2E76B

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e76B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76B01
2E74B 4H13B 4I7ZB 4OGQB 2WSCJ 2ZT9B 2E76B 2O01J 2QJKC 1VF5B 2QJPC 4RKUJ 3C8VA 2WSFJ 2QIWA 1S5LX 5KKZC 1JB0J 2D2CB 2K9YA 2QJYC 5KLIC 2E75B 4IL6X 4H44B 4H0LB 5L8RJ 2FYNC 1ZRTE 4PV1B 4KT0J 4Y28J 2WSEJ 2WPVB 3LW5J 2QSIA 1Q90D 2YIUC
chains in the Genus database with same CATH superfamily
1ZSPA 2RN0A 3DC6A 1PPJE 2KP8A 2YXQB 1ZAUA 2UXXA 3OEEG 3EFFK 5GONA 3M99B 3CP1A 1XNQO 2QWPB 1T2KD 4QMAA 3ABMB 2SPZA 4QE9A 2F23A 2JVDA 1GM9A 1NWQA 3L71J 4RESB 2AEJA 1N7SB 2ZFCA 1FDOA 1Z5WA 1FZEA 2JO1A 1YITV 3IAYA 2FBWC 4CS2A 4D6TD 4X66O 5B66Z 1JY3N 4BW5A 3ZHUA 1NTZJ 5K5GB 1DEBA 3G80A 2GA1A 1D5NA 2QE7H 1LP1B 2IBZD 1X4TA 2F93B 2WSCJ 1N0JA 1PL4A 3KYQA 3Q3DA 1VARA 4BRYA 1K73W 2EILB 4EB6A 2RQ6A 4MVOA 1KB9E 2QJYB 2ZT9C 1XHXA 1PPJH 1BGYH 1ZRTD 1WP8A 3ZIAG 1WMKA 1NH2D 1JJOA 4NXNB 1VQLP 3D70A 3RVYA 1BDDA 2OTJP 4UCVA 1KYOH 1KILD 4PELA 1FE6A 2P58A 3QH9A 2B89A 3PJSK 3B8EB 2Y0EA 1HBWA 5IYZB 4FFKA 3HE5A 3BCCG 3L70H 4JI7B 3P8CE 3M8AA 1PGJA 2RMKB 3P3NA 3V4QA 1PNLA 2OYIB 1SQGA 4O4IA 5KAIZ 5CCGA 3KZIH 3LSUA 1LTJC 3K3WA 5CA1A 3H1KE 5LOVB 4AQYB 2KS1B 3TETA 3W7TA 2OWOA 4X1YA 1VQMV 2RDCA 3G71V 1OCCC 2UU9O 3RWRD 2ZYGA 1YTZT 5AW2B 4HH2A 4XBFA 4X89A 3CX5E 1R6NA 3H1IE 3BPZA 4ABMA 4LF9O 2Z3YA 1M93A 1O9HA 5CA1B 1ZR2A 1LNQA 1BT8A 1WNSA 3FD9A 3X2QB 2EIKB 3WFVA 1SF9A 2JDIH 2YKOA 4GIFA 2Q73A 5KLIB 4O4HB 1PPJD 4PDRA 2P4VA 3JAMN 2ADQB 4DR5B 1XMOB 3A2FA 2A45G 2BCCH 1RE4A 1JTHB 5F2VO 1K5SA 2R44A 2A06D 2MW2B 4E2LA 1IC2A 3S4RA 2EJRA 1Q3EA 1GL2D 1AR5A 4WY4D 4NVPA 2CGOA 2UXNA 4JASA 4BRYB 4IGGA 2JWDA 5TISZ 3L73H 1XOUA 2UXDO 2LFSA 2GUSA 3KCXA 2IPPA 2N1TC 3EVKA 2IYPA 4FM1A 1EDJA 2JGDB 3WU2H 2D2CB 1SA0B 3MDSA 4XDKA 4JI5B 4G28B 4W80A 1BSHA 2PTMA 1KILC 2OGUA 3S1KA 3IN6A 1PGQA 2BASA 1TAEA 4X1IB 1H0TB 2KI7B 3AE3C 2WSCH 1QLEB 4PDMA 1SQXD 2EZPA 1KQLA 1IZNB 2PYJA 1W2BO 3APQA 2P1JA 2ZYDA 4F6RB 2M3EA 1Q43A 3GWOA 1IFDA 1P84I 3T1HB 3KHUA 3P7KA 3CD6P 2WT7A 3OTOO 4GCZA 3ML0A 4OPAA 5APSA 1L0NE 3AE4C 1G1JA 3ZRXA 1K7DA 2QEXV 1H8AA 3L75H 2CDYA 4UV9A 4Z2WA 2IFMA 4TT3H 1KORA 4FLZA 4RJTA 2OCCB 2KOGA 1YEWA 1VF6C 3LUTB 4XDJA 4B08A 1HNXB 1L0NK 1TU3F 5AVVB 2N9YB 1OCRB 3CXHH 4JI0O 5APXA 2WLIA 1FS0G 1IFJA 1Q2NA 1XMQB 4J11A 4X62O 3OEHG 3HUSC 2YC0A 2OQQA 2VQEB 4MW8A 3V2QA 2R5DA 1YF2A 1KFNA 4HAMA 2K9YA 3HTKA 4NR1A 2B88A 4TV8A 2ZXWC 1D2DA 3U59A 2GM4A 1G1XB 4AYCA 2KB1A 3RBXA 3RK3E 1U96A 1SQQE 5CN0A 2ZE5A 1JA8A 4AQYO 3H1HG 1VQKP 5LP6A 1NJIQ 3L74D 3HD7B 2BE3A 3H1JD 1QL2A 4WBAA 1QR9A 1LWUA 5C39A 1K4CC 3CC7V 1EN5A 4J10A 4MTGA 1OVRA 5KJ7D 2AHYA 3LDCA 3H1LJ 1JFFB 4PD4I 2CGNA 1EZVD 1GKFA 1BGYJ 1FJPA 4GLXA 4Z1MH 2Q8VA 3HR0A 1K4DC 1SQFA 3K5MA 1WAZA 2Q7EA 3ABUA 3FB5C 1JOCA 2ZD9A 1UPGA 3IC7A 1V55C 1VEWA 4UV8A 3JD2A 3WG7C 1BZKA 1T2KC 3F7YC 1G2CA 4D7TA 2EINB 1VQ5P 3LSSA 4JI6B 2FXPA 1NTKH 3O65A 1EXJA 1FDMA 2OYOA 2CTPA 3CMAV 2X6BA 3E86A 5LGTA 4NXMO 2AHZA 3CD6V 1JCHA 1AB3A 1X22A 2E75C 4PJ0Z 5KX5B 5J2UB 1RQUA 3FWLA 2XNDH 4WY4B 1RF1C 1PGOA 1OIPA 3QO8A 1I94B 3CCEV 1AROP 1XNRB 1JR9A 1KECA 1NR1A 4J7KA 4P30A 2CTQA 4DO2A 2AXTE 1OHHG 3P8MC 5JCOC 4DK1A 4GX5A 1N34O 1SQVD 1KP2A 4KT0J 5DEDA 1SQVH 3E22B 4RUFA 4X8AA 2QTSA 5GTHH 4LF5O 3HPLC 1M4UA 2CUGA 1OW7A 3GF7A 1VQ6P 1H2GA 3IJ4A 1URQD 2ZVNB 3AG3C 2WSEH 2DMXA 3SSUA 2CTRA 3W67A 3TK1A 4TV9A 1QVFU 2FTKA 3NR7A 2PY5A 1NZ6A 5GTHE 4W7YA 1SQXK 1XBLA 3L72J 4H0LC 3Q2YA 1SFCA 2WA3A 3B71A 1WT6A 1K5QA 2CK3G 1NBMG 5FPRA 3PN1A 3O6QB 5GTIZ 4ASUG 2E43A 4U3FE 2ZR2A 5BR8O 1FOSF 3HKCB 1WPXA 1NU1D 3CWBG 2B1IA 2XT9A 3UT5B 1Q81W 4OX9B 2KLUA 2O01J 3CXHI 1FZCB 3ASNB 1Y9BA 2Z5IA 2DE0X 1GRJA 2NLJC 4I55A 1ENVA 2K9PA 4A7PA 3ETGA 2D2CD 1L4AA 3SYPA 4I1LA 2QA4P 3HKBA 5LP6C 4JYAO 1TUBA 3CCUP 1X59A 4DR2B 4H0LD 3ZRWB 3VQVA 2ZXWB 4J9YB 1A02F 3M0DC 3AE7C 3W68A 2KSDA 3L72E 1V54C 4LF8B 1EXIA 4L8JA 3PLNA 1SRYA 3H32A 3CPWO 4JI1B 2KKWA 3VBBA 3E2EA 1NU1J 2QWOB 2B9BA 4DV5O 5AW7B 2IU3A 3MAQA 1JMKC 2YI8A 3RYFA 3A0HH 2FYZA 4DV2O 1LTAC 4R4MA 2K9JB 4A5UB 1ZP0C 4H37A 3JCUE 3C90A 4MN4C 1NTKE 4AUWA 5E79Z 2RJZA 3BA8A 4ZI7A 3H1IJ 3QVNA 4JAAA 1JEKA 2ZT9D 2GHYA 2BCCJ 3RL0g 4DUZB 4YPCA 4JV5B 2IDBA 3H1IG 4J7ZA 4O2AB 2VRSA 1Y6XA 1U97A 3H1JE 4M3LA 1I08A 5EZYA 1RF1A 3E22A 1M5IA 3W7SA 3B5NC 3I55V 1PM9A 3PRJA 1S72P 2KZIA 2HFED 3V4WA 2PAJA 1MFZA 2AEMA 2Q4PA 1PNKA 3VQYA 3ZMSA 1IBKB 3L74G 1YZBA 5LYJB 1N8RQ 4LP8A 1EZVH 5EZYB 1RF1B 2LFRA 2UUBO 4JI3O 5LHGA 3AG1B 4GOFA 3BY6A 4DV7B 4UB6Z 2H89C 3V6IA 2YIDA 4W7ZA 4PD4D 5AVYB 2C9NY 3BCCJ 1QU7A 1P7GA 3CCLP 2LGQA 1RM1C 4I5SA 3K9AA 4LFAO 1QX8A 1IBKO 2YMKA 2Q0OC 3ZHSA 1SESA 1YHQV 3TDKA 3UM7A 1F4NA 3RYCB 3VMXA 3ITKA 3D36A 1HH0A 5KAFZ 1FXHA 3RYIA 3AEFC 4TV8B 3VMYA 4AILC 3VYIA 5BZBA 3SR2C 4QPJA 3CRAA 5A9GA 2ZR3A 4UB6E 1L4AB 2QJYC 4I55B 1VQ4P 2PGDA 2ZM6O 2NNUA 4Z1VA 5B66H 1AP6A 1BSMA 1NTMG 1BQZA 2HVKC 2J59M 1M1JA 1Y8AA 4YXWH 2OTLV 4IYIA 1JM0A 2OARA 5IY5C 3CXHD 5KTBA 1XL6A 3II6A 3E89A 2YXLA 2ZINA 1SQVG 2FFDC 1ZUQA 1UIXA 2NPSB 2KZJA 1B6QA 3P3PA 4FM0A 4JBZA 3ASNC 2EINC 1N0NA 2Q69A 2NPSD 4U7OA 3OM3B 4DZOA 2I8DA 1M56B 2XOKG 1KQFB 2PFXA 1RE3A 1SQQK 2JEUA 2XNDG 3T4ZA 2FYNC 1NTMJ 1IXMA 3SWYA 1OCOB 1H2NA 1NTKG 2YI9A 5E79H 4HZ3A 1SQXH 1KD1W 3ZX6A 3AK3A 3BA9A 4O4IB 2UUCB 4NXNO 4FZ1A 1N4CA 1FXKA 1LTJA 4IFFA 3CC2P 4CBCA 4Z1MG 1GMJA 1JOYA 1ZLZA 1BCCE 1HUCA 3BASA 1GU4A 1THZA 2UXDB 1KFMA 5B1BB 4GUNA 1M57B 1F23A 5JH7A 3RT3C 3L74E 3TGUJ 1N36O 1YJNP 3CCLV 4LF7B 4JQ0D 4EEQA 2FYUE 2IZ0A 2BSKB 1VL2A 3FYIB 2M8RA 4PD4E 3K5NA 4CS4A 3H1HH 4X88A 4JPRA 3JCUH 1XQ8A 1OVUA 1J2JB 3MHVA 3N2GA 5AVXB 5CBOA 1NS1A 1VF6A 2KSJA 2FY8A 5BXZA 3AE2C 3UO2A 4TSFG 3SYAA 1IK7A 3CCQP 3ZHRA 1SLQA 1I5YA 1BE3E 5FLXN 2EIMB 2KG7A 1XMQO 3EWKA 5EC2C 1KKDA 2WQYC 2PYLA 4MTFA 1XNRO 1U7MA 2DYRB 3UT5A 3CCVV 3TGUD 4JTCB 1GN3A 4J41A 1H2SB 1NGMB 3H1HJ 1UJWB 3HB3B 4GT1A 3EFGA 4IFMA 1NTZG 2ODMA 2WLLB 1K97A 1TVKA 2QKAA 2XUMA 4JI8B 3K5BA 3QWOC 3HKDB 1Y76B 1AI7A 1XILA 3K79A 1N73B 4PI2A 4P9PA 4WVZA 2N9BA 4XA4A 4O2AA 1U7JA 4FLXA 3I5CA 2FYUD 4DV3B 1EDLA 4HYTB 1L4AC 2F1MA 4HB1A 3TSIA 5KHHA 4JGSA 2G3AA 3FGAD 3M9HA 4BIUA 4H13C 1ZR4A 2K9JA 3KXDA 1AJPA 4LH6A 3H1JJ 1FXVA 2CTWA 5IY5B 1AV1A 5KMGA 2BTQA 1EZJA 5FL7G 5E1AC 3OJAB 1AJQA 1SFCC 1Y74B 3OGIB 4FFBA 4OXSA 2Y9ZA 1K9MQ 1FD9A 1WA8B 3CSXA 1GK4A 2OIGA 1SQBD 2Q7GA 4KFMA 1GTWA 1AI4A 2C2AA 4L87A 3B8MA 1SS3A 1ZOYC 5E79E 3G4SP 3D71A 1CW5A 2M0BA 3GG2A 1K3EA 3RYHA 4OVNF 5KJ7C 3AG7A 3DXRB 4PI0A 3UIAA 4OPHA 1PP9H 2JJLA 4YJ2B 2IBZH 3E1IA 2HPCB 5LA6A 3SWFA 4OGQC 4I7ZC 1K8AW 1Y76A 1BHBA 4UVBA 2Y48A 3RK2C 4JI1O 4YHHO 3J81N 4LF9B 2A45H 2R5BA 4ZKPA 4DW0A 4DT0A 1N8RW 1AQTA 4OGQD 4LNUB 4PJ0E 4DV2B 4K0KO 2ZKOA 4UCUA 