;  1VF5 C;  1HNZ O;  1S4X A;  2MKV A;  5KKZ B;  4A7P A;  2QGN A;  3D8C A;  2W0X A;  1YHQ P;  4PA4 A;  3RBZ A;  5BXZ A;  1FU1 A;  3C3S A;  1JVM A;  5CBO A;  3JAT A;  3D36 A;  4UCV A;  3HKB A;  5LGN A;  5J9P C;  1S1C X;  2ZJS E;  1FOS E;  3HKC B;  3JYC A;  1KQS O;  3GHG A;  2Q7E A;  4UCU A;  4J7J A;  4KJM A;  1JNM A;  4DW0 A;  2V7Q J;  3FB8 C;  2QJY C;  3STL C;  3WB1 A;  2YXR B;  1LUV A;  2KKW A;  3ZHR A;  4J41 A;  4NB5 A;  3H1H H;  1NTK G;  1NTM J;  5IWA B;  4MVZ A;  1K34 A;  3B8N A;  2P5O A;  3OMI B;  3H32 A;  3G67 A;  5JVD B;  5IJ9 B;  1B06 A;  2O01 J;  1YBK A;  4O4L B;  1SQB D;  3ASN C;  4R8C A;  1QVG O;  4PV1 B;  3PH0 A;  3RL0 g;  4IT5 A;  5DN6 G;  1YDX A;  2ZM6 O;  5K1P A;  2R72 A;  2HVK C;  3LNM B;  3CMA P;  1EZV E;  2OYI C;  4DV5 O;  4EDF A;  2UXD O;  1WRG A;  4X65 O;  1VQ6 P;  4CH4 A;  2B88 A;  1M5I A;  5B5E Z;  4O4I A;  3CXH I;  1G4Y B;  2BOC C;  1NTK H;  1N36 O;  1FZE A;  2BEQ D;  2WZ7 A;  2YO3 A;  3CRR A;  2ZM6 B;  3C1L A;  1ZL8 A;  1MV8 A;  5B5E H;  1NHL A;  2DE0 X;  4LF4 B;  4W4K A;  3H1K H;  5AW6 B;  3X2Q C;  4DV5 B;  4XDJ A;  2QDO A;  3EFF K;  2KG7 A;  3D6Z A;  3SDL A;  4WY4 D;  2XAS A;  3B09 A;  4HJG H;  3CCS P;  3JD4 A;  4DV0 O;  4UB8 Z;  4WY4 C;  5TIS Z;  2WSC H;  5TJH A;  3QO7 A;  2LGW A;  5AVQ B;  3C9I A;  4UB8 H;  2XT9 A;  5AW0 B;  2Y69 B;  4MSW C;  2E75 D;  1M1K W;  1I5X A;  2DJV A;  2CDY A;  2POH A;  4HNA A;  3W7T A;  2XU6 A;  2XAQ A;  2G38 A;  4DV0 B;  2P90 A;  1RF0 C;  3FB7 C;  1MOF A;  2ZE7 A;  1XUQ A;  5KX5 B;  2XAH A;  2EIN B;  1VF7 A;  4E4E A;  4NTW A;  4PI0 A;  3P30 A;  3T1Y B;  4NXN O;  1K5Q A;  2VRZ A;  3ZMZ A;  3CCV V;  2Q5Z A;  3SPG A;  2KK7 A;  4GLX A;  1U7M A;  3V5B A;  1GMJ A;  1NR1 A;  4NKG B;  3DXR A;  4DV2 O;  1KTM A;  2OYH B;  2OTK E;  1L0L G;  1NTK K;  1LT9 A;  1BE3 D;  2R44 A;  5LOV A;  2ODM A;  1N34 B;  2JVD A;  2EX3 A;  2ZQM A;  4J7Z A;  4JYY A;  2Q0A A;  4X64 B;  5KLV E;  3L73 G;  1F23 A;  3L71 D;  2VRS A;  3AG2 B;  2YXQ B;  1MUU A;  2ZE5 A;  3OTO B;  4YY3 B;  1LGH B;  3P8C D;  3CXH D;  2R9I A;  1FJG B;  2WA4 A;  5B66 Z;  2E5L O;  1YJN P;  2N1T B;  2ZXX A;  3JSL A;  4J9Z B;  4CH6 A;  5B66 H;  1VAR A;  1KN7 A;  3ABK C;  3CX5 H;  1GH6 A;  1L0L H;  4YJ2 B;  4PDM A;  2UXB B;  1FC2 C;  2A06 H;  1SQB E;  4LC1 A;  3AE6 C;  1HNW O;  2VQF O;  3I5C A;  4DR5 B;  1PGQ A;  2B9Z A;  3U1A A;  3L73 H;  5LGT A;  5LMN B;  1PL5 A;  1AP6 A;  2GTA A;  4LF5 O;  1NI8 A;  2E74 B;  2UUC B;  5B1N A;  2JEU A;  4O4J B;  4I2L C;  2VQF B;  4RUE A;  1EXI A;  3CXH F;  3MDS A;  2KSE A;  2QM8 A;  4DR6 O;  4GOF A;  3V2N A;  2ZYD A;  2RN0 A;  2KIK A;  3D3I A;  2FYU D;  3CWB D;  3L72 E;  5APW A;  1VQP V;  1NTZ G;  5KLI C;  4PEL A;  2F1M A;  4EI2 A;  1KC8 W;  4H44 B;  5EBW C;  3FGA D;  3L74 E;  3TGU E;  1E1R G;  3KZI Z;  3LSU A;  2IBZ H;  3R2P A;  1H2M A;  1WJZ A;  4LF7 O;  2UWJ E;  3KZI H;  5CBG A;  3A8T A;  4KHP O;  1OX3 A;  3KPE A;  1GW3 A;  3G4S V;  1GDT A;  3MHS C;  3SPJ A;  5IYD O;  1DD3 A;  3JAK B;  1L0L K;  3GLM A;  2X0L A;  1ZLL A;  3AK3 A;  3A0H E;  3SJB C;  1V54 C;  3J81 N;  1DEE G;  2C9L Y;  4BW9 A;  1SQQ D;  3JAS A;  4MVR A;  2NNU A;  3WUV A;  4GX1 A;  5CA0 A;  5FL7 G;  5GON A;  4DR3 B;  1IVS A;  1EZV G;  4ASV A;  3G6B A;  3H1L E;  1N73 C;  1SET A;  2Q68 A;  2HP8 A;  1H8E G;  4YJ3 B;  3SJC C;  2ZD9 A;  1ZXG A;  3SJQ C;  1USD A;  1RY3 A;  3WUU A;  1G1X B;  4GKK O;  3CCM V;  1VQL V;  3CC4 V;  1XL6 A;  5IYZ A;  2IYO A;  4LH6 A;  2RCV A;  2ZT9 B;  1SQP G;  1Y67 A;  1W5C E;  2Q0O C;  3I56 P;  3H1I D;  1X22 A;  1L1F A;  5LXT A;  1ZN5 A;  1AQ5 A;  1EZV H;  1SFC A;  1JY2 O;  1W2B U;  4NTX A;  3K08 A;  3L36 A;  1IFM A;  2W0F C;  1I0H A;  5JJN B;  5CCG D;  3HE5 A;  1L0N D;  2JJ1 G;  2FFD A;  4LF9 O;  3WG7 C;  2WSE H;  3UO3 A;  3JAM N;  4N78 E;  2DWD C;  1ARO P;  1KIL E;  2W83 C;  4I0X B;  2DYR B;  3HTK A;  2H7H A;  4FZ0 A;  2QKC A;  4CH3 A;  1JQ0 A;  1S3J A;  2B5U A;  3ITK A;  1VIB A;  2K1A A;  5AVS B;  4LF9 B;  