2E76B

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
b'MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e76B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76B01
1S5LX 4KT0J 2D2CB 2E75B 1Q90D 1JB0J 4RKUJ 2E74B 2FYNC 4H13B 2WSCJ 4OGQB 4PV1B 5KLIC 2ZT9B 5KKZC 2WSFJ 1ZRTE 4IL6X 5L8RJ 4H44B 2O01J 2WSEJ 2QSIA 4Y28J 2QIWA 2E76B 4I7ZB 2K9YA 2QJPC 3C8VA 2YIUC 4H0LB 3LW5J 1VF5B 2QJYC 2QJKC 2WPVB
chains in the Genus database with same CATH superfamily
4J9YB 4WY4C 3RYHB 4BR6A 1GL2D 4BXLA 4YXDC 2AHYA 3STLC 3B2EE 2OARA 1SFCC 1P4RA 4JQ0D 2A0LA 1BQ0A 4YY3B 3K9AA 1BGYG 4IFMA 1QGKB 5AVVB 4G28B 1KILE 2YXLA 4C7UA 3K04A 4QPKA 4X20B 5C8YA 4DRXA 1QVFO 1FJGB 1CW5A 3H1LG 4BRYB 1L0ND 1QLEC 3KCYA 2IZ0A 3CD6V 5E79H 1NOHA 3UQ8A 3L72G 4L8JA 4PD4F 1OW7A 1KYOI 1H2GA 3E8BA 3JAMN 1VF5C 2GTAA 3JAWB 3EHBB 3U59A 1F4MA 4ZBMA 1Y66A 1K4DC 4MVRA 4KFMA 1VQ7P 2JGDA 4EIJA 2ARHA 1J1DB 2B88A 3G6EV 3AG4C 3SYQA 2KSDA 4EB6A 5H2FE 2YIBA 3RGBA 1WMKA 2JEXA 3JSLA 2R5BA 3G6BA 4KHPB 2QJKB 4B3SB 1YHQV 4UB8E 1VQ5P 4JI0O 2O01H 1EZVH 4UCOA 3F5WC 2A06D 3K57A 4X1KB 1K5QA 1DD4A 3BA9A 2BTQA 1HJ0A 1AJQA 1NVOA 1T3JA 4UCSA 5KHIA 3G6EP 1IFJA 5KAFZ 1VQLV 2WLMA 1IJDB 4BIZA 4J7ZA 2IDBA 3TJTA 5B1AC 5IDJA 3AK3A 4JI8B 2Q1KA 3JC22 1BE3D 1IFMA 2AXCA 1NTMJ 5E1AC 1K73W 5C39A 1SQXH 2B5UA 4RUFA 3D70A 5B1BB 1IFPA 4I6MC 4LR3A 1Y8AA 1FBMA 2QJKC 4ASWA 2FYUD 5AW8B 1NTKJ 4G27B 2QVAA 2IFMA 2H3OA 4MVZA 1KB9I 3VMAA 1GN3A 2O57A 3K9SA 3KG2A 3NXSA 3APQA 4FM2A 4DR5O 5BXZA 1FE6A 2PUSA 2C0XA 5KJ7A 5EFWB 4Y99B 3CJHA 3L4FA 4RO0A 3SPIA 3ZN1A 4H13C 2FXOA 1SS3A 3PP5A 1R1BA 2EBOA 1ZP0C 1BSNA 5AVZB 1YJNV 1SETA 3L70G 1FDIA 3MDSA 1YI2P 1VQNP 4JI2B 1R3IC 2YXQB 1VQ4P 4DR2O 4H0LC 1JMBA 4N3YB 2M0BA 3ZRVA 2JS5A 1M1KW 2Q7CA 1J5EB 2AXTE 2R44A 4DR3B 1SQQJ 1I7FA 3OMAB 1K92A 1I5XA 2O3JA 2ITAA 1GU5A 4DUYO 1YJNP 1M57D 2KIKA 2QDOA 5L3GA 4NXNB 1Y74B 3AE4C 4Y99C 5H2FH 1L4AB 1U7MA 2W27A 1XNRO 1QVGU 3KHUA 1GU4A 1VQKP 1TVKB 2LW1A 2Q6AA 1N8RW 4OX9O 2H8PD 4UB8H 3OEEG 3E22A 3GG2A 2GA1A 1HNXO 3VQVA 3CX5I 3CS5A 1KQGB 3E7KA 3Q1MA 1FZCC 1LTSC 1HNWO 1HTLC 1GM8A 1SQBE 1YITP 3K58A 1WAZA 3JARA 1S9KD 3V4QA 1Z2GA 3UT5B 1FOSE 3N2KB 2XU6A 4LFCO 4MVSA 3RK3E 2HLOA 5CA1B 2FTKA 3ETEA 1L4AC 4JI5O 1SRYA 1KORA 2ZINA 4X64B 1GM9A 1ZUQA 2AW9A 3AG2B 4GYCB 1NTMK 2KNCA 1AJNA 2L91A 3Q5PA 2YC0A 3AG3B 4ZI7B 1X8YA 2M7WA 4RAIA 2RKLA 2YO2A 1JJOA 2XOKG 2LJ2A 4LNUB 4GX0A 4U3JB 1OW6A 2BOBC 1NTKK 1XMQB 3ZN0A 4D6TE 4O4IA 3ZMZA 5IJ9B 2GUSA 1NS1A 1GL2A 2AEJA 2LXCB 1PNKA 2W6IG 1I5YA 4OPHA 4LF5B 3H1KG 4BIUA 1SESA 2OTLP 1IO4A 1JQ0A 3ZIAG 4X1IA 3JCUZ 3S3XA 4EDFA 2MK3A 3ABVC 2Z4EA 4IIJB 3TNUA 3F7YC 4X66B 4O9BA 4Z1MH 3CPWO 2GHYA 3AG2C 4PDVA 1YVWA 3K3WA 2AXTH 2Z0AA 3PHLA 5LP6B 3H1JJ 2C2AA 2CGOA 2WLLA 3BCCG 4DOJA 1K9MW 1EDKA 2IM9A 3QG5A 1FXKA 3D6ZA 4IYHA 3CWBD 2EIJB 1AFOA 1YIJV 2Y48A 4U7NA 3WG7C 2ZT9D 5APTA 3E83A 1Q8IA 1EN5A 3HD7D 2FBWC 2J58A 4TV8B 4JV5B 4IL6Z 2OCHA 5CBOA 1M5IA 5CMUA 3ZHRA 1KC8Q 1PPJD 5LHIA 3WB1A 1LWUB 2XDJA 4AQYB 5JQGB 5TJHA 2F66C 3LDCA 1FOSF 4EFBA 1S0VA 2HFED 4O4LB 3MD0A 2XTAA 1DD3A 2PGDA 3CC4P 3SJAC 4DV6B 2DJVA 2LGQA 3AG1B 1RQUA 3B09A 5LP6C 5H6RA 3RYFB 1L0LD 1Q86Q 4JF7A 4G2KA 1FS0E 2WPQA 2A9HA 4L76A 5B5EE 2DYSC 4JI7B 2WT7B 1WJZA 2CUGA 5EYPB 1BZKA 2IYPA 4MTXA 3GB7C 4HNAA 1NI8A 3CCMV 2ETNA 4NTWA 5KA5A 4DK1A 2A45H 1QU7A 1PGQA 3LDEA 5CHXA 1LWUC 2YIDA 3CRCA 1TUBB 2P4VA 1T2KD 2IBZE 3DC6A 1JY2N 5APWA 3L73J 1JFFB 2BOCC 2E5LB 3GF3A 4DJGA 4D6TH 2E74D 3H1JG 4UB6E 5CJ0A 3TF5A 1OIPA 3PH0A 3ABMC 1ZMEC 3AG1C 5EBMC 3X2QB 5LOVB 4TOIA 4YJ2A 3N2GB 3BATA 1AVMA 3V4WA 3A7OA 3K59A 3CE2A 1N34O 1K04A 2W6AA 3RBXA 3AEAC 3GWOA 3CCJV 5DEDA 5A9GA 1YXBA 2YKPA 2QJYB 1LGHB 3GHGB 3U11A 3WUVA 3OAAG 5K1XA 4FLWA 2HJFC 3JALB 1N73C 4YJ3A 5J2TA 3H1HJ 4RQEA 4QIWF 3L75E 2DE0X 3R65A 4JYYA 2KS1A 5CA0A 4GKKB 1RPOA 3CRAA 2WLJA 4OGQD 5LXTA 2P4KA 5J2UA 1YTFB 3X2QC 3K5BA 3SFDC 3CCJP 2JKVA 1UPGA 2UXDO 3T2MA 1RE4C 5L3FA 2UXNA 3V2NA 1EFRG 2BCCJ 4JI0B 2QJYC 2F95B 3Q4HB 3K0GA 3MGNA 3OW2O 3GHGC 2NPSD 3LSQA 1LT9A 3CCLV 4K35A 1XL4A 1GTWA 1BCCJ 3W68A 2DN9A 4JPRA 4I5SA 2WLKA 3G9RA 2DYRB 3LSSA 1G8MA 4P2ZA 5B5EH 2UXBO 3FB6C 5CBFA 2VS0A 3AE8C 3H1IJ 3DGEA 2WSEJ 3G3ZA 3B5NB 1TAEA 3CCLP 2E76B 2ZDIA 1S5LE 5IJ0A 5IYDO 3V5BA 3W7SA 1GH6A 1M1JB 4DR7B 3CXHD 2PY5A 2HVJC 2IBZH 3SDLA 1Y76B 1EM1A 2KB1A 4I4TB 5FPRA 3FB7C 4J7JA 4EKWA 1JUNA 2ZR3A 1WP8A 4UB6H 3L36A 3CCQP 3UIAA 2HPCA 1AR5A 1CP9A 1U57A 2DYRC 2MJZA 2PP6A 3RL0g 5JCOC 2BSKA 2IW5A 1NTZJ 1SQPD 1T8ZA 3H6PA 4N6JA 2EILB 3RL0B 3TGUJ 1M9NA 4UVAA 5EIBD 3L74J 4NXMO 1LNQA 3B5NC 1S72V 1CPYA 1MFZA 2GM4A 2E76C 3U1AA 4XE5B 1NAYA 4Q6GA 1YSCA 3L75H 4JI6O 1O9HA 1M1JC 5CCHC 1Z5WA 1P84F 1ENVA 3IAYA 4WCEV 1IBKO 4RKUJ 1BE3E 1GN4A 5BR8O 2FKWB 4DUYB 1VQOP 2RJZA 3G71V 2L5GB 4JI3B 3MIWA 3WUTA 1EN6A 2QTOA 2N1TB 2ZNIA 1XNRB 1VQPP 4HKZH 3RL0C 2EILC 4OX9B 4WY4D 3RW0A 3ZRWA 4CC5A 2WSSG 1G1IA 1OWAA 4O4JA 3HD7A 2KG7B 5EZYB 1VQMV 1HWTC 3AE3C 1NU1J 3SYAA 3R4YA 3G71P 3K5MA 2E42A 2WITA 3CRMA 3OE7G 2WQYC 1AI6A 4UFZA 2UUCO 2FY8A 2EINB 4B3MB 4JI1O 1IBLO 1G2CA 1K34A 2YI9A 1S5LH 3ZS8C 2RN0A 5ITZA 1VF5D 4YHHO 1SA0A 1X59A 3B8MA 2P7JA 3M8AA 4JASA 1PIXA 2Z5IA 4L74A 2N9YB 2PFXA 3P3PA 3APOA 4KUMA 2DW4A 1NKDA 3IF4A 2Q69A 4CPGA 3RYIB 2XUMA 3EFFK 3L71D 3TK1A 3CCUP 1SQBD 2UU9B 1KYOE 2A06H 1AP6A 2I1KA 4IYIA 1G4YB 4C7NB 1H8HG 2VQEO 1XI1A 1EDLA 2EINC 2YO3A 3AE2C 1WNSA 3F89A 1NTZK 1DTOA 5DN6G 4F6RB 2ZD9A 3CCRV 4DV2O 4DV7B 2CDYA 1QR8A 1S9KE 4D7TA 2DQ0A 5KLVG 2Q68A 1LR1A 1ZTEA 3RK3D 4E4EA 1PGOA 1AILA 3DC5A 3LW5H 1Z56A 1BE3H 3SPGA 2JVDA 4B7KA 2O1JA 3DXRA 2B87B 1VQ8P 1T5EA 1N7SD 1VF6C 3BAAA 2JJLA 1SQVD 1SLQA 3CSXA 3CCSP 5IYCO 5APYA 1XMOO 4JYAO 2A45G 2FYUH 1H8AA 4GKGA 4DR6O 5KAIE 1SQFA 3D3QA 1AROP 4DCKA 4WFEA 4BWNA 2I1JA 3FFQA 4UV8A 1ZWIC 2P58A 4KHXA 2EIKB 3SWFA 2LP7A 2YEVB 3KQGA 1JNMA 1IFIA 3TYYA 5KLVK 2POHA 3QO8A 2N74A 1HNZO 1LTTC 4H13D 4UVBA 2NPSA 2ZAEB 4DYLA 5BY1A 1S3JA 4L87A 3I55V 3ZRSA 1SQQE 2OQQA 3G4SV 1J1EC 1MABG 3FAVA 3OD4A 1KB9E 1XTGB 2Q7HA 4JBZA 5LYJB 4HH2A 4H0LD 1HDJA 1K33A 1H2SB 2YXYA 1OFCX 1AI5A 3CWBE 5JVDA 1WP7A 3E8GA 2KXPB 2EIKC 2GUZA 3M0DC 2QEXV 4MTOA 2F43G 1MSWD 3CCEP 2GDSA 1GKFA 4GUNA 3T1HB 4U3FD 3BVOA 4DXWA 2P5OA 1PD3A 1ZSPA 3KPEA 1KYOH 1Y9BA 5IWAB 1Y67A 4J11A 5B66H 3A3YB 4PI2A 2B89A 3O6QA 1HUCA 5GW7A 4HYOA 4ICGA 2CH7B 4N21A 4LWSA 3TCUA 3GVMA 2HG5C 3DTUB 3FXEA 5KHGA 1NYHA 2VQFO 3J7AU 4FLYA 1OCOB 2NN4A 5AVQB 5AVRB 5CBGA 2F4VO 2F1MA 5AW1B 1K4CC 3HKEA 1BGYJ 3AEIA 3QVNA 4RESB 3BEHA 4MW8A 5AVUB 5CBNA 3CX5E 1L4AD 1FJKA 2UXDB 3OAKA 4FZ0A 5KAIH 2IBZG 4FFKA 2R3CA 3H1LJ 1FZAA 1IZ3A 1UJWB 2OIEA 1URFA 2B9ZA 3SJCC 4FFBA 2NRGA 3L72J 2QKAA 4NKGB 5AW7B 4IT5A 1IX9A 2Q73A 2Q4PA 3GMAA 3S9OA 5LMUB 