3MD0A 1FKAO 4F6EA 4DR6O 2P06A 2KG7B 3AG2B 4IFDK 1JQ0A 4DRXA 4CZZA 3KG2A 4NYKA 5IWAO 2RCVA 2F43G 1FZAA 4FLUA 1Z2GA 2ZE7A 3Q4HB 3CCEP 1TVKB 5APTA 1OCCB 1PP9J 2MK3A 5CA3A 4U7JA 3FKSG 4LBEC 1ZL8B 4KP4A 4TLFA 1N7SC 2N74A 1WA8A 4U3JB 2Z0AA 4DV6O 1AI6A 5CBHA 2LR2A 2Q0AA 2WITA 3HUSB 3V5BA 3RVZA 1XL4A 2ZYAA 1E1QG 2PI5A 3DSQA 1ZRTE 2Q7CA 4AHCA 3L73J 1Q90D 2YKQA 4NKGB 3JC22 2PZSA 1IJDB 3L70G 4LH7A 1L4AD 3D3IA 5KX5A 2FMLA 2GSMB 5KHJA 2IX7C 1M9NA 4I50B 4AQRD 4UB6H 4MVQA 3C1LA 4PV1D 5CA0A 1W2EA 2HR3A 3OAKA 4JI4O 1VF7A 5IDJA 4F4LA 4DRXB 1XHZA 1SQBK 3TNUB 1IVSA 1NOHA 2QM4A 1KC8Q 2JRIA 5JJNB 4UVCA 3J7AU 1LTTC 3IC9A 5CCGD 5ITZA 2JS5A 1QCEA 2QE7G 1KB9I 1ORQC 1N34B 1S76D 1ZWIC 3CMEV 2W6JG 4FM2A 4YJ2A 4JI4B 3CCSP 3T1YO 4PA6A 5IYCO 2EIMC 1CI6A 3WU2E 3ZJZA 4FVMA 1IFMA 2KQXA 3JARA 1ZV8A 1L0NG 4KJMA 3WUUA 4LF7O 3FB7C 1NU1K 4DR4B 3OUFA 1BCCD 1ZLLA 2Q7HA 3T2MA 1ZW0A 2E42A 2ZVOB 2UU9B 1IFPA 1LWUC 2WSFH 4EI2A 1S0VA 1YI2V 2FXMA 3MTUE 5AVUB 2LW7A 1LT9C 3VP8A 4I50A 2H88C 3LNNA 4PD4H 1YVWA 3GHGC 1DIPA 4LFCB 1Y47A 4WF9V 3AECC 5AW1B 2OT5A 2OYHB 2P22C 4D6TG 3H9VA 3KZIE 2GV9A 3CCJV 4Q20A 1LP1A 3TGUG 1FXKC 4QNHB 3AE6C 3SJCC 5TJHA 1FC2C 1NTZD 4UB8E 2QKCA 1SQQG 2YSUB 3HUSA 1PV0A 3USSA 2HODB 5LOVA 2N05A 1KKCA 1PZQA 2CH7A 3B77A 2Y0DA 3ZN0A 3KZIZ 1NKDA 3BFRA 1AR1B 2HG5C 3MHHC 4F6RA 3PHLA 4DV0B 1NU1G 1KB9F 4I4TA 4ZI7B 2HYNA 3L70E 1P4RA 4WFGA 2O01N 4KXRA 2E5LB 1DD4A 4UXNA 1NVPB 1CSBA 2YIUB 3KDPB 4OH8B 2AGAA 1NTMK 1AFOA 2M5AA 2UWJE 2XZRA 2OYIA 4QE7A 5LP6B 4U3FG 1SQPH 1NJIW 4I4TB 5LMNO 1M1JC 3AE8C 5CCHC 3RK3D 3RL0D 3ABLC 1W2BU 4EYYQ 3AE9C 2UUAO 4TOIA 3SPIA 1LWUB 3GMAA 5AVTB 1SQBG 2ZE8A 4I0XB 2PF4E 1I5XA 5L3CA 2BOBC 4EIJA 3JARB 4L73A 2CAZC 1SQPE 4WB4A 2LGWA 2QWNB 5KLVH 5LBQA 2FB5A 4X1KB 1GO3F 1HWTC 3K0DA 1USDA 1J95A 4JI5O 4N78D 2H43A 4J80A 3L72G 1L0LH 1XEQA 1FZGA 1GAXA 1OCRC 5IYBO 5KAFE 1ZL8A 4GKJB 4K8XA 1NO4A 3I56P 3QO7A 5CJ0A 2O3JA 3KCYA 3ZRSA 3JD0A 4X1KA 4R8CA 4RKUJ 1SFCB 3L37A 5KHIA 2QJ1A 2A06G 3QO5A 4IL6H 3FB8C 4N6JA 3V2PA 2V4HA 4BIOA 1CI6B 1RF0C 1SVFA 5B5EE 1R1BA 2B9ZA 1TGOA 3JSVC 2A0LA 3OMIB 3WB0A 4NPEA 3VQXA 4WFHA 1GZLA 2OIEA 1KMIZ 1WB7A 1YTZI 2OTLP 3HD7C 2B87A 1DH3A 1JY2N 4BWNA 2M7WA 3W7UA 3CWBE 1KBHA 1LTSC 1VF5B 3S3WA 4R50A 4GOEA 4X64O 3G6EP 1KILA 5CA0B 5KA5A 4U7NA 2EJ7A 1SQVJ 3L71G 2Q1KA 5DN6G 1AA0A 1PL0A 4B7EA 4TWKA 2DWEC 4X1IA 3CB2A 3DC5A 5IE9A 4GYCB 4WFBV 1W5CE 1FYJA 1CP9A 4DR3B 1JMMA 3KPEA 1PV3A 1H8EG 3FB6C 1GW4A 3A0HZ 2JR8A 1SKVA 2ZIMA 3CI9A 4KHXA 1X9VA 2YNYA 1EM1A 3T1HO 1JY3O 2E74C 1KZUB 3A7OA 1GDTA 4RUEA 2CE4A 2OYQA 1BQ0A 3VN0A 4JI6O 1RE4C 1OZHA 2WSSH 3AG1C 2ZXEB 2YXRB 5AVZB 2H94A 1G4YB 4LFCO 3OGCC 3H1HD 2R9IA 1KUQA 3CCVP 1M56C 1P84H 3T4DA 4DV6B 3H1JG 2IJJA 4DJGA 3MP7B 1PP9D 2KUBA 2XAJA 4DW1A 3B40A 3O9OA 4BW9A 1OCOC 1VQMP 3IGAC 2ZJSE 1RSOB 5EYPB 1J1EB 1MFTA 4DR4O 2WSFJ 1B3QA 2AW9A 4WBNB 3ICXA 4JI2B 1DEEG 4JF3A 4X65B 1JY2O 5BVZA 2PI4A 1MNGA 5LL6Y 4DV4O 1QLED 3A0BE 2PRRA 5EBWC 4MT8A 5AW5B 5A2QN 1YJWV 1VQOP 1JMBA 2KIKA 5KMGB 4PA4A 2HHHB 1SQBE 2BTOA 3H1KG 5LHHA 4L76A 3GHGA 3WB2A 4GODA 3CEIA 2ARHA 1VQ4V 1KYOE 3AEEC 3TXQA 3K57A 3BVHA 2KLVA 2ATKC 2FXOA 3JD1A 5KJ7A 4IOIH 2C9LY 3C3TA 3JAKA 3MZWB 5IJ0A 1BCCH 1M1KW 1HVVA 4ASVA 4C7NB 1M1KQ 4JI7O 3SPGA 4JYAB 4GZRB 4PJ0H 4DR2O 3M91A 2PUSA 1BE3D 1E79G 1G1IA 4X65O 2X6AA 2UXCO 5DJTB 1I7FA 4TUYA 1GN2A 2DYRC 3BABA 5FPOA 4OX9O 1M57D 2XAQA 1HW7A 5JJJB 2F4VB 1E79H 5APUA 1W0JG 1URFA 2DQ0A 4X20B 5CB4A 1BCCJ 3V2NA 1OXZA 1VQPV 1RPOA 3RK2B 5H6RA 1OW6A 4QGPA 2P6JA 1SQQJ 4H44C 5GONB 1VQ6V 5IYDO 3A5TA 3P32A 3SPJA 1MABG 5KUKA 3QF7A 5LA6B 1SQPD 1KYOD 4DV3O 3AG2C 2YICA 4B3SO 3E7KA 2GUZA 1H89A 2HPCA 2UUBB 2YIBA 1JJ2U 1HR0B 2LJ2A 1DGSA 3CCQV 1A32A 1R6KA 2F66C 2JP3A 1K05A 4TV9B 3S3XA 1NVPD 1QVGO 2O57A 2VQFO 1SQXE 4CPGA 1J1DB 3QNEA 4IL6Z 1Q86W 5AW9B 3G3ZA 2JIZG 2Q5ZA 5KUMA 3E8FA 3L72D 5CMZA 2J5UA 1KTMA 1M90Q 3U11A 3RGBA 1YJ9P 4LLHA 1MOFA 3ZCCA 3W7WA 4FLVA 1GMGA 3L35A 4KHPB 1GN6A 5AW4B 3BRCA 2EX3A 1BL8A 2WLMA 1S5JA 4H44D 2AEFA 3ZS8C 2E76B 4Y99B 3CCUV 1Q82Q 3CXHE 4UCOA 4B3RB 2X7RB 1NU1E 2P4KA 1H88A 1BGYE 2Y0PA 1QHTA 1X0TA 1VMGA 3H1LE 2E76D 4D6TJ 5B66E 5EIBD 1MUUA 4QJFB 5JH7B 4LF8O 1J5EB 3A3YB 3TYYA 4DR1O 4H0LB 2XHBA 2HJDA 1L0LE 2K1EA 3CCMV 2WSSG 2WPVB 1G8MA 1H2KA 2IYOA 3M0DA 2WPRA 3CX5D 3G71P 1NTZE 1VQNP 5B3SB 3JCZA 3LDEA 1PIXA 5LHIA 5CCHA 3TCUA 4DV1O 4JYBA 1OVVA 3OMNB 1J5EO 3CCSV 1Q7YW 1MSDA 1RFYA 2MKVA 2CPSA 1AQ5A 4RQEA 1ZTEA 4XE5B 1IO4A 4ZBMA 1JO5A 1NI8A 3STZC 4K0KB 4MS2A 3P8CD 1EDIA 3WUTA 1QVGU 1G6UA 4FLTA 1GN4A 1T3JA 4FPPA 1S5HC 5LXTB 1N2DC 5IJ9A 1JNMA 4I7ZB 5KAIE 3CRMA 1FOSE 3CRRA 4ZIBA 2A45I 5L3FA 4MVSA 1PKXA 4JI8O 3D6ZA 2C0XA 1EN4A 3CE2A 1N32B 1EQ7A 4O4LA 2X6CA 1KILE 3ZMVA 4JYCA 4Q6GA 1K9MW 4EOTA 3Q1MA 5FNVB 5HFMA 1T8ZA 1E1RG 2FYUH 3RYCA 2IH3C 3OT7A 1F4MA 1U57A 3ASOB 4I9QA 1H2LA 3K5LA 2A06H 2VWJA 2YEVB 1YIJV 1YJ9V 4OWFA 4JI2O 1IX9A 2GUZB 1M90W 4LCUC 2UXBB 4WBNA 1D5AA 1NQTA 2JEXA 1Y66A 4D7SA 1L0LJ 2NRGA 4NXMB 4YJ3A 1GH6A 4J9ZB 2V7QG 2WTYA 5GTIH 4RQFA 4P2ZA 1HWYA 1JFFA 1L0NJ 3L72H 2RMZA 2WLJA 3G6EV 2W6BA 2WLKA 1IZ3A 1ZXGA 3T97B 2WPQA 2IM9A 3K04A 2M5AB 2P2UA 3ZDMA 5KLVG 1LTJB 2AXTH 1LUWA 2UXBO 3W7XA 4G27B 5KHGA 4TUYB 1N7SA 2WSEJ 1Q7YQ 1DF5A 3CWBJ 3EHBB 3A0RA 5KAIH 1YCIA 4ZOLB 2KB7P 1SQBH 4YIPA 4K8ZA 4DUZO 4JTDB 1GL2B 1VQPP 2EBOA 4WFAV 5APQA 1CPYA 4NPFX 2HKOA 3OMAB 3OR6C 1R3LC 4JAVA 1SETA 2K1AA 4DOJA 3BEHA 3NTNA 5H6QA 3IR9A 5AVWB 3JAKB 2ZQMA 1K8AQ 1S77D 2P5OA 4EB6B 3MUDA 1KN7A 4X62B 2G8YA 3AG4B 2V4DA 5J9PC 2QSAA 4DR6B 1LJ2A 2QG4A 4RO2A 1FJKA 1HGVA 1R73A 4QPKA 3OTFA 3WUVA 3APOA 1NU1H 2YUAA 3CS5A 4GKGA 3ETEA 2QEXP 5CBFA 3UKMA 2HHHO 1BGYD 1HGZA 2QA4V 3SPHA 3PTZA 1WB8A 3VMAA 3GB7C 4L74A 3C8VA 1FPOA 4CS3A 2OYIC 3LDDA 1NKNA 3OW2U 2ITDC 1SQQH 4EKWA 4N21A 1YBKA 3H1LH 4C46A 2YXHA 4IL6X 4DV1B 1PP9E 1J1DC 1DK1A 5EBLC 3SYCA 5CBNA 1EZVI 2E76C 4Y99C 2WLLA 3SFDC 1KC8W 4PDVA 3A2AA 3BRTB 1GK6A 1MA1A 4IHJA 2ZT9B 4KL1A 4AI8A 1KILB 1LUVA 2OYHC 5APYA 4LC1A 5DM6V 3X2QC 5BY1A 3UO3A 2UXCB 1NKZB 1L0LD 1R3JC 2IU0A 3PH0A 1NYHA 2R9AA 4DCKA 3LNMB 1VDFA 2Y0IA 3O8ZA 2R3CA 3U10A 3AEDC 1R6TA 1L0NH 4YY3B 5JCOA 4TQFA 3ABVC 1P7BA 2W6JH 2FKWB 2E5YA 4GDOA 3ETDA 4K35A 2EIJB 3ABMC 1L2PA 3FXEA 1OX3A 3G6BA 4MTXA 1SQPK 2QIWA 1EC5A 3L75J 2XTAA 2W27A 1ZMEC 1EBOA 2Q6AA 2LXCB 2W0FC 1YHQP 5IT9N 3FYEB 2FYUJ 1IK9A 3UQ8A 3B5ND 4X64B 1COWG 3JALA 4X66B 3V2RA 2IJIA 4DR3O 3JAWB 1Z5VA 1BDCA 1CXZB 2BTQB 1RP3B 3FAVA 1S5LE 4JZ2A 2WPDG 3BVOA 1IURA 2ITCC 1OZ0A 4UVAA 1HJBA 1XNQB 1MV8A 2RKLA 1RSOA 3CCRV 1NTKD 5EBMC 4ICGA 4PHZA 1GL2A 1NHLA 4DV5B 3AEAC 1NAYA 2R72A 2DN9A 2HP8A 2NR5A 3FXDA 2FKXA 2ZDIC 2I1KA 1S5LH 1VQ8P 5EFWB 3L75E 2E3CA 3L71D 3WU2Z 5AG2A 1R3IC 2BOCC 1URQB 