2E76B

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 32
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e76B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76B01
1ZRTE 2WSEJ 2QJPC 1Q90D 4IL6X 2E74B 2QIWA 5KKZC 1VF5B 2E76B 2WPVB 3C8VA 4H13B 2FYNC 4RKUJ 4KT0J 2O01J 2ZT9B 2D2CB 5KLIC 2YIUC 2WSCJ 1JB0J 4OGQB 2E75B 4H44B 2QSIA 4I7ZB 2K9YA 5L8RJ 3LW5J 1S5LX 2QJKC 2WSFJ 4PV1B 4Y28J 2QJYC 4H0LB
chains in the Genus database with same CATH superfamily
4AUWA 3L70J 3JAWB 1GL2A 1BMFG 4DR7B 4FFBA 1BGYJ 5K5GB 4K0KB 2WLIA 5JQGA 2JS5A 4FZ0A 1NJIQ 3GHGB 4C7NB 1KYOF 3AE5C 2QVAA 4O2BA 3K3WA 5IJ9A 1IBLO 5IE9A 3DC5A 4LP8A 1NGMB 2Q6QA 2GA1A 4FZ1A 3ABTA 1AI4A 3MDSA 1L0LH 1RFYA 2FTKA 2MK3A 3TSIA 5JJJB 2VWJA 3H1JH 1RQVA 4U3FG 4D6TH 2EX3A 1JM0A 2NR5A 1M8OB 1DF4A 3BY6A 4RO0A 2XT9A 4MVMA 4NXMO 1H2MA 2OYOA 1Q81W 3ABVC 4QPJA 1FAVA 1EZJA 1SQXE 3E8GA 1EN6A 1E1RG 1JO5A 3VMAA 1NTMG 4IL6Z 1NH2B 2B1GA 4X1YB 3WG7B 1E5WA 1G1JA 2YIAA 1W5CE 5BR8O 4DJGA 1H8AA 5CCGA 2OYQA 2ATKC 1SQPJ 1TVKA 2R9AA 1FZFA 1NR7A 4DV5B 3CCRP 1PZQA 1M93A 1JR9A 1M4UA 4DV4O 2O1KA 3B8MA 1M90W 3ETQA 3BVHA 3HPLC 4GYCB 2C0WA 4ZOLA 2E5YA 5AVVB 4X66O 3TNUA 3GVMA 1VQ6P 4GIFA 3OR7C 4O9BA 2A0LA 2HFEC 1Y4MA 3SSUA 1QR8A 2KSJA 2XU6A 3H1JD 2Y4TA 1WMKA 2IZ0A 3HE5A 1I08A 1WP7A 1BGYG 1KV4A 4YIPA 4ZI7B 2JWDA 4FLUA 3SWKA 5AVUB 3ZHQA 1Z5WA 3CCQP 2DW3A 4X1KB 4PDLA 3CC2V 3L74J 3KCXA 1X8YA 3O6QB 4KFMA 2R44A 1B04A 3FFQA 2DOSA 2Q5UA 4XA4A 3I56P 4CH3A 2KG7B 3F5HA 1Q6UA 2E76D 2KB1A 1AILA 1KU9A 3OTOO 3A7OA 1GZLA 2CH7B 4BWAA 3VMZA 3G71P 2R9RB 3AG4C 1RF0A 4PDRA 3L75H 1FZEA 3TF5A 1QBZA 3TGUD 1PP9G 1RH5B 3CC7V 1VQ5P 1S3JA 2XAQA 4GLXA 1PIXA 1USEA 4ICGA 1L0LE 4Z1MH 1BE3D 2GUSA 2QTSA 4WF9V 1SQVH 3M99B 4BRYB 1NS1A 3F5TA 1I7FA 3FAVA 3ZMZA 1RM1C 