1OCOC 3SJQC 2NLJC 3HKCA 3JAKA 1FPOA 3KCXA 5FNVB 1ZL8B 2J59M 4WY4A 2ZXWB 5AW5B 2UXBB 1FD9A 4Z1VA 1K97A 1SQQH 1SFCA 2HR3A 1KB9H 3JSVC 1FFXB 3KZIZ 4RQFA 4IHJB 3C8VA 1BSHA 2Y0DA 1BSMA 5JWPA 3NMDA 5EBWC 3GW6A 1NH2D 1EBOA 3CWBH 2KYVA 3B8EB 3T97B 1OMIA 3ICXA 3HKDB 3VMXA 5BMVB 5CJ4A 2JP3A 1JTHA 3D8CA 1W2BU 1JA8A 5CBHA 1H2NA 1E79H 1N4CA 3CCVP 1QVGO 2FXMA 3K03A 4HJGH 1RF1C 1VQ9P 4PHZA 3RYHA 5KLIC 1PPJH 2ZXWC 1N86A 4ABMA 5JJEB 3F5TA 3W7WA 1VQ7V 2V7QG 4GKJO 3JSNA 4H44B 3B71A 2GV9A 1KBHA 4JAVA 5AVYB 3ZHQA 1H2LA 1T3UA 2XNDH 5AW0B 1DF5A 5L3BA 1JJ2U 5L3DA 3ZX6A 2OYIB 4X20A 4D7SA 1XHZA 1VEWA 2ATKC 1L0LH 2OGUA 2YXHA 1QNMA 4X89A 1L0NG 4OWFA 4BIOA 1J95A 2E75B 4DRXB 4IFFA 3JD1A 3H25A 1VQ5V 4TLFA 1HJBA 2XAFA 1NO4A 5A2QN 2OTJP 1ZN5A 5BR8B 3OGCC 4E2LA 2UWJE 2NNUA 2H7HA 3PJSK 5J9PC 1SF9A 3WUUA 1DGSA 2HHHO 1RHZB 3CX5H 3B40A 1KD1W 5GTIZ 3U0ZA 3CXHE 1RPRA 1H2KA 3LSUA 1N7SA 2ZYDA 2W8ZA 4H44C 4F6EA 2JDIG 1S76D 3L70J 2B1IA 2JGDB 2X6CA 1EZJA 3VQWA 1LTIC 4WBAA 2OYIC 2HODB 4EB6B 2QE7H 2K37A 1QHTA 4N23A 1SQPE 2A06G 1KQSO 1L0NK 2QWOB 4C46A 4R6ZA 4DW1A 1B6QA 3B8NA 3IJ4A 4FLZA 3DSQA 1J2JB 3QH9A 2ODMA 1GTOA 4LP8A 1J1DC 3ABKB 4I9WA 1LTJA 4JI1B 3K08A 5APUA 1JPXA 5KHKA 2ZE5A 1PL5A 2BTQB 3ETDA 1K73Q 1AI4A 4YIPA 1SZTA 4YHHB 2KB7P 3S3WA 5C93A 2CK3G 1NJIW 2MW2B 4DV5O 1L1FA 4LF7O 1YI2V 2ADPA 2BCCE 1YF2A 1VQNV 1M93A 1QR9A 5IE9A 1GMGA 1VQ4V 2FYUG 2XKMA 2AEMA 2FFDB 4I55B 4O4HA 4K0KO 1K3EA 1JM0A 3MP7B 1MUUA 2VQEB 1L8DA 3ABKC 1W59A 3M0AA 3MZWB 5LHGA 5K5GB 4DV2B 3S4RA 4RJTA 1Q6HA 3H1IE 3KYQA 2ZNJA 1ZAUA 1VQKV 1JCHA 3CJHB 5B1BC 1M1KQ 1M56D 1XL6A 3MHSC 3CXHF 4WF9V 1IBMO 4JAUA 3BHPA 4NTYA 5E79Z 1FZCA 2AHZA 3HTKB 1AB3A 3HUSA 3EWKA 1B3QA 2XAHA 1YITV 3CYOA 2FFDC 4TV9A 3WB0A 4BW5A 1XMOB 2RQ6A 4JYAB 2R5DA 2ZFCA 3CXHH 3T1YO 3H1KJ 1JMKC 4CZZA 5B3SB 3IN6A 2Y69B 1GD2E 5KMGA 1N8RQ 1JO5A 1HVVA 4X62O 2R9AA 2Y0IA 4LF9B 3RK2D 3TGUE 1Y74A 1KYOD 1JY3N 3L74E 1L4AA 3M06A 1A02J 2LQTA 4W7ZA 1TGOA 2DW3A 3A0BE 3L71E 1AR1B 1DEBA 4GIFA 1SQPH 1VPCA 1HNZB 1HBWA 3BCCJ 1NTMD 3RVZA 2ZQMA 3E22B 3FYEB 3FWLA 2ZIOA 4W7YA 3WU2E 3QTCA 3OA7A 2WPDG 2ADQB 1NTKD 4PA4A 5B3SC 5DM6V 2Y69C 4PD4I 2YI8A 3UT5A 3IC9A 3L35A 3N2KA 2OTLV 1FAFA 1GK4A 4I1LA 1LUVA 2BCCH 3K06A 3MAQA 2LFRA 5GTHE 1G6UA 1SQVE 2FL4A 2KQXA 4EEQA 1PP9G 2LKMA 4PJ0E 1IZNB 2WSCJ 3ABUA 5JH7A 1KKDA 1NU1E 4XDLA 5AG2A 1JY2O 1QL2A 4LNUA 3B4SA 4NPEA 2OCCB 2Y9YA 3TDKA 5IJ9A 1SERA 2G38A 5EC1C 1SQQD 4DR1O 5CB4B 3A2AA 2GTSA 1I94B 1GL2B 1OCCB 1KB9D 2Q8VA 1E1RG 3AG3C 3ZEDA 4DR4O 1R5SA 2K1AA 2YMYA 3FXDA 4IIJA 1K9MQ 4X1IB 5H9CA 2OTKE 4PELA 5KKZB 3RYCA 3CC4V 2ZJSE 3TNUB 3H32B 4N78E 1YJWV 2WA3A 1Q81W 2O01J 3V6IA 2QIWA 5KUMA 5APVA 1KU9A 1NVPD 1N33O 2WLLB 2FMLA 1IXBA 2IZ1A 3II6A 1ZRTD 1MV8A 4B7EA 3L74H 5H2FZ 4U3FE 4A5UB 3AE9C 1IXMA 3A0BH 3L71H 3M9QA 4KJMA 1LTBC 2PYJA 1PPJG 1GL2C 4AILC 1SQBH 2FYZA 5CMZA 2CTQA 2PYLA 3CHXA 3K5NA 4UB8Z 1LWUA 3GWKC 1RE3A 1SS1A 3W7TA 1PL4A 1YJWP 4MS2A 1GK9A 3WU2H 1RQVA 4LF8O 5KKZC 4GX2A 4DUZB 3ZCCA 3JATB 2QRXA 2EIJC 1Y4MA 1IC2A 4TWKA 1UFIA 4PA3A 1L0LG 3WB2A 3CC2P 2WPSA 1T6AA 1D7MA 1GRJA 1MKMA 1DIPA 3CX5D 3A0RA 5GTHH 2YMKA 1BT8A 4DK0A 1SQVH 2OYHA 5LA6A 1RFYA 4I9QA 1URQB 4H33A 3BFRA 3SSUA 1YDXA 1L2PA 4HNAB 4PJ0H 1N73A 5AVXB 4AQRD 3PRJA 3SWYA 2WWWA 1NU1H 3V2RA 3D3IA 1PV3A 3MHHC 5GONB 1JMMA 3K5OA 2ZXEB 4CH6A 2FKXA 4DV0O 3H9VA 1LJ2A 3ETQA 4FLTA 1EZVG 2YICA 1E5WA 5KTBA 5LOVA 1FDMA 4DV3O 5CA3A 1SP4A 1AVYA 2QE7G 3HPLC 3H1JD 1RE4A 1H0TB 5CN0A 5EC2C 4U7JA 1YJ9P 3F7VC 1USEA 2D2CB 3A0HE 4P30A 4LH7A 3C3TA 2BTOA 3ZRXA 4B3RO 2KP8A 3GHGA 1URQC 2M3EA 3JALA 4YTPC 3VP9A 1WLEA 4PA6A 4CS4A 2AXTZ 4YJ3B 1OW8A 1SQXG 3LNMB 4IL6X 4DV1O 1V54B 1KFNA 1X0TA 2KS1B 5CA0B 1RSOA 4MVOA 4LC1A 1MZ9A 2VRSA 1VP7A 3R2PA 3HE4A 4R7CA 4I50A 1FXHA 5J2UB 2A3QA 2RCVA 4U3FH 2CPBA 1SC5B 1UIIA 3THOA 4JTDB 1MZFA 5IYZA 1RF0C 1JOYA 4JI4O 2D2CC 1XNQO 3Q4HA 1Q7YQ 3QWOC 4O2AB 2QWQB 1PV0A 1Q7YW 2J5UA 1XHXA 1M57B 2PI4A 1LT9B 3CCQV 2V4HA 1Q6UA 1VDFA 2QJPB 3JD0A 1QCEA 1V54C 2P67A 1SQXK 3C9IA 3ZMSA 4GX1A 2HG5D 3L73D 1KKCA 2P7TC 3P8MC 4R4LA 2M3BA 2MKVA 3VN0A 1XILA 4DV4O 1DX7A 3H1LE 1F23A 1XEQA 1PZQA 3B5NA 2LW7A 3E35A 2RH0A 3AEBC 3WFVA 2UUBO 2KOGA 4DR5B 3EVKA 3L72E 1M90Q 1FXVA 5CCHA 1WA8A 1M90W 4PV1D 1Y76A 4K0KB 1BHBA 2VWKA 1CI6A 2H43A 2OIGA 4QPJA 1HW7A 3ZMVA 1VF7A 2P90A 4I0XB 2AEFA 2KK7A 2QSIA 3H1HD 1VQOV 1NT2B 4CH5A 2QJPC 2QA4P 2HPCB 1EN4A 1NQTA 1SQPG 3P8CD 2H8PC 1VQPV 1JCCA 1PM9A 3ZHSA 3A0HH 2FB5A 4DR2B 1EQ7A 4LH6A 2BSKB 5KX5A 4BAYA 5BZBA 2WLIA 4YY3O 1KQFB 3VP8A 2A45I 3IGAC 1NH4A 3FB8C 1JEKA 2ZDIC 3HKBA 4FMTA 1BS3A 2BCCD 4RUEA 5CCGD 1R6TA 4XDKA 5AW3B 5IY5B 3JASB 1BCCD 2XAJA 3MHVA 2Q7GA 2JJ1G 5DECA 1HNXB 3CC7P 3QO5A 5EBLC 5KLVJ 1HNWB 1CZQA 1WN7A 2W6BA 2ILMA 1SFCD 1KECA 3BRTB 3STZC 4DO2A 2M5AB 1Q5OA 1FAVA 5TISE 3H1ID 5BU8B 4GDOA 2KG7A 2ZT9B 2BEQD 3E1RA 1ZX3A 1DLBA 4O4JB 4LFCB 3HD7B 4Z1MG 5LGNA 3TXQA 4L75A 4WWIA 1BDCA 1QLED 2N1TC 2KKWA 3W7XA 4JI5B 5IY5C 3OR6C 4NTXA 5B5EZ 3CCUV 1PKXA 4KHPO 4B3SO 1CSBA 4TT3H 3VMZA 3SPCA 3NFQA 2ZCEA 1IFDA 1YBKA 4D6TJ 1PGPA 3L70E 1DH3A 2NZ2A 2Z5HA 1HR0O 2ZM6O 1H38A 3L72H 2W0XA 1NTZD 2YSUB 2BEZF 3TGUD 3L74D 3FKSG 5ITZB 2K9JA 1US6A 4JI8O 2IX7C 1SA0B 1VQ8V 4NYKA 2OYOA 2ZT9C 3GLMA 4UB6Z 5AW6B 2XAQA 1X79B 3UO3A 3CCSV 1SQBG 1JVMA 4DR1B 1Q2NA 1NTME 1K8AQ 4LFBO 1NBMG 1K8AW 1D5NA 1H2MA 4DR4B 4ZKPA 1G1JA 2E74B 1QL1A 2ZE6A 1LP1B 2EZOA 4UCTA 3BVHA 2C9NY 1NTKE 2RMKB 5KHHA 2IBZI 2Z3YA 1YQ4C 4X88A 1MOFA 1IVSA 4LBEC 1XDCA 2B87A 2JS3A 1ORQC 5KLVD 1SQVG 3DXRB 2PTMA 2PRRA 1NU1D 1W2BO 4JI2O 1UIXA 2KSJA 4D6TG 3CMEV 1OVUA 3ABLB 3K5LA 3A8TA 5GTIE 2JEEA 1DEEG 5TISH 2M6YA 2N05A 4DR3O 1T2KC 4ZOLB 3CLQA 2R9IA 2E74C 4AYCA 1MSDA 3M0DA 4X65O 3WMM0 1PL0A 4FVMA 3CCEV 1ZOYC 1BL8A 4B86A 2YS8A 1Q6IA 3CMEP 1KILB 3GF7A 3ASNB 1NGMB 1P84I 3H1KE 1JY3P 4N78D 3JYCA 2XASA 4WBNA 3L70H 3QF7A 2XHBA 1R5LA 5KAFE 2M8RA 3RBZA 1S5LZ 4AUWA 1KYOF 4NPDA 3ABLC 3FAVB 1GW4A 1XTCC 1N0NA 1AJYA 1OCZB 1Q3EA 2QG4A 5EK0A 1EDIA 1VQ6V 3OMNB 3SYPA 1ZRTE 5JVDB 1K05A 1N34B 4ZNCA 4U3FG 4O2BA 3W67A 2GUZB 4MTGA 2CGNA 2X6AA 3L75J 4DV3B 4I7ZB 4JYBA 4FJCC 3AG7A 1YZBA 3SGIA 2H89C 5AVTB 2Y0EA 1KN7A 1KILC 1NTMH 4WFGA 2IYOA 2F93B 2Y0CA 4LF6O 1FS0G 4K8ZA 3ZDMA 4B3RB 1VQ6P 1QBZA 1XMQO 4P9OA 1NTKH 4LWSB 2JWDA 4JAAA 2QTSA 1OCZC 3I5DA 4LF5O 4PA9A 4NR1A 3OUSA 2V7QJ 2L35A 3CMAV 1BDDA 1HGVA 4FZ1A 5KHJA 3MUDC 2Y4TA 5B1NA 2K9YA 2DWDC 1AI7A 3UCSC 4R8CA 4I7ZC 4WVZA 3HKEB 4X66O 1YCIA 5LMNO 2SPZA 2XZRA 2JK5C 4L73A 5CCGA 1L0NJ 1K7DA 3JD4A 4RO2A 4ZHQA 1K5SA 4X1YB 1AQ5A 3HE5B 1KB9F 1U96A 3N4XA 4PD4E 4CH3A 4X9QA 3CMAP 1EXJA 3HRNA 3CCVV 4TUYA 3H1JE 1RF1A 3KKYA 1VQ9V 1GK6A 2Q9LA 4JV5O 3L75G 2EJRA 1FC2C 5EIBC 3JAKB 3H1KH 2Y4UA 4AQYO 1SKVA 3RT3C 4DV4B 