1OVR A;  4IYH A;  3NFQ A;  1JTH B;  4RO0 A;  4E2L A;  5CBF A;  1N7S A;  1U97 A;  3L9D A;  3K9A A;  4MS2 A;  1VF5 B;  2YI8 A;  2IU3 A;  3AG4 B;  3RYI B;  1J5E B;  4QE9 A;  1SQX E;  2I1J A;  2DQ0 A;  2AEJ A;  2NPS A;  3VP9 A;  5KLV G;  4DV4 O;  3AEG C;  2AZ2 A;  3M91 A;  2ITC C;  1VQ9 V;  1IZ3 A;  1CEZ A;  4UCO A;  3GF3 A;  1VQ4 V;  1KV4 A;  4DR7 B;  4TUY A;  2WPQ A;  4QGP A;  3LW5 J;  1KYO E;  1BCC D;  1JMM A;  3RK3 E;  2GUZ A;  4C7N A;  5E1A C;  4YXW G;  2K3R A;  5GTI E;  1GMG A;  5BY1 A;  5B1B C;  2YIB A;  1RQU A;  2QJY B;  2ZIO A;  1BDD A;  3E1I A;  5J2U B;  3ZS8 C;  4MW8 A;  3D36 C;  4B3M B;  1XEQ A;  1LR1 A;  3VMX A;  1ENV A;  3ZMT A;  1NAF A;  2HYN A;  3V4W A;  4DUY B;  5BU8 B;  1M90 Q;  5KUK A;  3GHG C;  1BGY E;  1K3E A;  2WVR A;  1UIX A;  1HUC A;  1VDF A;  1RE3 A;  1R8E A;  5DJT B;  3ASN B;  3FX0 A;  3CCU P;  1OFC X;  3HB3 B;  3GWO A;  2HVJ C;  4EB6 A;  4YXW H;  3Q2Y A;  2FY8 A;  2Y4T A;  3K06 A;  1E5W A;  1NH2 D;  1XBL A;  4CS2 A;  2OYI B;  4YHH O;  2JEX A;  4DV7 O;  3W7X A;  2JGD B;  4U3F E;  2ATK C;  4DO2 A;  4BXL A;  2W6J H;  3JCU H;  1M1K Q;  1R6K A;  1SQB H;  4BRY B;  3ETQ A;  4R50 A;  3L74 G;  4ZHQ B;  1IBM B;  4L76 A;  3X2Q B;  3M9Q A;  1BQZ A;  3RYF B;  4X88 A;  3CCV P;  3H1H D;  1NU1 K;  1PP9 E;  3N2K A;  1WNS A;  1DLB A;  4JI1 O;  4WY4 B;  2JP3 A;  2G3A A;  5EBM C;  4WBN B;  1D5N A;  2AXT E;  4KHX A;  1L0N E;  3U59 A;  4EOT A;  2Y9Z A;  1M57 D;  2BSK B;  3CD6 V;  3QNE A;  4O2A B;  1M57 C;  3ZED A;  5APX A;  5CBN A;  1R3K C;  1M56 D;  3L72 H;  4JI1 B;  3FB6 C;  2ZXW B;  2P58 A;  4ZBM A;  4YIO A;  1T3U A;  2ITD C;  1KQF B;  4H37 A;  3TGU H;  1EN4 A;  1XMQ B;  4JYA O;  4LLH A;  4Y28 J;  1IFN A;  4OX9 B;  4BAY A;  1NTK D;  1JY2 P;  1N33 B;  2UUB O;  2BCC E;  3BHP A;  2R5D A;  1GM7 A;  3RK2 D;  1K4C C;  2JDI H;  3BAA A;  3RK2 C;  3H1K D;  3A0H Z;  4HBN A;  1VP7 A;  3A0H H;  4O2B A;  2WLM A;  3CSX A;  1SQB K;  2YIC A;  1MKM A;  4L74 A;  2UUB B;  4WFF