2PYLA 1FZCB 1FOSF 1US6A 1M57D 1N0JA 3RYFB 4B3MO 3KPEA 1J1DB 4P30A 1NTKE 2UXXA 3N2GB 4WFBV 2OWOA 1G2CA 5AW6B 3TYYA 3F5WC 1JY2P 1LP1A 5APXA 1GO3F 1XL4A 1GD2E 3OAAG 2VQFB 4PV1D 5CCGD 1YYCA 2G8YA 5LGUA 1EDLA 4AI8A 1PPJG 4XFJA 3EQ2A 3H32A 5F2VO 3CCEV 3B8EB 1COWG 4EYYQ 2WSEJ 3PRJA 2WLMA 2Q7EA 3K58A 4HH2A 5IYCO 4YJ2B 2ZT9C 2CPBA 3RK3E 2VQEB 5FLXN 2E76B 4QE7A 4ZHQB 4O4HA 3B40A 4YXWH 2WSCJ 4RESB 5C8YB 2PRRA 1ZL8A 4DV6B 2WITA 4JZ2A 1SFCA 2DQ3A 2BEZF 1XNRO 2O01N 1XILA 4DV2B 3QF7A 3CPWO 4I4TA 4FLYA 4H33A 4JF3A 2IU0A 1M57C 3RL0B 3CCSV 4H0LB 2IDBA 3CWBJ 3L75D 4CZZA 3JD1A 4GKJO 5KAFZ 3CCLV 2IJKA 4B3RB 1GM9A 2NLJC 2CK3H 3M9QA 3RK2C 2IH1C 1PNLA 2QTOA 4YHHB 1M56C 1RE3A 2RNBA 2ZE6A 1KKCA 3OUSA 4LBEC 2UXBB 5CBNA 3EWKA 1T2KC 2D2CB 2DYRB 3OEEG 2SPZA 3UM7A 1CI6B 1EQ7A 1LT9C 3W68A 4UFZA 3RYHA 3MUDA 4I50B 1S72P 3JD3A 4NPEA 1AJYA 4LWSB 2R5DA 2JGDB 2YXQB 1XDCA 2X7RB 4X20A 1HNXO 3OE7G 2LKMA 1L2PA 4J11A 1R6KA 4IFDK 3KHUA 3D8CA 1GK9A 2QA4V 4NTXA 1M1KQ 4F6EA 1NTKG 3G3ZA 2JK5C 3F89A 3E7KA 2F1MA 2Y69B 3M7MX 2WLNA 1SQXK 3O65A 4R8CA 3H1JJ 2KK7A 3L72G 4JPRA 2J59M 1NWQA 1USDA 3TGUE 1BHAA 4GKKO 1HDJA 4X1IA 4EB6A 3ZMVA 1BE3J 1MNGA 3JAMN 3JSNA 5B1BB 1DLBA 1OCOB 3MTUE 1D5AA 1UIIA 5D5QA 3L9DA 1S9KE 1SQGA 4DV3B 2BCCH 3QVNA 4DRXA 1SQPD 3TGUJ 2ZIOA 4BIZA 3JASB 5KMGB 2VQEO 5LA6B 3W7WA 4O4LB 3B5NC 4IHJA 5E1AC 4N3YB 1NTKH 1Z5VA 3FWNA 3SPCA 3CMEV 2WTYA 3VTPC 2MKVA 1SA0B 3V5BA 5LP6B 5AW9B 5LP6A 1VQNV 3FXEA 4W4KA 2DYRC 4LLHA 5AW8B 3V4WA 3H1LH 2N1TD 2Z5UA 4JAUA 3BA8A 1Q3EA 3MZWB 3H1HH 5BZBA 1R5LA 3L74D 4UV8A 4IIJB 4TV8A 2W83C 2NN4A 4PA7A 2BTOA 2A7WA 2OTJV 2ZXWB 2BSKB 1Q86W 1O9GA 2UXCO 2B87A 4WY4B 5FPOA 2IPPA 4NYKA 1VL2A 2HR3A 3A2AA 5BVZA 5EIBD 1ZN5A 4JTDB 3TXSA 3L75J 4HYTB 2Q1KA 1IBMB 2XAJA 1R3JC 5CA0B 2FMLA 