2E76B

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e76B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76B01
2WPVB 1ZRTE 2E74B 1S5LX 4KT0J 2D2CB 2E75B 3C8VA 2FYNC 2QJYC 4RKUJ 5KKZC 4H13B 2QJPC 4I7ZB 2ZT9B 2WSEJ 2WSFJ 4H44B 2K9YA 5L8RJ 4Y28J 2E76B 3LW5J 5KLIC 2QSIA 4IL6X 1JB0J 2QIWA 2O01J 1VF5B 2WSCJ 4H0LB 1Q90D 4OGQB 4PV1B 2QJKC 2YIUC
chains in the Genus database with same CATH superfamily
3ABVC 3TXSA 2Y0IA 5AW8B 4EB6A 4NTWA 2UXXA 3JARA 2B9ZA 4JI2O 1RY3A 2Q73A 2IDBA 3GLMA 3AEIA 1NI8A 3TCUA 3JALA 4DUZB 1K8AW 2BCCJ 3T97A 4I5SA 2JEUA 3CMEP 4ICGA 3BCCG 1YBKA 4JZGA 5FPOA 2QSIA 4DR5B 1E1QG 3H9VA 1PPJG 4OXSA 1SQGA 4MW3A 2M3EA 3L75E 1L0LH 3C3TA 1LTBC 1IK7A 3OR6C 1GD2E 5B5EZ 2QRXA 3BRTB 4PDLA 4DV4O 1EFRG 1FXVA 4DXWA 4I9QA 2YXYA 3WUUA 2QJPB 2FYUG 4W7YA 4BXLA 2A0LA 1S9KE 2JS5A 4DR4B 3CPWU 1WPXA 4H44D 2IM9A 3X2QC 2VQFB 1GW3A 3OUSA 1S2EA 3UO2A 3BVHA 1NTMJ 2UU9B 1JOYA 2BEQD 4U3JA 4N6JA 4EEQA 3H6PA 1O9GA 5EBMC 2YUAA 4X64O 2MK3A 4TQDA 3OD4A 3H1KD 4U3FH 3G67A 2QIWA 1QGKB 2OTKE 3CX5D 2YIUC 3CCMV 1HNXB 3BRVB 4XFJA 2HHHB 1CI6B 1BCCJ 3EWKA 5E79H 4K8XA 1KZUB 1K9MQ 2XAHA 1S3JA 2Q3EA 3CXCU 3IF4A 3BA9A 2KZJA 2PI5A 1OCOC 1L0LG 3OFNG 4UUJC 5BU8B 3H1HD 2A9HA 4LF9O 5KJ7D 1BE3H 4ZHQB 3T4DA 1GN2A 2JO1A 4O2AB 1RHZB 1HDJA 2POHA 3RGUA 1EXIA 3CC2P 1U96A 1N7LA 5AVSB 4H44C 2G3AA 1L2PA 1UIIA 2G8YA 3JCZA 3ZN1A 3RL0C 4TV8A 4GX2A 2ZIOA 4YY3O 1HTLC 2RH0A 4K0KO 4W80A 4CH4A 4ZNCA 3LNMB 3PLNA 3J81N 3SGIA 4OH8B 1Q86W 3E8FA 2JK5C 3OW2U 1WNSA 2JEEA 1GM9A 4U3FG 3WU2E 5APSA 3CEIA 3L75H 3AG3C 2R9AA 2EIJB 1B06A 1IK9A 1URQA 3Q5RA 3SPCA 1KYOE 1PIXA 3DC6A 1MSDA 2XAFA 5AW2B 3GWKC 3V2QA 2P2UA 3PH0A 2ZAEB 1FZCA 4AHCA 1BE3G 1G6UA 1GL2D 3K5OA 2CTRA 3TGUJ 5LBQA 1KC8W 4JI4B 2YIBD 4D7TA 1ZMEC 2DOSA 2BCCD 1IFMA 3A2AA 2CH7B 1DTOA 2IJHA 3CX5E 1UJWB 1D5AA 1PL4A 2M5AA 3D6ZA 2GUSA 3PRJA 4FPPA 1NTKK 4K3AA 2EZPA 4IGGA 1N73C 2KK7A 1N32O 2Y9YA 2HFED 3KDPB 1EZJA 4DR5O 2A06E 1YTFD 3SDLA 4TUYB 2J5UA 3CD6P 2XAGA 1Q7YW 4JI3B 2W0XA 5C8YB 3HD7D 3L75G 3K0DA 1U7MA 1NKZB 5BVZA 1Y74B 4KP4A 5H9CA 1HNWB 2LP7A 2FFDA 2EULA 2GTAA 3MHVA 4QJFB 2E75B 3SFDC 3EQ2A 1IVSA 1IURA 4HBNA 1PM9A 2AZ0A 3WG7C 1GL2C 3MIWA 1ZN5A 1CPYA 1K92A 4BWAA 2N05A 2Y48A 1L0NE 4I9WA 3II6A 3M06A 1YI2P 1URQC 3ASOB 4PD4F 1N33B 1OHHG 1TVKB 1S5LE 3WU2H 1CW5A 1L8DA 4XDJA 4JI6B 1RE3A 1T3UA 5AVUB 1XDCA 2HHHO 3TNUB 4JI0O 1I5XA 4R7CA 2Y9ZA 3ETGA 3OR7C 1Y76B 5CBHA 2ADPA 4I50B 4LF8O 2Q8VA 1JMKC 4BIZA 3HD7C 1KYOH 1GDTA 4HYOA 3T1HO 1GU5A 1H2SB 1IBKB 1QHTA 2BCCE 4CS4A 1QEXA 1E79H 4DOJA 5CMUA 4NXMB 1MG1A 1GW4A 3K9SA 2XUMA 1BHBA 4WVZA 1ZSPA 5LYJB 1BZKA 1OCRB 1YIJV 3GVMA 1IX9A 3LUTB 3CCRV 2ITDC 4EFBA 1SETA 2HODB 4RJTA 3LSSA 3KHUA 2AXTZ 1NU1E 1CI6A 2FFDC 2KSEA 1DGSA 3ABUA 2JGDB 2LJ2A 1KORA 1KB9F 3CYOA 4NTXA 3GHGB 3A8TA 4IYHA 2A06H 1J95A 2XTAA 2KNCA 2P7TC 4JV5B 3CC4P 1DD3A 1K9MW 1ZRTD 4ZHQA 5KLVK 1FFTB 2XT9A 4DV7B 1IFNA 4O2AA 1NTME 3QWOC 2WLNA 1SA0B 2HJFC 4GIFA 3JD3A 2UUBB 2VRZA 5KAFE 1KB9I 2N9BA 4PV1B 1L1FA 4NPDA 3TGUD 3CHXA 3M9QA 3MTUE 3OM3B 1KILB 3KZIE 1GM7A 4CH5A 1E79G 1BCCE 1FXKB 1NVOA 1L0NH 1JMBA 2NN4A 4GDOA 2QTSA 4NR1A 3JCUE 2BEZF 2Q1KA 4QMAA 3MUDA 1S5LH 1AR1B 1XREA 4BWNA 1Q8IA 3FX7A 2LW7A 2I8DA 1J1DB 1EDIA 3TXQA 5APYA 1NGMB 5F2VO 1VF6C 3GWOA 2A06G 1OJHA 5FNVB 1QX8A 3VTPC 3AG4B 5KTBA 1FAFA 1N7SB 5CCHA 4FJCC 2YMKA 3VYIA 4MVZA 1SQBK 1GK4A 4DZOA 2NNUA 2ZINA 3E8BA 4I7ZB 3EXAA 1MV8A 2C9NY 2CH7A 2IW5A 2RQ6A 1RF0A 2KYVA 4PHZA 2RN9A 4DCKA 3BAAA 3CMEV 3M0DC 5JCOA 4WBAA 4YIOA 3L9DA 4PJ0H 2UXDB 2H3OA 1XMOB 2A3QA 1BSNA 1NU1H 3E8HA 5EZYB 2WSCJ 1L0NG 2ZQMA 3CC7P 1VQKP 4NXNB 3UIAA 4TUYA 3IGAC 5DEDA 2JEXA 3R66A 5JJJB 1R3JC 2CE4A 1TA8A 3VBBA 3QF7A 4RAIA 1J5EB 3RGBA 1N33O 5C8YA 3CRQA 2MJZA 1Y74A 1PGOA 1JVMA 2H7HA 2PUSA 1Y8AA 1NTMH 1BS3A 4MN4C 3TGUE 5E79Z 3VMZA 3SYCA 4JPRA 5J2UB 5KAFH 3QNEA 4JI7B 3K9AA 1VQLP 1K3EA 2ATKC 4G27B 4MVOA 3NFQA 1K73Q 1EZVI 1VF5D 3BHPA 2W6JH 2P06A 1KMIZ 2KI7B 4AUWA 3KZIH 4XDLA 3TSIA 4ASVA 1BCCH 5CBOA 1Q6UA 2WPVB 3W68A 5EBLC 4JYYA 1TVKA 2IJKA 4RUFA 4UVAA 1UIXA 4FM2A 3PP5A 3CPWO 3JCUH 3N2GB 1CEZA 3K58A 1AP5A 2DWDC 3TNUA 4PI0A 4MTXA 5CCHC 1NU1G 3ZHVA 1OMIA 3QO8A 1Y76A 3OAKA 3OJAB 2ZVOB 3CWBE 3IC9A 1HVVA 1G1IA 1RF0C 1YF2A 2M6YA 3ZIAG 2WMMA 1YVWA 2A7WA 3VP8A 4WB4A 1R3KC 3JAWB 1NTMG 1OCZC 1J1EB 2QJYB 1P7GA 2UUBO 4JAAA 4ASWA 5CCGD 5LYJA 1X0TA 4J7JA 1VF5C 3MHSC 3C8VA 5GTHZ 2HODA 5BMVB 2W6JG 2W0FC 1HJBA 3U1AA 3H1ID 2P90A 2K9JB 2GM4A 2JGDA 4MVMA 1FDIA 4IL6E 3VOUA 4DJGA 1BCCG 3GHGA 3DXRB 2AHZA 4TV9B 3ZJZA 1IC2A 2V7QJ 3OMNB 3H1JJ 3HKCB 3JSLA 2XDJA 3SR2C 4GLXA 1Q90D 1L4AB 1SA0A 2XU6A 1BL8A 2C0XA 5KKZB 1X9VA 4MTOA 1EN5A 2ZFCA 1PV0A 1Z5WA 3OW2O 2CPBA 1KV4A 5CJ4A 3ASOC 4DR6O 5KMGB 1YTZT 1KILA 4TWKA 1PGPA 2OQQA 3HUSB 3VN0A 4EFEA 1NTKJ 1KYOF 1SFCA 5CCGC 4I0XB 1FXKA 2B1GA 5EC1C 3KCXA 1YITP 3WB1A 5B1BB 3H25A 4GKKO 2O3JA 2YIUB 4H0LD 4B3TO 5AW9B 4OVNF 3H1LJ 1SQPD 2YI9A 2OYOA 2UXDO 4JYBA 3I56P 4KHPB 3W7SA 2QR4A 4NXNO 2OYQA 1SFCD 5FNVA 4X66B 3CWBH 4BRYB 1HNZO 1VQ4V 4RKUJ 3WU2Z 2WA3A 3CE2A 4FVMA 5LXTB 1N7SA 2K37A 2K3RA 2WPQA 4R4LA 2ZYGA 1FOSF 3FYIB 1JY3N 4PI2A 4ZKPA 3NXSA 4X8AA 5BR8B 1WP8A 3GHGC 3V4QA 3WUTA 4GX1A 1M1JC 1NHLA 1WMKA 4YXWH 1BGYJ 4J7ZA 1YI2V 5AVVB 3USSA 1T2KC 3X2QB 4WFGA 5EZYA 4DW1A 3IN6A 4LFCB 4LF5B 4I6MC 4CC6A 4CS3A 4O4JB 3K5MA 4H0LC 1WLEA 2ZT9D 1PGJA 1V9PA 2QWOB 1NR1A 2Y69B 3WFVA 1X8YA 4K8ZA 4KUMA 3O9OA 1EDLA 1NBMG 1Z56A 2KXPB 2CPSA 3IAOA 1SFCC 3RK2D 4U7NA 2EIKB 5J2UA 5DECA 1H2GA 4J9YB 2NRGA 3CWBG 2NPSA 3F89A 4OGQD 4FM1A 1W0JG 2QWRB 2VWKA 3D3IA 4CC5A 3OE7G 2DQ0A 3M7MX 5JVDB 2OARA 1OCOB 2HVKC 1QL2A 3AE3C 1K73W 1G1XB 2WT7A 4LF4B 2FTKA 3U11A 1F4NA 1Y6XA 2M3BA 1KFMA 5GW7A 3SYPA 3ZBHA 3N2GA 4OPHA 2WSEJ 4H44B 4YXWG 1KILE 3RW0A 2DW3A 2NPSD 5KLVJ 2P58A 4Z2WA 4RUEA 2DJVA 2ZT9C 1MUUA 4L74A 4MTGA 3CC4V 1LWUA 4B3RB 2R72A 5IYCO 5D5PA 1WJZA 4HAMA 4QE9A 3SWFA 1ZTEA 5IJ0B 3N7NA 1S5LZ 2RMKB 3MP7B 1KB9D 1W59A 3JAWA 4NB5A 1X4TA 5EIBD 4Y99C 1GK9A 5LGUA 1M90W 3AG3B 2WQYC 1X79B 4OGQC 3RK3D 1NTKD 5D5QA 3ZMVA 4GZRB 3N4XA 2BSKB 4PELA 1QNMA 5BMVA 2NLJC 2WWWA 1P84F 5K1PA 1VMGA 5KLIC 1HGVA 2K9JA 3KPEA 2E42A 3DXRA 3T4ZA 3H1LD 4TV9A 3JASB 1VQMV 2AXCA 4B86A 3HKCA 4IYIA 2E74D 1NAFA 2NPSC 1R1BA 4TSFG 1VQPV 1OIPA 3QTCA 1P84I 2DWEC 3PTZA 4FFBB 1L4AA 1SQBJ 2KS1B 2R3SA 4KHPO 2KG7B 3B2EE 1N73B 3G6EP 4FZ1A 4X66O 1RQUA 3B5ND 5KMGA 5AVZB 2AEFA 2EX3A 5EIBC 3HUSA 1MFTA 3HPLC 4LP8A 3SPIA 1I5YA 3ZX6A 4I0XA 2F4VB 3L74J 1YSCA 4F4LA 1XTCC 5BR8O 1BGYD 2XNDH 5KAFZ 3H1JE 1KN7A 4HB1A 2BOCC 5HFLA 1LWUC 3OEHG 4FM0A 1OX3A 5CBNA 3O6QB 3CXHF 3CC7V 1BDDA 3I56V 1NWQA 1A02F 3WG7B 1GL2B 2EJ7A 4OX9O 2QTOA 1J1EC 1AI5A 2QJYC 1AVMA 2V4HA 1N34O 4BRYA 3B8EB 3J7AU 1AB3A 