A;  2LQT A;  2IH1 C;  1M1J A;  2QM7 A;  3AG1 C;  3SJA C;  4X1Y B;  3BVO A;  4DV6 B;  1T8Z A;  1RQV A;  3KCX A;  3H1L H;  3ZN1 A;  1E79 H;  3ZCC A;  1LT9 C;  5C93 A;  2YXY A;  2KQX A;  4RKU J;  1Y47 A;  1VQK V;  4LFA B;  4XFJ A;  4D6T E;  3N4X A;  4ICG A;  3JAR B;  3M0D A;  2FYN C;  4WWI A;  3JAL B;  5AVX B;  3E8G A;  3ABK B;  1XNQ O;  1U57 A;  3F5H A;  1VQP P;  3A7O A;  4XDK A;  1CI6 B;  2FXO A;  2ZAE B;  3ZMS A;  1AJY A;  2JIZ G;  1OJH A;  2WLI A;  2HJD A;  3HKD A;  2Q9I A;  3CHX A;  2Q9L A;  2YIA A;  3W7W A;  1KC8 Q;  3O9O A;  1NVO A;  1A32 A;  2P67 A;  3FX7 A;  2GA1 A;  5DED A;  5IE9 A;  5IYC O;  3QTC A;  2CH7 B;  1BZK A;  3G4S P;  5EC1 C;  5H9C A;  3ASO C;  3ZN0 A;  4JI3 B;  3L75 E;  1NT2 B;  5L3C A;  1ZTE A;  3SYQ A;  1QU7 A;  1JFF A;  1AI6 A;  1NU1 J;  3O6Q A;  2QJK C;  3BCC E;  2YNY A;  1NKD A;  3W7S A;  3F7Y C;  3E1R A;  4YTP C;  2EIJ C;  2UU9 O;  5BU5 A;  1GZL A;  1XTG B;  2A45 G;  4JF3 A;  2J5U A;  2F93 B;  2RJZ A;  3CX5 D;  1USE A;  3T4D A;  1L0L D;  4AIL C;  1L8D A;  5CA3 A;  2KS1 A;  4QPK A;  3B2E E;  2GUV A;  1SQX H;  2DOS A;  2LXC B;  3D71 A;  4K8X A;  1BGY G;  3CCM P;  1VQL P;  4FMT A;  1GN2 A;  1AR1 B;  3J80 N;  3L73 D;  1VEW A;  2E5T A;  3AEC C;  1V54 B;  4O4H B;  1W59 A;  4C7R A;  4R6Z A;  2VS0 A;  4ZIB A;  1KIL A;  3ZIA G;  1LTJ A;  3B5N D;  1KYO H;  5IY5 C;  3W67 A;  2NR5 A;  5GTI Z;  1S77 D;  4JI6 O;  2RMK B;  2M3E A;  1S9K D;  3ETG A;  1AB3 A;  1EZV I;  5GTI H;  1ZRT E;  5CA1 A;  2W27 A;  2Y0C A;  4FLW A;  4N21 A;  4DCK A;  1N73 B;  2KNC A;  1Q81 W;  2M8R A;  1SQB J;  3H6P A;  4U3F G;  2HKO A;  1YZB A;  1Z2G A;  4P2Z A;  3TCU A;  4BIU A;  2WIT A;  3K0G A;  1NO4 A;  1BGY H;  3OEE G;  2IDB A;  5HFM A;  1GU5 A;  3WUT A;  3SYP A;  3CCL V;  2YMY A;  4F6E A;  3HKE B;  5JH7 A;  1M8O B;  1D2D A;  1V9P A;  2H89 C;  2ZIN A;  2KLU A;  3Q5R A;  4D7S A;  3K03 A;  4PD4 I;  2GBO A;  2FL4 A;  4I7Z C;  2W90 A;  4UV9 A;  1SQX K;  4ZKU A;  2WPD G;  5FNV B;  1KP3 