1WA8B 3CJHB 3OFNG 3CMAV 3L73G 1KD1Q 3MHSC 4AHCA 2QRXA 5IJ0A 5LMUO 5TISH 2XNXA 2YIBA 2ZM6O 2YKQA 3LIDA 3K59A 3VMXA 1QLED 1NZ6A 3BCCG 4ASVA 1AJPA 5A2QN 1VQ7P 2FBWC 2IBZE 1BDCA 3E35A 3KQGA 2UXDO 1PM9A 2FL4A 3LNNA 5L3FA 2G3AA 4O4IA 3L70E 1KILD 2P4VA 1AQ5A 1HNZB 2UU9B 4LH6A 2X6AA 5CB4A 3A5TA 1IFPA 1NTKD 1K05A 3LUTB 4PD4D 5B5EH 2EIJB 2IFMA 1OCRC 4FM2A 1NYHA 4QNHB 2F95B 1I94O 3MGNA 2C9LY 2K88A 2M6YA 1SQBJ 1N4CA 2Y0CA 3JCUH 5LXTA 3DXRA 3JCUZ 2JRIA 1MZ9A 3ML0A 1I5XA 2XTAA 1OXZA 1RPOA 3JAKB 5JJNB 4K8ZA 4QE9A 1VQMV 3L70D 3D36A 1ZTEA 1SQBE 2KUBA 2Q6AA 1SQXJ 1N8RQ 2EILC 3VQVA 3T1HB 1N36B 1FKAO 4IYHA 3OUFA 3CRMA 1WN7A 3L73J 1M1KW 2ZR3A 2JO1A 1LTBC 1FOSE 1OV9A 2IYOA 3WB2A 3W7XA 4WBNA 3E8BA 4PD4E 3RL0D 3E83A 3GLMA 4R4LA 5EZYB 1KMIZ 3IAOA 3CPWU 3FB7C 3CX5H 2JDIH 2CTWA 1SKVA 3SWFA 2ARHA 4KL1A 1SS3A 2YI8A 3WU2E 1IFMA 3ZRXA 3OT7A 3RYFA 3O8ZA 4GKKB 3H1KJ 1S1CX 1SESA 4FIPC 1IBKB 3WUVA 3AG2C 3Q5SA 3G6EP 1LUWA 1EBOA 3C1LA 1N33O 3MD0A 1F4NA 1RSOA 3C3SA 4LFCO 3VQYA 2VS0A 3ZN0A 1URQB 1VQ4P 5B1AB 2L5GB 2HP8A 3R2PA 2Q0OC 2Y48A 4DK1A 4I55A 1XMQO 4LF4O 4L76A 1P84H 3RYIB 1IFIA 1M56B 2W90A 5IY5B 1G4YB 1XHZA 1M1JB 4EDFA 4BW9A 4CBCA 2Y0DA 2HODB 4DZOA 4TWKA 2R32A 2WLIB 4TV9A 1IK9A 3GHGA 1MSWD 4C7NA 4TV9B 3D6YA 1YJ9P 2WVRA 4UB6Z 1V54B 4DRXB 1NTKK 1K33A 1Q8IA 2PGDA 1VQ9V 2CPSA 1N7SB 1THZA 3CWBG 3AG2B 5BMVA 4LF6B 1IXBA 1OFCX 3L71J 3JALA 4DV1B 4JI0B 3K9SA 4GOFA 1GL2B 1UFIA 4OX9B 3HKDB 1FZAA 3DSQA 1Z56A 2X6CA 1NO4A 3WG7C 3PH0A 2IJHA 2PY5A 1WPXA 3HD7D 1H8EG 3CRRA 1JCDA 3LSQA 2AGAA 1DTOA 2QA4P 2ZXEB 2Q68A 3RK2B 3SFEC 2A45H 4MVUA 2KB7P 4PV1C 3KDPB 2Y0PA 2WT7A 1WB7A 4X20B 1GMGA 4OX9O 5AVZB 1FD9A 2LFRA 2CGOA 5JCOC 2WQYC 1JY3O 3CSXA 3AE6C 1YVWA 1BGYD 1KC8W 4JYCA 4U3FH 3UO2A 3H1JG 5CMUA 4LH7A 3AE3C 5L3DA 3RWRD 