1Y67A 1FZCA 3M06A 1DTOA 2DWDC 1BE3H 1B04A 4FMTA 1X79B 5TISH 4EDFA 4JYYA 1FJGB 1VQLV 2K37A 2R70A 1PNMA 5AVSB 5KLVD 3SJBC 1IFNA 1DLBA 3MIWA 1YDXA 2RN9A 4FIPC 1FBMA 3ZRWA 2QVAA 4DYLA 2ADPA 5IJ0B 1MG1A 4IHJB 5GTHZ 5APWA 4WWIA 3S9OA 2BSKA 5H2FZ 2VQEO 5L3BA 1XI1A 1M1JB 2YKPA 1SQVK 1FFXB 4TQDA 3HTKB 2ITAA 3SWKA 2ZDIA 1IBMO 3U0ZA 3L73E 1KU9A 4RWUA 4NTXA 3THOA 3H1LD 3N4XA 1JCCA 1P84F 2IBZG 1PP9G 2IZ1A 1W0KG 3OE7G 4DR5O 5K1XA 1XMOO 3N2KB 2GTAA 2E5LO 3LIDA 5J2UA 2AZ0A 4WY4A 1SZXA 1S3JA 3K58A 3L70D 3A8TA 1SC5B 4BIZA 1WP7A 2YMYA 3L73D 4DV4B 4X1YB 3IFXA 1QEXA 2KS1A 4XDLA 1NT2B 3FAVB 4FZ0A 1XTGB 3D36C 2WT7B 2QRXA 4BXLA 2Q5UA 4LGDE 3CPWU 5EK0A 1S9KD 4R6ZA 1S2EA 3D6YA 3WMM0 1LTBC 4LF6B 4JF7A 4C7RA 1OV9A 3CLQA 2DOSA 2IW5A 5CB4B 5KA6A 4B3MB 3R65A 1HF9A 4O4HA 2W83C 2E74D 3SGIA 3I55P 3AEIA 2GTSA 4G2KA 3KQGA 1FFTB 1LT9A 1WLEA 4R7CA 4CC5A 4ZHQA 2C0WA 2BEQD 3RFRA 2LKMA 4FK5C 3SJAC 4CH4A 2P7JA 5M1BA 4LNUA 1NH4A 1MZ9A 3G4SV 2FFDA 1YQ4C 5HFLA 1HP8A 2QWRB 3ZN1A 1QNMA 3KKYA 2EULA 1R5SA 4W4KA 2DYSB 2L6LA 1NTZH 2HJFC 4C7UA 1BE3G 3B5NA 4ZKUA 1K73Q 1BSNA 3CCJP 1VPCA 2Y9YA 2QDOA 3RK3B 1M57C 3RL0B 1MZEA 5B1OA 3CRQA 1VQ5V 1Q8IA 1T3UA 3WG7B 3I5DA 4JV5O 1K34A 1Q82W 2XU6A 3B8NA 4NPDA 1NTZK 1XTCC 1RPRA 2Q3IA 1N32O 2B87B 3TXSA 2IJKA 4MTOA 3B4SA 4UCRA 1H0TA 3ZMZA 1T6AA 1IXBA 5L3EA 2W8ZA 2Y4TA 2YDEA 3RBZA 3CMEP 2HODA 1DD3A 3OTOB 1SFCD 1K92A 1EN6A 3K59A 1KQGB 2NPSA 4WY4C 4MVUA 2KYVA 4UFZA 5H9CA 3ABKC 5BMVA 1CZQA 4LFAB 2I1JA 1GTOA 3CYOA 3ZHQA 1YXBA 4OGQB 3L4FA 4B3SB 1KB9D 1KQSU 1AJYA 3D8CA 2Y4UA 2QJKC 3A0HE 3SYOA 5B1AB 3CRCA 3GVMA 3K9SA 1RM1B 5AVQB 5B5EZ 5JVDA 3OD4A 1HNZO 1BE3J 1SQXG 5ITZB 1S9KE 3CHXA 3ZMUA 1M8OB 3BRVB 1NTMD 1RH5B 2B5UA 5D5QA 4U3FD 3SDLA 1B06A 3VMZA 3CX5H 4MW3A 4EFBA 4EFEA 1OW8A 1X8YA 2RH0A 1GM7A 4BAYA 4N3YB 1YTFD 4YXDC 3H1HE 2QSIA 1YJWP 5CBGA 2XAHA 1NTKK 3R2PA 2E74B 3B2EE 3ETQA 5L3DA 3JATA 1QVFO 2QWQB 2B1GA 4I0XA 4B7KA 3IAOA 5APVA 1YITP 4GX1A 4IYHA 3QG5A 1H38A 3B5NB 3H25A 5DJUB 4K3AA 2ZIOA 4PA7A 2YIAA 2D3OW 2UUAB 4I6MC 4O4LB 1I94O 2YS8A 1KYOF 4B3TO 3Q5RA 4YXWG 3CC4V 3H1LG 1FZCC 3AE5C 4UB8Z 1NTMH 4YHHB 4L75A 3T1YB 2FL4A 2CPBA 2HVJC 4DUYO 2KK7A 1JX9A 1LT9B 4J7JA 1MKMA 3U1AA 1KD1Q 3DGEA 1N73A 1IBLO 2XDJA 4WCEV 1T5EA 3OR7C 4B3TB 2QJPB 3RW0A 1NAFA 3Q5PA 2E5TA 1NTME 3ABKB 5JVDB 2ZNIA 1N7LA 1AP5A 1VF5D 2R9RB 3R4YA 4YJ3B 2QM7A 2JGUA 4CH5A 1HDJA 1JB0J 3VOUA 4O4JB 2JS3A 4XFJA 3L9DA 2YXYA 1VQNV 1R8EA 3F5TA 2W90A 3SFEC 4PA9A 1L0LK 2BCCE 3HD7D 1JTHA 1EZVG 1SERA 4HNAB 3AEBC 3AG4C 3L74H 1OCZB 1Q6HA 1KP3A 3P30A 1OJHA 4FFBB 1NVOA 3N2KA 1VP7A 1Y4MA 1SQQD 2VRZA 1D7MA 1LGHB 3HRNA 2E75D 2LQTA 5CHXA 4W4LA 1FZBA 3H1IH 2Q68A 4UUJC 1WJZA 1QR8A 1YI2P 1H2MA 2Y0CA 1FAFA 3BHPA 2P67A 4J42A 5EIBC 2N1TB 1YTFB 3B09A 2V7QH 1XDCA 5B5EH 3EQ2A 3SJQC 2Z5HA 2YIUC 1P49A 1M7LA 4ASWA 4ZMDA 1MZFA 1O9GA 3STLC 2EIKC 1HTLC 2XNXA 3O6QA 5JJEB 5LMUB 4HKZH 3L75D 1WRGA 1KYOI 2FYUG 4CH3A 3M9QA 2R32A 2O1JA 1VQ7V 4JPZB 2MJZA 1SZTA 3CCRP 4N23A 2H8PC 4IL6E 5CCHD 1W59A 2VQFB 1ZN5A 2WWWA 3F89A 2CH7B 4DUYB 4LR3A 2F95B 3EXAA 1YQ3C 4WFEA 4D6TE 2BCCD 1SQBJ 4N78E 5EYPA 4DK0A 2IBZE 1KV4A 4DV0O 2XV5A 3DTUB 2WA4A 3CWBH 3F5WC 2WLIB 3GF3A 2H7HA 1GU5A 1AR4A 1FJGO 2PGGA 4CH6A 2FYNB 1AVYA 2CK3H 1R3KC 2K3RA 2ZNJA 3F5HA 4LFBO 5B1NA 3JSNA 3RYFB 3UCSC 3K03A 4DR7B 3JAWA 1ZX3A 1HNZB 1N86A 3H6PA 1YIJP 3Q4HA 3ZRVA 4DR1B 1L0ND 3JD4A 4O4JA 2UUCO 2OCHA 2HG5D 3RGUA 3A0BH 2A9HA 2HFEC 3GHGB 1V9PA 2WPSA 3TF5A 4HNAA 1Q81Q 5H5NA 4FLYA 3SYQA 2PP6A 3RK3C 1LR1A 3RL0C 1RY3A 1DX7A 2AZ2A 5B1BC 3JSLA 3U1CA 4GX2A 3CJHA 3D3QA 1N33B 3ZHVA 1QBZA 3H32B 1VF5C 2P10A 3OW2O 4LF4O 2HLDG 1MMMA 2G38A 3MHSC 1GD2E 1BS3A 4ZNCA 1NR7A 1JY3P 5KLVJ 1MSWD 3GLMA 1USEA 4UCSA 1RQVA 3LW5J 4B86A 1VQOV 3OAAG 4DXWA 3BAAA 3RYHB 4H13B 2QKSA 4I9WA 1QLNA 3J80N 4U3FJ 3E83A 4PD4F 4X20A 3FX0A 5LGUA 3H1ID 5BU8B 2Z5UA 2D2CC 1V55B 5C8YB 1GK9A 5CJ4A 5LMUO 2N1TD 4H13D 1OFCX 3E35A 2HLOA 3T97A 3MUDC 3H01A 5GTIE 2E75B 1FFXA 3JCUZ 3RYIB 5FNVA 3ABLB 2W6IG 2WVRA 2L35A 2N1TA 1GL2C 4GKJO 4PV1B 2ZM6B 1A02J 3MGNA 1Z56A 4PDLA 3BATA 1QQCA 2YEVA 1OWAA 3K0GA 2QJKB 1NH2B 3K06A 1F7YA 3AEGC 1YSCA 2YO2A 3NFQA 1Q5OA 1H8HG 4X9QA 2A79B 3FX7A 3BCCD 4JI3B 3OFNG 3ZBHA 1AI5A 3CMAP 2A7WA 3C3SA 2L5GB 4LF6O 4FLWA 3AK2A 4H44B 3K5OA 1N73C 5KLVK 1FDIA 2DW3A 3GWKC 2P7TC 2R3SA 1JCDA 2KNCA 3L71E 2Y69B 1IFIA 1URQC 5IWAB 5KHKA 4UCTA 2QGNA 2LXBA 3K08A 5C8YA 1GW3A 3JYCA 1S1CX 4P9OA 2M3BA 2Z4EA 2A3QA 1AILA 2LP7A 1Q6UA 3VQWA 1N7SD 3CC4P 2H3OA 4O9BA 4IT5A 4FJCC 1BCCG 2POHA 1G2CB 2J58A 3FWNA 4LF5B 1P84E 2Q67A 4TT3G 4O2BA 4JAUA 3L75G 2Q6QA 1F51A 3FFQA 5CMUA 4MVMA 2ZXXA 3CX5F 4LF4B 4HJGH 1SA0A 4GX0A 1YYCA 1YJNV 2JKVA 2ETNA 5EC1C 2LW1A 1HNXO 4LWSA 2WLHA 3AG3B 5TISE 1VQ9V 1N36B 2XASA 1JVMA 3BCCE 2HEPA 5AVRB 2KSEA 2ZCEA 1VQ7P 3H1KH 2RNBA 4C7NA 1PL5A 2YO3A 3RK2D 3LSQA 4YIOA 1S5LX 1HR0O 5AW3B 3E8BA 1JPXA 3CC2V 2AXCA 1KB9H 1L1FA 2JWAA 3I56V 5KAFH 3VTPC 1S4XA 2N04A 2NN4A 2O1KA 4R4LA 3T1CA 2JJ2G 1XREA 2IJHA 2OCCC 3CXCU 2DQ3A 4JTAB 5IJ9B 1TUBB 1LTGC 5DECA 4U3JA 3HKBB 3N7NA 1JY2P 3L73G 1WN7A 4E4EA 1SQXJ 1WPBA 3H1JH 4GKKO 3RN4A 3CC7P 1OMIA 3JD3A 5C93A 4WFFA 5KKZC 4JZGA 5J2TB 2ZAEB 3M7MX 5LYJA 1K04A 3ABTA 1AJNA 4B3RO 5AW0B 2BCCG 3HKDA 2L91A 1V54B 1CEZA 3HE4A 3Q5SA 2X0LA 1EDKA 1EZVE 3TJTA 4LWSB 5LMNB 4BWAA 2OTJV 1TA8A 1HJ0A 3CX5I 1RHZB 2JDIG 3H1KJ 1BHAA 4I2LC 1PD3A 3E8GA 1RE3C 5K1PA 1VQ8V 3HKEB 2JK5C 1FAVA 3G9RA 3TNUA 2XKMA 2V7QJ 2EZOA 3HD7A 2WZ7A 5GW7A 3ZHTA 3HE5B 5LGNA 5KLIC 2FYUK 3N27A 2BEZF 2GBOA 3M9BA 2Q9LA 2OYHA 4IIJA 2DW4A 5AW8B 4NTYA 3L71H 4MSWC 5KLVE 1P84D 5JWPA 3CWBD 2WMMA 1UIIA 1Y74A 3AK1A 3JATB 5D5PA 3CJHB 3VOPA 3L70J 3DXRA 2EIJC 1N33O 3H1KD 4YY3O 3L74J 3TGUE 2DJVA 2JJ1G 3E8HA 2IFNA 3BCCH 2WLNA 2FFDB 2W6AA 2F4VO 3C9IA 4QIWF 3M0AA 1S72V 5KKZB 4PA3A 1BGYG 2OTKE 5AW6B 3CL3D 2QR4A 1PPJG 2QTOA 1I0HA 5H2FH 3G67A 3WB1A 4DR7O 4H33A 2M6YA 3JASA 4HYOA 3HKCA 2XAFA 1TUEB 3QTCA 4B3MO 2WAMA 3LIEA 1JUNA 1QLEC 3VP9A 2ZE6A 2IBZI 1L0LG 2EILC 1HNWO 2QJPC 1FS0E 3GW6A 1FXKB 4MVRA 1US6A 1AVMA 3R66A 3OA7A 2AXTZ 1Q6IA 5J2TA 3CXHF 2K88A 3PP5A 5LXTA 5JQGA 2GUVA 1R5LA 4UB8H 2KNCB 1PFIA 3OUSA 4RAIA 5H2FE 1VQKV 1S5LZ 5L8RJ 3HE4B 2W0XA 1K33A 5L3GA 4JI0B 4MVZA 1QL1A 1UFIA 1VIBA 5IYZA 1LTIC 2JGDA 1M56D 1NTKJ 3ZMTA 1IBLB 3NXSA 3IF4A 2QM8A 1OCZC 1PGPA 1SQPG 2ILMA 3ASOC 2KXPB 4U3FH 1L8DA 3L36A 1LT1A 1KQSO 2LO1A 2Y69C 1BMFG 3IFMA 1DF4A 3F7VC 3JALB 3LW5H 4YTPC 3A0BZ 4HBNA 2Q9IA 1SQPJ 1IBMB 2NZ2A 1FZFA 4NTWA 3NMDA 4ZKIA 2JEEA 3ZEDA 4GKKB 2VWKA 4IIJB 4PV1C 3SPCA 1HNWB 5CCGC 1AVOA 1Q86Q 2IH1C 4KUMA 2DYSC 3E1RA 4NB5A 1SP4A 2P90A 2A06E 2GDSA 2O01H 2V1DA 5B1AC 1SQVE 1XUQA 1FU1A 1EFRG 2H8PD 1URQA 1SS1A 5BU5A 3HKEA 2VS0A 4DV7O 5JQGB 4RO0A 4O2BB 4ZOLA 1QGKB 3TGUH 5BR8B 4BR6A 5BMVB 1E5WA 2YIBD 1J1EC 3AE1C 1VQ9P 1IDSA 4D6TH 1ROPA 1RF0A 3N2GB 4ZHQB 4CC6A 2Q3EA 5B3SC 3CCMP 4Y28J 2NPSC 2XAGA 4KHPO 4LFBB 3JASB 1GM8A