3FAVB 5LXTA 2Y0DA 3BVOA 3JCUZ 1J2JB 1KQLA 1AV1A 4L73A 2W83C 3VQYA 4L76A 2Q68A 4DV3O 1ZP0C 1M93A 4UCTA 3CXHI 3EFFK 1EZVD 1M9NA 5LMNB 1K5SA 4Q20A 2IFMA 3ITKA 1YTFB 2JS3A 3AG1C 1VIBA 2IZ0A 3AK3A 3K3WA 1ZAUA 4UCSA 3WB2A 3HD7B 1EDJA 1S5LX 3H1LE 2XZRA 3FWNA 4I1LA 2K88A 4GOFA 3P32A 4W4KA 2YIAA 5KKZC 2XAQA 4LF4O 1NTZH 4O4JA 1XTGB 2LXCB 2XNDG 5AVRB 5KLVD 4Z1VA 2IBZI 5LGTA 2IH3C 2QGNA 4BW9A 1IBLB 2DYRC 2H43A 1EDKA 4DR7B 2ZXXA 2HG5D 4EOTA 3MZWB 1JY3P 1WPBA 3PHLA 4YJ2B 3F5HA 2P6JA 2YC0A 2CTQA 5B1BC 4B3RO 2VWJA 4GKJB 4N78E 3FWLA 2J58A 5JVDA 2B5UA 3QO5A 5ITZB 1IZNB 3N27A 3STZC 3A0BE 1F23A 5IDJA 3CSXA 2A45I 1LP1B 3AEFC 3CCSP 2V7QH 5LHGA 1F51A 4WFHA 2BE3A 3H1JH 3U0ZA 4AQYB 1NOHA 2PGDA 5DJTB 1GTOA 4EKWA 3L72E 2M7WA 2FKWB 4O4HB 5JJNB 2KOGA 5K5GB 4DR2B 1NTZG 5LMUB 2ADQB 3BABA 1HW7A 2FYNB 3OGIB 3JAKA 3T1YO 1VQ9V 1SQBD 1SQPK 5CA1B 4JI1O 3IJ4A 3JD1A 3SJAC 3JATB 5IJ0A 2M0BA 1NJIQ 2HG5C 1EZVE 4FMTA 5AVTB 5GTHE 5IT9N 3ETQA 4DV0B 4DW0A 3KKYA 5L3GA 4BIOA 2NZ2A 5H2FE 3CCVP 2I1JA 1JPXA 4E4EA 2YMYA 2F95B 3L74D 2BSKA 1U57A 1AFOA 1LTSC 4X62O 2N1TD 2Y69C 3BRCA 3T2MA 3ZDMA 5KJ7A 3H1LH 2FKXA 1YITV 1SQVD 2RN0A 4O2BA 3SWKA 1QR8A 2AW9A 3JASA 2EIKC 1SLQA 3P30A 1Y9BA 1GZLA 3M0AA 3I55P 2V7QG 3H1JG 3AK2A 4W4LA 4FFBA 2KS1A 4D6TH 2KG7A 4IFDK 2KNCB 5AVQB 1RQVA 2JR8A 4IL6Z 4ZMDA 1N73A 1YJ9P 2RCVA 2EIMC 1NR7A 3LIDA 1YJWP 3OTOB 2UXBB 3FD9A 3AE7C 2ODMA 1JMMA 1PP9J 4I55B 5IWAO 1FBMA 1HWTC 2BTQA 3SYQA 5LMNO 5EFWB 1WB7A 3CCLV 3ABLC 4QIWF 3A0BH 2KB7P 3A2FA 4DV2B 3E2EA 1XOUA 3TF5A 1DX7A 2DQ3A 3ZEDA 1D5NA 1DEEG 3O6QA 3H1LG 1GL2A 3D71A 3HKEA 1IFPA 3L72H 1DIPA 4LF7B 4Q6GA 2YIBA 4DV1B 1ORQC 1AJQA 4DR3O 1VEWA 4YHHB 2FYUK 3A3YB 3FAVA 1IBLO 3JYCA 3LDDA 5KUKA 3K08A 2XOKG 1PFIA 5KHJA 3L71J 1QU7A 4DR7O 4D6TG 1EZVH 1AJYA 5GTHH 3L74E 3L73J 2VRSA 5KJ7C 2QJKC 3HRNA 3OMIB 5CA3A 1RPOA 1A02J 5H2FH 4MS2A 3RWRD 1H8HG 3H1KE 3R2PA 1ZXGA 4GKJO 3HD7A 3G71V 5APXA 1MABG 2HLDG 2E5TA 3WMM0 2B9BA 1RH5B 3LNNA 2WSEH 1KQSU 1MSWD 3B4SA 4AILC 1JOCA 2XNXA 4UV9A 4DUZO 3K5LA 5HFMA 3JC22 1HF9A 1GMJA 2ZNJA 2PFXA 2OTJV 3ZN0A 1OCZB 5BY1A 4DV6B 2PAJA 4AQYO 3O8ZA 1JM0A 3H1HE 4RWUA 4UB6Z 1VQ7P 1L0LK 1VF5B 2O01H 3CCQP 1IXMA 1NS1A 3L72G 1EN6A 1KECA 3G80A 4YJ2A 5LMUO 2E43A 2B87B 2N9YB 4B3MB 2ZXWC 1JY2O 2DW4A 1O9HA 2G38A 2KUBA 1EZVG 4DR4O 4J11A 4DRXB 5ITZA 4DV0O 2VQFO 1IXBA 1QVGU 3UQ8A 4KJMA 2UU9O 4IL6X 4I4TB 1LP1A 3S1KA 2IX7C 3ZHQA 1H2LA 2QKAA 4FLUA 4JI8B 5AVYB 2MKVA 3IFMA 2UXCB 2Q3IA 4LH7A 1FZAA 2Q9IA 4DT0A 4O4HA 3VQXA 5IJ9B 1HP8A 1HNXO 5B1AC 3N2KB 2HFEC 3STLC 3QH9A 2ITCC 1JQ0A 1Q6IA 2OCHA 1P84D 2AEMA 5CA1A 2WLHA 3JATA 1K4CC 4A7PA 1JR9A 1JX9A 1AROP 1VQ6P 5L3CA 3G4SP 1MA1A 4PD4I 1NKDA 2JDIH 1NJIW 4NTYA 2IZ1A 1PP9D 2HEPA 4OWFA 1VF6A 4LR3A 2UXBO 2PI4A 2YNYA 3OAAG 1AI7A 4LFBB 3H1KH 4L87A 4MVUA 2KKWA 1IZ3A 3CX5H 1BDCA 5LHIA 3CMAP 1M5IA 4QNHB 5DJUB 4DR1B 4RO2A 3S3WA 3ICXA 4DV2O 2KB1A 5AW4B 2VQEB 1PV3A 3E1IA 3Q1MA 1M1JB 2Z0AA 3H1HH 3M0DA 1WA8A 5AW0B 4FK5C 4LF7O 1AVYA 4DV1O 3ZRVA 4I2LC 2Z3YA 3FYEB 3L71D 3L73D 3CXHD 4H0LB 4WFFA 1XHXA 1THZA 4I55A 3E86A 1FDOA 3K04A 1V54C 1RSOA 1IFJA 3K79A 4FZ0A 4P2ZA 1PZQA 1SQXD 2QEXP 1I08A 3W7UA 1A32A 2JDIG 1KKCA 1AI4A 2FYNC 5APQA 1SFCB 4JI4O 1PD3A 3AE4C 1F4MA 3H1KG 3HTKA 2Q6QA 3C9IA 4QPJA 1USDA 3H1IJ 4X1IB 1AJNA 4HNAA 1I7FA 1M1KQ 3G6BA 2IBZD 3IR9A 2F23A 2ZCEA 1UFIA 1LTAC 3CB2A 1Q81Q 1Q43A 2WAMA 4WFAV 1CSBA 2HPCA 1QVFU 4AYCA 4NPEA 2PRRA 2R70A 3H1HG 4RESB 4JI3O 3NTNA 1SRYA 1GRJA 3F7YC 2L6LA 1HNWO 1AVOA 1SF9A 4B3MO 2BCCH 2YKPA 1OZHA 3BY6A 1W0KG 2ZT9B 3M9HA 4N23A 1OVVA 5KHKA 3K57A 1LTIC 2RKLA 2EILC 1FC2C 1XMQB 4H37A 1XUQA 2LFRA 4IOIH 4NKGB 4JYCA 1W2EA 3OT7A 3CCSV 3RK2B 4J7KA 4Z1MH 2GUZB 4JPZB 2EJRA 2F93B 1FE6A 4Y99B 4OGQB 1Q82W 2UXCO 1SQPJ 3OUFA 1ZRTE 1SQVK 3QO7A 2BOBC 1SZTA 2B87A 1GN3A 5KLIB 5GONB 4LC1A 5L3FA 4JI6O 5KA6A 3W67A 5L3EA 1GAXA 2FB5A 1M57D 4DRXA 1XHZA 3CCVV 2JJLA 4C7UA 2NPSB 4AI8A 1IBKO 1GU4A 1AR5A 4I4TA 2BCCG 5IE9A 4L8JA 3Q5SA 2Q7EA 2HP8A 4LFBO 2WT7B 4NXMO 2W6AA 2HLOA 4PA9A 4NYKA 1CZQA 1VQ5P 2JGUA 4H13D 3JD0A 1R6KA 5IJ9A 5KAIE 1FZBA 3D3QA 3N2KA 4Z1MG 1LR1A 5CCGA 1FJGB 4DR1O 3A0BZ 3F5TA 3LSQA 3UKMA 3RK3B 3M8AA 4JF3A 2E3CA 4HH2A 2LXBA 2V1DA 2CK3H 4LH6A 1N86A 1LWUB 1M90Q 4JV5O 1YJWV 3DSQA 3ZRWB 1LT9C 3APOA 5KHIA 4DV7O 3CC2V 3BCCJ 3U1CA 1B6QA 2HVJC 1JO5A 3E83A 2E74B 3WB0A 4GODA 5EYPB 1IBMB 3P8CD 4MVRA 1X22A 3DTUB 1G1JA 1EM1A 1YQ3C 1FAVA 2R5BA 3E1RA 1S1CX 1U7JA 4CBCA 2WSFJ 5H2FZ 1JCHA 2WPSA 3LW5J 3ZHRA 2FYUJ 3P7KA 3B5NB 4H13C 1M1JA 4B3SB 3AG1B 3CCEP 3SJQC 2DE0X 3ZRSA 2E5YA 1JUNA 4FLXA 4FLWA 2AEJA 3L4FA 1OVUA 3F7VC 3HKBB 3A0HE 1KP3A 3M91A 2WTYA 3O65A 1U97A 3TGUH 2CK3G 1ZLLA 1ZW0A 4B7KA 2WLIB 1YHQP 3AK1A 2DYRB 2W27A 2QKSA 3CCJP 4NVPA 5TISE 3ZS8C 3CS5A 2GTSA 3ETDA 1DK1A 5LHHA 1RP3B 1SQQD 2PGGA 4X1IA 2Q67A 2ZNIA 1L0LJ 3CRMA 1W5CE 1XEQA 4PDVA 4DV5B 1JTHB 1KFNA 3RYFB 2ZXEB 1XNQB 2ZR3A 1NU1K 5KAIH 2A79B 1GK6A 3IFXA 1XMOO 1WT6A 3RYCB 5AW6B 5LP6B 3SPGA 3TK1A 1VQ7V 1NVPD 3CX5F 1M1KW 3RYIB 3CD6V 1KYOI 1LTGC 3JAMN 1J5EO 4HZ3A 2E76D 1Q81W 1K4DC 1KQSO 4UCUA 3V2NA 1GTWA 2HR3A 1SVFA 1RPRA 2O01N 1PGQA 5C39A 3TGUG 3CCMP 3RT3C 1H2NA 4U3FJ 4JI7O 3HKDB 4UV8A 2QSAA 3H1IE 5FLXN 4UB6E 1ZX3A 3AG2B 3NR7A 4IHJB 2GUZA 1URFA 3JSNA 2EZOA 1FZGA 4DK1A 3EHBB 2H8PD 1R73A 4IL6H 1BQZA 1G8MA 3D36A 3W7WA 2Z5UA 2YXLA 1I94B 1NH4A 1M8OB 1FYJA 2CGOA 2ZDIA 3U59A 5GONA 2Q9LA 3B77A 1VQNP 1QVGO 5L3DA 2XV5A 2PF4E 1F7YA 1IDSA 3A0HH 3LIEA 4PD4D 1RF1A 4WY4D 5JJEB 3G4SV 2E76C 3BCCD 3WUVA 4KL1A 2LR2A 4JI5B 5CA0B 3ZCCA 1PPJD 3TETA 1OZ0A 4X20B 4JTAB 2D3OW 5TISH 3UCSC 4YXDC 1XQ8A 4X89A 3SJCC 2RMZA 2EIMB 4FLTA 1SQPE 1XNRB 2HYNA 1SQXK 2FYUD 2PZSA 3CRCA 2H8PC 3S4RA 1DEBA 3ETEA 3DC5A 1SC5B 1ZL8A 2JKVA 2Y0EA 3W7TA 3U10A 3ABLB 5KHGA 3UM7A 2N1TB 3JAKB 2YICA 2Q0OC 3V5BA 4YPCA 1SERA 1SESA 4DO2A 3ZRWA 1LTJC 4JYAB 3RK2C 4WY4C 4J9ZB 1LT1A 3FB8C 3OA7A 2Z5HA 2JIZG 2H89C 1Q5OA 5EYPA 3D36C 2Q0AA 2H88C 3H1IH 4UB6H 2R9RB 2ZDIC 1RE4A 2E5LB 2FYZA 1L0LD 5AW7B 2QJKB 2HJDA 4O2BB 1KUQA 4DYLA 3B5NA 3A5TA 2DN9A 1XBLA 1M7LA 1RF1C 3K5BA 2OTLP 1MNGA 2P22C 5FL7G 5APVA 1YTZI 2IU3A 4UCRA 4DV5O 1N8RQ 1XNQO 3C90A 1LUVA 4PD4E 3HKBA 4QE7A 3BCCE 1S72P 2WLIA 1OW8A 1CP9A 1PKXA 4Y28J 5GTIE 3D8CA 1OW6A 2RNBA 3GG2A 1RFYA 1VDFA 4U3FD 2O57A 1EXJA 3PJSK 1R5SA 2BTQB 3RK3C 3L37A 3SWYA 2X0LA 2W90A 4YJ3B 2WSSH 2LFSA 3AECC 2WSCH 2ZXWB 1Y66A 1GO3F 1SQPH 1SQVJ 1JTHA 4P9PA 3RYFA 3H1IG 1OXZA 5B66E 3ZMSA 1QL1A 4MVQA 3KCYA 3RYCA 1VQKV 5LP6A 1AP6A 4LFCO 3HKEB 1KP2A 4LF5O 3RYIA 1BE3D 2QWQB 2E74C 3QVNA 1BQ0A 2KLUA 2JVDA 4O9BA 1KB9E 1I94O 5L8RJ 1FD9A 1MOFA 3AG7A 3MD0A 3EVKA 1S77D 3RK3E 1RE4C 1ZR4A 1YIJP 1NTKE 2P67A 1VQLV 5B1AB 3VP9A 3B40A 3HKDA 4WBNB 3B5NC 3L36A 2YO2A 2ZR2A 