4WY4D 3KZIE 2KQXA 3LIEA 1N8RW 1SQQG 3Q5PA 1AV1A 5B1NA 2B1IA 2ITDC 3RL0g 1S5LH 5EBMC 2HKOA 3A8TA 1HGVA 4DT0A 1X22A 3AG1B 3BHPA 2Q8VA 2YMKA 1R8EA 3IFXA 4GX0A 3X2QB 3P7KA 5AG2A 3FX0A 2C2AA 4UB8E 1MZFA 1Y47A 3VN0A 1GU4A 3BFRA 2B88A 5JH7B 1D2DA 3VP8A 4YPCA 3ETEA 3ZMTA 2OTLP 2FFDC 2GHYA 1Q82W 1U97A 2N1TB 5IWAB 1NKZB 1KB9H 2ITAA 1QVGO 2QJYC 2Q69A 3M0AA 3CWBE 3M91A 1N86A 1R3IC 4K35A 1SQQH 3J81N 1S2EA 4OVNF 1PNKA 3UO3A 3OJAB 1UPGA 2WPVB 3G4SP 4ZIBA 1M1JC 1IVSA 3ABLB 1GH6A 1KYOD 1Q5OA 2PI4A 2KXPB 1TA8A 5LGTA 2Q7HA 1KN7A 3CRQA 4UUJC 3CCUP 1BSHA 3MHVA 2FYZA 3E22B 1HWYA 2JR8A 3N2KA 1FS0G 3U11A 4W7ZA 2YSUB 3WU2Z 4LF5O 3GG2A 1K34A 4DUYO 3Q5RA 1LTIC 5KAIH 3OTFA 1QLEB 2YXLA 2V7QJ 4R6ZA 1SQQJ 3CWBD 3QWOC 3K06A 4K0KO 1KB9E 2YO3A 2NNUA 3AG3C 2ZT9B 1BE3H 4TUYA 5KUMA 5AVYB 3RYHB 2LR2A 2OTKE 2LFSA 3ZRWA 3T1YB 4TSFG 5CBOA 3F7YC 4GCZA 3N2GA 2Z4EA 2UXNA 1RE4C 4DR5B 1W2EA 2K9JB 3BRTB 1VDFA 4XBFA 3D71A 4RUFA 1FJGB 1Y9BA 3ETDA 2F4VB 1HP8A 5A9GA 5LMNB 4FM1A 5JJEB 1JFFB 3EVKA 2HPCB 1Y74B 1NTZG 2IBZG 4JI6B 5KLIC 3HKCA 3ZDMA 4U3FE 3RYIA 1YJWP 1R6TA 4DUZB 4RUEA 3G6BA 2LJ2A 1HBWA 1FJPA 1VQMP 1K8AW 3AE7C 4O4HB 2NPSC 1OZHA 5B66H 4UVCA 1QX8A 3BPZA 3CCVV 1SQXG 1YQ3C 3U10A 3ZEDA 5IT9N 4DYLA 3SJQC 4IYIA 4HB1A 4GT1A 2QWQB 2GUZA 1LT1A 1QLEC 3CRAA 3UQ8A 2K1AA 2AEMA 3A0BE 3CC4P 2D3OW 2FKWB 3T4DA 3GWKC 1NKNA 1YQ4C 3AECC 1YJ9V 3JCUE 2WZ7A 4I7ZB 3CP1A 5E79Z 4HBNA 4UCTA 5KX5A 2M0BA 2CDYA 4WFFA 1VQLV 4D6TD 3UIAA 1OX3A 4H37A 5AW7B 1N36O 3EXAA 4I50A 2WSEH 3E8HA 4UB8H 2H89C 4X65O 2YEVA 1NU1G 2B87B 2Y0EA 3A0HH 2LQTA 2Z0AA 5LYJB 2M3EA 3VQWA 4MS2A 1YI2V 1U96A 2XASA 1QEXA 1VMGA 5GONA 1AI6A 3WB0A 4F6RA 3PP5A 5AW5B 4JAAA 2N9BA 2H43A 2ZKOA 1OCCB 1AI5A 2QSAA 3CCEP 2R5BA 4ZKPA 1KFNA 3KCYA 4NB5A 1RE3C 5KUKA 4AILC 3L4FA 