5KAFH 2ITDC 2IU3A 3E1IA 4C7RA 1WPXA 4IHJA 2UUBB 2W90A 3NTNA 4X8AA 3D6YA 2ZVNB 2IPPA 3M7MX 3HKDA 4JI7O 1AP5A 2OTJV 2LFSA 1HWYA 1JTHB 4NXMB 4ZMDA 3HB3B 3F5HA 3ITKA 2KSEA 3D71A 1VF5B 3ZBHA 1BE3J 3OUFA 5LGTA 2P2UA 3C1LA 4DW0A 3IFMA 2ZYAA 4JI6B 4UUJC 1BGYD 5B66Z 1MMMA 3T4DA 1JY2P 3CX5F 5C8YB 2Q5UA 2E5LO 1IBKB 3D36C 4BRYA 3FX0A 1EXIA 3BABA 1CEZA 2EJ7A 2OYIA 3Q2YA 2FYUJ 3AG4B 3H1LD 1O9GA 3JCUE 5AW9B 1KD1Q 3JCZA 4TT3G 1WT6A 3L73E 3JAWA 2CE4A 2DOSA 3UO2A 2WSCH 1H8EG 1KP2A 3L72D 3SPJA 4PDLA 1IDSA 2OYQA 4YPCA 4MTFA 3CEIA 5HFLA 1P49A 2R70A 2KZJA 2W0FC 3IAOA 2D3OW 1P7BA 2EULA 3O8ZA 3RK3B 5KAIZ 1FKAO 1Q43A 4GKKO 2Q3EA 1N7SB 2F23A 2RDCA 5B1AB 2E75C 4PD4H 3H1HE 4JPZB 4IL6E 1JY3O 3AEGC 1MZEA 2A7WA 2HODA 3H1JH 4X1KA 2I8DA 2UUCB 3T1CA 3ML0A 4LF4O 1HP8A 5JJJB 3P8CE 3CD6P 3EXAA 1IBLB 2ZE8A 2GUVA 3E8FA 1FZBA 3CRRA 3P3NA 1SQGA 1BE3G 4DZOA 3N27A 1VARA 2WPVB 1NJIQ 1D2DA 2IJKA 2RNBA 2X0LA 1URQD 4HAMA 4JTCB 2ZM6B 1HR0B 3RK3C 1LTJB 3LUTB 2Q0AA 1X9VA 4XFJA 3J81N 2BASA 4H13B 1N7SC 1KP3A 1BCCE 2YNYA 3CP1A 1TUEB 2PGGA 5DJTB 3BA8A 4F4LA 1YHQP 2P6JA 1Z5VA 4KXRA 1QEXA 3IR9A 2E43A 4Q20A 4B3TO 1PFIA 1W2EA 1ZXGA 3LIEA 3OR7C 2JO1A 4PDRA 2FFDA 3BY6A 1V9PA 4I55A 4H0LB 2C9LY 2YXRB 2GSMB 2WLHA 5D5QA 4DR7O 4LFBB 4O4HB 2D2CD 1VQLP 1LTJC 1PP9J 4Z2WA 3JCUH 3L73H 2FXPA 3L70D 1YTFD 4FLVA 4R4MA 1NAFA 1HGZA 5DJUB 2FYUK 2R9RB 1DF4A 4W80A 4DR6B 4J7KA 4ZKUA 3HTKA 1OCRB 1GW3A 3M9HA 3R66A 1FZCB 2RN9A 2YKOA 4PDMA 2BE3A 1M7LA 1NTZE 1SZXA 3HUSB 1S4XA 5H5NA 4QE7A 4AI8A 4TV9B 4J42A 3RGUA 5KJ7C 4EFEA 1TVKA 1VIBA 3AE1C 4IOIH 1OVVA 3H1HH 5KMGB 3P30A 4IL6H 3VMYA 1LUWA 4X65B 2IFNA 2WTYA 4TQDA 3G80A 4JI3O 1HF9A 2QM7A 2WSFJ 2ZYGA 1A32A 3A5TA 1NTMG 1FYJA 4WFBV 3B77A 3JD2A 3CWBJ 3B5ND 3U1CA 2E76D 3JARB 4ASVA 1U7JA 1OCRC 4QGPA 1E1QG 3ASOB 4GOEA 5CCHD 1QVFU 1NTKG 3HUSC 5CA1A 4FM1A 5KLVE 1BCCH 3NR7A 1EZVI 4ZI7A 2QWNB 1LTGC 3RWRD 4FM0A 2KNCB 2OWOA 1KUQA 3CRQA 1YYCA 1W0JG 2C0WA 4ZIBA 3RL0D 4B3MO 2JIZG 4WFHA 4U3JA 1L0LJ 1H89A 4ZKIA 3RVYA 3BRCA 3AE6C 3ZHTA 2KI7B 3H1IH 1PP9D 1F7YA 4O4IB 5JH7B 1NH2B 1M8OB 2K88A 2WSEH 2A79B 2Q7EA 4IFDK 3ASOC 4LF6B 2VWJA 2VQFB 4QMAA 3S1KA 1Y47A 2R32A 4OVNF 2WSSH 1SQQG 2LXBA 4FPPA 3K79A 1JOCA 3H1KD 3WG7B 2F4VB 2X6BA 5CB4A 2WLNA 4J9ZB 4QNHB 1GO3F 2UUAO 1GM7A 2R3SA 3SJBC 1NKNA 2UU9O 2N1TD 1KQSU 1Q81Q 4UCRA 2X7RB 3VQYA 5LP6A 2WPRA 3CWBG 5APSA 1X22A 2YIUB 2QKSA 3FD9A 2Y0PA 3I5CA 3AEEC 2OCCC 1NTZH 3H32A 3Q5SA 5LMNB 4DV7O 3TGUH 4HYTB 1KTMA 1FXKB 3RYCB 1THZA 2HLDG 3CC2V 1E79G 5K1PA 3BCCD 4GOFA 2Q5ZA 2HKOA 3VTPC 2KLVA 1JX9A 2N9BA 4TV8A 1ZV8A 2Z5UA 1OCCC 2LR2A 3M91A 3HR0A 2DYSB 2YKQA 1S1CX 3EQ2A 5JQGA 4AHCA 1SQQK 4UV9A 4TSFG 2XNDG 2KUBA 4O4LA 4UCVA 4UVCA 1SQXJ 3OTFA 4NVPA 1RM1B 3RYFA 1KC8W 2WAMA 2YIUC 3JATA 3VYIA 1FU1A 3AE5C 4P9PA 3CXHI 2WT7A 4GODA 5EYPA 5AW2B 1FXKC 4QJFB 4UXNA 1YIJP 3ABMB 3K0DA 3LDDA 2N04A 4XA4A 2UXCO 5KLVH 3AEDC 1GZLA 3LIDA 3M9BA 1YJ9V 4MW3A 4LLHA 1Q86W 1TUBA 2XT9A 2Q0OC 5B1OA 3AEFC 1URQA 4GKJB 1JFFA 2OYHB 2ZIMA 5LA6B 4FLUA 2QKCA 1N73B 4PD4D 1X4TA 2WMMA 2NR5A 4NPFX 1AV1A 1ZLZA 1MFTA 1RM1C 3N2GA 4EI2A 1L0LK 3CB2A 5GONA 2O1KA 1RE3C 4NB5A 4ASUG 4YJ2B 1FZEA 3OM3B 2W6JH 3QO7A 3SYCA 1KMIZ 5FLXN 1N36O 1N32O 3T1HO 1H0TA 1EZVD 1RF0A 3CCMP 2HHHB 5D5PA 2P22C 3FYIB 3L9DA 3ABTA 5J2TB 2PZSA 1IK9A 5IWAO 4KL1A 3OEHG 4OPAA 4CBCA 2ITCC 1PGJA 1Q82Q 1S2EA 1Q82W 2OYHC 3LNNA 2R72A 1ROPA 1NR1A 1SQPJ 2VRZA 1WB7A 5LXTB 2O01N 1XREA 3UKMA 4B08A 3FGAD 4KP4A 1XBLA 1M56B 2B1GA 1CXZB 2Y9ZA 4MN4C 1MG1A 1SQXD 2HJDA 1RSOB 5JJNB 2EIMB 5AW4B 3HE4B 3A0BZ 3OT7A 4I50B 4MVQA 3OTOO 1P84E 2QM4A 4LF4B 3ZMTA 1S77D 1TU3F 5L8RJ 3SR2C 5IYZB 2IJJA 1KFMA 1WRGA 2OT5A 1I08A 1BGYE 4XBFA 4O2AA 1KILD 3H01A 3Q3DA 3WU2Z 3N7NA 3E86A 5JCOA 2E3CA 4TQFA 3RK2B 4JTAB 1PNMA 5LBQA 3PTZA 2GBOA 2QA4V 4HZ3A 4DV5B 4KT0J 3L73G 4LF7B 4GLXA 4K3AA 5LMUO 1M56C 1JB0J 3JD3A 4WB4A 1LTAC 2PF4E 1ZLLA 1AVOA 2L6LA 3CPWU 4QE9A 2P06A 1L0NE 1M1JA 2IH1C 5GTHZ 5IJ0B 2EIMC 1G1XB 1SVFA 4I4TA 2ZR2A 4YXWH 1VL2A 1TA8A 1R6NA 4A7PA 4R50A 1P7GA 3M99B 4PJ0Z 4B3TB 1M57C 3CXCU 1LT9C 4WFAV 1QX8A 4HBNA 1USDA 4BW9A 4M3LA 4LFAO 3OJAB 1WA8B 3H1HG 1PNLA 1NR7A 5F2VO 4I0XA 3RK2C 2CPSA 3V2PA 1CI6B 3A2FA 1XQ8A 5KA6A 4EYYQ 3CL3D 2YIAA 1IBMB 4XDJA 2XNXA 2QWPB 2V1DA 3CC7V 3AECC 4LGDE 1KZUB 4GT1A 2P1JA 1NWQA 2H88C 2A06E 5M1BA 3T1YB 1R3KC 5BVZA 1FJGO 2QR4A 3SYOA 1RH5B 5APXA 5KX5B 2HVKC 3L71J 2BCCG 5AVSB 3USSA 4X62B 3AK2A 2WLIB 1AQTA 1SQBJ 3ZHUA 2WZ7A 2WVRA 3V2QA 4HB1A 2QGNA 2N1TA 3HKBB 2JR8A 1U97A 4FLXA 1BCCG 4I2LC 2LGWA 3U10A 3JASA 1SQPK 1OXZA 2YDEA 4MVMA 3QNEA 1RP3B 4JF3A 4CS3A 3ZJZA 1P84H 1RY3A 1F51A 3ZRWB 2ZKOA 2IJHA 3PN1A 1GDTA 5EZYA 1S72P 3H1IG 2P10A 2M5AA 4MSWC 1H88A 4YIOA 1BGYH 2FYUE 1R6KA 5FPOA 3BPZA 1NVPB 1V55B 1SQVJ 1GN6A 1WPBA 2V7QH 4GX5A 1D5AA 1R8EA 1IFNA 5L3EA 3KXDA 1COWG 1XOUA 3H1LH 2K1EA 1GMJA 5KUKA 2LO1A 2CTPA 2WA4A 2DMXA 1G2CB 1L0NH 2HEPA 3KZIE 3CI9A 2K9PA 3IFXA 1NTZG 1B04A 1FZFA 3TGUG 3P32A 1HH0A 4H44D 1VF6A 2QSAA 3P7KA 4OXSA 3L74G 1JR9A 2PAJA 4CC6A 2V4DA 3HD7C 3L71G 1VQMP 2AZ0A 2HP8A 2AZ2A 3RYIA 1V55C 1AR4A 3C90A 2K9JB 2JDIH 4W4LA 3VQXA 4C7NA 2E75D 2YUAA 4H37A 3MTUE 3E89A 2HFEC 2QM8A 3OW2U 1QQCA 3AE7C 4F6RA 2G8YA 3W7UA 1QLNA 1N7LA 2XAGA 2UUAB 2CTWA 3A0HZ 1R73A 1N2DC 1MA1A 2QWRB 1B06A 1OZHA 3O65A 1BHAA 1FJPA 3FX7A 5B66E 1S5JA 2DQ3A 3OMIB 3VBBA 1LP1A 4U3FJ 2E5TA 3T4ZA 4MVUA 1N33B 1ZR2A 1S5HC 1OV9A 4JYCA 1ZR4A 1SQBK 1NU1G 3OFNG 4K8XA 3L37A 1YEWA 4FK5C 2YIBD 1J5EO 3KDPB 1MNGA 3ZMUA 5L3CA 2CK3H 2Q6QA 4FIPC 4OGQB 5BU5A 1OHHG 1VMGA 1J1EB 1F4NA 3TXSA 5APQA 2YEVA 5HFMA 4LF8B 1GN2A 3I56V 3TETA 1PP9E 4NXNO 3CCRP 2H94A 1EDJA 4D6TD 1WB8A 4ZOLA 4W4KA 2DWEC 2IH3C 1KV4A 2W6JG 1M4UA 4LF9O 3O9OA 4J41A 1YTZT 2JEUA 1BQZA 2NPSB 1SQVK 2QJ1A 1R3LC 2ZE7A 4LCUC 2G3AA 1KILA 3SPHA 2FYNB 4RWUA 2UXCB 5IYBO 4GZRB 5LYJA 3BASA 2E5YA 1R3JC 3I56P 3KZIH 1NU1K 2PI5A 2RMZA 4MT8A 4OGQC 4WBNB 4WFFA 1EC5A 4DV0B 4OH8B 3BCCE 1OVRA 3OGIB 4JGSA 4BWAA 3RFRA 1ZW0A 2JRIA 4X64O 2AGAA 2KLUA 1JCDA 3ZHVA 5KJ7D 3MUDA 2JJ2G 3ASNC 5IT9N 2NPSC 3Q5RA 1N36B 1N32B 4O2BB 1BMFG 3E8HA 2CH7A 1LT1A 3PLNA 3I55P 3G4SP 3O6QB 2FYNC 4PV1B 4J10A 3FWNA 1PPJE 3EFGA 1W5CE 1IK7A 4J80A 2JGUA 1AA0A 3TSIA 4DV1B 1IURA 3IC7A 2Q9IA 1AJPA 4U7OA 3SWKA 4JZ2A 1OX3A 3C3SA 2QEXP 4PA7A 3SFEC 2K3RA 1NZ6A 2W83C 5E79E 1YQ3C 4IGGA 1I94O 1L0LE 1XUQA 5LL6Y 4JZGA 5FL7G 3VOPA 2B9BA 3UM7A 5H6QA 4JI4B 5GTIH 4YXWG 4EOTA 2CTRA 3RN4A 1XNQB 1OJHA 3VOUA 3G67A 1N0JA 1Y6XA 1FFTB 2IBZD 3OTOB 2HYNA 3ETGA 4GCZA 1PP9H 4FFBB 4PV1C 5TISZ 4X1YA 2ZVOB 3HE5A 3FB5C 2CAZC 4ZHQB 3AK1A 5FNVA 1ZL8A 2EX3A 2Q3IA 3BRVB 1FDOA 3HKCB 2JWAA 2XV5A 4WY4B 1A02F 2ZXXA 1S5LX 4CS2A 1KQLA 1W0KG 2IJIA 1EZVE 2IU0A 1SFCB 1GAXA 4TUYB 4CH4A 1YTZI 1FFXA 1Q90D 1RF1B 4PI0A 5KLIB 1DK1A 4DV6O 4DT0A 5LGUA 1I0HA 1FZGA 3E2EA 5AVWB 3L75D 3J80N 2UXXA 3T97A 3D36A 4UCUA 4DUZO 2KZIA 5BMVA 1NKZB 3BCCH 2EZPA 2Q67A 1QLEB 4Y28J 1NHLA 5CCGC 2WSFH 4LFAB 3LW5J 1P84D 5LHHA 1SQXE 1OZ0A