5C93A 5DN6G 3BATA 3OMAB 3MGNA 4GCZA 4U7OA 5KUMA 4JI5O 1L0LE 4IHJA 4ASUG 3ZHSA 2EBOA 2ZE5A 4LF9B 2XASA 3L75D 1FFXB 1YJNP 2FMLA 1QLED 1P7BA 1Q3EA 2AZ2A 1SS1A 2WSSG 1VQ5V 2LQTA 1XNRO 4GOEA 1PNLA 1SQPG 1IFIA 1BMFG 1I0HA 3K06A 4GX5A 4G28B 1K97A 4LF6B 2L91A 1S9KD 1SQFA 4H33A 4K0KB 4N21A 1WP7A 3Q4HB 4PDRA 5A9GA 2R3CA 1FZFA 3H01A 1Q6HA 4JF7A 3BA8A 4W7ZA 2N74A 1VQOP 4F6RB 1P4RA 2JWAA 1R3IC 3VQWA 1BSMA 2QM8A 2YIDA 5CA0A 2GSMB 4X20A 2CAZC 5LL6Y 5GTIH 5BU5A 2KSJA 4JYAO 3M99B 4KHXA 2UWJE 1BGYE 3JD4A 1L0NJ 2OYHB 2Q5UA 4FIPC 1TUBA 5LP6C 4TOIA 2ILMA 2WVRA 3GF3A 1HGZA 3FX0A 4JZ2A 3AEAC 3AE8C 1JY2N 1QLEC 1V54B 5B66H 1H89A 3HR0A 3JSVC 1KQGB 4A5UB 1SQQK 2N1TA 2D2CD 2QA4P 1ZLZA 4ABMA 2FL4A 4RQFA 1KB9H 3FKSG 3SJBC 1HBWA 2PTMA 4CH6A 3AG2C 5JH7B 2WPDG 5KAIZ 5KX5B 3G9RA 1YHQV 1N32B 1NTKH 3LDCA 3E8GA 1SS3A 4LNUB 3CCJV 4CPGA 2ZKOA 3E35A 3RBZA 2IYOA 1K04A 2WITA 4GKGA 1NU1J 2F4VO 1BHAA 3D70A 1M56D 5KLVE 3FFQA 3W7XA 4JAUA 3THOA 4JQ0D 2LGQA 1S5HC 3AEGC 5CBGA 1OCCC 1NH2D 2EILB 1KYOD 1NAYA 3P3NA 4ZOLB 2QG4A 3RL0D 1WA8B 3VQVA 2D2CC 3R65A 2Z5IA 4TQFA 1KBHA 2DYSB 1N8RW 4EDFA 3SYOA 4C7NB 5M1BA 2XAJA 2GUVA 3FXDA 2KIKA 1UPGA 4J42A 1KTMA 1D7MA 1Y47A 1LNQA 1RSOB 1EBOA 1BGYH 4JI0B 4YJ3A 1NTKG 3A0HZ 4LF8B 1EQ7A 1FPOA 4GUNA 2N1TC 2HKOA 4ZKIA 3T1HB 2A06D 2CGNA 1BT8A 3HTKB 1M56C 4E2LA 5KA5A 1QCEA 5TISZ 1NTZK 4HNAB 3ABMC 1SQBE 4FLZA 2OCCC 3AE1C 1HUCA 2C2AA 4UB8E 2IU0A 2Y0PA 1VQNV 1JEKA 3ML0A 2HPCB 4UCVA 4LF6O 2ETNA 1SP4A 4EYYQ 4QPKA 2O1KA 5CJ0A 4JTCB 2JRIA 4WBNA 5KHHA 1MZ9A 3GB7C 5H5NA 3KXDA 1PNMA 4HYTB 1L0ND 1BSHA 1SQXJ 1DLBA 4PDMA 1SQVE 4HJGH 4LFAB 3IC7A 1FFXA 2W6IG 4P9OA 1BGYG 1Q82Q 5KLVH 2FY8A 1R5LA 1EC5A 1LT9B 2AHYA 1XL4A 1K34A 1NO4A 1TU3F 1G2CB 1M57B 1G4YB 4J10A 1FKAO 5LA6B 2C9LY 1QQCA 3E7KA 3K5NA 3Q4HA 2X6CA 1JJOA 4DR2O 1VARA 2WA4A 2KQXA 1T5EA 3I5CA 4F6RA 1W2BU 1LUWA 1URQD 1AQ5A 3K0GA 4H13B 2PP6A 1KD1Q 2KSDA 1Z5VA 4D7SA 3RVZA 4CZZA 2OYHA 3FB7C 2ITAA 2ZD9A 1H0TB 4LBEC 4M3LA 4PA6A 1FOSE 1NU1D 2KZIA 1YEWA 3A0RA 1VQ4P 1CXZB 2J59M 4PA7A 2OT5A 1R6NA 2OTLV 5J2TB 5KLVG 1N4CA 1SQBH 3KYQA 3CWBJ 1XL6A 3SYAA 1NTMD 4UB8H 5AW1B 5JH7A 4BAYA 4CS2A 5KX5A 1S72V 3G6EV 3ZMUA 2YDEA 2PYLA 4G2KA 3L74H 2L35A 3BASA 4LNUA 1NZ6A 4BIUA 4X1YB 3OTOO 1BCCD 2IJIA 3ABKC 3A7OA 1VQ8P 1SQVH 1V55B 2OYIB 3ZHTA 1N36B 1JY2P 1AI6A 3L70J 1ZR2A 1FZCC 1K7DA 4R6ZA 3AE9C 2GV9A 1DD4A 3OGCC 4X88A 2YXHA 4MVSA 2JWDA 5IY5B 2GDSA 2DMXA 4ZOLA 3AEEC 1ROPA 2Y4UA 2LW1A 2BTOA 3E22B 1PL5A 3AE5C 4ZBMA 2OYHC 1SQBG 2CUGA 3BEHA 4O4LB 4YHHO 4C7NA 4O4IB 2FXPA 3C1LA 3RN4A 4PJ0E 4MT8A 3NMDA 4JBZA 2Q7HA 3L74G 2WLLB 1NVPB 1QR9A 5LGNA 1RM1B 5BZBA 2E76B 1YJNV 4LFAO 1SQVG 5GTIZ 5CN0A 4IT5A 4EI2A 1P84E 3GW6A 5CMZA 3I5DA 1Y67A 3P8MC 2PYJA 2K1AA 4TLFA 4BR6A 4X65B 4DV6O 1YDXA 3AEBC 5B66Z 1JA8A 1PP9E 5K1XA 2YI8A 1VQOV 1RE3C 3ZHUA 3V4WA 1NKNA 4F6EA 2QJPC 2WLJA 3LSUA 1VQMP 3FB5C 2UUAB 1GMGA 4WCEV 2IPPA 4UXNA 1DF4A 3SFEC 3F5WC 4GYCB 1JCCA 1VL2A 4HKZH 1GH6A 1LT9A 1LTJB 1VQPP 4XE5B 1SQQJ 4WY4B 2DYSC 2Q7CA 1G2CA 5DM6V 4JI8O 3RBXA 2OIEA 5LA6A 3Q2YA 1N2DC 2OWOA 2ZVNB 4DR6B 2K9PA 3CWBD 2X6BA 4RO0A 3L71E 3B71A 4DUYB 2QA4V 2WZ7A 3L73E 2CDYA 3VMYA 4UCOA 3CXHE 1ZUQA 4J41A 4P30A 1EN4A 4GKKB 3OTFA 4MTFA 4B3TB 1GM8A 1HWYA 2Z4EA 1SQXE 1RF1B 1WAZA 1MFZA 2F66C 1ZV8A 1GKFA 2GBOA 2YS8A 1HJ0A 4L75A 3PN1A 4FLVA 2CTWA 1H0TA 5CCHD 1XILA 1PL0A 3AEDC 1KD1W 2UXNA 2RDCA 2P4KA 3L70D 5EC2C 1FU1A 2FXMA 2ZJSE 1IJDB 1HNZB 1US6A 1S4XA 2GA1A 2IBZE 1H88A 3AE6C 1WRGA 5AVXB 1IO4A 1P49A 1N36O 3BFRA 3HE5B 3CCUP 5J2TA 5IYDO 1AR4A 1P84H 3I55V 2R32A 1S76D 3HE4B 2W6BA 5JQGB 3C3SA 3M9BA 1ZL8B 3CLQA 2VQEO 2XKMA 2RJZA 1LGHB 4PA4A 1S0VA 1FJKA 2IFNA 3ASNB 3MUDC 1YJ9V 2ZM6B 3AE2C 1PP9H 5AG2A 2EIJC 5BXZA 5B5EE 3Q3DA 1IFDA 4X1YA 2E75D 1USEA 1E5WA 1LJ2A 1MMMA 4UFZA 1M57C 2OYIA 2QDOA 4IFFA 1NTZJ 4LCUC 3APQA 2P5OA 4I50A 5APTA 1OV9A 1L0NK 3UO3A 4C7RA 2H94A 1GN4A 4RQEA 2CTPA 1AA0A 1H8EG 3E22A 5JCOC 2IJJA 3L71H 2C0WA 5LOVB 2P1JA 1N0NA 1H2KA 3L73H 4K35A 4O4LA 3CXHH 3R4YA 4O4IA 2P7JA 1MZEA 1MKMA 1HH0A 4X65O 1OWAA 2YEVB 2WPRA 1SQXH 2QVAA 2X6AA 1PP9G 3L70E 1SKVA 2WLLA 4LWSB 2E75C 3V2RA 3VMAA 3RYHB 5B3SB 2ZYAA 1YQ4C 3GMAA 2UUAO 3H32B 1VQ9P 2JJ1G 3ABTA 1XMQO 2IBZH 2Q69A 4WF9V 3RVYA 3B09A 4OPAA 4YIPA 4FLYA 2QM4A 2ZYDA 2Y0CA 3CJHB 2XHBA 1S5JA 5EK0A 3UT5B 2M8RA 4B08A 5CBFA 3CCQV 5AW5B 2EINB 1R3LC 2PY5A 1T6AA 1V55C 2KLVA 2OYIC 1Y4MA 4ZIBA 1QBZA 4DUYO 3L71G 4EIJA 5AVWB 1QLEB 2K9YA 1NTMK 5CB4B 1LTTC 3L73G 1T2KD 2W8ZA 2UUCB 2Q4PA 5B5EH 2L5GB 1T3JA 1JB0J 3P8CE 4UB8Z 3TJTA 2A45H 5IY5C 3CX5I 3CP1A 1SQXG 4PV1D 4PA3A 3S3XA 2FXOA 2QJ1A 4U7JA 4WFBV 3S9OA 3GF7A 1KKDA 1LTJA 4FFKA 3CI9A 4YTPC 3RL0g 4B7EA 1KILD 3MAQA 2K1EA 2MW2B 4WY4A 2IH1C 4ZI7B 4KT0J 1W2BO 1FS0E 1NQTA 4LLHA 1MZFA 5B1NA 1OCRC 5IYZB 2IBZG 3CRAA 4D6TJ 2WLKA 2Y4TA 5H6RA 1GN6A 3QG5A 1ENVA 1BE3J 4WFEA 1JFFB 1FJGO 1T8ZA 1ZWIC 1TGOA 3DGEA 3J80N 4C46A 2V4DA 1VQ6V 4QGPA 4IIJB 1COWG 1AQTA 3CCLP 1RM1C 5L3BA 4X1KB 4JAVA 3K59A 1OCCB 2YO3A 2ZM6O 1N7SD 4WWIA 3L70H 4OX9B 5EBWC 1KQFB 1VQ8V 1VPCA 2D2CB 1SQQE 1HR0B 1N34B 4TT3H 1NTZD 2JJ2G 5TJHA 4PV1C 1TUBB 2A45G 2AGAA 1JCDA 4GX0A 1IBMO 3ZRXA 3CMAV 3L72J 5APUA 3HE5A 3L75J 3T1CA 1KILC 1YZBA 4DV3B 1WN7A 4J80A 4X9QA 1OFCX 2IYPA 1FXKC 4MW8A 1YXBA 4N3YB 3HE4A 4UVCA 5JQGA 4JGSA 1K8AQ 2LKMA 4B3SO 3IAYA 1VF7A 1K05A 1VP7A 4EB6B 1FXHA 3G71P 1M56B 3JARB 5APWA 2R5DA 1J1DC 2VS0A 1H8AA 3JALB 3OEEG 1AILA 1Z2GA 3ABMB 3T97B 2OCCB 1H38A 2JP3A 1JJ2U 3E89A 1R6TA 3G3ZA 2OTJP 3AG4C 1NH2B 1PNKA 2Q5ZA 4KFMA 2QEXV 2YKQA 1N7SC 1YYCA 3MDSA 3H1JD 2F43G 4GT1A 3CRRA 5CHXA 3L70G 3RL0B 1B04A 3FGAD 1H2MA 4XA4A 4I7ZC 4TT3G 2OGUA 1X59A 1TAEA 5JWPA 2O01J 4JASA 4JTDB 2WLMA 4R50A 1NT2B 3D6YA 2Q7GA 5LOVA 4LGDE 4JI2B 4CH3A 2AXTE 3Q5PA 3VMXA 1JNMA 1K5QA 3SPJA 2BASA 4U3JB 5AW3B 2YXRB 2YEVA 1PPJE 3SPHA 2YXQB 1N0JA 1TUEB 2ZIMA 4LWSA 4MSWC 1B3QA 1NTZE 2NR5A 2QWPB 3FXEA 3RYHA 2UUCO 1E1RG 2P10A 3T1YB 3JD2A 1SQQH 3H32A 4DV4B 1FJPA 3P3PA 4JI1B 2FYUE 1QVFO 4R8CA 5B1OA 4DK0A 2QE7H 1K33A 4PJ0Z 5FPRA 3ASNC 5IYBO 2B88A 4NPFX 3CJHA 3ZMTA 3UT5A 4XDKA 4D6TD 4R4MA 1OVRA 2QWNB 2ZE7A 1FS0G 2ZE8A 4X62B 3LDEA 2P4VA 2B1IA 3RFRA 3V2PA 4X64B 2Q6AA 1Q86Q 1WB8A 5CB4A 4N78D 5J9PC 1AJPA 4TV8B 3TDKA 3CL3D 2R9IA 1L4AD 3H1KJ 3CCRP 1D2DA 2ZE6A 2YSUB 4IFMA 4BW5A 1Q2NA 1JY3O 4ZKUA 2FBWC 3L35A 3KZIZ 5H6QA 2KP8A 3BPZA 3L72D 4ZI7A 2QM7A 3HB3B 1HR0O 3EFGA 1R8EA 1SQQG 4XBFA 5IYZA 1URQB 1FZEA 3CCUV 3H1HJ 2QE7G 3SSUA 1KC8Q 3KG2A 5IWAB 1DH3A 1ZOYC 3ABKB 1QLNA 1DF5A 1JFFA 1M4UA 2X7RB 3B8MA 2AXTH 2O1JA 4YY3B 1FZCB 4PD4H 3FB6C 4IIJA 4UVBA 2QKCA 1NYHA 3BCCH 5B3SC 3VOPA 3V6IA 4X1KA 1SZXA 4AQRD 2OIGA 1PPJH 4U3FE 3MHHC 2YKOA 3ZMZA 2M5AB 1YCIA 2R44A 1L4AC 2B89A 2GHYA 4DR3B 2SPZA 2F1MA 3KQGA 5E79E 1Q7YQ 1OW7A 2WSFH 3LW5H 2LGWA 5A2QN 2FYUH 4D6TE 2EINC 1FDMA 3HUSC 1KU9A 5E1AC 2N04A 3B8NA 1BE3E 3K03A 2E5LO 2FFDB 1XI1A 2I1KA 4KXRA 3TYYA 3CCEV 2LO1A 2ARHA