chains in the Genus database with same CATH topology
1VL2A 2E74B 3IAOA 2FXPA 4GDOA 2JP3A 1S1CX 1K05A 2E74C 1EXJA 3D6YA 3H25A 4U7JA 2E75C 3GF3A 2QIWA 1RQUA 3AE2C 1ZMEC 3Q5RA 1KTMA 1DD4A 2D2CB 2J5UA 3AE5C 1IK7A 1FDOA 3T97B 2E74D 1HF9A 2JO1A 2FBWC 3EWKA 2H89C 2WQYC 2BEQD 1ZRTE 3IN6A 4KT0J 1MKMA 2WSEJ 5M1BA 1Q90D 3AE3C 3AE8C 1YQ4C 1NGMB 1OW7A 2WSCJ 2YMKA 3GF7A 4H44D 3Q5PA 2E76B 3AE9C 3Q3DA 2QJPC 3GMAA 1VF5D 3R4YA 1PL5A 3AEFC 3AEAC 2WSFJ 1S5LX 2ZT9C 2E76D 1JB0J 1VF5C 2QJYC 3AE4C 4PV1D 2P10A 4XFJA 4H0LC 3Q2YA 1R8EA 1WMKA 4R4LA 3B71A 3SFEC 2G3AA 4H0LB 3GLMA 5L8RJ 3FGAD 4TT3H 2G8YA 3D70A 1KORA 1RQVA 2WPVB 3LW5J 3AEBC 4H13C 1TU3F 4H13B 2O01J 1PIXA 1UIXA 2D2CC 1Y9BA 3AEEC 4RKUJ 1OMIA 3C8VA 2E75D 4YTPC 2OQQA 4H13D 5KKZC 3S9OA 2D2CD 2MKVA 2NZ2A 2K9YA 1DD3A 1KQFB 1K04A 2E75B 4IL6X 4H0LD 1KQGB 4PV1C 3RK3E 3AE7C 1ZOYC 2FYNC 3Q5SA 3D71A 2E76C 1KMIZ 4PV1B 3SFDC 1EXIA 2YIUC 1HJ0A 4OGQB 4I7ZB 1AJYA 3AEGC 3O6QA 2ZT9B 4OGQC 2QJKC 1VF5B 3G9RA 2H88C 4I7ZC 2V7QJ 1DIPA 3AECC 3D6ZA 4R4MA 1ZP0C 1GMJA 1OW6A 1KILE 5KLIC 1NYHA 4OGQD 3AE1C 4H44C 2BEZF 3Q1MA 3AE6C 4Z1MH 2ZT9D 3RL0g 4H44B 1OW8A 1U57A 3AEDC 1FDIA 2IDBA 4Y28J 1PV3A 4YXDC 2QSIA 3ABVC 1YQ3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  4H13 B;  4I7Z B;  4OGQ B;  2WSC J;  2ZT9 B;  2E76 B;  2O01 J;  2QJK C;  1VF5 B;  2QJP C;  4RKU J;  3C8V A;  2WSF J;  2QIW A;  1S5L X;  5KKZ C;  1JB0 J;  2D2C B;  2K9Y A;  2QJY C;  5KLI C;  2E75 B;  4IL6 X;  4H44 B;  4H0L B;  5L8R J;  2FYN C;  1ZRT E;  4PV1 B;  4KT0 J;  4Y28 J;  2WSE J;  2WPV B;  3LW5 J;  2QSI A;  1Q90 D;  2YIU C; 
#chains in the Genus database with same CATH topology
 1ZSP A;  2RN0 A;  3DC6 A;  1PPJ E;  2KP8 A;  2YXQ B;  1ZAU A;  2UXX A;  3OEE G;  3EFF K;  5GON A;  3M99 B;  3CP1 A;  1XNQ O;  2QWP B;  1T2K D;  4QMA A;  3ABM B;  2SPZ A;  4QE9 A;  2F23 A;  2JVD A;  1GM9 A;  1NWQ A;  3L71 J;  4RES B;  2AEJ A;  1N7S B;  2ZFC A;  1FDO A;  1Z5W A;  1FZE A;  2JO1 A;  1YIT V;  3IAY A;  2FBW C;  4CS2 A;  4D6T D;  4X66 O;  5B66 Z;  1JY3 N;  4BW5 A;  3ZHU A;  1NTZ J;  5K5G B;  1DEB A;  3G80 A;  2GA1 A;  1D5N A;  2QE7 H;  1LP1 B;  2IBZ D;  1X4T A;  2F93 B;  2WSC J;  1N0J A;  1PL4 A;  3KYQ A;  3Q3D A;  1VAR A;  4BRY A;  1K73 W;  2EIL B;  4EB6 A;  2RQ6 A;  4MVO A;  1KB9 E;  2QJY B;  2ZT9 C;  1XHX A;  1PPJ H;  1BGY H;  1ZRT D;  1WP8 A;  3ZIA G;  1WMK A;  1NH2 D;  1JJO A;  4NXN B;  1VQL P;  3D70 A;  3RVY A;  1BDD A;  2OTJ P;  4UCV A;  1KYO H;  1KIL D;  4PEL A;  1FE6 A;  2P58 A;  3QH9 A;  2B89 A;  3PJS K;  3B8E B;  2Y0E A;  1HBW A;  5IYZ B;  4FFK A;  3HE5 A;  3BCC G;  3L70 H;  4JI7 B;  3P8C E;  3M8A A;  1PGJ A;  2RMK B;  3P3N A;  3V4Q A;  1PNL A;  2OYI B;  1SQG A;  4O4I A;  5KAI Z;  5CCG A;  3KZI H;  3LSU A;  1LTJ C;  3K3W A;  5CA1 A;  3H1K E;  5LOV B;  4AQY B;  2KS1 B;  3TET A;  3W7T A;  2OWO A;  4X1Y A;  1VQM V;  2RDC A;  3G71 V;  1OCC C;  2UU9 O;  3RWR D;  2ZYG A;  1YTZ T;  5AW2 B;  4HH2 A;  4XBF A;  4X89 A;  3CX5 E;  1R6N A;  3H1I E;  3BPZ A;  4ABM A;  4LF9 O;  2Z3Y A;  1M93 A;  1O9H A;  5CA1 B;  1ZR2 A;  1LNQ A;  1BT8 A;  1WNS A;  3FD9 A;  3X2Q B;  2EIK B;  3WFV A;  1SF9 A;  2JDI H;  2YKO A;  4GIF A;  2Q73 A;  5KLI B;  4O4H B;  1PPJ D;  4PDR A;  2P4V A;  3JAM N;  2ADQ B;  4DR5 B;  1XMO B;  3A2F A;  2A45 G;  2BCC H;  1RE4 A;  1JTH B;  5F2V O;  1K5S A;  2R44 A;  2A06 D;  2MW2 B;  4E2L A;  1IC2 A;  3S4R A;  2EJR A;  1Q3E A;  1GL2 D;  1AR5 A;  4WY4 D;  4NVP A;  2CGO A;  2UXN A;  4JAS A;  4BRY B;  4IGG A;  2JWD A;  5TIS Z;  3L73 H;  1XOU A;  2UXD O;  2LFS A;  2GUS A;  3KCX A;  2IPP A;  2N1T C;  3EVK A;  2IYP A;  4FM1 A;  1EDJ A;  2JGD B;  3WU2 H;  2D2C B;  1SA0 B;  3MDS A;  4XDK A;  4JI5 B;  4G28 B;  4W80 A;  1BSH A;  2PTM A;  1KIL C;  2OGU A;  3S1K A;  3IN6 A;  1PGQ A;  2BAS A;  1TAE A;  4X1I B;  1H0T B;  2KI7 B;  3AE3 C;  2WSC H;  1QLE B;  4PDM A;  1SQX D;  2EZP A;  1KQL A;  1IZN B;  2PYJ A;  1W2B O;  3APQ A;  2P1J A;  2ZYD A;  4F6R B;  2M3E A;  1Q43 A;  3GWO A;  1IFD A;  1P84 I;  3T1H B;  3KHU A;  3P7K A;  3CD6 P;  2WT7 A;  3OTO O;  4GCZ A;  3ML0 A;  4OPA A;  5APS A;  1L0N E;  3AE4 C;  1G1J A;  3ZRX A;  1K7D A;  2QEX V;  1H8A A;  3L75 H;  2CDY A;  4UV9 A;  4Z2W A;  2IFM A;  4TT3 H;  1KOR A;  4FLZ A;  4RJT A;  2OCC B;  2KOG A;  1YEW A;  1VF6 C;  3LUT B;  4XDJ A;  4B08 A;  1HNX B;  1L0N K;  1TU3 F;  5AVV B;  2N9Y B;  1OCR B;  3CXH H;  4JI0 O;  5APX A;  2WLI A;  1FS0 G;  1IFJ A;  1Q2N A;  1XMQ B;  4J11 A;  4X62 O;  3OEH G;  3HUS C;  2YC0 A;  2OQQ A;  2VQE B;  4MW8 A;  3V2Q A;  2R5D A;  1YF2 A;  1KFN A;  4HAM A;  2K9Y A;  3HTK A;  4NR1 A;  2B88 A;  4TV8 A;  2ZXW C;  1D2D A;  3U59 A;  2GM4 A;  1G1X B;  4AYC A;  2KB1 A;  3RBX A;  3RK3 E;  1U96 A;  1SQQ E;  5CN0 A;  2ZE5 A;  1JA8 A;  4AQY O;  3H1H G;  1VQK P;  5LP6 A;  1NJI Q;  3L74 D;  3HD7 B;  2BE3 A;  3H1J D;  1QL2 A;  4WBA A;  1QR9 A;  1LWU A;  5C39 A;  1K4C C;  3CC7 V;  1EN5 A;  4J10 A;  4MTG A;  1OVR A;  5KJ7 D;  2AHY A;  3LDC A;  3H1L J;  1JFF B;  4PD4 I;  2CGN A;  1EZV D;  1GKF A;  1BGY J;  1FJP A;  4GLX A;  4Z1M H;  2Q8V A;  3HR0 A;  1K4D C;  1SQF A;  3K5M A;  1WAZ A;  2Q7E A;  3ABU A;  3FB5 C;  1JOC A;  2ZD9 A;  1UPG A;  3IC7 A;  1V55 C;  1VEW A;  4UV8 A;  3JD2 A;  3WG7 C;  1BZK A;  1T2K C;  3F7Y C;  1G2C A;  4D7T A;  2EIN B;  1VQ5 P;  3LSS A;  4JI6 B;  2FXP A;  1NTK H;  3O65 A;  1EXJ A;  1FDM A;  2OYO A;  2CTP A;  3CMA V;  2X6B A;  3E86 A;  5LGT A;  4NXM O;  2AHZ A;  3CD6 V;  1JCH A;  1AB3 A;  1X22 A;  2E75 C;  4PJ0 Z;  5KX5 B;  5J2U B;  1RQU A;  3FWL A;  2XND H;  4WY4 B;  1RF1 C;  1PGO A;  1OIP A;  3QO8 A;  1I94 B;  3CCE V;  1ARO P;  1XNR B;  1JR9 A;  1KEC A;  1NR1 A;  4J7K A;  4P30 A;  2CTQ A;  4DO2 A;  2AXT E;  1OHH G;  3P8M C;  5JCO C;  4DK1 A;  4GX5 A;  1N34 O;  1SQV D;  1KP2 A;  4KT0 J;  5DED A;  1SQV H;  3E22 B;  4RUF A;  4X8A A;  2QTS A;  5GTH H;  4LF5 O;  3HPL C;  1M4U A;  2CUG A;  1OW7 A;  3GF7 A;  1VQ6 P;  1H2G A;  3IJ4 A;  1URQ D;  2ZVN B;  3AG3 C;  2WSE H;  2DMX A;  3SSU A;  2CTR A;  3W67 A;  3TK1 A;  4TV9 A;  1QVF U;  2FTK A;  3NR7 A;  2PY5 A;  1NZ6 A;  5GTH E;  4W7Y A;  1SQX K;  1XBL A;  3L72 J;  4H0L C;  3Q2Y A;  1SFC A;  2WA3 A;  3B71 A;  1WT6 A;  1K5Q A;  2CK3 G;  1NBM G;  5FPR A;  3PN1 A;  3O6Q B;  5GTI Z;  4ASU G;  2E43 A;  4U3F E;  2ZR2 A;  5BR8 O;  1FOS F;  3HKC B;  1WPX A;  1NU1 D;  3CWB G;  2B1I A;  2XT9 A;  3UT5 B;  1Q81 W;  4OX9 B;  2KLU A;  2O01 J;  3CXH I;  1FZC