chains in the Genus database with same CATH topology
4YXDC 4H0LC 2NZ2A 2G3AA 1DD3A 3GMAA 3S9OA 1KMIZ 2D2CC 1RQUA 2E75C 1U57A 2BEZF 2J5UA 1KILE 3AEGC 4OGQC 3RL0g 3AE4C 2P10A 2ZT9C 3GLMA 2V7QJ 2O01J 2QIWA 2K9YA 3C8VA 3AE6C 2E76C 4I7ZC 1R8EA 4R4LA 2MKVA 2WPVB 3Q1MA 1OW7A 1KQGB 3T97B 3FGAD 1GMJA 3AE9C 1VF5C 1OMIA 3Q5RA 2JP3A 3AEBC 3GF3A 4RKUJ 2E74B 2E74D 4XFJA 2FYNC 4H13B 4H13D 1ZMEC 4PV1B 3EWKA 4PV1D 5KLIC 1RQVA 1YQ4C 1EXJA 5KKZC 1IK7A 2OQQA 1TU3F 5L8RJ 4H44B 3B71A 4H44D 1K04A 3RK3E 1WMKA 3IN6A 2QSIA 3AEAC 2JO1A 2QJPC 3AEEC 3Q3DA 1KORA 4H0LB 1MKMA 4H0LD 3SFEC 3Q5SA 1UIXA 1DIPA 1KTMA 1YQ3C 3Q5PA 2YMKA 2D2CD 4KT0J 1DD4A 2E75B 2E75D 3AE3C 3H25A 1JB0J 3D6YA 1HJ0A 3R4YA 1OW6A 3AE7C 2G8YA 1KQFB 4OGQD 2E74C 1S1CX 2WQYC 2IDBA 2FXPA 1PV3A 4R4MA 4PV1C 1ZOYC 3SFDC 1VL2A 1Y9BA 3O6QA 4H44C 3GF7A 3ABVC 2YIUC 1FDOA 3D70A 3D71A 1VF5B 1VF5D 2QJYC 1NGMB 4Z1MH 2QJKC 3AE5C 1S5LX 4U7JA 1NYHA 2D2CB 1Q90D 3AE1C 1PIXA 3G9RA 1EXIA 3AEDC 3Q2YA 2WSCJ 3AECC 3D6ZA 1AJYA 4OGQB 4YTPC 4GDOA 1HF9A 2ZT9B 2ZT9D 2BEQD 2H88C 4H13C 3AEFC 1OW8A 2WSFJ 1ZRTE 3AE8C 4IL6X 5M1BA 1K05A 1ZP0C 2FBWC 2WSEJ 4Y28J 1PL5A 2E76B 4I7ZB 1FDIA 2E76D 3AE2C 2H89C 4TT3H 3LW5J 3IAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L X;  4KT0 J;  2D2C B;  2E75 B;  1Q90 D;  1JB0 J;  4RKU J;  2E74 B;  2FYN C;  4H13 B;  2WSC J;  4OGQ B;  4PV1 B;  5KLI C;  2ZT9 B;  5KKZ C;  2WSF J;  1ZRT E;  4IL6 X;  5L8R J;  4H44 B;  2O01 J;  2WSE J;  2QSI A;  4Y28 J;  2QIW A;  2E76 B;  4I7Z B;  2K9Y A;  2QJP C;  3C8V A;  2YIU C;  4H0L B;  3LW5 J;  1VF5 B;  2QJY C;  2QJK C;  2WPV B; 
#chains in the Genus database with same CATH topology
 4J9Y B;  4WY4 C;  3RYH B;  4BR6 A;  1GL2 D;  4BXL A;  4YXD C;  2AHY A;  3STL C;  3B2E E;  2OAR A;  1SFC C;  1P4R A;  4JQ0 D;  2A0L A;  1BQ0 A;  4YY3 B;  3K9A A;  1BGY G;  4IFM A;  1QGK B;  5AVV B;  4G28 B;  1KIL E;  2YXL A;  4C7U A;  3K04 A;  4QPK A;  4X20 B;  5C8Y A;  4DRX A;  1QVF O;  1FJG B;  1CW5 A;  3H1L G;  4BRY B;  1L0N D;  1QLE C;  3KCY A;  2IZ0 A;  3CD6 V;  5E79 H;  1NOH A;  3UQ8 A;  3L72 G;  4L8J A;  4PD4 F;  1OW7 A;  1KYO I;  1H2G A;  3E8B A;  3JAM N;  1VF5 C;  2GTA A;  3JAW B;  3EHB B;  3U59 A;  1F4M A;  4ZBM A;  1Y66 A;  1K4D C;  4MVR A;  4KFM A;  1VQ7 P;  2JGD A;  4EIJ A;  2ARH A;  1J1D B;  2B88 A;  3G6E V;  3AG4 C;  3SYQ A;  2KSD A;  4EB6 A;  5H2F E;  2YIB A;  3RGB A;  1WMK A;  2JEX A;  3JSL A;  2R5B A;  3G6B A;  4KHP B;  2QJK B;  4B3S B;  1YHQ V;  4UB8 E;  1VQ5 P;  4JI0 O;  2O01 H;  1EZV H;  4UCO A;  3F5W C;  2A06 D;  3K57 A;  4X1K B;  1K5Q A;  1DD4 A;  3BA9 A;  2BTQ A;  1HJ0 A;  1AJQ A;  1NVO A;  1T3J A;  4UCS A;  5KHI A;  3G6E P;  1IFJ A;  5KAF Z;  1VQL V;  2WLM A;  1IJD B;  4BIZ A;  4J7Z A;  2IDB A;  3TJT A;  5B1A C;  5IDJ A;  3AK3 A;  4JI8 B;  2Q1K A;  3JC2 2;  1BE3 D;  1IFM A;  2AXC A;  1NTM J;  5E1A C;  1K73 W;  5C39 A;  1SQX H;  2B5U A;  4RUF A;  3D70 A;  5B1B B;  1IFP A;  4I6M C;  4LR3 A;  1Y8A A;  1FBM A;  2QJK C;  4ASW A;  2FYU D;  5AW8 B;  1NTK J;  4G27 B;  2QVA A;  2IFM A;  2H3O A;  4MVZ A;  1KB9 I;  3VMA A;  1GN3 A;  2O57 A;  3K9S A;  3KG2 A;  3NXS A;  3APQ A;  4FM2 A;  4DR5 O;  5BXZ A;  1FE6 A;  2PUS A;  2C0X A;  5KJ7 A;  5EFW B;  4Y99 B;  3CJH A;  3L4F A;  4RO0 A;  3SPI A;  3ZN1 A;  4H13 C;  2FXO A;  1SS3 A;  3PP5 A;  1R1B A;  2EBO A;  1ZP0 C;  1BSN A;  5AVZ B;  1YJN V;  1SET A;  3L70 G;  1FDI A;  3MDS A;  1YI2 P;  1VQN P;  4JI2 B;  1R3I C;  2YXQ B;  1VQ4 P;  4DR2 O;  4H0L C;  1JMB A;  4N3Y B;  2M0B A;  3ZRV A;  2JS5 A;  1M1K W;  2Q7C A;  1J5E B;  2AXT E;  2R44 A;  4DR3 B;  1SQQ J;  1I7F A;  3OMA B;  1K92 A;  1I5X A;  2O3J A;  2ITA A;  1GU5 A;  4DUY O;  1YJN P;  1M57 D;  2KIK A;  2QDO A;  5L3G A;  4NXN B;  1Y74 B;  3AE4 C;  4Y99 C;  5H2F H;  1L4A B;  1U7M A;  2W27 A;  1XNR O;  1QVG U;  3KHU A;  1GU4 A;  1VQK P;  1TVK B;  2LW1 A;  2Q6A A;  1N8R W;  4OX9 O;  2H8P D;  4UB8 H;  3OEE G;  3E22 A;  3GG2 A;  2GA1 A;  1HNX O;  3VQV A;  3CX5 I;  3CS5 A;  1KQG B;  3E7K A;  3Q1M A;  1FZC C;  1LTS C;  1HNW O;  1HTL C;  1GM8 A;  1SQB E;  1YIT P;  3K58 A;  1WAZ A;  3JAR A;  1S9K D;  3V4Q A;  1Z2G A;  3UT5 B;  1FOS E;  3N2K B;  2XU6 A;  4LFC O;  4MVS A;  3RK3 E;  2HLO A;  5CA1 B;  2FTK A;  3ETE A;  1L4A C;  4JI5 O;  1SRY A;  1KOR A;  2ZIN A;  4X64 B;  1GM9 A;  1ZUQ A;  2AW9 A;  3AG2 B;  4GYC B;  1NTM K;  2KNC A;  1AJN A;  2L91 A;  3Q5P A;  2YC0 A;  3AG3 B;  4ZI7 B;  1X8Y A;  2M7W A;  4RAI A;  2RKL A;  2YO2 A;  1JJO A;  2XOK G;  2LJ2 A;  4LNU B;  4GX0 A;  4U3J B;  1OW6 A;  2BOB C;  1NTK K;  1XMQ B;  3ZN0 A;  4D6T E;  4O4I A;  3ZMZ A;  5IJ9 B;  2GUS A;  1NS1 A;  1GL2 A;  2AEJ A;  2LXC B;  1PNK A;  2W6I G;  1I5Y A;  4OPH A;  4LF5 B;  3H1K G;  4BIU A;  1SES A;  2OTL P;  1IO4 A;  1JQ0 A;  3ZIA G;  4X1I A;  3JCU Z;  3S3X A;  4EDF A;  2MK3 A;  3ABV C;  2Z4E A;  4IIJ B;  3TNU A;  3F7Y C;  4X66 B;  4O9B A;  4Z1M H;  3CPW O;  2GHY A;  3AG2 C;  4PDV A;  1YVW A;  3K3W A;  2AXT H;  2Z0A A;  3PHL A;  5LP6 B;  3H1J J;  2C2A A;  2CGO A;  2WLL A;  3BCC G;  4DOJ A;  1K9M W;  1EDK A;  2IM9 A;  3QG5 A;  1FXK A;  3D6Z A;  4IYH A;  3CWB D;  2EIJ B;  1AFO A;  1YIJ V;  2Y48 A;  4U7N A;  3WG7 C;  2ZT9 D;  5APT A;  3E83 A;  1Q8I A;  1EN5 A;  3HD7 D;  2FBW C;  2J58 A;  4TV8 B;  4JV5 B;  4IL6 Z;  2OCH A;  5CBO A;  1M5I A;  5CMU A;  3ZHR A;  1KC8 Q;  1PPJ D;  5LHI A;  3WB1 A;  1LWU B;  2XDJ A;  4AQY B;  5JQG B;  5TJH A;  2F66 C;  3LDC A;  1FOS F;  4EFB A;  1S0V A;  2HFE D;  4O4L B;  3MD0 A;  2XTA A;  1DD3 A;  2PGD A;  3CC4 P;  3SJA C;  4DV6 B;  2DJV A;  2LGQ A;  3AG1 B;  1RQU A;  3B09 A;  5LP6 C;  5H6R A;  3RYF B;  1L0L D;  1Q86 Q;  4JF7 A;  4G2K A;  1FS0 E;  2WPQ A;  2A9H A;  4L76 A;  5B5E E;  2DYS C;  4JI7 B;  2WT7 B;  1WJZ A;  2CUG A;  5EYP B;  1BZK A;  2IYP A;  4MTX A;  3GB7 C;  4HNA A;  1NI8 A;  3CCM V;  2ETN A;  4NTW A;  5KA5 A;  4DK1 A;  2A45 H;  1QU7 A;  1PGQ A;  3LDE A;  5CHX A;  1LWU C;  2YID A;  3CRC A;  1TUB B;  2P4V A;  1T2K D;  2IBZ E;  3DC6 A;  1JY2 N;  5APW A;  3L73 J;  1JFF B;  2BOC C;  2E5L B;  3GF3 A;  4DJG A;  4D6T H;  2E74 D;  3H1J G;  4UB6 E;  5CJ0 A;  3TF5 A;  1OIP A;  3PH0 A;  3ABM C;  1ZME C;  3AG1 C;  5EBM C;  3X2Q B;  5LOV B;  4TOI A;  4YJ2 A;  3N2G B;  3BAT A;  1AVM A;  3V4W A;  3A7O A;  3K59 A;  3CE2 A;  1N34 O;  1K04 A;  2W6A A;  3RBX A;  3AEA C;  3GWO A;  3CCJ V;  5DED A;  5A9G A;  1YXB A;  2YKP A;  2QJY B;  1LGH B;  