A;  1FFT B;  3RWR D;  2QWR B;  1VQ9 P;  1SFC D;  1VQ4 P;  3WG7 B;  1N2D C;  1SFC C;  5CHX A;  1I94 B;  2XAF A;  1ZV8 A;  2JJL A;  2V1D A;  4X66 B;  4IL6 X;  1UII A;  1PP9 H;  3CS5 A;  2BCC G;  4JAU A;  3F5T A;  2YKQ A;  2XDJ A;  3L37 A;  1K73 W;  5LMU B;  2AXT Z;  3BFR A;  2FFD C;  3FYI B;  2F66 C;  3ZJZ A;  1G2C B;  2AXT H;  1L0N H;  1X9V A;  4FLT A;  1AA0 A;  3IAO A;  3PTZ A;  5K1X A;  3P7K A;  4WFH A;  3P8M C;  1F7Y A;  5EIB C;  1FOS F;  1PM9 A;  1SF9 A;  5ITZ A;  2OYQ A;  2P22 C;  1EZV D;  1VL2 A;  1OW6 A;  4B3S O;  2Q73 A;  5B3S C;  3KYQ A;  2OCC C;  3A2F A;  1NJI W;  1BE3 J;  1G1J A;  1MZ9 A;  1N7S C;  2H94 A;  3UQ8 A;  1XHZ A;  4D6T G;  2QKS A;  1YI2 V;  1T2K D;  1FZA A;  4PHZ A;  4YIP A;  4I9Q A;  1T2K C;  3L71 J;  4B3S B;  5E79 E;  2WSF J;  3TDK A;  2KP8 A;  5CCG A;  1NGM B;  2QE7 H;  1KQG B;  3UO2 A;  2PRR A;  3JAT B;  2IX7 C;  3GVM A;  3HKB B;  4WCE V;  4PA6 A;  2WWW A;  3V6I A;  3VYI A;  3BRC A;  2YIB D;  1R6T A;  3ZRW A;  1YIJ P;  5AW2 B;  3GHG B;  1H88 A;  2Y9Y A;  4X1K A;  1SVF A;  1Q90 D;  4PD4 D;  5IJ0 A;  2FML A;  1TUE B;  5D5Q A;  3MD0 A;  3ABU A;  5KHK A;  4D6T H;  3L75 G;  1L0N K;  3OGC C;  3CYO A;  5A2Q N;  3H1J E;  3H32 B;  2LFS A;  2LKM A;  3B71 A;  5AW4 B;  3CD6 P;  1URQ D;  1RE3 C;  1URQ C;  1AQT A;  4N6J A;  4FPP A;  2ZE6 A;  1OZH A;  2JO1 A;  4DW1 A;  2B89 A;  1DH3 A;  4J42 A;  2MJZ A;  2FYU J;  3SPI A;  1SP4 A;  3CWB J;  3OTF A;  4PD4 F;  1QVF U;  4O4I B;  4X1I A;  1KMI Z;  1WPB A;  3CLQ A;  2B87 A;  2BAS A;  5KLV D;  1ZL8 B;  1NTZ E;  4JI0 B;  1RP3 B;  3CRA A;  5IWA O;  2IZ0 A;  3AE3 C;  1DTO A;  3WB2 A;  4KUM A;  3L35 A;  2KG7 B;  2ZVN B;  1M57 B;  2EBO A;  3BCC H;  1VQM V;  3OD4 A;  2B1G A;  1SQV E;  3CC2 P;  3M7M X;  1S2E A;  1SQQ J;  1VQK P;  4HNA B;  2YIU C;  1FPO A;  1PL4 A;  2GV9 A;  3JD2 A;  5LL6 Y;  5EYP A;  5KMG A;  1EM1 A;  3RK2 B;  4GIF A;  3CME V;  4WFA V;  4LF4 O;  2KUB A;  3RGB A;  3E8H A;  4I4T A;  3QG5 A;  1M90 W;  2YKO A;  2Z5H A;  3AE5 C;  3BPZ A;  1MFZ A;  1A02 F;  2M5A A;  3AED C;  4N3Y B;  4JTA B;  4Y99 C;  3AG1 B;  2D2C B;  1MSD A;  1X4T A;  3DXR B;  4G28 B;  4DUZ O; 