B;  3ASN B;  1Y9B A;  2Z5I A;  2DE0 X;  1GRJ A;  2NLJ C;  4I55 A;  1ENV A;  2K9P A;  4A7P A;  3ETG A;  2D2C D;  1L4A A;  3SYP A;  4I1L A;  2QA4 P;  3HKB A;  5LP6 C;  4JYA O;  1TUB A;  3CCU P;  1X59 A;  4DR2 B;  4H0L D;  3ZRW B;  3VQV A;  2ZXW B;  4J9Y B;  1A02 F;  3M0D C;  3AE7 C;  3W68 A;  2KSD A;  3L72 E;  1V54 C;  4LF8 B;  1EXI A;  4L8J A;  3PLN A;  1SRY A;  3H32 A;  3CPW O;  4JI1 B;  2KKW A;  3VBB A;  3E2E A;  1NU1 J;  2QWO B;  2B9B A;  4DV5 O;  5AW7 B;  2IU3 A;  3MAQ A;  1JMK C;  2YI8 A;  3RYF A;  3A0H H;  2FYZ A;  4DV2 O;  1LTA C;  4R4M A;  2K9J B;  4A5U B;  1ZP0 C;  4H37 A;  3JCU E;  3C90 A;  4MN4 C;  1NTK E;  4AUW A;  5E79 Z;  2RJZ A;  3BA8 A;  4ZI7 A;  3H1I J;  3QVN A;  4JAA A;  1JEK A;  2ZT9 D;  2GHY A;  2BCC J;  3RL0 g;  4DUZ B;  4YPC A;  4JV5 B;  2IDB A;  3H1I G;  4J7Z A;  4O2A B;  2VRS A;  1Y6X A;  1U97 A;  3H1J E;  4M3L A;  1I08 A;  5EZY A;  1RF1 A;  3E22 A;  1M5I A;  3W7S A;  3B5N C;  3I55 V;  1PM9 A;  3PRJ A;  1S72 P;  2KZI A;  2HFE D;  3V4W A;  2PAJ A;  1MFZ A;  2AEM A;  2Q4P A;  1PNK A;  3VQY A;  3ZMS A;  1IBK B;  3L74 G;  1YZB A;  5LYJ B;  1N8R Q;  4LP8 A;  1EZV H;  5EZY B;  1RF1 B;  2LFR A;  2UUB O;  4JI3 O;  5LHG A;  3AG1 B;  4GOF A;  3BY6 A;  4DV7 B;  4UB6 Z;  2H89 C;  3V6I A;  2YID A;  4W7Z A;  4PD4 D;  5AVY B;  2C9N Y;  3BCC J;  1QU7 A;  1P7G A;  3CCL P;  2LGQ A;  1RM1 C;  4I5S A;  3K9A A;  4LFA O;  1QX8 A;  1IBK O;  2YMK A;  2Q0O C;  3ZHS A;  1SES A;  1YHQ V;  3TDK A;  3UM7 A;  1F4N A;  3RYC B;  3VMX A;  3ITK A;  3D36 A;  1HH0 A;  5KAF Z;  1FXH A;  3RYI A;  3AEF C;  4TV8 B;  3VMY A;  4AIL C;  3VYI A;  5BZB A;  3SR2 C;  4QPJ A;  3CRA A;  5A9G A;  2ZR3 A;  4UB6 E;  1L4A B;  2QJY C;  4I55 B;  1VQ4 P;  2PGD A;  2ZM6 O;  2NNU A;  4Z1V A;  5B66 H;  1AP6 A;  1BSM A;  1NTM G;  1BQZ A;  2HVK C;  2J59 M;  1M1J A;  1Y8A A;  4YXW H;  2OTL V;  4IYI A;  1JM0 A;  2OAR A;  5IY5 C;  3CXH D;  5KTB A;  1XL6 A;  3II6 A;  3E89 A;  2YXL A;  2ZIN A;  1SQV G;  2FFD C;  1ZUQ A;  1UIX A;  2NPS B;  2KZJ A;  1B6Q A;  3P3P A;  4FM0 A;  4JBZ A;  3ASN C;  2EIN C;  1N0N A;  2Q69 A;  2NPS D;  4U7O A;  3OM3 B;  4DZO A;  2I8D A;  1M56 B;  2XOK G;  1KQF B;  2PFX A;  1RE3 A;  1SQQ K;  2JEU A;  2XND G;  3T4Z A;  2FYN C;  1NTM J;  1IXM A;  3SWY A;  1OCO B;  1H2N A;  1NTK G;  2YI9 A;  5E79 H;  4HZ3 A;  1SQX H;  1KD1 W;  3ZX6 A;  3AK3 A;  3BA9 A;  4O4I B;  2UUC B;  4NXN O;  4FZ1 A;  1N4C A;  1FXK A;  1LTJ A;  4IFF A;  3CC2 P;  4CBC A;  4Z1M G;  1GMJ A;  1JOY A;  1ZLZ A;  1BCC E;  1HUC A;  3BAS A;  1GU4 A;  1THZ A;  2UXD B;  1KFM A;  5B1B B;  4GUN A;  1M57 B;  1F23 A;  5JH7 A;  3RT3 C;  3L74 E;  3TGU J;  1N36 O;  1YJN P;  3CCL V;  4LF7 B;  4JQ0 D;  4EEQ A;  2FYU E;  2IZ0 A;  2BSK B;  1VL2 A;  3FYI B;  2M8R A;  4PD4 E;  3K5N A;  4CS4 A;  3H1H H;  4X88 A;  4JPR A;  3JCU H;  1XQ8 A;  1OVU A;  1J2J B;  3MHV A;  3N2G A;  5AVX B;  5CBO A;  1NS1 A;  1VF6 A;  2KSJ A;  2FY8 A;  5BXZ A;  3AE2 C;  3UO2 A;  4TSF G;  3SYA A;  1IK7 A;  3CCQ P;  3ZHR A;  1SLQ A;  1I5Y A;  1BE3 E;  5FLX N;  2EIM B;  2KG7 A;  1XMQ O;  3EWK A;  5EC2 C;  1KKD A;  2WQY C;  2PYL A;  4MTF A;  1XNR O;  1U7M A;  2DYR B;  3UT5 A;  3CCV V;  3TGU D;  4JTC B;  1GN3 A;  4J41 A;  1H2S B;  1NGM B;  3H1H J;  1UJW B;  3HB3 B;  4GT1 A;  3EFG A;  4IFM A;  1NTZ G;  2ODM A;  2WLL B;  1K97 A;  1TVK A;  2QKA A;  2XUM A;  4JI8 B;  3K5B A;  3QWO C;  3HKD B;  1Y76 B;  1AI7 A;  1XIL A;  3K79 A;  1N73 B;  4PI2 A;  4P9P A;  4WVZ A;  2N9B A;  4XA4 A;  4O2A A;  1U7J A;  4FLX A;  3I5C A;  2FYU D;  4DV3 B;  1EDL A;  4HYT B;  1L4A C;  2F1M A;  4HB1 A;  3TSI A;  5KHH A;  4JGS A;  2G3A A;  3FGA D;  3M9H A;  4BIU A;  4H13 C;  1ZR4 A;  2K9J A;  3KXD A;  1AJP A;  4LH6 A;  3H1J J;  1FXV A;  2CTW A;  5IY5 B;  1AV1 A;  5KMG A;  2BTQ A;  1EZJ A;  5FL7 G;  5E1A C;  3OJA B;  1AJQ A;  1SFC C;  1Y74 B;  3OGI B;  4FFB A;  4OXS A;  2Y9Z A;  1K9M Q;  1FD9 A;  1WA8 B;  3CSX A;  1GK4 A;  2OIG A;  1SQB D;  2Q7G A;  4KFM A;  1GTW A;  1AI4 A;  2C2A A;  4L87 A;  3B8M A;  1SS3 A;  1ZOY C;  5E79 E;  3G4S P;  3D71 A;  1CW5 A;  2M0B A;  3GG2 A;  1K3E A;  3RYH A;  4OVN F;  5KJ7 C;  3AG7 A;  3DXR B;  4PI0 A;  3UIA A;  4OPH A;  1PP9 H;  2JJL A;  4YJ2 B;  2IBZ H;  3E1I A;  2HPC B;  5LA6 A;  3SWF A;  4OGQ C;  4I7Z C;  1K8A W;  1Y76 A;  1BHB A;  4UVB A;  2Y48 A;  3RK2 C;  4JI1 O;  4YHH O;  3J81 N;  4LF9 B;  2A45 H;  2R5B A;  4ZKP A;  4DW0 A;  4DT0 A;  1N8R W;  1AQT A;  4OGQ D;  4LNU B;  4PJ0 E;  4DV2 B;  4K0K O;  2ZKO A;  4UCU A;  3MD0 A;  1FKA O;  4F6E A;  4DR6 O;  2P06 A;  2KG7 B;  3AG2 B;  4IFD K;  1JQ0 A;  4DRX A;  4CZZ A;  3KG2 A;  4NYK A;  5IWA O;  2RCV A;  2F43 G;  1FZA A;  4FLU A;  1Z2G A;  2ZE7 A;  3Q4H B;  3CCE P;  1TVK B;  5APT A;  1OCC B;  1PP9 J;  2MK3 A;  5CA3 A;  4U7J A;  3FKS G;  4LBE C;  1ZL8 B;  4KP4 A;  4TLF A;  1N7S C;  2N74 A;  1WA8 A;  4U3J B;  2Z0A A;  4DV6 O;  1AI6 A;  5CBH A;  2LR2 A;  2Q0A A;  2WIT A;  3HUS B;  3V5B A;  3RVZ A;  1XL4 A;  2ZYA A;  1E1Q G;  2PI5 A;  3DSQ A;  1ZRT E;  2Q7C A;  4AHC A;  3L73 J;  1Q90 D;  2YKQ A;  4NKG B;  3JC2 2;  2PZS A;  1IJD B;  3L70 G;  4LH7 A;  1L4A D;  3D3I A;  5KX5 A;  2FML A;  2GSM B;  5KHJ A;  2IX7 C;  1M9N A;  4I50 B;  4AQR D;  4UB6 H;  4MVQ A;  3C1L A;  4PV1 D;  5CA0 A;  1W2E A;  2HR3 A;  3OAK A;  4JI4 O;  1VF7 A;  5IDJ A;  4F4L A;  4DRX B;  1XHZ A;  1SQB K;  3TNU B;  1IVS A;  1NOH A;  2QM4 A;  1KC8 Q;  2JRI A;  5JJN B;  4UVC A;  3J7A U;  1LTT C;  3IC9 A;  5CCG D;  5ITZ A;  2JS5 A;  1QCE A;  2QE7 G;  1KB9 I;  1ORQ C;  1N34 B;  1S76 D;  1ZWI C;  3CME V;  2W6J G;  4FM2 A;  4YJ2 A;  4JI4 B;  3CCS P;  3T1Y O;  4PA6 A;  5IYC O;  2EIM C;  1CI6 A;  3WU2 E;  3ZJZ A;  4FVM A;  1IFM A;  2KQX A;  3JAR A;  1ZV8 A;  1L0N G;  4KJM A;  3WUU A;  4LF7 O;  3FB7 C;  1NU1 K;  4DR4 B;  3OUF A;  1BCC D;  1ZLL A;  2Q7H A;  3T2M A;  1ZW0 A;  2E42 A;  2ZVO B;  2UU9 B;  1IFP A;  1LWU C;  2WSF H;  4EI2 A;  1S0V A;  1YI2 V;  2FXM A;  3MTU E;  5AVU B;  2LW7 A;  1LT9 C;  3VP8 A;  4I50 A;  2H88 C;  3LNN A;  4PD4 H;  1YVW A;  3GHG C;  1DIP A;  4LFC B;  1Y47 A;  4WF9 V;  3AEC C;  5AW1 B;  2OT5 A;  2OYH B;  2P22 C;  4D6T G;  3H9V A;  3KZI E;  2GV9 A;  3CCJ V;  4Q20 A;  1LP1 A;  3TGU G;  1FXK C;  4QNH B;  3AE6 C;  3SJC C;  5TJH A;  1FC2 C;  1NTZ D;  4UB8 E;  2QKC A;  1SQQ G;  2YSU B;  3HUS A;  1PV0 A;  3USS A;  2HOD B;  5LOV A;  2N05 A;  1KKC A;  1PZQ A;  2CH7 A;  3B77 A;  2Y0D A;  3ZN0 A;  3KZI Z;  1NKD A;  3BFR A;  1AR1 B;  2HG5 C;  3MHH C;  4F6R A;  3PHL A;  4DV0 B;  1NU1 G;  1KB9 F;  4I4T A;  4ZI7 B;  2HYN A;  3L70 E;  1P4R A;  4WFG A;  2O01 N;  4KXR A;  2E5L B;  