3GHG B;  3U11 A;  3WUV A;  3OAA G;  5K1X A;  4FLW A;  2HJF C;  3JAL B;  1N73 C;  4YJ3 A;  5J2T A;  3H1H J;  4RQE A;  4QIW F;  3L75 E;  2DE0 X;  3R65 A;  4JYY A;  2KS1 A;  5CA0 A;  4GKK B;  1RPO A;  3CRA A;  2WLJ A;  4OGQ D;  5LXT A;  2P4K A;  5J2U A;  1YTF B;  3X2Q C;  3K5B A;  3SFD C;  3CCJ P;  2JKV A;  1UPG A;  2UXD O;  3T2M A;  1RE4 C;  5L3F A;  2UXN A;  3V2N A;  1EFR G;  2BCC J;  4JI0 B;  2QJY C;  2F95 B;  3Q4H B;  3K0G A;  3MGN A;  3OW2 O;  3GHG C;  2NPS D;  3LSQ A;  1LT9 A;  3CCL V;  4K35 A;  1XL4 A;  1GTW A;  1BCC J;  3W68 A;  2DN9 A;  4JPR A;  4I5S A;  2WLK A;  3G9R A;  2DYR B;  3LSS A;  1G8M A;  4P2Z A;  5B5E H;  2UXB O;  3FB6 C;  5CBF A;  2VS0 A;  3AE8 C;  3H1I J;  3DGE A;  2WSE J;  3G3Z A;  3B5N B;  1TAE A;  3CCL P;  2E76 B;  2ZDI A;  1S5L E;  5IJ0 A;  5IYD O;  3V5B A;  3W7S A;  1GH6 A;  1M1J B;  4DR7 B;  3CXH D;  2PY5 A;  2HVJ C;  2IBZ H;  3SDL A;  1Y76 B;  1EM1 A;  2KB1 A;  4I4T B;  5FPR A;  3FB7 C;  4J7J A;  4EKW A;  1JUN A;  2ZR3 A;  1WP8 A;  4UB6 H;  3L36 A;  3CCQ P;  3UIA A;  2HPC A;  1AR5 A;  1CP9 A;  1U57 A;  2DYR C;  2MJZ A;  2PP6 A;  3RL0 g;  5JCO C;  2BSK A;  2IW5 A;  1NTZ J;  1SQP D;  1T8Z A;  3H6P A;  4N6J A;  2EIL B;  3RL0 B;  3TGU J;  1M9N A;  4UVA A;  5EIB D;  3L74 J;  4NXM O;  1LNQ A;  3B5N C;  1S72 V;  1CPY A;  1MFZ A;  2GM4 A;  2E76 C;  3U1A A;  4XE5 B;  1NAY A;  4Q6G A;  1YSC A;  3L75 H;  4JI6 O;  1O9H A;  1M1J C;  5CCH C;  1Z5W A;  1P84 F;  1ENV A;  3IAY A;  4WCE V;  1IBK O;  4RKU J;  1BE3 E;  1GN4 A;  5BR8 O;  2FKW B;  4DUY B;  1VQO P;  2RJZ A;  3G71 V;  2L5G B;  4JI3 B;  3MIW A;  3WUT A;  1EN6 A;  2QTO A;  2N1T B;  2ZNI A;  1XNR B;  1VQP P;  4HKZ H;  3RL0 C;  2EIL C;  4OX9 B;  4WY4 D;  3RW0 A;  3ZRW A;  4CC5 A;  2WSS G;  1G1I A;  1OWA A;  4O4J A;  3HD7 A;  2KG7 B;  5EZY B;  1VQM V;  1HWT C;  3AE3 C;  1NU1 J;  3SYA A;  3R4Y A;  3G71 P;  3K5M A;  2E42 A;  2WIT A;  3CRM A;  3OE7 G;  2WQY C;  1AI6 A;  4UFZ A;  2UUC O;  2FY8 A;  2EIN B;  4B3M B;  4JI1 O;  1IBL O;  1G2C A;  1K34 A;  2YI9 A;  1S5L H;  3ZS8 C;  2RN0 A;  5ITZ A;  1VF5 D;  4YHH O;  1SA0 A;  1X59 A;  3B8M A;  2P7J A;  3M8A A;  4JAS A;  1PIX A;  2Z5I A;  4L74 A;  2N9Y B;  2PFX A;  3P3P A;  3APO A;  4KUM A;  2DW4 A;  1NKD A;  3IF4 A;  2Q69 A;  4CPG A;  3RYI B;  2XUM A;  3EFF K;  3L71 D;  3TK1 A;  3CCU P;  1SQB D;  2UU9 B;  1KYO E;  2A06 H;  1AP6 A;  2I1K A;  4IYI A;  1G4Y B;  4C7N B;  1H8H G;  2VQE O;  1XI1 A;  1EDL A;  2EIN C;  2YO3 A;  3AE2 C;  1WNS A;  3F89 A;  1NTZ K;  1DTO A;  5DN6 G;  4F6R B;  2ZD9 A;  3CCR V;  4DV2 O;  4DV7 B;  2CDY A;  1QR8 A;  1S9K E;  4D7T A;  2DQ0 A;  5KLV G;  2Q68 A;  1LR1 A;  1ZTE A;  3RK3 D;  4E4E A;  1PGO A;  1AIL A;  3DC5 A;  3LW5 H;  1Z56 A;  1BE3 H;  3SPG A;  2JVD A;  4B7K A;  2O1J A;  3DXR A;  2B87 B;  1VQ8 P;  1T5E A;  1N7S D;  1VF6 C;  3BAA A;  2JJL A;  1SQV D;  1SLQ A;  3CSX A;  3CCS P;  5IYC O;  5APY A;  1XMO O;  4JYA O;  2A45 G;  2FYU H;  1H8A A;  4GKG A;  4DR6 O;  5KAI E;  1SQF A;  3D3Q A;  1ARO P;  4DCK A;  4WFE A;  4BWN A;  2I1J A;  3FFQ A;  4UV8 A;  1ZWI C;  2P58 A;  4KHX A;  2EIK B;  3SWF A;  2LP7 A;  2YEV B;  3KQG A;  1JNM A;  1IFI A;  3TYY A;  5KLV K;  2POH A;  3QO8 A;  2N74 A;  1HNZ O;  1LTT C;  4H13 D;  4UVB A;  2NPS A;  2ZAE B;  4DYL A;  5BY1 A;  1S3J A;  4L87 A;  3I55 V;  3ZRS A;  1SQQ E;  2OQQ A;  3G4S V;  1J1E C;  1MAB G;  3FAV A;  3OD4 A;  1KB9 E;  1XTG B;  2Q7H A;  4JBZ A;  5LYJ B;  4HH2 A;  4H0L D;  1HDJ A;  1K33 A;  1H2S B;  2YXY A;  1OFC X;  1AI5 A;  3CWB E;  5JVD A;  1WP7 A;  3E8G A;  2KXP B;  2EIK C;  2GUZ A;  3M0D C;  2QEX V;  4MTO A;  2F43 G;  1MSW D;  3CCE P;  2GDS A;  1GKF A;  4GUN A;  3T1H B;  4U3F D;  3BVO A;  4DXW A;  2P5O A;  1PD3 A;  1ZSP A;  3KPE A;  1KYO H;  1Y9B A;  5IWA B;  1Y67 A;  4J11 A;  5B66 H;  3A3Y B;  4PI2 A;  2B89 A;  3O6Q A;  1HUC A;  5GW7 A;  4HYO A;  4ICG A;  2CH7 B;  4N21 A;  4LWS A;  3TCU A;  3GVM A;  2HG5 C;  3DTU B;  3FXE A;  5KHG A;  1NYH A;  2VQF O;  3J7A U;  4FLY A;  1OCO B;  2NN4 A;  5AVQ B;  5AVR B;  5CBG A;  2F4V O;  2F1M A;  5AW1 B;  1K4C C;  3HKE A;  1BGY J;  3AEI A;  3QVN A;  4RES B;  3BEH A;  4MW8 A;  5AVU B;  5CBN A;  3CX5 E;  1L4A D;  1FJK A;  2UXD B;  3OAK A;  4FZ0 A;  5KAI H;  2IBZ G;  4FFK A;  2R3C A;  3H1L J;  1FZA A;  1IZ3 A;  1UJW B;  2OIE A;  1URF A;  2B9Z A;  3SJC C;  4FFB A;  2NRG A;  3L72 J;  2QKA A;  4NKG B;  5AW7 B;  4IT5 A;  1IX9 A;  2Q73 A;  2Q4P A;  3GMA A;  3S9O A;  5LMU B;  1OCO C;  3SJQ C;  2NLJ C;  3HKC A;  3JAK A;  1FPO A;  3KCX A;  5FNV B;  1ZL8 B;  2J59 M;  4WY4 A;  2ZXW B;  5AW5 B;  2UXB B;  1FD9 A;  4Z1V A;  1K97 A;  1SQQ H;  1SFC A;  2HR3 A;  1KB9 H;  3JSV C;  1FFX B;  3KZI Z;  4RQF A;  4IHJ B;  3C8V A;  1BSH A;  2Y0D A;  1BSM A;  5JWP A;  3NMD A;  5EBW C;  3GW6 A;  1NH2 D;  1EBO A;  3CWB H;  2KYV A;  3B8E B;  3T97 B;  1OMI A;  3ICX A;  3HKD B;  3VMX A;  5BMV B;  5CJ4 A;  2JP3 A;  1JTH A;  3D8C A;  1W2B U;  1JA8 A;  5CBH A;  1H2N A;  1E79 H;  1N4C A;  3CCV P;  1QVG O;  2FXM A;  3K03 A;  4HJG H;  1RF1 C;  1VQ9 P;  4PHZ A;  3RYH A;  5KLI C;  1PPJ H;  2ZXW C;  1N86 A;  4ABM A;  5JJE B;  3F5T A;  3W7W A;  1VQ7 V;  2V7Q G;  4GKJ O;  3JSN A;  4H44 B;  3B71 A;  2GV9 A;  1KBH A;  4JAV A;  5AVY B;  3ZHQ A;  1H2L A;  1T3U A;  2XND H;  5AW0 B;  1DF5 A;  5L3B A;  1JJ2 U;  5L3D A;  3ZX6 A;  2OYI B;  4X20 A;  4D7S A;  1XHZ A;  1VEW A;  2ATK C;  1L0L H;  2OGU A;  2YXH A;  1QNM A;  4X89 A;  1L0N G;  4OWF A;  4BIO A;  1J95 A;  2E75 B;  4DRX B;  4IFF A;  3JD1 A;  3H25 A;  1VQ5 V;  4TLF A;  1HJB A;  2XAF A;  1NO4 A;  5A2Q N;  2OTJ P;  1ZN5 A;  5BR8 B;  3OGC C;  4E2L A;  2UWJ E;  2NNU A;  2H7H A;  3PJS K;  5J9P C;  1SF9 A;  3WUU A;  1DGS A;  2HHH O;  1RHZ B;  3CX5 H;  3B40 A;  1KD1 W;  5GTI Z;  3U0Z A;  3CXH E;  1RPR A;  1H2K A;  3LSU A;  1N7S A;  2ZYD A;  2W8Z A;  4H44 C;  4F6E A;  2JDI G;  1S76 D;  3L70 J;  2B1I A;  2JGD B;  2X6C A;  1EZJ A;  3VQW A;  1LTI C;  4WBA A;  2OYI C;  2HOD B;  4EB6 B;  2QE7 H;  2K37 A;  1QHT A;  4N23 A;  1SQP E;  2A06 G;  1KQS O;  1L0N K;  2QWO B;  4C46 A;  4R6Z A;  4DW1 A;  1B6Q A;  3B8N A;  3IJ4 A;  4FLZ A;  3DSQ A;  1J2J B;  3QH9 A;  2ODM A;  1GTO A;  4LP8 A;  1J1D C;  3ABK B;  4I9W A;  1LTJ A;  4JI1 B;  3K08 A;  5APU A;  1JPX A;  5KHK A;  2ZE5 A;  1PL5 A;  2BTQ B;  3ETD A;  1K73 Q;  1AI4 A;  4YIP A;  1SZT A;  4YHH B;  2KB7 P;  3S3W A;  5C93 A;  2CK3 G;  1NJI W;  2MW2 B;  4DV5 O;  1L1F A;  4LF7 O;  1YI2 V;  2ADP A;  2BCC E;  1YF2 A;  1VQN V;  1M93 A;  1QR9 A;  5IE9 A;  1GMG A;  1VQ4 V;  2FYU G;  2XKM A;  2AEM A;  2FFD B;  4I55 B;  4O4H A;  4K0K O;  1K3E A;  1JM0 A;  3MP7 