chains in the Genus database with same CATH topology
3ABVC 3AEGC 1S5LX 3Q5PA 3AE3C 1VF5C 3C8VA 4H13D 3B71A 3GLMA 2IDBA 3O6QA 5KKZC 3D71A 3D6ZA 1DIPA 1PV3A 2WSEJ 4H44B 1FDIA 2E74C 2D2CC 1KILE 2K9YA 4GDOA 5L8RJ 3Q1MA 2BEZF 2QSIA 2V7QJ 1JB0J 5M1BA 2ZT9C 1HJ0A 3RK3E 2E76C 2P10A 4PV1D 1IK7A 2J5UA 1NGMB 4U7JA 1KTMA 4H0LB 1Q90D 3S9OA 3AEDC 1AJYA 3GF7A 3RL0g 4YTPC 2QJKC 1FDOA 2E74B 4YXDC 3AE6C 4KT0J 2E75B 3SFDC 2YMKA 2WQYC 3AE9C 4OGQC 4R4MA 1DD4A 4H44D 2FYNC 1YQ3C 2OQQA 1S1CX 4I7ZB 3AE4C 2WSFJ 2BEQD 3AEEC 3AE1C 1PL5A 3AE5C 3LW5J 3AEFC 5KLIC 1GMJA 1HF9A 3H25A 4H13C 4H0LD 2QIWA 3AE2C 2FXPA 2WSCJ 1VF5B 2E74D 3Q3DA 4XFJA 2FBWC 1ZMEC 2E75D 3EWKA 1KQFB 2D2CB 4TT3H 4PV1C 2H89C 4RKUJ 4R4LA 1R8EA 1RQUA 2NZ2A 2ZT9B 2E76B 2JO1A 2H88C 3GF3A 1EXIA 1U57A 4IL6X 1ZOYC 1VF5D 2G3AA 3AE8C 1TU3F 3AEAC 2G8YA 4H44C 4Z1MH 1KMIZ 1WMKA 2MKVA 1NYHA 1K05A 4OGQB 1KQGB 2D2CD 3IN6A 3R4YA 2WPVB 1Y9BA 3AEBC 1MKMA 1ZRTE 1UIXA 4H0LC 3T97B 2ZT9D 2JP3A 1KORA 3G9RA 2QJYC 2E76D 4H13B 2QJPC 1OMIA 1OW8A 1OW7A 1RQVA 2E75C 4Y28J 1OW6A 3IAOA 1DD3A 3FGAD 3GMAA 1YQ4C 3SFEC 3Q5RA 1EXJA 4I7ZC 3AE7C 1ZP0C 1PIXA 1VL2A 1K04A 4OGQD 3AECC 2O01J 3D6YA 3D70A 3Q5SA 4PV1B 2YIUC 3Q2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV B;  1ZRT E;  2E74 B;  1S5L X;  4KT0 J;  2D2C B;  2E75 B;  3C8V A;  2FYN C;  2QJY C;  4RKU J;  5KKZ C;  4H13 B;  2QJP C;  4I7Z B;  2ZT9 B;  2WSE J;  2WSF J;  4H44 B;  2K9Y A;  5L8R J;  4Y28 J;  2E76 B;  3LW5 J;  5KLI C;  2QSI A;  4IL6 X;  1JB0 J;  2QIW A;  2O01 J;  1VF5 B;  2WSC J;  4H0L B;  1Q90 D;  4OGQ B;  4PV1 B;  2QJK C;  2YIU C; 
#chains in the Genus database with same CATH topology
 3ABV C;  3TXS A;  2Y0I A;  5AW8 B;  4EB6 A;  4NTW A;  2UXX A;  3JAR A;  2B9Z A;  4JI2 O;  1RY3 A;  2Q73 A;  2IDB A;  3GLM A;  3AEI A;  1NI8 A;  3TCU A;  3JAL A;  4DUZ B;  1K8A W;  2BCC J;  3T97 A;  4I5S A;  2JEU A;  3CME P;  4ICG A;  3BCC G;  1YBK A;  4JZG A;  5FPO A;  2QSI A;  4DR5 B;  1E1Q G;  3H9V A;  1PPJ G;  4OXS A;  1SQG A;  4MW3 A;  2M3E A;  3L75 E;  1L0L H;  3C3T A;  1LTB C;  1IK7 A;  3OR6 C;  1GD2 E;  5B5E Z;  2QRX A;  3BRT B;  4PDL A;  4DV4 O;  1EFR G;  1FXV A;  4DXW A;  4I9Q A;  2YXY A;  3WUU A;  2QJP B;  2FYU G;  4W7Y A;  4BXL A;  2A0L A;  1S9K E;  2JS5 A;  4DR4 B;  3CPW U;  1WPX A;  4H44 D;  2IM9 A;  3X2Q C;  2VQF B;  1GW3 A;  3OUS A;  1S2E A;  3UO2 A;  3BVH A;  1NTM J;  2UU9 B;  1JOY A;  2BEQ D;  4U3J A;  4N6J A;  4EEQ A;  3H6P A;  1O9G A;  5EBM C;  2YUA A;  4X64 O;  2MK3 A;  4TQD A;  3OD4 A;  3H1K D;  4U3F H;  3G67 A;  2QIW A;  1QGK B;  2OTK E;  3CX5 D;  2YIU C;  3CCM V;  1HNX B;  3BRV B;  4XFJ A;  2HHH B;  1CI6 B;  1BCC J;  3EWK A;  5E79 H;  4K8X A;  1KZU B;  1K9M Q;  2XAH A;  1S3J A;  2Q3E A;  3CXC U;  3IF4 A;  3BA9 A;  2KZJ A;  2PI5 A;  1OCO C;  1L0L G;  3OFN G;  4UUJ C;  5BU8 B;  3H1H D;  2A9H A;  4LF9 O;  5KJ7 D;  1BE3 H;  4ZHQ B;  3T4D A;  1GN2 A;  2JO1 A;  4O2A B;  1RHZ B;  1HDJ A;  2POH A;  3RGU A;  1EXI A;  3CC2 P;  1U96 A;  1N7L A;  5AVS B;  4H44 C;  2G3A A;  1L2P A;  1UII A;  2G8Y A;  3JCZ A;  3ZN1 A;  3RL0 C;  4TV8 A;  4GX2 A;  2ZIO A;  4YY3 O;  1HTL C;  2RH0 A;  4K0K O;  4W80 A;  4CH4 A;  4ZNC A;  3LNM B;  3PLN A;  3J81 N;  3SGI A;  4OH8 B;  1Q86 W;  3E8F A;  2JK5 C;  3OW2 U;  1WNS A;  2JEE A;  1GM9 A;  4U3F G;  3WU2 E;  5APS A;  3CEI A;  3L75 H;  3AG3 C;  2R9A A;  2EIJ B;  1B06 A;  1IK9 A;  1URQ A;  3Q5R A;  3SPC A;  1KYO E;  1PIX A;  3DC6 A;  1MSD A;  2XAF A;  5AW2 B;  3GWK C;  3V2Q A;  2P2U A;  3PH0 A;  2ZAE B;  1FZC A;  4AHC A;  1BE3 G;  1G6U A;  1GL2 D;  3K5O A;  2CTR A;  3TGU J;  5LBQ A;  1KC8 W;  4JI4 B;  2YIB D;  4D7T A;  1ZME C;  2DOS A;  2BCC D;  1IFM A;  3A2A A;  2CH7 B;  1DTO A;  2IJH A;  3CX5 E;  1UJW B;  1D5A A;  1PL4 A;  2M5A A;  3D6Z A;  2GUS A;  3PRJ A;  4FPP A;  1NTK K;  4K3A A;  2EZP A;  4IGG A;  1N73 C;  2KK7 A;  1N32 O;  2Y9Y A;  2HFE D;  3KDP B;  1EZJ A;  4DR5 O;  2A06 E;  1YTF D;  3SDL A;  4TUY B;  2J5U A;  3CD6 P;  2XAG A;  1Q7Y W;  4JI3 B;  2W0X A;  5C8Y B;  3HD7 D;  3L75 G;  3K0D A;  1U7M A;  1NKZ B;  5BVZ A;  1Y74 B;  4KP4 A;  5H9C A;  1HNW B;  2LP7 A;  2FFD A;  2EUL A;  2GTA A;  3MHV A;  4QJF B;  2E75 B;  3SFD C;  3EQ2 A;  1IVS A;  1IUR A;  4HBN A;  1PM9 A;  2AZ0 A;  3WG7 C;  1GL2 C;  3MIW A;  1ZN5 A;  1CPY A;  1K92 A;  4BWA A;  2N05 A;  2Y48 A;  1L0N E;  4I9W A;  3II6 A;  3M06 A;  1YI2 P;  1URQ C;  3ASO B;  4PD4 F;  1N33 B;  1OHH G;  1TVK B;  1S5L E;  3WU2 H;  1CW5 A;  1L8D A;  4XDJ A;  4JI6 B;  1RE3 A;  1T3U A;  5AVU B;  1XDC A;  2HHH O;  3TNU B;  4JI0 O;  1I5X A;  4R7C A;  2Y9Z A;  3ETG A;  3OR7 C;  1Y76 B;  5CBH A;  2ADP A;  4I50 B;  4LF8 O;  2Q8V A;  1JMK C;  4BIZ A;  3HD7 C;  1KYO H;  1GDT A;  4HYO A;  3T1H O;  1GU5 A;  1H2S B;  1IBK B;  1QHT A;  2BCC E;  4CS4 A;  1QEX A;  1E79 H;  4DOJ A;  5CMU A;  4NXM B;  1MG1 A;  1GW4 A;  3K9S A;  2XUM A;  1BHB A;  4WVZ A;  1ZSP A;  5LYJ B;  1BZK A;  1OCR B;  1YIJ V;  3GVM A;  1IX9 A;  3LUT B;  3CCR V;  2ITD C;  4EFB A;  1SET A;  2HOD B;  4RJT A;  3LSS A;  3KHU A;  2AXT Z;  1NU1 E;  1CI6 A;  2FFD C;  2KSE A;  1DGS A;  3ABU A;  2JGD B;  2LJ2 A;  1KOR A;  1KB9 F;  3CYO A;  4NTX A;  3GHG B;  3A8T A;  4IYH A;  2A06 H;  1J95 A;  2XTA A;  2KNC A;  2P7T C;  4JV5 B;  3CC4 P;  1DD3 A;  1K9M W;  1ZRT D;  4ZHQ A;  5KLV K;  1FFT B;  2XT9 A;  4DV7 B;  1IFN A;  4O2A A;  1NTM E;  3QWO C;  2WLN A;  1SA0 B;  2HJF C;  4GIF A;  3JD3 A;  2UUB B;  2VRZ A;  5KAF E;  1KB9 I;  2N9B A;  4PV1 B;  1L1F A;  4NPD A;  3TGU D;  3CHX A;  3M9Q A;  3MTU E;  3OM3 B;  1KIL B;  3KZI E;  1GM7 A;  4CH5 A;  1E79 G;  1BCC E;  1FXK B;  1NVO A;  1L0N H;  1JMB A;  2NN4 A;  4GDO A;  2QTS A;  4NR1 A;  3JCU E;  2BEZ F;  2Q1K A;  4QMA A;  3MUD A;  1S5L H;  1AR1 B;  1XRE A;  4BWN A;  1Q8I A;  3FX7 A;  2LW7 A;  2I8D A;  1J1D B;  1EDI A;  3TXQ A;  5APY A;  1NGM B;  5F2V O;  1VF6 C;  3GWO A;  2A06 G;  1OJH A;  5FNV B;  1QX8 A;  3VTP C;  3AG4 B;  5KTB A;  1FAF A;  1N7S B;  5CCH A;  4FJC C;  2YMK A;  3VYI A;  4MVZ A;  1SQB K;  1GK4 A;  4DZO A;  2NNU A;  2ZIN A;  3E8B A;  4I7Z B;  3EXA A;  1MV8 A;  2C9N Y;  2CH7 A;  2IW5 A;  2RQ6 A;  1RF0 A;  2KYV A;  4PHZ A;  2RN9 A;  4DCK A;  3BAA A;  3CME V;  3M0D C;  5JCO A;  4WBA A;  4YIO A;  3L9D A;  4PJ0 H;  2UXD B;  2H3O A;  1XMO B;  2A3Q A;  1BSN A;  1NU1 H;  3E8H A;  5EZY B;  2WSC J;  1L0N G;  2ZQM A;  3CC7 P;  1VQK P;  4NXN B;  3UIA A;  4TUY A;  3IGA C;  5DED A;  2JEX A;  