2JS3A 2CE4A 2RJZA 2HEPA 5E79H 1KKDA 1SVFA 1GW3A 3ABLC 1LT9A 4MW3A 1K97A 2BTQB 3MHHC 2NPSD 5IY5C 4GODA 3VP9A 1FFXB 2H88C 3QTCA 4J7KA 4YXDC 4NR1A 5BXZA 1MMMA 3FGAD 3CMEP 3SJBC 2F23A 1JB0J 4GZRB 1OVVA 2W6AA 3PN1A 4AQYB 3GMAA 2G38A 2QJYB 3RL0C 1SQQK 1L0LG 5GTHH 1VQNP 2W6JH 4RJTA 2OYIB 1JVMA 4JI1O 2DQ0A 4YXWG 1N7SC 5HFLA 4YY3B 3M9HA 3WU2H 1R6NA 1ZRTE 2BASA 3SYQA 2DYSB 1LTAC 4X1KA 2ETNA 3H1LD 1SZTA 5EIBC 4FLVA 1YJNV 1M90Q 1JCHA 1ENVA 4DUYB 1NKDA 1K8AQ 5CA0A 3ZRSA 3AG1C 1PL4A 1GU5A 3RFRA 3MAQA 1LUVA 3S4RA 4LC1A 4BXLA 2WT7B 1G6UA 3CD6V 3G6EV 1YHQV 3DC6A 4TQFA 1OWAA 5C93A 2A9HA 3CXHF 2ZAEB 3HD7A 2IM9A 3BEHA 4Y28J 1I0HA 2Y9YA 1LNQA 3B5NA 1GM8A 2ZXWC 4R4MA 2OYIC 2FYNB 1P84E 3RYCA 4B3SB 3SJAC 3P8MC 1KBHA 2QKCA 2ITCC 4H13B 1VQ7V 3H1HE 1FZGA 1N73B 2OYHA 1PP9J 1H38A 4PA4A 3AK2A 1DEEG 1Y67A 4U7JA 2ZFCA 2IJIA 1VQ9P 1VQ6V 3B09A 2QJ1A 3FKSG 1Y8AA 4C46A 1JPXA 1Q86Q 1S5LZ 1L4AA 4J10A 1KILC 1ZW0A 3CL3D 2EIKC 4JI5B 2BCCG 1L4AB 1SFCC 3H1IH 3U1CA 2AXTE 1RF1B 1HR0B 2POHA 1XQ8A 4A7PA 3A2FA 4U3JA 1GW4A 2XNDH 2LXBA 3SFDC 3L74E 3AEIA 4C7RA 3JYCA 3ITKA 4NXMB 3P8CD 4I55B 4EIJA 1X0TA 4JV5O 2Q5ZA 3HKCB 1JJOA 1WB8A 2KKWA 2IBZH 1LTGC 5KLVG 3K0DA 3K79A 1VP7A 2ZIMA 1NAYA 1CZQA 4AQYO 1AJNA 1CW5A 2N74A 3OR6C 3TETA 1HW7A 2P10A 1KUQA 2JGUA 1ORQC 1N0NA 4O4LA 1VQOV 1SQPE 1DD3A 3G71V 3HRNA 4TT3H 3ABKC 2YIUB 5LOVB 3Q4HB 3N2KB 2RN9A 1KB9I 4ZI7A 2EULA 4RAIA 4JI2B 4O4JA 5FNVA 5LHIA 1N7LA 3BASA 3M9BA 3CX5E 2EILB 3SPIA 4UCSA 2B5UA 3IC9A 3S3XA 3KG2A 1BCCJ 4QMAA 2H8PC 3QG5A 4LFAB 4NPFX 2OT5A 1URFA 2E3CA 2GDSA 1F7YA 1FS0E 2DN9A 1SQVD 2BCCJ 2E5LO 4RQFA 2ADQB 4I0XB 2PFXA 1J1EC 4I0XA 1KTMA 2B89A 1T5EA 2F43G 2HHHB 4LF9B 3JD2A 5B1AC 5GONB 4DV2O 1IJDB 3AG4B 1PPJD 1WRGA 1NVOA 2BCCE 2PUSA 5KJ7D 2Z5HA 4DR1B 1Q6IA 3SYOA 5AVSB 