B;  1MUU A;  2VQE B;  1L8D A;  3ABK C;  1W59 A;  3M0A A;  3MZW B;  5LHG A;  5K5G B;  4DV2 B;  3S4R A;  4RJT A;  1Q6H A;  3H1I E;  3KYQ A;  2ZNJ A;  1ZAU A;  1VQK V;  1JCH A;  3CJH B;  5B1B C;  1M1K Q;  1M56 D;  1XL6 A;  3MHS C;  3CXH F;  4WF9 V;  1IBM O;  4JAU A;  3BHP A;  4NTY A;  5E79 Z;  1FZC A;  2AHZ A;  3HTK B;  1AB3 A;  3HUS A;  3EWK A;  1B3Q A;  2XAH A;  1YIT V;  3CYO A;  2FFD C;  4TV9 A;  3WB0 A;  4BW5 A;  1XMO B;  2RQ6 A;  4JYA B;  2R5D A;  2ZFC A;  3CXH H;  3T1Y O;  3H1K J;  1JMK C;  4CZZ A;  5B3S B;  3IN6 A;  2Y69 B;  1GD2 E;  5KMG A;  1N8R Q;  1JO5 A;  1HVV A;  4X62 O;  2R9A A;  2Y0I A;  4LF9 B;  3RK2 D;  3TGU E;  1Y74 A;  1KYO D;  1JY3 N;  3L74 E;  1L4A A;  3M06 A;  1A02 J;  2LQT A;  4W7Z A;  1TGO A;  2DW3 A;  3A0B E;  3L71 E;  1AR1 B;  1DEB A;  4GIF A;  1SQP H;  1VPC A;  1HNZ B;  1HBW A;  3BCC J;  1NTM D;  3RVZ A;  2ZQM A;  3E22 B;  3FYE B;  3FWL A;  2ZIO A;  4W7Y A;  3WU2 E;  3QTC A;  3OA7 A;  2WPD G;  2ADQ B;  1NTK D;  4PA4 A;  5B3S C;  5DM6 V;  2Y69 C;  4PD4 I;  2YI8 A;  3UT5 A;  3IC9 A;  3L35 A;  3N2K A;  2OTL V;  1FAF A;  1GK4 A;  4I1L A;  1LUV A;  2BCC H;  3K06 A;  3MAQ A;  2LFR A;  5GTH E;  1G6U A;  1SQV E;  2FL4 A;  2KQX A;  4EEQ A;  1PP9 G;  2LKM A;  4PJ0 E;  1IZN B;  2WSC J;  3ABU A;  5JH7 A;  1KKD A;  1NU1 E;  4XDL A;  5AG2 A;  1JY2 O;  1QL2 A;  4LNU A;  3B4S A;  4NPE A;  2OCC B;  2Y9Y A;  3TDK A;  5IJ9 A;  1SER A;  2G38 A;  5EC1 C;  1SQQ D;  4DR1 O;  5CB4 B;  3A2A A;  2GTS A;  1I94 B;  1GL2 B;  1OCC B;  1KB9 D;  2Q8V A;  1E1R G;  3AG3 C;  3ZED A;  4DR4 O;  1R5S A;  2K1A A;  2YMY A;  3FXD A;  4IIJ A;  1K9M Q;  4X1I B;  5H9C A;  2OTK E;  4PEL A;  5KKZ B;  3RYC A;  3CC4 V;  2ZJS E;  3TNU B;  3H32 B;  4N78 E;  1YJW V;  2WA3 A;  1Q81 W;  2O01 J;  3V6I A;  2QIW A;  5KUM A;  5APV A;  1KU9 A;  1NVP D;  1N33 O;  2WLL B;  2FML A;  1IXB A;  2IZ1 A;  3II6 A;  1ZRT D;  1MV8 A;  4B7E A;  3L74 H;  5H2F Z;  4U3F E;  4A5U B;  3AE9 C;  1IXM A;  3A0B H;  3L71 H;  3M9Q A;  4KJM A;  1LTB C;  2PYJ A;  1PPJ G;  1GL2 C;  4AIL C;  1SQB H;  2FYZ A;  5CMZ A;  2CTQ A;  2PYL A;  3CHX A;  3K5N A;  4UB8 Z;  1LWU A;  3GWK C;  1RE3 A;  1SS1 A;  3W7T A;  1PL4 A;  1YJW P;  4MS2 A;  1GK9 A;  3WU2 H;  1RQV A;  4LF8 O;  5KKZ C;  4GX2 A;  4DUZ B;  3ZCC A;  3JAT B;  2QRX A;  2EIJ C;  1Y4M A;  1IC2 A;  4TWK A;  1UFI A;  4PA3 A;  1L0L G;  3WB2 A;  3CC2 P;  2WPS A;  1T6A A;  1D7M A;  1GRJ A;  1MKM A;  1DIP A;  3CX5 D;  3A0R A;  5GTH H;  2YMK A;  1BT8 A;  4DK0 A;  1SQV H;  2OYH A;  5LA6 A;  1RFY A;  4I9Q A;  1URQ B;  4H33 A;  3BFR A;  3SSU A;  1YDX A;  1L2P A;  4HNA B;  4PJ0 H;  1N73 A;  5AVX B;  4AQR D;  3PRJ A;  3SWY A;  2WWW A;  1NU1 H;  3V2R A;  3D3I A;  1PV3 A;  3MHH C;  5GON B;  1JMM A;  3K5O A;  2ZXE B;  4CH6 A;  2FKX A;  4DV0 O;  3H9V A;  1LJ2 A;  3ETQ A;  4FLT A;  1EZV G;  2YIC A;  1E5W A;  5KTB A;  5LOV A;  1FDM A;  4DV3 O;  5CA3 A;  1SP4 A;  1AVY A;  2QE7 G;  3HPL C;  3H1J D;  1RE4 A;  1H0T B;  5CN0 A;  5EC2 C;  4U7J A;  1YJ9 P;  3F7V C;  1USE A;  2D2C B;  3A0H E;  4P30 A;  4LH7 A;  3C3T A;  2BTO A;  3ZRX A;  4B3R O;  2KP8 A;  3GHG A;  1URQ C;  2M3E A;  3JAL A;  4YTP C;  3VP9 A;  1WLE A;  4PA6 A;  4CS4 A;  2AXT Z;  4YJ3 B;  1OW8 A;  1SQX G;  3LNM B;  4IL6 X;  4DV1 O;  1V54 B;  1KFN A;  1X0T A;  2KS1 B;  5CA0 B;  1RSO A;  4MVO A;  4LC1 A;  1MZ9 A;  2VRS A;  1VP7 A;  3R2P A;  3HE4 A;  4R7C A;  4I50 A;  1FXH A;  5J2U B;  2A3Q A;  2RCV A;  4U3F H;  2CPB A;  1SC5 B;  1UII A;  3THO A;  4JTD B;  1MZF A;  5IYZ A;  1RF0 C;  1JOY A;  4JI4 O;  2D2C C;  1XNQ O;  3Q4H A;  1Q7Y Q;  3QWO C;  4O2A B;  2QWQ B;  1PV0 A;  1Q7Y W;  2J5U A;  1XHX A;  1M57 B;  2PI4 A;  1LT9 B;  3CCQ V;  2V4H A;  1Q6U A;  1VDF A;  2QJP B;  3JD0 A;  1QCE A;  1V54 C;  2P67 A;  1SQX K;  3C9I A;  3ZMS A;  4GX1 A;  2HG5 D;  3L73 D;  1KKC A;  2P7T C;  3P8M C;  4R4L A;  2M3B A;  2MKV A;  3VN0 A;  1XIL A;  4DV4 O;  1DX7 A;  3H1L E;  1F23 A;  1XEQ A;  1PZQ A;  3B5N A;  2LW7 A;  3E35 A;  2RH0 A;  3AEB C;  3WFV A;  2UUB O;  2KOG A;  4DR5 B;  3EVK A;  3L72 E;  1M90 Q;  1FXV A;  5CCH A;  1WA8 A;  1M90 W;  4PV1 D;  1Y76 A;  4K0K B;  1BHB A;  2VWK A;  1CI6 A;  2H43 A;  2OIG A;  4QPJ A;  1HW7 A;  3ZMV A;  1VF7 A;  2P90 A;  4I0X B;  2AEF A;  2KK7 A;  2QSI A;  3H1H D;  1VQO V;  1NT2 B;  4CH5 A;  2QJP C;  2QA4 P;  2HPC B;  1EN4 A;  1NQT A;  1SQP G;  3P8C D;  2H8P C;  1VQP V;  1JCC A;  1PM9 A;  3ZHS A;  3A0H H;  2FB5 A;  4DR2 B;  1EQ7 A;  4LH6 A;  2BSK B;  5KX5 A;  4BAY A;  5BZB A;  2WLI A;  4YY3 O;  1KQF B;  3VP8 A;  2A45 I;  3IGA C;  1NH4 A;  3FB8 C;  1JEK A;  2ZDI C;  3HKB A;  4FMT A;  1BS3 A;  2BCC D;  4RUE A;  5CCG D;  1R6T A;  4XDK A;  5AW3 B;  5IY5 B;  3JAS B;  1BCC D;  2XAJ A;  3MHV A;  2Q7G A;  2JJ1 G;  5DEC A;  1HNX B;  3CC7 P;  3QO5 A;  5EBL C;  5KLV J;  1HNW B;  1CZQ A;  1WN7 A;  2W6B A;  2ILM A;  1SFC D;  1KEC A;  3BRT B;  3STZ C;  4DO2 A;  2M5A B;  1Q5O A;  1FAV A;  5TIS E;  3H1I D;  5BU8 B;  4GDO A;  2KG7 A;  2ZT9 B;  2BEQ D;  3E1R A;  1ZX3 A;  1DLB A;  4O4J B;  4LFC B;  3HD7 B;  4Z1M G;  5LGN A;  3TXQ A;  4L75 A;  4WWI A;  1BDC A;  1QLE D;  2N1T C;  2KKW A;  3W7X A;  4JI5 B;  5IY5 C;  3OR6 C;  4NTX A;  5B5E Z;  3CCU V;  1PKX A;  4KHP O;  4B3S O;  1CSB A;  4TT3 H;  3VMZ A;  3SPC A;  3NFQ A;  2ZCE A;  1IFD A;  1YBK A;  4D6T J;  1PGP A;  3L70 E;  1DH3 A;  2NZ2 A;  2Z5H A;  1HR0 O;  2ZM6 O;  1H38 A;  3L72 H;  2W0X A;  1NTZ D;  2YSU B;  2BEZ F;  3TGU D;  3L74 D;  3FKS G;  5ITZ B;  2K9J A;  1US6 A;  4JI8 O;  2IX7 C;  1SA0 B;  1VQ8 V;  4NYK A;  2OYO A;  2ZT9 C;  3GLM A;  4UB6 Z;  5AW6 B;  2XAQ A;  1X79 B;  3UO3 A;  3CCS V;  1SQB G;  1JVM A;  4DR1 B;  1Q2N A;  1NTM E;  1K8A Q;  4LFB O;  1NBM G;  1K8A W;  1D5N A;  1H2M A;  4DR4 B;  4ZKP A;  1G1J A;  2E74 B;  1QL1 A;  2ZE6 A;  1LP1 B;  2EZO A;  4UCT A;  3BVH A;  2C9N Y;  1NTK E;  2RMK B;  5KHH A;  2IBZ I;  2Z3Y A;  1YQ4 C;  4X88 A;  1MOF A;  1IVS A;  4LBE C;  1XDC A;  2B87 A;  2JS3 A;  1ORQ C;  5KLV D;  1SQV G;  3DXR B;  2PTM A;  2PRR A;  1NU1 D;  1W2B O;  4JI2 O;  1UIX A;  2KSJ A;  4D6T G;  3CME V;  1OVU A;  3ABL B;  3K5L A;  3A8T A;  5GTI E;  2JEE A;  1DEE G;  5TIS H;  2M6Y A;  2N05 A;  4DR3 O;  1T2K C;  4ZOL B;  3CLQ A;  2R9I A;  2E74 C;  4AYC A;  1MSD A;  3M0D A;  4X65 O;  3WMM 0;  1PL0 A;  4FVM A;  3CCE V;  1ZOY C;  1BL8 A;  4B86 A;  2YS8 A;  1Q6I A;  3CME P;  1KIL B;  3GF7 A;  3ASN B;  1NGM B;  1P84 I;  3H1K E;  1JY3 P;  4N78 D;  3JYC A;  2XAS A;  4WBN A;  3L70 H;  3QF7 A;  2XHB A;  1R5L A;  5KAF E;  2M8R A;  3RBZ A;  1S5L Z;  4AUW A;  1KYO F;  4NPD A;  3ABL C;  3FAV B;  1GW4 A;  1XTC C;  1N0N A;  1AJY