3R66 A;  5JJJ B;  1R3J C;  2CE4 A;  1TA8 A;  3VBB A;  3QF7 A;  4RAI A;  1J5E B;  3RGB A;  1N33 O;  5C8Y A;  3CRQ A;  2MJZ A;  1Y74 A;  1PGO A;  1JVM A;  2H7H A;  2PUS A;  1Y8A A;  1NTM H;  1BS3 A;  4MN4 C;  3TGU E;  5E79 Z;  3VMZ A;  3SYC A;  4JPR A;  5J2U B;  5KAF H;  3QNE A;  4JI7 B;  3K9A A;  1VQL P;  1K3E A;  2ATK C;  4G27 B;  4MVO A;  3NFQ A;  1K73 Q;  1EZV I;  1VF5 D;  3BHP A;  2W6J H;  2P06 A;  1KMI Z;  2KI7 B;  4AUW A;  3KZI H;  4XDL A;  3TSI A;  4ASV A;  1BCC H;  5CBO A;  1Q6U A;  2WPV B;  3W68 A;  5EBL C;  4JYY A;  1TVK A;  2IJK A;  4RUF A;  4UVA A;  1UIX A;  4FM2 A;  3PP5 A;  3CPW O;  3JCU H;  3N2G B;  1CEZ A;  3K58 A;  1AP5 A;  2DWD C;  3TNU A;  4PI0 A;  4MTX A;  5CCH C;  1NU1 G;  3ZHV A;  1OMI A;  3QO8 A;  1Y76 A;  3OAK A;  3OJA B;  2ZVO B;  3CWB E;  3IC9 A;  1HVV A;  1G1I A;  1RF0 C;  1YF2 A;  2M6Y A;  3ZIA G;  2WMM A;  1YVW A;  2A7W A;  3VP8 A;  4WB4 A;  1R3K C;  3JAW B;  1NTM G;  1OCZ C;  1J1E B;  2QJY B;  1P7G A;  2UUB O;  4JAA A;  4ASW A;  5CCG D;  5LYJ A;  1X0T A;  4J7J A;  1VF5 C;  3MHS C;  3C8V A;  5GTH Z;  2HOD A;  5BMV B;  2W6J G;  2W0F C;  1HJB A;  3U1A A;  3H1I D;  2P90 A;  2K9J B;  2GM4 A;  2JGD A;  4MVM A;  1FDI A;  4IL6 E;  3VOU A;  4DJG A;  1BCC G;  3GHG A;  3DXR B;  2AHZ A;  4TV9 B;  3ZJZ A;  1IC2 A;  2V7Q J;  3OMN B;  3H1J J;  3HKC B;  3JSL A;  2XDJ A;  3SR2 C;  4GLX A;  1Q90 D;  1L4A B;  1SA0 A;  2XU6 A;  1BL8 A;  2C0X A;  5KKZ B;  1X9V A;  4MTO A;  1EN5 A;  2ZFC A;  1PV0 A;  1Z5W A;  3OW2 O;  2CPB A;  1KV4 A;  5CJ4 A;  3ASO C;  4DR6 O;  5KMG B;  1YTZ T;  1KIL A;  4TWK A;  1PGP A;  2OQQ A;  3HUS B;  3VN0 A;  4EFE A;  1NTK J;  1KYO F;  1SFC A;  5CCG C;  4I0X B;  1FXK A;  2B1G A;  5EC1 C;  3KCX A;  1YIT P;  3WB1 A;  5B1B B;  3H25 A;  4GKK O;  2O3J A;  2YIU B;  4H0L D;  4B3T O;  5AW9 B;  4OVN F;  3H1L J;  1SQP D;  2YI9 A;  2OYO A;  2UXD O;  4JYB A;  3I56 P;  4KHP B;  3W7S A;  2QR4 A;  4NXN O;  2OYQ A;  1SFC D;  5FNV A;  4X66 B;  3CWB H;  4BRY B;  1HNZ O;  1VQ4 V;  4RKU J;  3WU2 Z;  2WA3 A;  3CE2 A;  4FVM A;  5LXT B;  1N7S A;  2K37 A;  2K3R A;  2WPQ A;  4R4L A;  2ZYG A;  1FOS F;  3FYI B;  1JY3 N;  4PI2 A;  4ZKP A;  3NXS A;  4X8A A;  5BR8 B;  1WP8 A;  3GHG C;  3V4Q A;  3WUT A;  4GX1 A;  1M1J C;  1NHL A;  1WMK A;  4YXW H;  1BGY J;  4J7Z A;  1YI2 V;  5AVV B;  3USS A;  1T2K C;  3X2Q B;  4WFG A;  5EZY A;  4DW1 A;  3IN6 A;  4LFC B;  4LF5 B;  4I6M C;  4CC6 A;  4CS3 A;  4O4J B;  3K5M A;  4H0L C;  1WLE A;  2ZT9 D;  1PGJ A;  1V9P A;  2QWO B;  1NR1 A;  2Y69 B;  3WFV A;  1X8Y A;  4K8Z A;  4KUM A;  3O9O A;  1EDL A;  1NBM G;  1Z56 A;  2KXP B;  2CPS A;  3IAO A;  1SFC C;  3RK2 D;  4U7N A;  2EIK B;  5J2U A;  5DEC A;  1H2G A;  4J9Y B;  2NRG A;  3CWB G;  2NPS A;  3F89 A;  4OGQ D;  4FM1 A;  1W0J G;  2QWR B;  2VWK A;  3D3I A;  4CC5 A;  3OE7 G;  2DQ0 A;  3M7M X;  5JVD B;  2OAR A;  1OCO B;  2HVK C;  1QL2 A;  3AE3 C;  1K73 W;  1G1X B;  2WT7 A;  4LF4 B;  2FTK A;  3U11 A;  1F4N A;  1Y6X A;  2M3B A;  1KFM A;  5GW7 A;  3SYP A;  3ZBH A;  3N2G A;  4OPH A;  2WSE J;  4H44 B;  4YXW G;  1KIL E;  3RW0 A;  2DW3 A;  2NPS D;  5KLV J;  2P58 A;  4Z2W A;  4RUE A;  2DJV A;  2ZT9 C;  1MUU A;  4L74 A;  4MTG A;  3CC4 V;  1LWU A;  4B3R B;  2R72 A;  5IYC O;  5D5P A;  1WJZ A;  4HAM A;  4QE9 A;  3SWF A;  1ZTE A;  5IJ0 B;  3N7N A;  1S5L Z;  2RMK B;  3MP7 B;  1KB9 D;  1W59 A;  3JAW A;  4NB5 A;  1X4T A;  5EIB D;  4Y99 C;  1GK9 A;  5LGU A;  1M90 W;  3AG3 B;  2WQY C;  1X79 B;  4OGQ C;  3RK3 D;  1NTK D;  5D5Q A;  3ZMV A;  4GZR B;  3N4X A;  2BSK B;  4PEL A;  1QNM A;  5BMV A;  2NLJ C;  2WWW A;  1P84 F;  5K1P A;  1VMG A;  5KLI C;  1HGV A;  2K9J A;  3KPE A;  2E42 A;  3DXR A;  3T4Z A;  3H1L D;  4TV9 A;  3JAS B;  1VQM V;  2AXC A;  4B86 A;  3HKC A;  4IYI A;  2E74 D;  1NAF A;  2NPS C;  1R1B A;  4TSF G;  1VQP V;  1OIP A;  3QTC A;  1P84 I;  2DWE C;  3PTZ A;  4FFB B;  1L4A A;  1SQB J;  2KS1 B;  2R3S A;  4KHP O;  2KG7 B;  3B2E E;  1N73 B;  3G6E P;  4FZ1 A;  4X66 O;  1RQU A;  3B5N D;  5KMG A;  5AVZ B;  2AEF A;  2EX3 A;  5EIB C;  3HUS A;  1MFT A;  3HPL C;  4LP8 A;  3SPI A;  1I5Y A;  3ZX6 A;  4I0X A;  2F4V B;  3L74 J;  1YSC A;  4F4L A;  1XTC C;  5BR8 O;  1BGY D;  2XND H;  5KAF Z;  3H1J E;  1KN7 A;  4HB1 A;  2BOC C;  5HFL A;  1LWU C;  3OEH G;  4FM0 A;  1OX3 A;  5CBN A;  3O6Q B;  3CXH F;  3CC7 V;  1BDD A;  3I56 V;  1NWQ A;  1A02 F;  3WG7 B;  1GL2 B;  2EJ7 A;  4OX9 O;  2QTO A;  1J1E C;  1AI5 A;  2QJY C;  1AVM A;  2V4H A;  1N34 O;  4BRY A;  3B8E B;  3J7A U;  1AB3 A;  3FAV B;  5LXT A;  2Y0D A;  3BVO A;  3JCU Z;  1J2J B;  1KQL A;  1AV1 A;  4L73 A;  2W83 C;  3VQY A;  4L76 A;  2Q68 A;  4DV3 O;  1ZP0 C;  1M93 A;  4UCT A;  3CXH I;  3EFF K;  1EZV D;  1M9N A;  5LMN B;  1K5S A;  4Q20 A;  2IFM A;  3ITK A;  1YTF B;  2JS3 A;  3AG1 C;  1VIB A;  2IZ0 A;  3AK3 A;  3K3W A;  1ZAU A;  4UCS A;  3WB2 A;  3HD7 B;  1EDJ A;  1S5L X;  3H1L E;  2XZR A;  3FWN A;  4I1L A;  2K88 A;  4GOF A;  3P32 A;  4W4K A;  2YIA A;  5KKZ C;  2XAQ A;  4LF4 O;  1NTZ H;  4O4J A;  1XTG B;  2LXC B;  2XND G;  5AVR B;  5KLV D;  4Z1V A;  2IBZ I;  5LGT A;  2IH3 C;  2QGN A;  4BW9 A;  1IBL B;  2DYR C;  2H43 A;  1EDK A;  4DR7 B;  2ZXX A;  2HG5 D;  4EOT A;  3MZW B;  1JY3 P;  1WPB A;  3PHL A;  4YJ2 B;  3F5H A;  2P6J A;  2YC0 A;  2CTQ A;  5B1B C;  4B3R O;  2VWJ A;  4GKJ B;  4N78 E;  3FWL A;  2J58 A;  5JVD A;  2B5U A;  3QO5 A;  5ITZ B;  1IZN B;  3N27 A;  3STZ C;  3A0B E;  1F23 A;  5IDJ A;  3CSX A;  2A45 I;  1LP1 B;  3AEF C;  3CCS P;  2V7Q H;  5LHG A;  1F51 A;  4WFH A;  2BE3 A;  3H1J H;  3U0Z A;  4AQY B;  1NOH A;  2PGD A;  5DJT B;  1GTO A;  4EKW A;  3L72 E;  2M7W A;  2FKW B;  4O4H B;  5JJN B;  2KOG A;  5K5G B;  4DR2 B;  1NTZ G;  5LMU B;  2ADQ B;  3BAB A;  1HW7 A;  2FYN B;  3OGI B;  3JAK A;  3T1Y O;  1VQ9 V;  1SQB D;  1SQP K;  5CA1 B;  4JI1 O;  3IJ4 A;  3JD1 A;  3SJA C;  3JAT B;  5IJ0 A;  2M0B A;  1NJI Q;  2HG5 C;  1EZV E;  4FMT A;  5AVT B;  5GTH E;  5IT9 N;  3ETQ A;  4DV0 B;  4DW0 A;  3KKY A;  5L3G A;  4BIO A;  2NZ2 A;  5H2F E;  3CCV P;  2I1J A;  1JPX A;  4E4E A;  2YMY A;  2F95 B;  3L74 D;  2BSK A;  1U57 A;  1AFO A;  1LTS C;  4X62 O;  2N1T D;  2Y69 C;  3BRC A;  3T2M A;  3ZDM A;  5KJ7 A;  3H1L H;  2FKX A;  1YIT V;  1SQV D;  2RN0 A;  4O2B A;  3SWK A;  1QR8 A;  2AW9 A;  3JAS A;  2EIK C;  1SLQ A;  3P30 A;  1Y9B A;  1GZL A;  3M0A A;  3I55 P;  2V7Q G;  3H1J G;  3AK2 A;  4W4L A;  4FFB A;  2KS1 A;  4D6T H;  2KG7 A;  4IFD K;  2KNC B;  5AVQ B;  1RQV A;  2JR8 A;  4IL6 Z;  4ZMD A;  1N73 A;  1YJ9 P;  2RCV A;  2EIM C;  1NR7 A;  3LID A;  1YJW P;  3OTO B;  2UXB B;  3FD9 A;  3AE7 C;  2ODM A;  1JMM A;  1PP9 J;  