1DD4 A;  4UXN A;  1NVP B;  1CSB A;  2YIU B;  3KDP B;  4OH8 B;  2AGA A;  1NTM K;  1AFO A;  2M5A A;  2UWJ E;  2XZR A;  2OYI A;  4QE7 A;  5LP6 B;  4U3F G;  1SQP H;  1NJI W;  4I4T B;  5LMN O;  1M1J C;  3AE8 C;  5CCH C;  3RK3 D;  3RL0 D;  3ABL C;  1W2B U;  4EYY Q;  3AE9 C;  2UUA O;  4TOI A;  3SPI A;  1LWU B;  3GMA A;  5AVT B;  1SQB G;  2ZE8 A;  4I0X B;  2PF4 E;  1I5X A;  5L3C A;  2BOB C;  4EIJ A;  3JAR B;  4L73 A;  2CAZ C;  1SQP E;  4WB4 A;  2LGW A;  2QWN B;  5KLV H;  5LBQ A;  2FB5 A;  4X1K B;  1GO3 F;  1HWT C;  3K0D A;  1USD A;  1J95 A;  4JI5 O;  4N78 D;  2H43 A;  4J80 A;  3L72 G;  1L0L H;  1XEQ A;  1FZG A;  1GAX A;  1OCR C;  5IYB O;  5KAF E;  1ZL8 A;  4GKJ B;  4K8X A;  1NO4 A;  3I56 P;  3QO7 A;  5CJ0 A;  2O3J A;  3KCY A;  3ZRS A;  3JD0 A;  4X1K A;  4R8C A;  4RKU J;  1SFC B;  3L37 A;  5KHI A;  2QJ1 A;  2A06 G;  3QO5 A;  4IL6 H;  3FB8 C;  4N6J A;  3V2P A;  2V4H A;  4BIO A;  1CI6 B;  1RF0 C;  1SVF A;  5B5E E;  1R1B A;  2B9Z A;  1TGO A;  3JSV C;  2A0L A;  3OMI B;  3WB0 A;  4NPE A;  3VQX A;  4WFH A;  1GZL A;  2OIE A;  1KMI Z;  1WB7 A;  1YTZ I;  2OTL P;  3HD7 C;  2B87 A;  1DH3 A;  1JY2 N;  4BWN A;  2M7W A;  3W7U A;  3CWB E;  1KBH A;  1LTS C;  1VF5 B;  3S3W A;  4R50 A;  4GOE A;  4X64 O;  3G6E P;  1KIL A;  5CA0 B;  5KA5 A;  4U7N A;  2EJ7 A;  1SQV J;  3L71 G;  2Q1K A;  5DN6 G;  1AA0 A;  1PL0 A;  4B7E A;  4TWK A;  2DWE C;  4X1I A;  3CB2 A;  3DC5 A;  5IE9 A;  4GYC B;  4WFB V;  1W5C E;  1FYJ A;  1CP9 A;  4DR3 B;  1JMM A;  3KPE A;  1PV3 A;  1H8E G;  3FB6 C;  1GW4 A;  3A0H Z;  2JR8 A;  1SKV A;  2ZIM A;  3CI9 A;  4KHX A;  1X9V A;  2YNY A;  1EM1 A;  3T1H O;  1JY3 O;  2E74 C;  1KZU B;  3A7O A;  1GDT A;  4RUE A;  2CE4 A;  2OYQ A;  1BQ0 A;  3VN0 A;  4JI6 O;  1RE4 C;  1OZH A;  2WSS H;  3AG1 C;  2ZXE B;  2YXR B;  5AVZ B;  2H94 A;  1G4Y B;  4LFC O;  3OGC C;  3H1H D;  2R9I A;  1KUQ A;  3CCV P;  1M56 C;  1P84 H;  3T4D A;  4DV6 B;  3H1J G;  2IJJ A;  4DJG A;  3MP7 B;  1PP9 D;  2KUB A;  2XAJ A;  4DW1 A;  3B40 A;  3O9O A;  4BW9 A;  1OCO C;  1VQM P;  3IGA C;  2ZJS E;  1RSO B;  5EYP B;  1J1E B;  1MFT A;  4DR4 O;  2WSF J;  1B3Q A;  2AW9 A;  4WBN B;  3ICX A;  4JI2 B;  1DEE G;  4JF3 A;  4X65 B;  1JY2 O;  5BVZ A;  2PI4 A;  1MNG A;  5LL6 Y;  4DV4 O;  1QLE D;  3A0B E;  2PRR A;  5EBW C;  4MT8 A;  5AW5 B;  5A2Q N;  1YJW V;  1VQO P;  1JMB A;  2KIK A;  5KMG B;  4PA4 A;  2HHH B;  1SQB E;  2BTO A;  3H1K G;  5LHH A;  4L76 A;  3GHG A;  3WB2 A;  4GOD A;  3CEI A;  2ARH A;  1VQ4 V;  1KYO E;  3AEE C;  3TXQ A;  3K57 A;  3BVH A;  2KLV A;  2ATK C;  2FXO A;  3JD1 A;  5KJ7 A;  4IOI H;  2C9L Y;  3C3T A;  3JAK A;  3MZW B;  5IJ0 A;  1BCC H;  1M1K W;  1HVV A;  4ASV A;  4C7N B;  1M1K Q;  4JI7 O;  3SPG A;  4JYA B;  4GZR B;  4PJ0 H;  4DR2 O;  3M91 A;  2PUS A;  1BE3 D;  1E79 G;  1G1I A;  4X65 O;  2X6A A;  2UXC O;  5DJT B;  1I7F A;  4TUY A;  1GN2 A;  2DYR C;  3BAB A;  5FPO A;  4OX9 O;  1M57 D;  2XAQ A;  1HW7 A;  5JJJ B;  2F4V B;  1E79 H;  5APU A;  1W0J G;  1URF A;  2DQ0 A;  4X20 B;  5CB4 A;  1BCC J;  3V2N A;  1OXZ A;  1VQP V;  1RPO A;  3RK2 B;  5H6R A;  1OW6 A;  4QGP A;  2P6J A;  1SQQ J;  4H44 C;  5GON B;  1VQ6 V;  5IYD O;  3A5T A;  3P32 A;  3SPJ A;  1MAB G;  5KUK A;  3QF7 A;  5LA6 B;  1SQP D;  1KYO D;  4DV3 O;  3AG2 C;  2YIC A;  4B3S O;  3E7K A;  2GUZ A;  1H89 A;  2HPC A;  2UUB B;  2YIB A;  1JJ2 U;  1HR0 B;  2LJ2 A;  1DGS A;  3CCQ V;  1A32 A;  1R6K A;  2F66 C;  2JP3 A;  1K05 A;  4TV9 B;  3S3X A;  1NVP D;  1QVG O;  2O57 A;  2VQF O;  1SQX E;  4CPG A;  1J1D B;  3QNE A;  4IL6 Z;  1Q86 W;  5AW9 B;  3G3Z A;  2JIZ G;  2Q5Z A;  5KUM A;  3E8F A;  3L72 D;  5CMZ A;  2J5U A;  1KTM A;  1M90 Q;  3U11 A;  3RGB A;  1YJ9 P;  4LLH A;  1MOF A;  3ZCC A;  3W7W A;  4FLV A;  1GMG A;  3L35 A;  4KHP B;  1GN6 A;  5AW4 B;  3BRC A;  2EX3 A;  1BL8 A;  2WLM A;  1S5J A;  4H44 D;  2AEF A;  3ZS8 C;  2E76 B;  4Y99 B;  3CCU V;  1Q82 Q;  3CXH E;  4UCO A;  4B3R B;  2X7R B;  1NU1 E;  2P4K A;  1H88 A;  1BGY E;  2Y0P A;  1QHT A;  1X0T A;  1VMG A;  3H1L E;  2E76 D;  4D6T J;  5B66 E;  5EIB D;  1MUU A;  4QJF B;  5JH7 B;  4LF8 O;  1J5E B;  3A3Y B;  3TYY A;  4DR1 O;  4H0L B;  2XHB A;  2HJD A;  1L0L E;  2K1E A;  3CCM V;  2WSS G;  2WPV B;  1G8M A;  1H2K A;  2IYO A;  3M0D A;  2WPR A;  3CX5 D;  3G71 P;  1NTZ E;  1VQN P;  5B3S B;  3JCZ A;  3LDE A;  1PIX A;  5LHI A;  5CCH A;  3TCU A;  4DV1 O;  4JYB A;  1OVV A;  3OMN B;  1J5E O;  3CCS V;  1Q7Y W;  1MSD A;  1RFY A;  2MKV A;  2CPS A;  1AQ5 A;  4RQE A;  1ZTE A;  4XE5 B;  1IO4 A;  4ZBM A;  1JO5 A;  1NI8 A;  3STZ C;  4K0K B;  4MS2 A;  3P8C D;  1EDI A;  3WUT A;  1QVG U;  1G6U A;  4FLT A;  1GN4 A;  1T3J A;  4FPP A;  1S5H C;  5LXT B;  1N2D C;  5IJ9 A;  1JNM A;  4I7Z B;  5KAI E;  3CRM A;  1FOS E;  3CRR A;  4ZIB A;  2A45 I;  5L3F A;  4MVS A;  1PKX A;  4JI8 O;  3D6Z A;  2C0X A;  1EN4 A;  3CE2 A;  1N32 B;  1EQ7 A;  4O4L A;  2X6C A;  1KIL E;  3ZMV A;  4JYC A;  4Q6G A;  1K9M W;  4EOT A;  3Q1M A;  5FNV B;  5HFM A;  1T8Z A;  1E1R G;  2FYU H;  3RYC A;  2IH3 C;  3OT7 A;  1F4M A;  1U57 A;  3ASO B;  4I9Q A;  1H2L A;  3K5L A;  2A06 H;  2VWJ A;  2YEV B;  1YIJ V;  1YJ9 V;  4OWF A;  4JI2 O;  1IX9 A;  2GUZ B;  1M90 W;  4LCU C;  2UXB B;  4WBN A;  1D5A A;  1NQT A;  2JEX A;  1Y66 A;  4D7S A;  1L0L J;  2NRG A;  4NXM B;  4YJ3 A;  1GH6 A;  4J9Z B;  2V7Q G;  2WTY A;  5GTI H;  4RQF A;  4P2Z A;  1HWY A;  1JFF A;  1L0N J;  3L72 H;  2RMZ A;  2WLJ A;  3G6E V;  2W6B A;  2WLK A;  1IZ3 A;  1ZXG A;  3T97 B;  2WPQ A;  2IM9 A;  3K04 A;  2M5A B;  2P2U A;  3ZDM A;  5KLV G;  1LTJ B;  2AXT H;  1LUW A;  2UXB O;  3W7X A;  4G27 B;  5KHG A;  4TUY B;  1N7S A;  2WSE J;  1Q7Y Q;  1DF5 A;  3CWB J;  3EHB B;  3A0R A;  5KAI H;  1YCI A;  4ZOL B;  2KB7 P;  1SQB H;  4YIP A;  4K8Z A;  4DUZ O;  4JTD B;  1GL2 B;  1VQP P;  2EBO A;  4WFA V;  5APQ A;  1CPY A;  4NPF X;  2HKO A;  3OMA B;  3OR6 C;  1R3L C;  4JAV A;  1SET A;  2K1A A;  4DOJ A;  3BEH A;  3NTN A;  5H6Q A;  3IR9 A;  5AVW B;  3JAK B;  2ZQM A;  1K8A Q;  1S77 D;  2P5O A;  4EB6 B;  3MUD A;  1KN7 A;  4X62 B;  2G8Y A;  3AG4 B;  2V4D A;  5J9P C;  2QSA A;  4DR6 B;  1LJ2 A;  2QG4 A;  4RO2 A;  1FJK A;  1HGV A;  1R73 A;  4QPK A;  3OTF A;  3WUV A;  3APO A;  1NU1 H;  2YUA A;  3CS5 A;  4GKG A;  3ETE A;  2QEX P;  5CBF A;  3UKM A;  2HHH O;  1BGY D;  1HGZ A;  2QA4 V;  3SPH A;  3PTZ A;  1WB8 A;  3VMA A;  3GB7 C;  4L74 A;  3C8V A;  1FPO A;  4CS3 A;  2OYI C;  3LDD A;  1NKN A;  3OW2 U;  2ITD C;  1SQQ H;  4EKW A;  4N21 A;  1YBK A;  3H1L H;  4C46 A;  2YXH A;  4IL6 X;  4DV1 B;  1PP9 E;  1J1D C;  1DK1 A;  5EBL C;  3SYC A;  5CBN A;  1EZV I;  2E76 C;  4Y99 C;  2WLL A;  3SFD C;  1KC8 W;  