#chains in the Genus database with same CATH homology
 4I7Z B;  1HF9 A;  3O6Q A;  2QJK C;  1WMK A;  5L8R J;  4YTP C;  2K9Y A;  3EWK A;  3D70 A;  3SFD C;  1GMJ A;  2J5U A;  4YXD C;  1ZOY C;  3GF7 A;  2WSF J;  1PIX A;  3AEE C;  1NGM B;  1KTM A;  1DIP A;  1KQG B;  4H0L B;  1IK7 A;  1VF5 D;  2E75 C;  1VF5 C;  4PV1 D;  2MKV A;  2ZT9 B;  3ABV C;  4PV1 C;  1FDI A;  3D71 A;  2JP3 A;  2G3A A;  1EXJ A;  4TT3 H;  3AEC C;  1Q90 D;  1OMI A;  2BEZ F;  3G9R A;  3D6Y A;  1S1C X;  2D2C D;  2P10 A;  3Q2Y A;  4H44 D;  1ZP0 C;  2D2C C;  1ZRT E;  4H44 C;  4OGQ D;  1KQF B;  3B71 A;  1YQ3 C;  3AEB C;  2V7Q J;  3Q5S A;  2NZ2 A;  1KIL E;  4OGQ C;  1ZME C;  2QJY C;  4Y28 J;  4GDO A;  2E76 D;  2WSC J;  1K04 A;  2FXP A;  2YMK A;  3Q3D A;  2E76 C;  3AE4 C;  4R4L A;  2JO1 A;  3Q5P A;  1OW8 A;  1YQ4 C;  3AE6 C;  4H0L D;  1PV3 A;  1KOR A;  2OQQ A;  2IDB A;  4H0L C;  2O01 J;  1PL5 A;  4H13 D;  2E75 B;  1VF5 B;  1MKM A;  3AEA C;  3AE2 C;  3T97 B;  1KMI Z;  2H88 C;  4H13 C;  2E74 B;  3IN6 A;  2QSI A;  4PV1 B;  1S5L X;  3RL0 g;  1EXI A;  3AEG C;  3AE1 C;  1K05 A;  2H89 C;  4R4M A;  1RQV A;  3Q5R A;  3GF3 A;  1TU3 F;  3AE3 C;  3C8V A;  4I7Z C;  1HJ0 A;  4RKU J;  3LW5 J;  3RK3 E;  4XFJ A;  1OW7 A;  3SFE C;  5KLI C;  3AE7 C;  2BEQ D;  3H25 A;  4H44 B;  1JB0 J;  3FGA D;  2FYN C;  3S9O A;  3AE9 C;  1RQU A;  4OGQ B;  3AEF C;  1U57 A;  4IL6 X;  2WPV B;  2WQY C;  1NYH A;  5M1B A;  2YIU C;  2ZT9 D;  2E76 B;  3D6Z A;  2FBW C;  1AJY A;  2ZT9 C;  5KKZ C;  2QIW A;  4KT0 J;  1Y9B A;  1DD3 A;  3AE8 C;  2G8Y A;  3GLM A;  4Z1M H;  2E75 D;  3R4Y A;  1UIX A;  3IAO A;  1R8E A;  3Q1M A;  2E74 D;  2QJP C;  4H13 B;  2E74 C;  2WSE J;  3AE5 C;  3AED C;  1DD4 A;  3GMA A;  4U7J A;  2D2C B;  1VL2 A;  1OW6 A;  1FDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...