1ZAUA 3I56V 1JCCA 4LNUB 4GDOA 3HUSC 1YI2P 1JY2N 1VF5D 1ZLZA 4MVSA 1XBLA 2BTQA 3L75E 1NTMJ 2YIBD 1PL0A 2Y0IA 1R5SA 3L71E 3B8NA 5AVWB 4MTFA 5KLVE 1IXMA 1BE3G 3HUSA 2RMKB 3IGAC 4DR2O 1TAEA 3BCCH 5IJ9B 2HFED 2RCVA 3AEAC 1GMJA 2R3CA 2QE7H 1MSDA 4QIWF 5EBLC 3L36A 3B77A 3TGUG 1RPRA 1K5QA 2HJDA 1JQ0A 2KP8A 2CTPA 3CCSP 5JVDA 4FLWA 2UUAB 3AE1C 1PV0A 2D2CD 2GV9A 2OCHA 3IR9A 3OEHG 4MVOA 2WPSA 3HE4B 1YITV 1P49A 3OGIB 2KI7B 2WLLB 2AXCA 3CWBH 4QPKA 1FJKA 3WFVA 2CGNA 4H44C 1CP9A 1FFTB 3C9IA 4DCKA 3K08A 4JQ0D 1OHHG 2QKSA 2E76C 3GHGC 4JI2O 3H1HG 3AE2C 1XNQB 4MVZA 5IWAO 4DV4B 1OCZC 2V4DA 1TVKB 4PDVA 1GAXA 1BZKA 3H1LG 3ABUA 1NI8A 2N05A 2YS8A 2K1EA 1FPOA 3AE9C 4WY4A 3CCJP 4Z1MG 3B5NB 3UT5B 2P6JA 4LF5B 3UKMA 4DR3O 1EZVH 3BA9A 3TGUH 1S77D 4DXWA 1VQ4V 1L0LD 5BY1A 4WY4C 3P3PA 1JY3N 5M1BA 1H0TB 1NAFA 4O2BB 2HLDG 5H2FZ 5CJ0A 5CCGC 2AEJA 4D6TE 3VQXA 4L75A 3AG7A 1VF5C 2IBZI 1FAFA 2F66C 5GW7A 3IJ4A 1A02F 1KP2A 3G67A 2XHBA 1YTZT 4HNAA 2JGDA 1AVYA 2D2CC 1HTLC 3T1YO 3BATA 5GTIZ 1FDOA 1AVMA 5GTHE 2WPQA 2A06H 4OPHA 2E75D 2JDIG 3BABA 3SR2C 1Q90D 3TXQA 1YEWA 4MTGA 2ZXXA 1BDDA 1GL2D 1M57B 3D70A 2RKLA 2M5AA 2AEFA 5J9PC 2UUCO 1L0ND 2DE0X 3JCZA 2Q3EA 1XEQA 5IYZB 3CC2P 1JMKC 4DR2B 2WPDG 3H32B 4N78D 5KTBA 4JI6O 2CUGA 5E79E 2QR4A 3PTZA 3W7SA 1NU1D 3BVOA 4U3FD 5AW0B 4L73A 3H9VA 1FXKA 4FM0A 1JEKA 4PA3A 4DV5O 2OCCB 5CBGA 3CD6P 4BIUA 1T3UA 2EJ7A 2QWOB 1JA8A 3L73H 3APOA 3ZN1A 4B3TO 5AVQB 2JEXA 1SQPK 3AE4C 1NTZK 1QL1A 1OW7A 4L87A 3HKBB 3JC22 4MN4C 4DV1O 1HNWO 3W67A 4CS4A 4N6JA 2E5LB 1HVVA 2JIZG 1JMBA 5KA5A 1VF6A 1T8ZA 2W6JG 1SLQA 4EOTA 5KAFE 1Q7YQ 5CCHD 4H0LD 1MOFA 3H1JE 1KB9D 1J5EB 1Y74A 3ZHVA 3ASOB 1QGKB 1OCOC 1DH3A 5DJUB 3GWOA 1KILB 1G1XB 2AHYA 4B3SO 2ZVNB 2QE7G 1RP3B 4X89A 1U57A 1VQKP 1LWUA 2JEEA 2JJLA 