4PDV A;  3A2A A;  3BRT B;  1GK6 A;  1MA1 A;  4IHJ A;  2ZT9 B;  4KL1 A;  4AI8 A;  1KIL B;  1LUV A;  2OYH C;  5APY A;  4LC1 A;  5DM6 V;  3X2Q C;  5BY1 A;  3UO3 A;  2UXC B;  1NKZ B;  1L0L D;  1R3J C;  2IU0 A;  3PH0 A;  1NYH A;  2R9A A;  4DCK A;  3LNM B;  1VDF A;  2Y0I A;  3O8Z A;  2R3C A;  3U10 A;  3AED C;  1R6T A;  1L0N H;  4YY3 B;  5JCO A;  4TQF A;  3ABV C;  1P7B A;  2W6J H;  2FKW B;  2E5Y A;  4GDO A;  3ETD A;  4K35 A;  2EIJ B;  3ABM C;  1L2P A;  3FXE A;  1OX3 A;  3G6B A;  4MTX A;  1SQP K;  2QIW A;  1EC5 A;  3L75 J;  2XTA A;  2W27 A;  1ZME C;  1EBO A;  2Q6A A;  2LXC B;  2W0F C;  1YHQ P;  5IT9 N;  3FYE B;  2FYU J;  1IK9 A;  3UQ8 A;  3B5N D;  4X64 B;  1COW G;  3JAL A;  4X66 B;  3V2R A;  2IJI A;  4DR3 O;  3JAW B;  1Z5V A;  1BDC A;  1CXZ B;  2BTQ B;  1RP3 B;  3FAV A;  1S5L E;  4JZ2 A;  2WPD G;  3BVO A;  1IUR A;  2ITC C;  1OZ0 A;  4UVA A;  1HJB A;  1XNQ B;  1MV8 A;  2RKL A;  1RSO A;  3CCR V;  1NTK D;  5EBM C;  4ICG A;  4PHZ A;  1GL2 A;  1NHL A;  4DV5 B;  3AEA C;  1NAY A;  2R72 A;  2DN9 A;  2HP8 A;  2NR5 A;  3FXD A;  2FKX A;  2ZDI C;  2I1K A;  1S5L H;  1VQ8 P;  5EFW B;  3L75 E;  2E3C A;  3L71 D;  3WU2 Z;  5AG2 A;  1R3I C;  2BOC C;  1URQ B;  1Y67 A;  1FZC A;  3M06 A;  1DTO A;  2DWD C;  1BE3 H;  1B04 A;  4FMT A;  1X79 B;  5TIS H;  4EDF A;  4JYY A;  1FJG B;  1VQL V;  2K37 A;  2R70 A;  1PNM A;  5AVS B;  5KLV D;  3SJB C;  1IFN A;  1DLB A;  3MIW A;  1YDX A;  2RN9 A;  4FIP C;  1FBM A;  3ZRW A;  2QVA A;  4DYL A;  2ADP A;  5IJ0 B;  1MG1 A;  4IHJ B;  5GTH Z;  5APW A;  4WWI A;  3S9O A;  2BSK A;  5H2F Z;  2VQE O;  5L3B A;  1XI1 A;  1M1J B;  2YKP A;  1SQV K;  1FFX B;  4TQD A;  3HTK B;  2ITA A;  3SWK A;  2ZDI A;  1IBM O;  3U0Z A;  3L73 E;  1KU9 A;  4RWU A;  4NTX A;  3THO A;  3H1L D;  3N4X A;  1JCC A;  1P84 F;  2IBZ G;  1PP9 G;  2IZ1 A;  1W0K G;  3OE7 G;  4DR5 O;  5K1X A;  1XMO O;  3N2K B;  2GTA A;  2E5L O;  3LID A;  5J2U A;  2AZ0 A;  4WY4 A;  1SZX A;  1S3J A;  3K58 A;  3L70 D;  3A8T A;  1SC5 B;  4BIZ A;  1WP7 A;  2YMY A;  3L73 D;  4DV4 B;  4X1Y B;  3IFX A;  1QEX A;  2KS1 A;  4XDL A;  1NT2 B;  3FAV B;  4FZ0 A;  1XTG B;  3D36 C;  2WT7 B;  2QRX A;  4BXL A;  2Q5U A;  4LGD E;  3CPW U;  5EK0 A;  1S9K D;  4R6Z A;  1S2E A;  3D6Y A;  3WMM 0;  1LTB C;  4LF6 B;  4JF7 A;  4C7R A;  1OV9 A;  3CLQ A;  2DOS A;  2IW5 A;  5CB4 B;  5KA6 A;  4B3M B;  3R65 A;  1HF9 A;  4O4H A;  2W83 C;  2E74 D;  3SGI A;  3I55 P;  3AEI A;  2GTS A;  4G2K A;  3KQG A;  1FFT B;  1LT9 A;  1WLE A;  4R7C A;  4CC5 A;  4ZHQ A;  2C0W A;  2BEQ D;  3RFR A;  2LKM A;  4FK5 C;  3SJA C;  4CH4 A;  2P7J A;  5M1B A;  4LNU A;  1NH4 A;  1MZ9 A;  3G4S V;  2FFD A;  1YQ4 C;  5HFL A;  1HP8 A;  2QWR B;  3ZN1 A;  1QNM A;  3KKY A;  2EUL A;  1R5S A;  4W4K A;  2DYS B;  2L6L A;  1NTZ H;  2HJF C;  4C7U A;  1BE3 G;  3B5N A;  4ZKU A;  1K73 Q;  1BSN A;  3CCJ P;  1VPC A;  2Y9Y A;  2QDO A;  3RK3 B;  1M57 C;  3RL0 B;  1MZE A;  5B1O A;  3CRQ A;  1VQ5 V;  1Q8I A;  1T3U A;  3WG7 B;  3I5D A;  4JV5 O;  1K34 A;  1Q82 W;  2XU6 A;  3B8N A;  4NPD A;  1NTZ K;  1XTC C;  1RPR A;  2Q3I A;  1N32 O;  2B87 B;  3TXS A;  2IJK A;  4MTO A;  3B4S A;  4UCR A;  1H0T A;  3ZMZ A;  1T6A A;  1IXB A;  5L3E A;  2W8Z A;  2Y4T A;  2YDE A;  3RBZ A;  3CME P;  2HOD A;  1DD3 A;  3OTO B;  1SFC D;  1K92 A;  1EN6 A;  3K59 A;  1KQG B;  2NPS A;  4WY4 C;  4MVU A;  2KYV A;  4UFZ A;  5H9C A;  3ABK C;  5BMV A;  1CZQ A;  4LFA B;  2I1J A;  1GTO A;  3CYO A;  3ZHQ A;  1YXB A;  4OGQ B;  3L4F A;  4B3S B;  1KB9 D;  1KQS U;  1AJY A;  3D8C A;  2Y4U A;  2QJK C;  3A0H E;  3SYO A;  5B1A B;  3CRC A;  3GVM A;  3K9S A;  1RM1 B;  5AVQ B;  5B5E Z;  5JVD A;  3OD4 A;  1HNZ O;  1BE3 J;  1SQX G;  5ITZ B;  1S9K E;  3CHX A;  3ZMU A;  1M8O B;  3BRV B;  1NTM D;  1RH5 B;  2B5U A;  5D5Q A;  4U3F D;  3SDL A;  1B06 A;  3VMZ A;  3CX5 H;  4MW3 A;  4EFB A;  4EFE A;  1OW8 A;  1X8Y A;  2RH0 A;  1GM7 A;  4BAY A;  4N3Y B;  1YTF D;  4YXD C;  3H1H E;  2QSI A;  1YJW P;  5CBG A;  2XAH A;  1NTK K;  3R2P A;  2E74 B;  3B2E E;  3ETQ A;  5L3D A;  3JAT A;  1QVF O;  2QWQ B;  2B1G A;  4I0X A;  4B7K A;  3IAO A;  5APV A;  1YIT P;  4GX1 A;  4IYH A;  3QG5 A;  1H38 A;  3B5N B;  3H25 A;  5DJU B;  4K3A A;  2ZIO A;  4PA7 A;  2YIA A;  2D3O W;  2UUA B;  4I6M C;  4O4L B;  1I94 O;  2YS8 A;  1KYO F;  4B3T O;  3Q5R A;  4YXW G;  3CC4 V;  3H1L G;  1FZC C;  3AE5 C;  4UB8 Z;  1NTM H;  4YHH B;  4L75 A;  3T1Y B;  2FL4 A;  2CPB A;  2HVJ C;  4DUY O;  2KK7 A;  1JX9 A;  1LT9 B;  4J7J A;  1MKM A;  3U1A A;  1KD1 Q;  3DGE A;  1N73 A;  1IBL O;  2XDJ A;  4WCE V;  1T5E A;  3OR7 C;  4B3T B;  2QJP B;  3RW0 A;  1NAF A;  3Q5P A;  2E5T A;  1NTM E;  3ABK B;  5JVD B;  2ZNI A;  1N7L A;  1AP5 A;  1VF5 D;  2R9R B;  3R4Y A;  4YJ3 B;  2QM7 A;  2JGU A;  4CH5 A;  1HDJ A;  1JB0 J;  3VOU A;  4O4J B;  2JS3 A;  4XFJ A;  3L9D A;  2YXY A;  1VQN V;  1R8E A;  3F5T A;  2W90 A;  3SFE C;  4PA9 A;  1L0L K;  2BCC E;  3HD7 D;  1JTH A;  1EZV G;  1SER A;  4HNA B;  3AEB C;  3AG4 C;  3L74 H;  1OCZ B;  1Q6H A;  1KP3 A;  3P30 A;  1OJH A;  4FFB B;  1NVO A;  3N2K A;  1VP7 A;  1Y4M A;  1SQQ D;  2VRZ A;  1D7M A;  1LGH B;  3HRN A;  2E75 D;  2LQT A;  5CHX A;  4W4L A;  1FZB A;  3H1I H;  2Q68 A;  4UUJ C;  1WJZ A;  1QR8 A;  1YI2 P;  1H2M A;  2Y0C A;  1FAF A;  3BHP A;  2P67 A;  4J42 A;  5EIB C;  2N1T B;  1YTF B;  3B09 A;  2V7Q H;  1XDC A;  5B5E H;  3EQ2 A;  3SJQ C;  2Z5H A;  2YIU C;  1P49 A;  1M7L A;  4ASW A;  4ZMD A;  1MZF A;  1O9G A;  3STL C;  2EIK C;  1HTL C;  2XNX A;  3O6Q A;  5JJE B;  5LMU B;  4HKZ H;  3L75 D;  1WRG A;  1KYO I;  2FYU G;  4CH3 A;  3M9Q A;  2R32 A;  2O1J A;  1VQ7 V;  4JPZ B;  2MJZ A;  1SZT A;  3CCR P;  4N23 A;  2H8P C;  4IL6 E;  5CCH D;  1W59 A;  2VQF B;  1ZN5 A;  2WWW A;  3F89 A;  2CH7 B;  4DUY B;  4LR3 A;  2F95 B;  3EXA A;  1YQ3 C;  4WFE A;  4D6T E;  2BCC D;  1SQB J;  4N78 E;  5EYP A;  4DK0 A;  2IBZ E;  1KV4 A;  4DV0 O;  2XV5 A;  3DTU B;  2WA4 A;  3CWB H;  3F5W C;  2WLI B;  3GF3 A;  2H7H A;  1GU5 A;  1AR4 A;  1FJG O;  2PGG A;  4CH6 A;  2FYN B;  1AVY A;  2CK3 H;  1R3K C;  2K3R A;  2ZNJ A;  3F5H A;  4LFB O;  5B1N A;  3JSN A;  3RYF B;  3UCS C;  3K03 A;  4DR7 B;  3JAW A;  1ZX3 A;  1HNZ B;  1N86 A;  3H6P A;  1YIJ P;  3Q4H A;  3ZRV A;  4DR1 B;  1L0N D;  3JD4 A;  4O4J A;  2UUC O;  2OCH A;  2HG5 D;  3RGU A;  3A0B H;  2A9H A;  2HFE C;  3GHG B;  1V9P A;  2WPS A;  3TF5 A;  4HNA A;  1Q81 Q;  5H5N A;  4FLY A;  3SYQ A;  2PP6 A;  3RK3 C;  1LR1 A;  3RL0 C;  1RY3 A;  1DX7 A;  2AZ2 A;  5B1B C;  3JSL A;  3U1C A;  4GX2 A;  3CJH A;  3D3Q A;  1N33 B;  3ZHV A;  1QBZ A;  3H32 B;  1VF5 C;  2P10 A;  3OW2 O;  4LF4 O;  2HLD G;  1MMM A;  2G38 A;  3MHS C;  