A;  1OCZ B;  1Q3E A;  2QG4 A;  5EK0 A;  1EDI A;  1VQ6 V;  3OMN B;  3SYP A;  1ZRT E;  5JVD B;  1K05 A;  1N34 B;  4ZNC A;  4U3F G;  4O2B A;  3W67 A;  2GUZ B;  4MTG A;  2CGN A;  2X6A A;  3L75 J;  4DV3 B;  4I7Z B;  4JYB A;  4FJC C;  3AG7 A;  1YZB A;  3SGI A;  2H89 C;  5AVT B;  2Y0E A;  1KN7 A;  1KIL C;  1NTM H;  4WFG A;  2IYO A;  2F93 B;  2Y0C A;  4LF6 O;  1FS0 G;  4K8Z A;  3ZDM A;  4B3R B;  1VQ6 P;  1QBZ A;  1XMQ O;  4P9O A;  1NTK H;  4LWS B;  2JWD A;  4JAA A;  2QTS A;  1OCZ C;  3I5D A;  4LF5 O;  4PA9 A;  4NR1 A;  3OUS A;  2V7Q J;  2L35 A;  3CMA V;  1BDD A;  1HGV A;  4FZ1 A;  5KHJ A;  3MUD C;  2Y4T A;  5B1N A;  2K9Y A;  2DWD C;  1AI7 A;  3UCS C;  4R8C A;  4I7Z C;  4WVZ A;  3HKE B;  4X66 O;  1YCI A;  5LMN O;  2SPZ A;  2XZR A;  2JK5 C;  4L73 A;  5CCG A;  1L0N J;  1K7D A;  3JD4 A;  4RO2 A;  4ZHQ A;  1K5S A;  4X1Y B;  1AQ5 A;  3HE5 B;  1KB9 F;  1U96 A;  3N4X A;  4PD4 E;  4CH3 A;  4X9Q A;  3CMA P;  1EXJ A;  3HRN A;  3CCV V;  4TUY A;  3H1J E;  1RF1 A;  3KKY A;  1VQ9 V;  1GK6 A;  2Q9L A;  4JV5 O;  3L75 G;  2EJR A;  1FC2 C;  5EIB C;  3JAK B;  3H1K H;  2Y4U A;  4AQY O;  1SKV A;  3RT3 C;  4DV4 B;  5KAF H;  2ITD C;  2IU3 A;  3E1I A;  4C7R A;  1WPX A;  4IHJ A;  2UUB B;  2W90 A;  3NTN A;  4X8A A;  3D6Y A;  2ZVN B;  2IPP A;  3M7M X;  3HKD A;  4JI7 O;  1AP5 A;  2OTJ V;  2LFS A;  1HWY A;  1JTH B;  4NXM B;  4ZMD A;  3HB3 B;  3F5H A;  3ITK A;  2KSE A;  3D71 A;  1VF5 B;  3ZBH A;  1BE3 J;  3OUF A;  5LGT A;  2P2U A;  3C1L A;  4DW0 A;  3IFM A;  2ZYA A;  4JI6 B;  4UUJ C;  1BGY D;  5B66 Z;  1MMM A;  3T4D A;  1JY2 P;  3CX5 F;  5C8Y B;  2Q5U A;  2E5L O;  1IBK B;  3D36 C;  4BRY A;  3FX0 A;  1EXI A;  3BAB A;  1CEZ A;  2EJ7 A;  2OYI A;  3Q2Y A;  2FYU J;  3AG4 B;  3H1L D;  1O9G A;  3JCU E;  5AW9 B;  1KD1 Q;  3JCZ A;  4TT3 G;  1WT6 A;  3L73 E;  3JAW A;  2CE4 A;  2DOS A;  3UO2 A;  2WSC H;  1H8E G;  1KP2 A;  3L72 D;  3SPJ A;  4PDL A;  1IDS A;  2OYQ A;  4YPC A;  4MTF A;  3CEI A;  5HFL A;  1P49 A;  2R70 A;  2KZJ A;  2W0F C;  3IAO A;  2D3O W;  1P7B A;  2EUL A;  3O8Z A;  3RK3 B;  5KAI Z;  1FKA O;  1Q43 A;  4GKK O;  2Q3E A;  1N7S B;  2F23 A;  2RDC A;  5B1A B;  2E75 C;  4PD4 H;  3H1H E;  4JPZ B;  4IL6 E;  1JY3 O;  3AEG C;  1MZE A;  2A7W A;  2HOD A;  3H1J H;  4X1K A;  2I8D A;  2UUC B;  3T1C A;  3ML0 A;  4LF4 O;  1HP8 A;  5JJJ B;  3P8C E;  3CD6 P;  3EXA A;  1IBL B;  2ZE8 A;  2GUV A;  3E8F A;  1FZB A;  3CRR A;  3P3N A;  1SQG A;  1BE3 G;  4DZO A;  3N27 A;  1VAR A;  2WPV B;  1NJI Q;  1D2D A;  2IJK A;  2RNB A;  2X0L A;  1URQ D;  4HAM A;  4JTC B;  2ZM6 B;  1HR0 B;  3RK3 C;  1LTJ B;  3LUT B;  2Q0A A;  1X9V A;  4XFJ A;  3J81 N;  2BAS A;  4H13 B;  1N7S C;  1KP3 A;  1BCC E;  2YNY A;  3CP1 A;  1TUE B;  2PGG A;  5DJT B;  3BA8 A;  4F4L A;  1YHQ P;  2P6J A;  1Z5V A;  4KXR A;  1QEX A;  3IR9 A;  2E43 A;  4Q20 A;  4B3T O;  1PFI A;  1W2E A;  1ZXG A;  3LIE A;  3OR7 C;  2JO1 A;  4PDR A;  2FFD A;  3BY6 A;  1V9P A;  4I55 A;  4H0L B;  2C9L Y;  2YXR B;  2GSM B;  2WLH A;  5D5Q A;  4DR7 O;  4LFB B;  4O4H B;  2D2C D;  1VQL P;  1LTJ C;  1PP9 J;  4Z2W A;  3JCU H;  3L73 H;  2FXP A;  3L70 D;  1YTF D;  4FLV A;  4R4M A;  1NAF A;  1HGZ A;  5DJU B;  2FYU K;  2R9R B;  1DF4 A;  4W80 A;  4DR6 B;  4J7K A;  4ZKU A;  3HTK A;  1OCR B;  1GW3 A;  3M9H A;  3R66 A;  1FZC B;  2RN9 A;  2YKO A;  4PDM A;  2BE3 A;  1M7L A;  1NTZ E;  1SZX A;  3HUS B;  1S4X A;  5H5N A;  4QE7 A;  4AI8 A;  4TV9 B;  4J42 A;  3RGU A;  5KJ7 C;  4EFE A;  1TVK A;  1VIB A;  3AE1 C;  4IOI H;  1OVV A;  3H1H H;  5KMG B;  3P30 A;  4IL6 H;  3VMY A;  1LUW A;  4X65 B;  2IFN A;  2WTY A;  4TQD A;  3G80 A;  4JI3 O;  1HF9 A;  2QM7 A;  2WSF J;  2ZYG A;  1A32 A;  3A5T A;  1NTM G;  1FYJ A;  4WFB V;  3B77 A;  3JD2 A;  3CWB J;  3B5N D;  3U1C A;  2E76 D;  3JAR B;  4ASV A;  1U7J A;  1OCR C;  4QGP A;  1E1Q G;  3ASO B;  4GOE A;  5CCH D;  1QVF U;  1NTK G;  3HUS C;  5CA1 A;  4FM1 A;  5KLV E;  1BCC H;  3NR7 A;  1EZV I;  4ZI7 A;  2QWN B;  1LTG C;  3RWR D;  4FM0 A;  2KNC B;  2OWO A;  1KUQ A;  3CRQ A;  1YYC A;  1W0J G;  2C0W A;  4ZIB A;  3RL0 D;  4B3M O;  2JIZ G;  4WFH A;  4U3J A;  1L0L J;  1H89 A;  4ZKI A;  3RVY A;  3BRC A;  3AE6 C;  3ZHT A;  2KI7 B;  3H1I H;  1PP9 D;  1F7Y A;  4O4I B;  5JH7 B;  1NH2 B;  1M8O B;  2K88 A;  2WSE H;  2A79 B;  2Q7E A;  4IFD K;  3ASO C;  4LF6 B;  2VWJ A;  2VQF B;  4QMA A;  3S1K A;  1Y47 A;  2R32 A;  4OVN F;  2WSS H;  1SQQ G;  2LXB A;  4FPP A;  3K79 A;  1JOC A;  3H1K D;  3WG7 B;  2F4V B;  2X6B A;  5CB4 A;  2WLN A;  4J9Z B;  4QNH B;  1GO3 F;  2UUA O;  1GM7 A;  2R3S A;  3SJB C;  1NKN A;  2UU9 O;  2N1T D;  1KQS U;  1Q81 Q;  4UCR A;  2X7R B;  3VQY A;  5LP6 A;  2WPR A;  3CWB G;  5APS A;  1X22 A;  2YIU B;  2QKS A;  3FD9 A;  2Y0P A;  3I5C A;  3AEE C;  2OCC C;  1NTZ H;  3H32 A;  3Q5S A;  5LMN B;  4DV7 O;  3TGU H;  4HYT B;  1KTM A;  1FXK B;  3RYC B;  1THZ A;  2HLD G;  3CC2 V;  1E79 G;  5K1P A;  3BCC D;  4GOF A;  2Q5Z A;  2HKO A;  3VTP C;  2KLV A;  1JX9 A;  2N9B A;  4TV8 A;  1ZV8 A;  2Z5U A;  1OCC C;  2LR2 A;  3M91 A;  3HR0 A;  2DYS B;  2YKQ A;  1S1C X;  3EQ2 A;  5JQG A;  4AHC A;  1SQQ K;  4UV9 A;  4TSF G;  2XND G;  2KUB A;  4O4L A;  4UCV A;  4UVC A;  1SQX J;  3OTF A;  4NVP A;  1RM1 B;  3RYF A;  1KC8 W;  2WAM A;  2YIU C;  3JAT A;  3VYI A;  1FU1 A;  3AE5 C;  4P9P A;  3CXH I;  2WT7 A;  4GOD A;  5EYP A;  5AW2 B;  1FXK C;  4QJF B;  4UXN A;  1YIJ P;  3ABM B;  3K0D A;  3LDD A;  2N04 A;  4XA4 A;  2UXC O;  5KLV H;  3AED C;  1GZL A;  3LID A;  3M9B A;  1YJ9 V;  4MW3 A;  4LLH A;  1Q86 W;  1TUB A;  2XT9 A;  2Q0O C;  5B1O A;  3AEF C;  1URQ A;  4GKJ B;  1JFF A;  2OYH B;  2ZIM A;  5LA6 B;  4FLU A;  2QKC A;  1N73 B;  4PD4 D;  1X4T A;  2WMM A;  2NR5 A;  4NPF X;  1AV1 A;  1ZLZ A;  1MFT A;  1RM1 C;  3N2G A;  4EI2 A;  1L0L K;  3CB2 A;  5GON A;  2O1K A;  1RE3 C;  4NB5 A;  4ASU G;  4YJ2 B;  1FZE A;  3OM3 B;  2W6J H;  3QO7 A;  3SYC A;  1KMI Z;  5FLX N;  1N36 O;  1N32 O;  3T1H O;  1H0T A;  1EZV D;  1RF0 A;  3CCM P;  2HHH B;  5D5P A;  2P22 C;  3FYI B;  3L9D A;  3ABT A;  5J2T B;  2PZS A;  1IK9 A;  5IWA O;  4KL1 A;  3OEH G;  4OPA A;  4CBC A;  2ITC C;  1PGJ A;  1Q82 Q;  1S2E A;  1Q82 W;  2OYH C;  3LNN A;  2R72 A;  1ROP A;  1NR1 A;  1SQP J;  2VRZ A;  1WB7 A;  5LXT B;  2O01 N;  1XRE A;  3UKM A;  4B08 A;  3FGA D;  4KP4 A;  1XBL A;  1M56 B;  2B1G A;  1CXZ B;  2Y9Z A;  4MN4 C;  1MG1 A;  1SQX D;  2HJD A;  1RSO B;  5JJN B;  2EIM B;  5AW4 B;  3HE4 B;  3A0B Z;  3OT7 A;  4I50 B;  4MVQ A;  3OTO O;  1P84 E;  2QM4 A;  4LF4 B;  3ZMT A;  1S77 D;  1TU3 F;  5L8R J;  3SR2 C;  5IYZ B;  2IJJ A;  1KFM A;  1WRG A;  2OT5 A;  1I08 A;  1BGY E;  4XBF A;  4O2A A;  1KIL D;  