4I55 B;  5IWA O;  1FBM A;  1HWT C;  2BTQ A;  3SYQ A;  5LMN O;  5EFW B;  1WB7 A;  3CCL V;  3ABL C;  4QIW F;  3A0B H;  2KB7 P;  3A2F A;  4DV2 B;  3E2E A;  1XOU A;  3TF5 A;  1DX7 A;  2DQ3 A;  3ZED A;  1D5N A;  1DEE G;  3O6Q A;  3H1L G;  1GL2 A;  3D71 A;  3HKE A;  1IFP A;  3L72 H;  1DIP A;  4LF7 B;  4Q6G A;  2YIB A;  4DV1 B;  1ORQ C;  1AJQ A;  4DR3 O;  1VEW A;  4YHH B;  2FYU K;  3A3Y B;  3FAV A;  1IBL O;  3JYC A;  3LDD A;  5KUK A;  3K08 A;  2XOK G;  1PFI A;  5KHJ A;  3L71 J;  1QU7 A;  4DR7 O;  4D6T G;  1EZV H;  1AJY A;  5GTH H;  3L74 E;  3L73 J;  2VRS A;  5KJ7 C;  2QJK C;  3HRN A;  3OMI B;  5CA3 A;  1RPO A;  1A02 J;  5H2F H;  4MS2 A;  3RWR D;  1H8H G;  3H1K E;  3R2P A;  1ZXG A;  4GKJ O;  3HD7 A;  3G71 V;  5APX A;  1MAB G;  2HLD G;  2E5T A;  3WMM 0;  2B9B A;  1RH5 B;  3LNN A;  2WSE H;  1KQS U;  1MSW D;  3B4S A;  4AIL C;  1JOC A;  2XNX A;  4UV9 A;  4DUZ O;  3K5L A;  5HFM A;  3JC2 2;  1HF9 A;  1GMJ A;  2ZNJ A;  2PFX A;  2OTJ V;  3ZN0 A;  1OCZ B;  5BY1 A;  4DV6 B;  2PAJ A;  4AQY O;  3O8Z A;  1JM0 A;  3H1H E;  4RWU A;  4UB6 Z;  1VQ7 P;  1L0L K;  1VF5 B;  2O01 H;  3CCQ P;  1IXM A;  1NS1 A;  3L72 G;  1EN6 A;  1KEC A;  3G80 A;  4YJ2 A;  5LMU O;  2E43 A;  2B87 B;  2N9Y B;  4B3M B;  2ZXW C;  1JY2 O;  2DW4 A;  1O9H A;  2G38 A;  2KUB A;  1EZV G;  4DR4 O;  4J11 A;  4DRX B;  5ITZ A;  4DV0 O;  2VQF O;  1IXB A;  1QVG U;  3UQ8 A;  4KJM A;  2UU9 O;  4IL6 X;  4I4T B;  1LP1 A;  3S1K A;  2IX7 C;  3ZHQ A;  1H2L A;  2QKA A;  4FLU A;  4JI8 B;  5AVY B;  2MKV A;  3IFM A;  2UXC B;  2Q3I A;  4LH7 A;  1FZA A;  2Q9I A;  4DT0 A;  4O4H A;  3VQX A;  5IJ9 B;  1HP8 A;  1HNX O;  5B1A C;  3N2K B;  2HFE C;  3STL C;  3QH9 A;  2ITC C;  1JQ0 A;  1Q6I A;  2OCH A;  1P84 D;  2AEM A;  5CA1 A;  2WLH A;  3JAT A;  1K4C C;  4A7P A;  1JR9 A;  1JX9 A;  1ARO P;  1VQ6 P;  5L3C A;  3G4S P;  1MA1 A;  4PD4 I;  1NKD A;  2JDI H;  1NJI W;  4NTY A;  2IZ1 A;  1PP9 D;  2HEP A;  4OWF A;  1VF6 A;  4LR3 A;  2UXB O;  2PI4 A;  2YNY A;  3OAA G;  1AI7 A;  4LFB B;  3H1K H;  4L87 A;  4MVU A;  2KKW A;  1IZ3 A;  3CX5 H;  1BDC A;  5LHI A;  3CMA P;  1M5I A;  4QNH B;  5DJU B;  4DR1 B;  4RO2 A;  3S3W A;  3ICX A;  4DV2 O;  2KB1 A;  5AW4 B;  2VQE B;  1PV3 A;  3E1I A;  3Q1M A;  1M1J B;  2Z0A A;  3H1H H;  3M0D A;  1WA8 A;  5AW0 B;  4FK5 C;  4LF7 O;  1AVY A;  4DV1 O;  3ZRV A;  4I2L C;  2Z3Y A;  3FYE B;  3L71 D;  3L73 D;  3CXH D;  4H0L B;  4WFF A;  1XHX A;  1THZ A;  4I55 A;  3E86 A;  1FDO A;  3K04 A;  1V54 C;  1RSO A;  1IFJ A;  3K79 A;  4FZ0 A;  4P2Z A;  1PZQ A;  1SQX D;  2QEX P;  1I08 A;  3W7U A;  1A32 A;  2JDI G;  1KKC A;  1AI4 A;  2FYN C;  5APQ A;  1SFC B;  4JI4 O;  1PD3 A;  3AE4 C;  1F4M A;  3H1K G;  3HTK A;  2Q6Q A;  3C9I A;  4QPJ A;  1USD A;  3H1I J;  4X1I B;  1AJN A;  4HNA A;  1I7F A;  1M1K Q;  3G6B A;  2IBZ D;  3IR9 A;  2F23 A;  2ZCE A;  1UFI A;  1LTA C;  3CB2 A;  1Q81 Q;  1Q43 A;  2WAM A;  4WFA V;  1CSB A;  2HPC A;  1QVF U;  4AYC A;  4NPE A;  2PRR A;  2R70 A;  3H1H G;  4RES B;  4JI3 O;  3NTN A;  1SRY A;  1GRJ A;  3F7Y C;  2L6L A;  1HNW O;  1AVO A;  1SF9 A;  4B3M O;  2BCC H;  2YKP A;  1OZH A;  3BY6 A;  1W0K G;  2ZT9 B;  3M9H A;  4N23 A;  1OVV A;  5KHK A;  3K57 A;  1LTI C;  2RKL A;  2EIL C;  1FC2 C;  1XMQ B;  4H37 A;  1XUQ A;  2LFR A;  4IOI H;  4NKG B;  4JYC A;  1W2E A;  3OT7 A;  3CCS V;  3RK2 B;  4J7K A;  4Z1M H;  2GUZ B;  4JPZ B;  2EJR A;  2F93 B;  1FE6 A;  4Y99 B;  4OGQ B;  1Q82 W;  2UXC O;  1SQP J;  3OUF A;  1ZRT E;  1SQV K;  3QO7 A;  2BOB C;  1SZT A;  2B87 A;  1GN3 A;  5KLI B;  5GON B;  4LC1 A;  5L3F A;  4JI6 O;  5KA6 A;  3W67 A;  5L3E A;  1GAX A;  2FB5 A;  1M57 D;  4DRX A;  1XHZ A;  3CCV V;  2JJL A;  4C7U A;  2NPS B;  4AI8 A;  1IBK O;  1GU4 A;  1AR5 A;  4I4T A;  2BCC G;  5IE9 A;  4L8J A;  3Q5S A;  2Q7E A;  2HP8 A;  4LFB O;  2WT7 B;  4NXM O;  2W6A A;  2HLO A;  4PA9 A;  4NYK A;  1CZQ A;  1VQ5 P;  2JGU A;  4H13 D;  3JD0 A;  1R6K A;  5IJ9 A;  5KAI E;  1FZB A;  3D3Q A;  3N2K A;  4Z1M G;  1LR1 A;  5CCG A;  1FJG B;  4DR1 O;  3A0B Z;  3F5T A;  3LSQ A;  3UKM A;  3RK3 B;  3M8A A;  4JF3 A;  2E3C A;  4HH2 A;  2LXB A;  2V1D A;  2CK3 H;  4LH6 A;  1N86 A;  1LWU B;  1M90 Q;  4JV5 O;  1YJW V;  3DSQ A;  3ZRW B;  1LT9 C;  3APO A;  5KHI A;  4DV7 O;  3CC2 V;  3BCC J;  3U1C A;  1B6Q A;  2HVJ C;  1JO5 A;  3E83 A;  2E74 B;  3WB0 A;  4GOD A;  5EYP B;  1IBM B;  3P8C D;  4MVR A;  1X22 A;  3DTU B;  1G1J A;  1EM1 A;  1YQ3 C;  1FAV A;  2R5B A;  3E1R A;  1S1C X;  1U7J A;  4CBC A;  2WSF J;  5H2F Z;  1JCH A;  2WPS A;  3LW5 J;  3ZHR A;  2FYU J;  3P7K A;  3B5N B;  4H13 C;  1M1J A;  4B3S B;  3AG1 B;  3CCE P;  3SJQ C;  2DE0 X;  3ZRS A;  2E5Y A;  1JUN A;  4FLX A;  4FLW A;  2AEJ A;  3L4F A;  1OVU A;  3F7V C;  3HKB B;  3A0H E;  1KP3 A;  3M91 A;  2WTY A;  3O65 A;  1U97 A;  3TGU H;  2CK3 G;  1ZLL A;  1ZW0 A;  4B7K A;  2WLI B;  1YHQ P;  3AK1 A;  2DYR B;  2W27 A;  2QKS A;  3CCJ P;  4NVP A;  5TIS E;  3ZS8 C;  3CS5 A;  2GTS A;  3ETD A;  1DK1 A;  5LHH A;  1RP3 B;  1SQQ D;  2PGG A;  4X1I A;  2Q67 A;  2ZNI A;  1L0L J;  3CRM A;  1W5C E;  1XEQ A;  4PDV A;  4DV5 B;  1JTH B;  1KFN A;  3RYF B;  2ZXE B;  1XNQ B;  2ZR3 A;  1NU1 K;  5KAI H;  2A79 B;  1GK6 A;  3IFX A;  1XMO O;  1WT6 A;  3RYC B;  5AW6 B;  5LP6 B;  3SPG A;  3TK1 A;  1VQ7 V;  1NVP D;  3CX5 F;  1M1K W;  3RYI B;  3CD6 V;  1KYO I;  1LTG C;  3JAM N;  1J5E O;  4HZ3 A;  2E76 D;  1Q81 W;  1K4D C;  1KQS O;  4UCU A;  3V2N A;  1GTW A;  2HR3 A;  1SVF A;  1RPR A;  2O01 N;  1PGQ A;  5C39 A;  3TGU G;  3CCM P;  3RT3 C;  1H2N A;  4U3F J;  4JI7 O;  3HKD B;  4UV8 A;  2QSA A;  3H1I E;  5FLX N;  4UB6 E;  1ZX3 A;  3AG2 B;  3NR7 A;  4IHJ B;  2GUZ A;  1URF A;  3JSN A;  2EZO A;  1FZG A;  4DK1 A;  3EHB B;  2H8P D;  1R73 A;  4IL6 H;  1BQZ A;  1G8M A;  3D36 A;  3W7W A;  2Z5U A;  2YXL A;  1I94 B;  1NH4 A;  1M8O B;  1FYJ A;  2CGO A;  2ZDI A;  3U59 A;  5GON A;  2Q9L A;  3B77 A;  1VQN P;  1QVG O;  5L3D A;  2XV5 A;  2PF4 E;  1F7Y A;  1IDS A;  3A0H H;  3LIE A;  4PD4 D;  1RF1 A;  4WY4 D;  5JJE B;  3G4S V;  2E76 C;  3BCC D;  3WUV A;  4KL1 A;  2LR2 A;  4JI5 B;  5CA0 B;  3ZCC A;  1PPJ D;  3TET A;  1OZ0 A;  4X20 B;  4JTA B;  2D3O W;  5TIS H;  3UCS C;  4YXD C;  1XQ8 A;  4X89 A;  3SJC C;  2RMZ A;  2EIM B;  4FLT A;  1SQP E;  1XNR B;  2HYN A;  1SQX K;  2FYU D;  2PZS A;  3CRC A;  2H8P C;  3S4R A;  1DEB A;  3ETE A;  3DC5 A;  1SC5 B;  1ZL8 A;  2JKV A;  2Y0E A;  3W7T A;  3U10 A;  3ABL B;  5KHG A;  3UM7 A;  2N1T B;  3JAK B;  2YIC A;  2Q0O C;  3V5B A;  4YPC A;  1SER A;  1SES A;  4DO2 A;  3ZRW A;  1LTJ C;  4JYA B;  3RK2 C;  4WY4 C;  4J9Z B;  1LT1 A;  3FB8 C;  3OA7 A;  2Z5H A;  2JIZ G;  2H89 C;  1Q5O A;  