2X0LA 4ZHQA 5DEDA 4UB6H 1KECA 1V55C 3HKEA 1ZL8B 4P2ZA 1LWUC 3CCQV 1WA8A 3CJHA 3WB1A 1TUEB 4EFEA 4ASWA 2E43A 4B3RO 2H7HA 4DV0B 3N7NA 1M5IA 5AW4B 4MVQA 1SQVJ 4FFKA 5LMUB 4KHPO 2LW1A 4LNUA 1E79H 4HYOA 3L72J 3G4SV 2UUCB 2BE3A 1Q81Q 1GK4A 1IURA 2Q9IA 1HJBA 4DW0A 4D6TJ 3RGUA 3V2PA 1BCCD 1PNMA 1Y6XA 2K9PA 5J2TB 5TISZ 1SZXA 4DW1A 2ZDIA 4EKWA 1RE4A 5JCOA 1HNZO 4LF8B 1MA1A 4IL6E 1DEBA 2O01H 1PP9H 3G80A 4WBAA 1H88A 1Q82Q 5KHHA 2BSKA 3L35A 2A06D 1H2GA 1L8DA 3OMIB 1URQC 3L71G 5EYPB 3NMDA 1BE3E 5L3GA 2N1TC 4UB6E 2CTRA 3MUDC 2YXYA 4DR3B 1AR1B 4TOIA 5B3SB 1QL2A 4GOEA 3F7VC 3B4SA 1HNWB 5H2FH 3M06A 4GX5A 4JI1B 1VQPP 2AHZA 1FC2C 4YJ3A 1QVGU 2R3SA 1NR1A 1JMMA 3R66A 4MTOA 4DV6O 1F4MA 1MKMA 4I9WA 1PGOA 2EIMC 2W6BA 3VOPA 3GW6A 4QGPA 1SQBH 3SJCC 5EC2C 3U59A 2WA3A 3KKYA 4DO2A 3Q2YA 4ZBMA 5LBQA 1VF5B 4CH5A 3OMAB 1EDJA 3STLC 3ZIAG 3HB3B 2FYNC 1DF5A 3AEGC 3HE5B 2P90A 2E74D 2DW4A 1YIJP 1EN5A 5APYA 5TJHA 3CCVP 2QGNA 1NTZE 3A3YB 3BCCJ 3VBBA 1NH4A 4Q6GA 1TUBA 1BSNA 3UCSC 1H2NA 1NTMH 1SQQD 4PELA 3FYIB 1LP1B 2FXPA 2JEUA 4K8XA 3OTOB 3QO7A 4JTCB 4R7CA 1WPBA 2NRGA 5LP6C 3H1IE 3OMNB 1N33B 2DYSC 2A45G 1L1FA 3ZCCA 1K9MQ 2KYVA 1A32A 5CBFA 4ZMDA 2LGQA 3LW5H 1PGPA 2FYUE 4H13C 5GTIE 2QEXP 2JP3A 4LF8O 4KJMA 3IN6A 4IFFA 1R3LC 1GM7A 3CEIA 1KQGB 4B86A 3FWLA 3H1HD 4CC6A 2ZYGA 4Z2WA 3WUUA 1BGYH 4BWNA 1S72V 4UCUA 4I2LC 5AVXB 1F23A 3K0GA 2QIWA 1J1EB 1FE6A 3KXDA 5APWA 3HR0A 3PLNA 2O1JA 3USSA 3RN4A 2A3QA 2ZE5A 4I4TB 2WLJA 2WA4A 4W80A 3ZMUA 1H8HG 1UIXA 2E42A 2Y69C 1AI7A 2YKPA 2I8DA 5L3BA 1X59A 2LW7A 4JI0O 2WSCH 2L6LA 1R3KC 1YXBA 2Q9LA 3BRCA 5J2UA 5EBWC 4IGGA 3EFGA 1MFTA 4PJ0H 1GTWA 4JI4B 3V6IA 4D7TA 1IX9A 3H1LE 1WNSA 4FPPA 3ZRWB 4X65B 2WSSG 1DGSA 2VRZA 3E1IA 1MABG 3CXHE 3CB2A 3FB8C 2GBOA 3APQA 4UXNA 2Y9ZA 1OCZB 