1GD2 E;  1BS3 A;  4ZNC A;  1NR7 A;  1JY3 P;  5KLV J;  1MSW D;  3GLM A;  1USE A;  4UCS A;  1RQV A;  3LW5 J;  4B86 A;  1VQO V;  3OAA G;  4DXW A;  3BAA A;  3RYH B;  4H13 B;  2QKS A;  4I9W A;  1QLN A;  3J80 N;  4U3F J;  3E83 A;  4PD4 F;  4X20 A;  3FX0 A;  5LGU A;  3H1I D;  5BU8 B;  2Z5U A;  2D2C C;  1V55 B;  5C8Y B;  1GK9 A;  5CJ4 A;  5LMU O;  2N1T D;  4H13 D;  1OFC X;  3E35 A;  2HLO A;  3T97 A;  3MUD C;  3H01 A;  5GTI E;  2E75 B;  1FFX A;  3JCU Z;  3RYI B;  5FNV A;  3ABL B;  2W6I G;  2WVR A;  2L35 A;  2N1T A;  1GL2 C;  4GKJ O;  4PV1 B;  2ZM6 B;  1A02 J;  3MGN A;  1Z56 A;  4PDL A;  3BAT A;  1QQC A;  2YEV A;  1OWA A;  3K0G A;  2QJK B;  1NH2 B;  3K06 A;  1F7Y A;  3AEG C;  1YSC A;  2YO2 A;  3NFQ A;  1Q5O A;  1H8H G;  4X9Q A;  2A79 B;  3FX7 A;  3BCC D;  4JI3 B;  3OFN G;  3ZBH A;  1AI5 A;  3CMA P;  2A7W A;  3C3S A;  2L5G B;  4LF6 O;  4FLW A;  3AK2 A;  4H44 B;  3K5O A;  1N73 C;  5KLV K;  1FDI A;  2DW3 A;  3GWK C;  2P7T C;  2R3S A;  1JCD A;  2KNC A;  3L71 E;  2Y69 B;  1IFI A;  1URQ C;  5IWA B;  5KHK A;  4UCT A;  2QGN A;  2LXB A;  3K08 A;  5C8Y A;  1GW3 A;  3JYC A;  1S1C X;  4P9O A;  2M3B A;  2Z4E A;  2A3Q A;  1AIL A;  2LP7 A;  1Q6U A;  3VQW A;  1N7S D;  3CC4 P;  2H3O A;  4O9B A;  4IT5 A;  4FJC C;  1BCC G;  2POH A;  1G2C B;  2J58 A;  3FWN A;  4LF5 B;  1P84 E;  2Q67 A;  4TT3 G;  4O2B A;  4JAU A;  3L75 G;  2Q6Q A;  1F51 A;  3FFQ A;  5CMU A;  4MVM A;  2ZXX A;  3CX5 F;  4LF4 B;  4HJG H;  1SA0 A;  4GX0 A;  1YYC A;  1YJN V;  2JKV A;  2ETN A;  5EC1 C;  2LW1 A;  1HNX O;  4LWS A;  2WLH A;  3AG3 B;  5TIS E;  1VQ9 V;  1N36 B;  2XAS A;  1JVM A;  3BCC E;  2HEP A;  5AVR B;  2KSE A;  2ZCE A;  1VQ7 P;  3H1K H;  2RNB A;  4C7N A;  1PL5 A;  2YO3 A;  3RK2 D;  3LSQ A;  4YIO A;  1S5L X;  1HR0 O;  5AW3 B;  3E8B A;  1JPX A;  3CC2 V;  2AXC A;  1KB9 H;  1L1F A;  2JWA A;  3I56 V;  5KAF H;  3VTP C;  1S4X A;  2N04 A;  2NN4 A;  2O1K A;  4R4L A;  3T1C A;  2JJ2 G;  1XRE A;  2IJH A;  2OCC C;  3CXC U;  2DQ3 A;  4JTA B;  5IJ9 B;  1TUB B;  1LTG C;  5DEC A;  4U3J A;  3HKB B;  3N7N A;  1JY2 P;  3L73 G;  1WN7 A;  4E4E A;  1SQX J;  1WPB A;  3H1J H;  4GKK O;  3RN4 A;  3CC7 P;  1OMI A;  3JD3 A;  5C93 A;  4WFF A;  5KKZ C;  4JZG A;  5J2T B;  2ZAE B;  3M7M X;  5LYJ A;  1K04 A;  3ABT A;  1AJN A;  4B3R O;  5AW0 B;  2BCC G;  3HKD A;  2L91 A;  1V54 B;  1CEZ A;  3HE4 A;  3Q5S A;  2X0L A;  1EDK A;  1EZV E;  3TJT A;  4LWS B;  5LMN B;  4BWA A;  2OTJ V;  1TA8 A;  1HJ0 A;  3CX5 I;  1RHZ B;  2JDI G;  3H1K J;  1BHA A;  4I2L C;  1PD3 A;  3E8G A;  1RE3 C;  5K1P A;  1VQ8 V;  3HKE B;  2JK5 C;  1FAV A;  3G9R A;  3TNU A;  2XKM A;  2V7Q J;  2EZO A;  3HD7 A;  2WZ7 A;  5GW7 A;  3ZHT A;  3HE5 B;  5LGN A;  5KLI C;  2FYU K;  3N27 A;  2BEZ F;  2GBO A;  3M9B A;  2Q9L A;  2OYH A;  4IIJ A;  2DW4 A;  5AW8 B;  4NTY A;  3L71 H;  4MSW C;  5KLV E;  1P84 D;  5JWP A;  3CWB D;  2WMM A;  1UII A;  1Y74 A;  3AK1 A;  3JAT B;  5D5P A;  3CJH B;  3VOP A;  3L70 J;  3DXR A;  2EIJ C;  1N33 O;  3H1K D;  4YY3 O;  3L74 J;  3TGU E;  2DJV A;  2JJ1 G;  3E8H A;  2IFN A;  3BCC H;  2WLN A;  2FFD B;  2W6A A;  2F4V O;  3C9I A;  4QIW F;  3M0A A;  1S72 V;  5KKZ B;  4PA3 A;  1BGY G;  2OTK E;  5AW6 B;  3CL3 D;  2QR4 A;  1PPJ G;  2QTO A;  1I0H A;  5H2F H;  3G67 A;  3WB1 A;  4DR7 O;  4H33 A;  2M6Y A;  3JAS A;  4HYO A;  3HKC A;  2XAF A;  1TUE B;  3QTC A;  4B3M O;  2WAM A;  3LIE A;  1JUN A;  1QLE C;  3VP9 A;  2ZE6 A;  2IBZ I;  1L0L G;  2EIL C;  1HNW O;  2QJP C;  1FS0 E;  3GW6 A;  1FXK B;  4MVR A;  1US6 A;  1AVM A;  3R66 A;  3OA7 A;  2AXT Z;  1Q6I A;  5J2T A;  3CXH F;  2K88 A;  3PP5 A;  5LXT A;  5JQG A;  2GUV A;  1R5L A;  4UB8 H;  2KNC B;  1PFI A;  3OUS A;  4RAI A;  5H2F E;  1VQK V;  1S5L Z;  5L8R J;  3HE4 B;  2W0X A;  1K33 A;  5L3G A;  4JI0 B;  4MVZ A;  1QL1 A;  1UFI A;  1VIB A;  5IYZ A;  1LTI C;  2JGD A;  1M56 D;  1NTK J;  3ZMT A;  1IBL B;  3NXS A;  3IF4 A;  2QM8 A;  1OCZ C;  1PGP A;  1SQP G;  2ILM A;  3ASO C;  2KXP B;  4U3F H;  1L8D A;  3L36 A;  1LT1 A;  1KQS O;  2LO1 A;  2Y69 C;  1BMF G;  3IFM A;  1DF4 A;  3F7V C;  3JAL B;  3LW5 H;  4YTP C;  3A0B Z;  4HBN A;  2Q9I A;  1SQP J;  1IBM B;  2NZ2 A;  1FZF A;  4NTW A;  3NMD A;  4ZKI A;  2JEE A;  3ZED A;  4GKK B;  2VWK A;  4IIJ B;  4PV1 C;  3SPC A;  1HNW B;  5CCG C;  1AVO A;  1Q86 Q;  2IH1 C;  4KUM A;  2DYS C;  3E1R A;  4NB5 A;  1SP4 A;  2P90 A;  2A06 E;  2GDS A;  2O01 H;  2V1D A;  5B1A C;  1SQV E;  1XUQ A;  1FU1 A;  1EFR G;  2H8P D;  1URQ A;  1SS1 A;  5BU5 A;  3HKE A;  2VS0 A;  4DV7 O;  5JQG B;  4RO0 A;  4O2B B;  4ZOL A;  1QGK B;  3TGU H;  5BR8 B;  4BR6 A;  5BMV B;  1E5W A;  2YIB D;  1J1E C;  3AE1 C;  1VQ9 P;  1IDS A;  4D6T H;  1ROP A;  1RF0 A;  3N2G B;  4ZHQ B;  4CC6 A;  2Q3E A;  5B3S C;  3CCM P;  4Y28 J;  2NPS C;  2XAG A;  4KHP O;  4LFB B;  3JAS B;  1GM8 A; 
#chains in the Genus database with same CATH homology
 1VL2 A;  2E74 B;  3IAO A;  2FXP A;  4GDO A;  2JP3 A;  1S1C X;  1K05 A;  2E74 C;  1EXJ A;  3D6Y A;  3H25 A;  4U7J A;  2E75 C;  3GF3 A;  2QIW A;  1RQU A;  3AE2 C;  1ZME C;  3Q5R A;  1KTM A;  1DD4 A;  2D2C B;  2J5U A;  3AE5 C;  1IK7 A;  1FDO A;  3T97 B;  2E74 D;  1HF9 A;  2JO1 A;  2FBW C;  3EWK A;  2H89 C;  2WQY C;  2BEQ D;  1ZRT E;  3IN6 A;  4KT0 J;  1MKM A;  2WSE J;  5M1B A;  1Q90 D;  3AE3 C;  3AE8 C;  1YQ4 C;  1NGM B;  1OW7 A;  2WSC J;  2YMK A;  3GF7 A;  4H44 D;  3Q5P A;  2E76 B;  3AE9 C;  3Q3D A;  2QJP C;  3GMA A;  1VF5 D;  3R4Y A;  1PL5 A;  3AEF C;  3AEA C;  2WSF J;  1S5L X;  2ZT9 C;  2E76 D;  1JB0 J;  1VF5 C;  2QJY C;  3AE4 C;  4PV1 D;  2P10 A;  4XFJ A;  4H0L C;  3Q2Y A;  1R8E A;  1WMK A;  4R4L A;  3B71 A;  3SFE C;  2G3A A;  4H0L B;  3GLM A;  5L8R J;  3FGA D;  4TT3 H;  2G8Y A;  3D70 A;  1KOR A;  1RQV A;  2WPV B;  3LW5 J;  3AEB C;  4H13 C;  1TU3 F;  4H13 B;  2O01 J;  1PIX A;  1UIX A;  2D2C C;  1Y9B A;  3AEE C;  4RKU J;  1OMI A;  3C8V A;  2E75 D;  4YTP C;  2OQQ A;  4H13 D;  5KKZ C;  3S9O A;  2D2C D;  2MKV A;  2NZ2 A;  2K9Y A;  1DD3 A;  1KQF B;  1K04 A;  2E75 B;  4IL6 X;  4H0L D;  1KQG B;  4PV1 C;  3RK3 E;  3AE7 C;  1ZOY C;  2FYN C;  3Q5S A;  3D71 A;  2E76 C;  1KMI Z;  4PV1 B;  3SFD C;  1EXI A;  2YIU C;  1HJ0 A;  4OGQ B;  4I7Z B;  1AJY A;  3AEG C;  3O6Q A;  2ZT9 B;  4OGQ C;  2QJK C;  1VF5 B;  3G9R A;  2H88 C;  4I7Z C;  2V7Q J;  1DIP A;  3AEC C;  3D6Z A;  4R4M A;  1ZP0 C;  1GMJ A;  1OW6 A;  1KIL E;  5KLI C;  1NYH A;  4OGQ D;  3AE1 C;  4H44 C;  2BEZ F;  3Q1M A;  3AE6 C;  4Z1M H;  2ZT9 D;  3RL0 g;  4H44 B;  1OW8 A;  1U57 A;  3AED C;  1FDI A;  2IDB A;  4Y28 J;  1PV3 A;  4YXD C;  2QSI A;  3ABV C;  1YQ3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...