5EYP A;  3D36 C;  2Q0A A;  2H88 C;  3H1I H;  4UB6 H;  2R9R B;  2ZDI C;  1RE4 A;  2E5L B;  2FYZ A;  1L0L D;  5AW7 B;  2QJK B;  2HJD A;  4O2B B;  1KUQ A;  4DYL A;  3B5N A;  3A5T A;  2DN9 A;  1XBL A;  1M7L A;  1RF1 C;  3K5B A;  2OTL P;  1MNG A;  2P22 C;  5FL7 G;  5APV A;  1YTZ I;  2IU3 A;  4UCR A;  4DV5 O;  1N8R Q;  1XNQ O;  3C90 A;  1LUV A;  4PD4 E;  3HKB A;  4QE7 A;  3BCC E;  1S72 P;  2WLI A;  1OW8 A;  1CP9 A;  1PKX A;  4Y28 J;  5GTI E;  3D8C A;  1OW6 A;  2RNB A;  3GG2 A;  1RFY A;  1VDF A;  4U3F D;  2O57 A;  1EXJ A;  3PJS K;  1R5S A;  2BTQ B;  3RK3 C;  3L37 A;  3SWY A;  2X0L A;  2W90 A;  4YJ3 B;  2WSS H;  2LFS A;  3AEC C;  2WSC H;  2ZXW B;  1Y66 A;  1GO3 F;  1SQP H;  1SQV J;  1JTH A;  4P9P A;  3RYF A;  3H1I G;  1OXZ A;  5B66 E;  3ZMS A;  1QL1 A;  4MVQ A;  3KCY A;  3RYC A;  1VQK V;  5LP6 A;  1AP6 A;  4LFC O;  3HKE B;  1KP2 A;  4LF5 O;  3RYI A;  1BE3 D;  2QWQ B;  2E74 C;  3QVN A;  1BQ0 A;  2KLU A;  2JVD A;  4O9B A;  1KB9 E;  1I94 O;  5L8R J;  1FD9 A;  1MOF A;  3AG7 A;  3MD0 A;  3EVK A;  1S77 D;  3RK3 E;  1RE4 C;  1ZR4 A;  1YIJ P;  1NTK E;  2P67 A;  1VQL V;  5B1A B;  3VP9 A;  3B40 A;  3HKD A;  4WBN B;  3B5N C;  3L36 A;  2YO2 A;  2ZR2 A;  5C93 A;  5DN6 G;  3BAT A;  3OMA B;  3MGN A;  4GCZ A;  4U7O A;  5KUM A;  4JI5 O;  1L0L E;  4IHJ A;  4ASU G;  3ZHS A;  2EBO A;  2ZE5 A;  4LF9 B;  2XAS A;  3L75 D;  1FFX B;  1YJN P;  2FML A;  1QLE D;  1P7B A;  1Q3E A;  2AZ2 A;  1SS1 A;  2WSS G;  1VQ5 V;  2LQT A;  1XNR O;  4GOE A;  1PNL A;  1SQP G;  1IFI A;  1BMF G;  1I0H A;  3K06 A;  4GX5 A;  4G28 B;  1K97 A;  4LF6 B;  2L91 A;  1S9K D;  1SQF A;  4H33 A;  4K0K B;  4N21 A;  1WP7 A;  3Q4H B;  4PDR A;  5A9G A;  2R3C A;  1FZF A;  3H01 A;  1Q6H A;  4JF7 A;  3BA8 A;  4W7Z A;  2N74 A;  1VQO P;  4F6R B;  1P4R A;  2JWA A;  1R3I C;  3VQW A;  1BSM A;  2QM8 A;  2YID A;  5CA0 A;  2GSM B;  4X20 A;  2CAZ C;  5LL6 Y;  5GTI H;  5BU5 A;  2KSJ A;  4JYA O;  3M99 B;  4KHX A;  2UWJ E;  1BGY E;  3JD4 A;  1L0N J;  2OYH B;  2Q5U A;  4FIP C;  1TUB A;  5LP6 C;  4TOI A;  2ILM A;  2WVR A;  3GF3 A;  1HGZ A;  3FX0 A;  4JZ2 A;  3AEA C;  3AE8 C;  1JY2 N;  1QLE C;  1V54 B;  5B66 H;  1H89 A;  3HR0 A;  3JSV C;  1KQG B;  4A5U B;  1SQQ K;  2N1T A;  2D2C D;  2QA4 P;  1ZLZ A;  4ABM A;  2FL4 A;  4RQF A;  1KB9 H;  3FKS G;  3SJB C;  1HBW A;  2PTM A;  4CH6 A;  3AG2 C;  5JH7 B;  2WPD G;  5KAI Z;  5KX5 B;  3G9R A;  1YHQ V;  1N32 B;  1NTK H;  3LDC A;  3E8G A;  1SS3 A;  4LNU B;  3CCJ V;  4CPG A;  2ZKO A;  3E35 A;  3RBZ A;  2IYO A;  1K04 A;  2WIT A;  4GKG A;  1NU1 J;  2F4V O;  1BHA A;  3D70 A;  1M56 D;  5KLV E;  3FFQ A;  3W7X A;  4JAU A;  3THO A;  4JQ0 D;  2LGQ A;  1S5H C;  3AEG C;  5CBG A;  1OCC C;  1NH2 D;  2EIL B;  1KYO D;  1NAY A;  3P3N A;  4ZOL B;  2QG4 A;  3RL0 D;  1WA8 B;  3VQV A;  2D2C C;  3R65 A;  2Z5I A;  4TQF A;  1KBH A;  2DYS B;  1N8R W;  4EDF A;  3SYO A;  4C7N B;  5M1B A;  2XAJ A;  2GUV A;  3FXD A;  2KIK A;  1UPG A;  4J42 A;  1KTM A;  1D7M A;  1Y47 A;  1LNQ A;  1RSO B;  1EBO A;  1BGY H;  4JI0 B;  4YJ3 A;  1NTK G;  3A0H Z;  4LF8 B;  1EQ7 A;  1FPO A;  4GUN A;  2N1T C;  2HKO A;  4ZKI A;  3T1H B;  2A06 D;  2CGN A;  1BT8 A;  3HTK B;  1M56 C;  4E2L A;  5KA5 A;  1QCE A;  5TIS Z;  1NTZ K;  4HNA B;  3ABM C;  1SQB E;  4FLZ A;  2OCC C;  3AE1 C;  1HUC A;  2C2A A;  4UB8 E;  2IU0 A;  2Y0P A;  1VQN V;  1JEK A;  3ML0 A;  2HPC B;  4UCV A;  4LF6 O;  2ETN A;  1SP4 A;  4EYY Q;  4QPK A;  2O1K A;  5CJ0 A;  4JTC B;  2JRI A;  4WBN A;  5KHH A;  1MZ9 A;  3GB7 C;  5H5N A;  3KXD A;  1PNM A;  4HYT B;  1L0N D;  1BSH A;  1SQX J;  1DLB A;  4PDM A;  1SQV E;  4HJG H;  4LFA B;  3IC7 A;  1FFX A;  2W6I G;  4P9O A;  1BGY G;  1Q82 Q;  5KLV H;  2FY8 A;  1R5L A;  1EC5 A;  1LT9 B;  2AHY A;  1XL4 A;  1K34 A;  1NO4 A;  1TU3 F;  1G2C B;  1M57 B;  1G4Y B;  4J10 A;  1FKA O;  5LA6 B;  2C9L Y;  1QQC A;  3E7K A;  3K5N A;  3Q4H A;  2X6C A;  1JJO A;  4DR2 O;  1VAR A;  2WA4 A;  2KQX A;  1T5E A;  3I5C A;  4F6R A;  1W2B U;  1LUW A;  1URQ D;  1AQ5 A;  3K0G A;  4H13 B;  2PP6 A;  1KD1 Q;  2KSD A;  1Z5V A;  4D7S A;  3RVZ A;  4CZZ A;  2OYH A;  3FB7 C;  2ITA A;  2ZD9 A;  1H0T B;  4LBE C;  4M3L A;  4PA6 A;  1FOS E;  1NU1 D;  2KZI A;  1YEW A;  3A0R A;  1VQ4 P;  1CXZ B;  2J59 M;  4PA7 A;  2OT5 A;  1R6N A;  2OTL V;  5J2T B;  5KLV G;  1N4C A;  1SQB H;  3KYQ A;  3CWB J;  1XL6 A;  3SYA A;  1NTM D;  4UB8 H;  5AW1 B;  5JH7 A;  4BAY A;  4CS2 A;  5KX5 A;  1S72 V;  3G6E V;  3ZMU A;  2YDE A;  2PYL A;  4G2K A;  3L74 H;  2L35 A;  3BAS A;  4LNU A;  1NZ6 A;  4BIU A;  4X1Y B;  3OTO O;  1BCC D;  2IJI A;  3ABK C;  3A7O A;  1VQ8 P;  1SQV H;  1V55 B;  2OYI B;  3ZHT A;  1N36 B;  1JY2 P;  1AI6 A;  3L70 J;  1ZR2 A;  1FZC C;  1K7D A;  4R6Z A;  3AE9 C;  2GV9 A;  1DD4 A;  3OGC C;  4X88 A;  2YXH A;  4MVS A;  2JWD A;  5IY5 B;  2GDS A;  2DMX A;  4ZOL A;  3AEE C;  1ROP A;  2Y4U A;  2LW1 A;  2BTO A;  3E22 B;  1PL5 A;  3AE5 C;  4ZBM A;  2OYH C;  1SQB G;  2CUG A;  3BEH A;  4O4L B;  4YHH O;  4C7N A;  4O4I B;  2FXP A;  3C1L A;  3RN4 A;  4PJ0 E;  4MT8 A;  3NMD A;  4JBZ A;  2Q7H A;  3L74 G;  2WLL B;  1NVP B;  1QR9 A;  5LGN A;  1RM1 B;  5BZB A;  2E76 B;  1YJN V;  4LFA O;  1SQV G;  5GTI Z;  5CN0 A;  4IT5 A;  4EI2 A;  1P84 E;  3GW6 A;  5CMZ A;  3I5D A;  1Y67 A;  3P8M C;  2PYJ A;  2K1A A;  4TLF A;  4BR6 A;  4X65 B;  4DV6 O;  1YDX A;  3AEB C;  5B66 Z;  1JA8 A;  1PP9 E;  5K1X A;  2YI8 A;  1VQO V;  1RE3 C;  3ZHU A;  3V4W A;  1NKN A;  4F6E A;  2QJP C;  2WLJ A;  3LSU A;  1VQM P;  3FB5 C;  2UUA B;  1GMG A;  4WCE V;  2IPP A;  4UXN A;  1DF4 A;  3SFE C;  3F5W C;  4GYC B;  1JCC A;  1VL2 A;  4HKZ H;  1GH6 A;  1LT9 A;  1LTJ B;  1VQP P;  4XE5 B;  1SQQ J;  4WY4 B;  2DYS C;  2Q7C A;  1G2C A;  5DM6 V;  4JI8 O;  3RBX A;  2OIE A;  5LA6 A;  3Q2Y A;  1N2D C;  2OWO A;  2ZVN B;  4DR6 B;  2K9P A;  3CWB D;  2X6B A;  4RO0 A;  3L71 E;  3B71 A;  4DUY B;  2QA4 V;  2WZ7 A;  3L73 E;  2CDY A;  3VMY A;  4UCO A;  3CXH E;  1ZUQ A;  4J41 A;  4P30 A;  1EN4 A;  4GKK B;  3OTF A;  4MTF A;  4B3T B;  1GM8 A;  1HWY A;  2Z4E A;  1SQX E;  1RF1 B;  1WAZ A;  1MFZ A;  2F66 C;  1ZV8 A;  1GKF A;  2GBO A;  2YS8 A;  1HJ0 A;  4L75 A;  3PN1 A;  4FLV A;  2CTW A;  1H0T A;  5CCH D;  1XIL A;  1PL0 A;  3AED C;  1KD1 W;  2UXN A;  2RDC A;  2P4K A;  3L70 D;  5EC2 C;  1FU1 A;  2FXM A;  2ZJS E;  1IJD B;  1HNZ B;  1US6 A;  1S4X A;  2GA1 A;  2IBZ E;  1H88 A;  3AE6 C;  1WRG A;  5AVX B;  1IO4 A;  1P49 A;  1N36 O;  3BFR A;  3HE5 B;  3CCU P;  5J2T A;  5IYD O;  1AR4 A;  1P84 H;  3I55 V;  2R32 A;  1S76 D;  3HE4 B;  2W6B A;  5JQG B;  3C3S A;  3M9B A;  1ZL8 B;  3CLQ A;  2VQE O;  2XKM A;  2RJZ A;  1LGH B;  4PA4 A;  1S0V