3H01 A;  3Q3D A;  3WU2 Z;  3N7N A;  3E86 A;  5JCO A;  2E3C A;  4TQF A;  3RK2 B;  4JTA B;  1PNM A;  5LBQ A;  3PTZ A;  2GBO A;  2QA4 V;  4HZ3 A;  4DV5 B;  4KT0 J;  3L73 G;  4LF7 B;  4GLX A;  4K3A A;  5LMU O;  1M56 C;  1JB0 J;  3JD3 A;  4WB4 A;  1LTA C;  2PF4 E;  1ZLL A;  1AVO A;  2L6L A;  3CPW U;  4QE9 A;  2P06 A;  1L0N E;  1M1J A;  2IH1 C;  5GTH Z;  5IJ0 B;  2EIM C;  1G1X B;  1SVF A;  4I4T A;  2ZR2 A;  4YXW H;  1VL2 A;  1TA8 A;  1R6N A;  4A7P A;  4R50 A;  1P7G A;  3M99 B;  4PJ0 Z;  4B3T B;  1M57 C;  3CXC U;  1LT9 C;  4WFA V;  1QX8 A;  4HBN A;  1USD A;  4BW9 A;  4M3L A;  4LFA O;  3OJA B;  1WA8 B;  3H1H G;  1PNL A;  1NR7 A;  5F2V O;  4I0X A;  3RK2 C;  2CPS A;  3V2P A;  1CI6 B;  3A2F A;  1XQ8 A;  5KA6 A;  4EYY Q;  3CL3 D;  2YIA A;  1IBM B;  4XDJ A;  2XNX A;  2QWP B;  2V1D A;  3CC7 V;  3AEC C;  4LGD E;  1KZU B;  4GT1 A;  2P1J A;  1NWQ A;  2H88 C;  2A06 E;  5M1B A;  3T1Y B;  1R3K C;  5BVZ A;  1FJG O;  2QR4 A;  3SYO A;  1RH5 B;  5APX A;  5KX5 B;  2HVK C;  3L71 J;  2BCC G;  5AVS B;  3USS A;  4X62 B;  3AK2 A;  2WLI B;  1AQT A;  1SQB J;  3ZHU A;  2WZ7 A;  2WVR A;  3V2Q A;  4HB1 A;  2QGN A;  2N1T A;  3HKB B;  2JR8 A;  1U97 A;  4FLX A;  1BCC G;  4I2L C;  2LGW A;  3U10 A;  3JAS A;  1SQP K;  1OXZ A;  2YDE A;  4MVM A;  3QNE A;  1RP3 B;  4JF3 A;  4CS3 A;  3ZJZ A;  1P84 H;  1RY3 A;  1F51 A;  3ZRW B;  2ZKO A;  2IJH A;  3PN1 A;  1GDT A;  5EZY A;  1S72 P;  3H1I G;  2P10 A;  2M5A A;  4MSW C;  1H88 A;  4YIO A;  1BGY H;  2FYU E;  1R6K A;  5FPO A;  3BPZ A;  1NVP B;  1V55 B;  1SQV J;  1GN6 A;  1WPB A;  2V7Q H;  4GX5 A;  1D5A A;  1R8E A;  1IFN A;  5L3E A;  3KXD A;  1COW G;  1XOU A;  3H1L H;  2K1E A;  1GMJ A;  5KUK A;  2LO1 A;  2CTP A;  2WA4 A;  2DMX A;  1G2C B;  1L0N H;  2HEP A;  3KZI E;  3CI9 A;  2K9P A;  3IFX A;  1NTZ G;  1B04 A;  1FZF A;  3TGU G;  3P32 A;  1HH0 A;  4H44 D;  1VF6 A;  2QSA A;  3P7K A;  4OXS A;  3L74 G;  1JR9 A;  2PAJ A;  4CC6 A;  2V4D A;  3HD7 C;  3L71 G;  1VQM P;  2AZ0 A;  2HP8 A;  2AZ2 A;  3RYI A;  1V55 C;  1AR4 A;  3C90 A;  2K9J B;  2JDI H;  4W4L A;  3VQX A;  4C7N A;  2E75 D;  2YUA A;  4H37 A;  3MTU E;  3E89 A;  2HFE C;  2QM8 A;  3OW2 U;  1QQC A;  3AE7 C;  4F6R A;  2G8Y A;  3W7U A;  1QLN A;  1N7L A;  2XAG A;  2UUA B;  2CTW A;  3A0H Z;  1R73 A;  1N2D C;  1MA1 A;  2QWR B;  1B06 A;  1OZH A;  3O65 A;  1BHA A;  1FJP A;  3FX7 A;  5B66 E;  1S5J A;  2DQ3 A;  3OMI B;  3VBB A;  1LP1 A;  4U3F J;  2E5T A;  3T4Z A;  4MVU A;  1N33 B;  1ZR2 A;  1S5H C;  1OV9 A;  4JYC A;  1ZR4 A;  1SQB K;  1NU1 G;  3OFN G;  4K8X A;  3L37 A;  1YEW A;  4FK5 C;  2YIB D;  1J5E O;  3KDP B;  1MNG A;  3ZMU A;  5L3C A;  2CK3 H;  2Q6Q A;  4FIP C;  4OGQ B;  5BU5 A;  1OHH G;  1VMG A;  1J1E B;  1F4N A;  3TXS A;  5APQ A;  2YEV A;  5HFM A;  4LF8 B;  1GN2 A;  3I56 V;  3TET A;  1PP9 E;  4NXN O;  3CCR P;  2H94 A;  1EDJ A;  4D6T D;  1WB8 A;  4ZOL A;  4W4K A;  2DWE C;  2IH3 C;  1KV4 A;  2W6J G;  1M4U A;  4LF9 O;  3O9O A;  4J41 A;  1YTZ T;  2JEU A;  1BQZ A;  2NPS B;  1SQV K;  2QJ1 A;  1R3L C;  2ZE7 A;  4LCU C;  2G3A A;  1KIL A;  3SPH A;  2FYN B;  4RWU A;  2UXC B;  5IYB O;  4GZR B;  5LYJ A;  3BAS A;  2E5Y A;  1R3J C;  3I56 P;  3KZI H;  1NU1 K;  2PI5 A;  2RMZ A;  4MT8 A;  4OGQ C;  4WBN B;  4WFF A;  1EC5 A;  4DV0 B;  4OH8 B;  3BCC E;  1OVR A;  3OGI B;  4JGS A;  4BWA A;  3RFR A;  1ZW0 A;  2JRI A;  4X64 O;  2AGA A;  2KLU A;  1JCD A;  3ZHV A;  5KJ7 D;  3MUD A;  2JJ2 G;  3ASN C;  5IT9 N;  2NPS C;  3Q5R A;  1N36 B;  1N32 B;  4O2B B;  1BMF G;  3E8H A;  2CH7 A;  1LT1 A;  3PLN A;  3I55 P;  3G4S P;  3O6Q B;  2FYN C;  4PV1 B;  4J10 A;  3FWN A;  1PPJ E;  3EFG A;  1W5C E;  1IK7 A;  4J80 A;  2JGU A;  1AA0 A;  3TSI A;  4DV1 B;  1IUR A;  3IC7 A;  2Q9I A;  1AJP A;  4U7O A;  3SWK A;  4JZ2 A;  1OX3 A;  3C3S A;  2QEX P;  4PA7 A;  3SFE C;  2K3R A;  1NZ6 A;  2W83 C;  5E79 E;  1YQ3 C;  4IGG A;  1I94 O;  1L0L E;  1XUQ A;  5LL6 Y;  4JZG A;  5FL7 G;  3VOP A;  2B9B A;  3UM7 A;  5H6Q A;  4JI4 B;  5GTI H;  4YXW G;  4EOT A;  2CTR A;  3RN4 A;  1XNQ B;  1OJH A;  3VOU A;  3G67 A;  1N0J A;  1Y6X A;  1FFT B;  2IBZ D;  3OTO B;  2HYN A;  3ETG A;  4GCZ A;  1PP9 H;  4FFB B;  4PV1 C;  5TIS Z;  4X1Y A;  2ZVO B;  3HE5 A;  3FB5 C;  2CAZ C;  4ZHQ B;  3AK1 A;  5FNV A;  1ZL8 A;  2EX3 A;  2Q3I A;  3BRV B;  1FDO A;  3HKC B;  2JWA A;  2XV5 A;  4WY4 B;  1A02 F;  2ZXX A;  1S5L X;  4CS2 A;  1KQL A;  1W0K G;  2IJI A;  1EZV E;  2IU0 A;  1SFC B;  1GAX A;  4TUY B;  4CH4 A;  1YTZ I;  1FFX A;  1Q90 D;  1RF1 B;  4PI0 A;  5KLI B;  1DK1 A;  4DV6 O;  4DT0 A;  5LGU A;  1I0H A;  1FZG A;  3E2E A;  5AVW B;  3L75 D;  3J80 N;  2UXX A;  3T97 A;  3D36 A;  4UCU A;  4DUZ O;  2KZI A;  5BMV A;  1NKZ B;  3BCC H;  2EZP A;  2Q67 A;  1QLE B;  4Y28 J;  1NHL A;  5CCG C;  2WSF H;  4LFA B;  3LW5 J;  1P84 D;  5LHH A;  1SQX E;  1OZ0 A; 
#chains in the Genus database with same CATH homology
 4YXD C;  4H0L C;  2NZ2 A;  2G3A A;  1DD3 A;  3GMA A;  3S9O A;  1KMI Z;  2D2C C;  1RQU A;  2E75 C;  1U57 A;  2BEZ F;  2J5U A;  1KIL E;  3AEG C;  4OGQ C;  3RL0 g;  3AE4 C;  2P10 A;  2ZT9 C;  3GLM A;  2V7Q J;  2O01 J;  2QIW A;  2K9Y A;  3C8V A;  3AE6 C;  2E76 C;  4I7Z C;  1R8E A;  4R4L A;  2MKV A;  2WPV B;  3Q1M A;  1OW7 A;  1KQG B;  3T97 B;  3FGA D;  1GMJ A;  3AE9 C;  1VF5 C;  1OMI A;  3Q5R A;  2JP3 A;  3AEB C;  3GF3 A;  4RKU J;  2E74 B;  2E74 D;  4XFJ A;  2FYN C;  4H13 B;  4H13 D;  1ZME C;  4PV1 B;  3EWK A;  4PV1 D;  5KLI C;  1RQV A;  1YQ4 C;  1EXJ A;  5KKZ C;  1IK7 A;  2OQQ A;  1TU3 F;  5L8R J;  4H44 B;  3B71 A;  4H44 D;  1K04 A;  3RK3 E;  1WMK A;  3IN6 A;  2QSI A;  3AEA C;  2JO1 A;  2QJP C;  3AEE C;  3Q3D A;  1KOR A;  4H0L B;  1MKM A;  4H0L D;  3SFE C;  3Q5S A;  1UIX A;  1DIP A;  1KTM A;  1YQ3 C;  3Q5P A;  2YMK A;  2D2C D;  4KT0 J;  1DD4 A;  2E75 B;  2E75 D;  3AE3 C;  3H25 A;  1JB0 J;  3D6Y A;  1HJ0 A;  3R4Y A;  1OW6 A;  3AE7 C;  2G8Y A;  1KQF B;  4OGQ D;  2E74 C;  1S1C X;  2WQY C;  2IDB A;  2FXP A;  1PV3 A;  4R4M A;  4PV1 C;  1ZOY C;  3SFD C;  1VL2 A;  1Y9B A;  3O6Q A;  4H44 C;  3GF7 A;  3ABV C;  2YIU C;  1FDO A;  3D70 A;  3D71 A;  1VF5 B;  1VF5 D;  2QJY C;  1NGM B;  4Z1M H;  2QJK C;  3AE5 C;  1S5L X;  4U7J A;  1NYH A;  2D2C B;  1Q90 D;  3AE1 C;  1PIX A;  3G9R A;  1EXI A;  3AED C;  3Q2Y A;  2WSC J;  3AEC C;  3D6Z A;  1AJY A;  4OGQ B;  4YTP C;  4GDO A;  1HF9 A;  2ZT9 B;  2ZT9 D;  2BEQ D;  2H88 C;  4H13 C;  3AEF C;  1OW8 A;  2WSF J;  1ZRT E;  3AE8 C;  4IL6 X;  5M1B A;  1K05 A;  1ZP0 C;  2FBW C;  2WSE J;  4Y28 J;  1PL5 A;  2E76 B;  4I7Z B;  1FDI A;  2E76 D;  3AE2 C;  2H89 C;  4TT3 H;  3LW5 J;  3IAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...