A;  1FJK A;  2IFN A;  3ASN B;  3MUD C;  1YJ9 V;  2ZM6 B;  3AE2 C;  1PP9 H;  5AG2 A;  2EIJ C;  5BXZ A;  5B5E E;  3Q3D A;  1IFD A;  4X1Y A;  2E75 D;  1USE A;  1E5W A;  1LJ2 A;  1MMM A;  4UFZ A;  1M57 C;  2OYI A;  2QDO A;  4IFF A;  1NTZ J;  4LCU C;  3APQ A;  2P5O A;  4I50 A;  5APT A;  1OV9 A;  1L0N K;  3UO3 A;  4C7R A;  2H94 A;  1GN4 A;  4RQE A;  2CTP A;  1AA0 A;  1H8E G;  3E22 A;  5JCO C;  2IJJ A;  3L71 H;  2C0W A;  5LOV B;  2P1J A;  1N0N A;  1H2K A;  3L73 H;  4K35 A;  4O4L A;  3CXH H;  3R4Y A;  4O4I A;  2P7J A;  1MZE A;  1MKM A;  1HH0 A;  4X65 O;  1OWA A;  2YEV B;  2WPR A;  1SQX H;  2QVA A;  2X6A A;  1PP9 G;  3L70 E;  1SKV A;  2WLL A;  4LWS B;  2E75 C;  3V2R A;  3VMA A;  3RYH B;  5B3S B;  2ZYA A;  1YQ4 C;  3GMA A;  2UUA O;  3H32 B;  1VQ9 P;  2JJ1 G;  3ABT A;  1XMQ O;  2IBZ H;  2Q69 A;  4WF9 V;  3RVY A;  3B09 A;  4OPA A;  4YIP A;  4FLY A;  2QM4 A;  2ZYD A;  2Y0C A;  3CJH B;  2XHB A;  1S5J A;  5EK0 A;  3UT5 B;  2M8R A;  4B08 A;  5CBF A;  3CCQ V;  5AW5 B;  2EIN B;  1R3L C;  2PY5 A;  1T6A A;  1V55 C;  2KLV A;  2OYI C;  1Y4M A;  4ZIB A;  1QBZ A;  4DUY O;  3L71 G;  4EIJ A;  5AVW B;  1QLE B;  2K9Y A;  1NTM K;  5CB4 B;  1LTT C;  3L73 G;  1T2K D;  2W8Z A;  2UUC B;  2Q4P A;  5B5E H;  2L5G B;  1T3J A;  1JB0 J;  3P8C E;  4UB8 Z;  3TJT A;  2A45 H;  5IY5 C;  3CX5 I;  3CP1 A;  1SQX G;  4PV1 D;  4PA3 A;  3S3X A;  2FXO A;  2QJ1 A;  4U7J A;  4WFB V;  3S9O A;  3GF7 A;  1KKD A;  1LTJ A;  4FFK A;  3CI9 A;  4YTP C;  3RL0 g;  4B7E A;  1KIL D;  3MAQ A;  2K1E A;  2MW2 B;  4WY4 A;  2IH1 C;  4ZI7 B;  4KT0 J;  1W2B O;  1FS0 E;  1NQT A;  4LLH A;  1MZF A;  5B1N A;  1OCR C;  5IYZ B;  2IBZ G;  3CRA A;  4D6T J;  2WLK A;  2Y4T A;  5H6R A;  1GN6 A;  3QG5 A;  1ENV A;  1BE3 J;  4WFE A;  1JFF B;  1FJG O;  1T8Z A;  1ZWI C;  1TGO A;  3DGE A;  3J80 N;  4C46 A;  2V4D A;  1VQ6 V;  4QGP A;  4IIJ B;  1COW G;  1AQT A;  3CCL P;  1RM1 C;  5L3B A;  4X1K B;  4JAV A;  3K59 A;  1OCC B;  2YO3 A;  2ZM6 O;  1N7S D;  4WWI A;  3L70 H;  4OX9 B;  5EBW C;  1KQF B;  1VQ8 V;  1VPC A;  2D2C B;  1SQQ E;  1HR0 B;  1N34 B;  4TT3 H;  1NTZ D;  2JJ2 G;  5TJH A;  4PV1 C;  1TUB B;  2A45 G;  2AGA A;  1JCD A;  4GX0 A;  1IBM O;  3ZRX A;  3CMA V;  3L72 J;  5APU A;  3HE5 A;  3L75 J;  3T1C A;  1KIL C;  1YZB A;  4DV3 B;  1WN7 A;  4J80 A;  4X9Q A;  1OFC X;  2IYP A;  1FXK C;  4MW8 A;  1YXB A;  4N3Y B;  3HE4 A;  4UVC A;  5JQG A;  4JGS A;  1K8A Q;  2LKM A;  4B3S O;  3IAY A;  1VF7 A;  1K05 A;  1VP7 A;  4EB6 B;  1FXH A;  3G71 P;  1M56 B;  3JAR B;  5APW A;  2R5D A;  1J1D C;  2VS0 A;  1H8A A;  3JAL B;  3OEE G;  1AIL A;  1Z2G A;  3ABM B;  3T97 B;  2OCC B;  1H38 A;  2JP3 A;  1JJ2 U;  3E89 A;  1R6T A;  3G3Z A;  2OTJ P;  3AG4 C;  1NH2 B;  1PNK A;  2Q5Z A;  4KFM A;  2QEX V;  2YKQ A;  1N7S C;  1YYC A;  3MDS A;  3H1J D;  2F43 G;  4GT1 A;  3CRR A;  5CHX A;  3L70 G;  3RL0 B;  1B04 A;  3FGA D;  1H2M A;  4XA4 A;  4I7Z C;  4TT3 G;  2OGU A;  1X59 A;  1TAE A;  5JWP A;  2O01 J;  4JAS A;  4JTD B;  2WLM A;  4R50 A;  1NT2 B;  3D6Y A;  2Q7G A;  5LOV A;  4LGD E;  4JI2 B;  4CH3 A;  2AXT E;  3Q5P A;  3VMX A;  1JNM A;  1K5Q A;  3SPJ A;  2BAS A;  4U3J B;  5AW3 B;  2YXR B;  2YEV A;  1PPJ E;  3SPH A;  2YXQ B;  1N0J A;  1TUE B;  2ZIM A;  4LWS A;  4MSW C;  1B3Q A;  1NTZ E;  2NR5 A;  2QWP B;  3FXE A;  3RYH A;  2UUC O;  1E1R G;  2P10 A;  3T1Y B;  3JD2 A;  1SQQ H;  3H32 A;  4DV4 B;  1FJP A;  3P3P A;  4JI1 B;  2FYU E;  1QVF O;  4R8C A;  5B1O A;  4DK0 A;  2QE7 H;  1K33 A;  4PJ0 Z;  5FPR A;  3ASN C;  5IYB O;  2B88 A;  4NPF X;  3CJH A;  3ZMT A;  3UT5 A;  4XDK A;  4D6T D;  4R4M A;  1OVR A;  2QWN B;  2ZE7 A;  1FS0 G;  2ZE8 A;  4X62 B;  3LDE A;  2P4V A;  2B1I A;  3RFR A;  3V2P A;  4X64 B;  2Q6A A;  1Q86 Q;  1WB8 A;  5CB4 A;  4N78 D;  5J9P C;  1AJP A;  4TV8 B;  3TDK A;  3CL3 D;  2R9I A;  1L4A D;  3H1K J;  3CCR P;  1D2D A;  2ZE6 A;  2YSU B;  4IFM A;  4BW5 A;  1Q2N A;  1JY3 O;  4ZKU A;  2FBW C;  3L35 A;  3KZI Z;  5H6Q A;  2KP8 A;  3BPZ A;  3L72 D;  4ZI7 A;  2QM7 A;  3HB3 B;  1HR0 O;  3EFG A;  1R8E A;  1SQQ G;  4XBF A;  5IYZ A;  1URQ B;  1FZE A;  3CCU V;  3H1H J;  2QE7 G;  3SSU A;  1KC8 Q;  3KG2 A;  5IWA B;  1DH3 A;  1ZOY C;  3ABK B;  1QLN A;  1DF5 A;  1JFF A;  1M4U A;  2X7R B;  3B8M A;  2AXT H;  2O1J A;  4YY3 B;  1FZC B;  4PD4 H;  3FB6 C;  4IIJ A;  4UVB A;  2QKC A;  1NYH A;  3BCC H;  5B3S C;  3VOP A;  3V6I A;  4X1K A;  1SZX A;  4AQR D;  2OIG A;  1PPJ H;  4U3F E;  3MHH C;  2YKO A;  3ZMZ A;  2M5A B;  1YCI A;  2R44 A;  1L4A C;  2B89 A;  2GHY A;  4DR3 B;  2SPZ A;  2F1M A;  3KQG A;  5E79 E;  1Q7Y Q;  1OW7 A;  2WSF H;  3LW5 H;  2LGW A;  5A2Q N;  2FYU H;  4D6T E;  2EIN C;  1FDM A;  3HUS C;  1KU9 A;  5E1A C;  2N04 A;  3B8N A;  1BE3 E;  3K03 A;  2E5L O;  2FFD B;  1XI1 A;  2I1K A;  4KXR A;  3TYY A;  3CCE V;  2LO1 A;  2ARH A; 
#chains in the Genus database with same CATH homology
 3ABV C;  3AEG C;  1S5L X;  3Q5P A;  3AE3 C;  1VF5 C;  3C8V A;  4H13 D;  3B71 A;  3GLM A;  2IDB A;  3O6Q A;  5KKZ C;  3D71 A;  3D6Z A;  1DIP A;  1PV3 A;  2WSE J;  4H44 B;  1FDI A;  2E74 C;  2D2C C;  1KIL E;  2K9Y A;  4GDO A;  5L8R J;  3Q1M A;  2BEZ F;  2QSI A;  2V7Q J;  1JB0 J;  5M1B A;  2ZT9 C;  1HJ0 A;  3RK3 E;  2E76 C;  2P10 A;  4PV1 D;  1IK7 A;  2J5U A;  1NGM B;  4U7J A;  1KTM A;  4H0L B;  1Q90 D;  3S9O A;  3AED C;  1AJY A;  3GF7 A;  3RL0 g;  4YTP C;  2QJK C;  1FDO A;  2E74 B;  4YXD C;  3AE6 C;  4KT0 J;  2E75 B;  3SFD C;  2YMK A;  2WQY C;  3AE9 C;  4OGQ C;  4R4M A;  1DD4 A;  4H44 D;  2FYN C;  1YQ3 C;  2OQQ A;  1S1C X;  4I7Z B;  3AE4 C;  2WSF J;  2BEQ D;  3AEE C;  3AE1 C;  1PL5 A;  3AE5 C;  3LW5 J;  3AEF C;  5KLI C;  1GMJ A;  1HF9 A;  3H25 A;  4H13 C;  4H0L D;  2QIW A;  3AE2 C;  2FXP A;  2WSC J;  1VF5 B;  2E74 D;  3Q3D A;  4XFJ A;  2FBW C;  1ZME C;  2E75 D;  3EWK A;  1KQF B;  2D2C B;  4TT3 H;  4PV1 C;  2H89 C;  4RKU J;  4R4L A;  1R8E A;  1RQU A;  2NZ2 A;  2ZT9 B;  2E76 B;  2JO1 A;  2H88 C;  3GF3 A;  1EXI A;  1U57 A;  4IL6 X;  1ZOY C;  1VF5 D;  2G3A A;  3AE8 C;  1TU3 F;  3AEA C;  2G8Y A;  4H44 C;  4Z1M H;  1KMI Z;  1WMK A;  2MKV A;  1NYH A;  1K05 A;  4OGQ B;  1KQG B;  2D2C D;  3IN6 A;  3R4Y A;  2WPV B;  1Y9B A;  3AEB C;  1MKM A;  1ZRT E;  1UIX A;  4H0L C;  3T97 B;  2ZT9 D;  2JP3 A;  1KOR A;  3G9R A;  2QJY C;  2E76 D;  4H13 B;  2QJP C;  1OMI A;  1OW8 A;  1OW7 A;  1RQV A;  2E75 C;  4Y28 J;  1OW6 A;  3IAO A;  1DD3 A;  3FGA D;  3GMA A;  1YQ4 C;  3SFE C;  3Q5R A;  1EXJ A;  4I7Z C;  3AE7 C;  1ZP0 C;  1PIX A;  1VL2 A;  1K04 A;  4OGQ D;  3AEC C;  2O01 J;  3D6Y A;  3D70 A;  3Q5S A;  4PV1 B;  2YIU C;  3Q2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...