2YDEA 3T2MA 3CXCU 4LFBO 5B66Z 2QG4A 2ZQMA 4J42A 4I6MC 3H1KG 3JARA 1DX7A 3LW5J 3JARB 3QO5A 5TISE 4DV7O 1XMOO 1IDSA 2IU3A 4GKJB 3WUTA 1HF9A 3R65A 2UWJE 2H3OA 2XAGA 2FYUK 4BR6A 4MW8A 4JI5O 2ZE8A 4HJGH 2QJPC 1Q2NA 2Q73A 1YJNP 1ZRTD 3WMM0 4JI3B 2HODA 3K04A 3LDEA 4FFBB 4YHHO 3OGCC 2RQ6A 5ITZA 3Q3DA 5KHKA 4LF7B 4PI0A 3SGIA 1T3JA 2H8PD 1G2CB 2A79B 1VIBA 3ABKB 2YIUC 5B1BC 3H6PA 3KYQA 4DV7B 3L73E 5APTA 2KG7A 3K5OA 1EZVD 4WWIA 5H5NA 3K5MA 1HNXB 3L72E 4IHJB 4LWSA 3FX7A 2QM7A 5B5EE 4KHPB 2B9ZA 2M3BA 3ASNB 4X62O 4B7EA 1F51A 1SRYA 3ZJZA 1EFRG 2QWRB 5EYPA 1IFNA 2I1JA 3L70H 5KLIB 3CCMP 4CS3A 3ABMB 1E79G 1DIPA 2E75C 3CXHH 5KAIZ 1P7BA 4DUZO 5KJ7C 3I55P 2Q67A 5DN6G 1LTJB 2MJZA 2KNCA 1SQBK 1MFZA 3RVYA 3D3IA 4UB8Z 1RY3A 3I5CA 1LT9B 2ZNJA 1L0NH 4UV9A 3LDDA 3ZRVA 2HLOA 1YITP 4PV1B 5KLVD 1KD1W 3NXSA 2ZJSE 3H1ID 5CMZA 2PP6A 1VARA 1PPJH 1NU1J 3HKEB 1K4CC 2P67A 5DM6V 1NU1H 3G9RA 2X6BA 1KC8Q 1WT6A 2P4KA 1N7SA 1AR4A 2ZYDA 1HGZA 1S9KD 2GUVA 5IJ0B 1VQPV 2EJRA 3H1KD 5L3CA 4UCRA 2KIKA 1NVPB 2YKOA 5JVDB 5AW2B 1SQPH 2BCCD 3RBZA 2H94A 2E5TA 3IAYA 1NTZH 1NU1E 4BRYA 2HJFC 4HNAB 5K1XA 3RK3C 2C0XA 2GTSA 4OPAA 2YICA 4NTYA 4OWFA 1QHTA 1FFXA 2BEQD 2QDOA 2PI5A 2P58A 2P7JA 1NH2D 2KLUA 2WAMA 1NJIW 1HH0A 4DR1O 4H44D 1CPYA 3K9AA 5JH7A 3JAKA 4IIJA 4TV8B 5CBHA 3TJTA 3AEBC 1YTZI 5CCHC 4WB4A 4EFBA 2WSFH 1KB9F 2HPCA 3CC4V 2EZOA 4LF7O 1W0KG 1L0LJ 3CCLP 5CCHA 2FFDB 3S3WA 4PA6A 3JAWA 4TT3G 2ZNIA 3CI9A 3W7UA 3QNEA 1MV8A 2AXTZ 3T97A 1CEZA 1J95A 4YIOA 3ETGA 5CJ4A 4XDLA 1JNMA 4MTXA 4HKZH 4W4LA 5EZYA 3L72H 1Q6HA 1AP5A 3X2QC 2AW9A 1S0VA 5AVRB 5KAIE 1XTGB 2UXDB 1FZCA 1ZX3A 1W2BU 4PJ0E 1FU1A 4RKUJ 2KZJA 1HJ0A 3JATB 4DR6O 2Q3IA 2BOBC 4KXRA 4O2AB 4IL6H 2FYUJ 1BQ0A 1IFJA 1KQSO 2JJ2G 1M56D 4F4LA 2VQFO 2P06A 4PD4F 1GL2C 5J2UB 1IC2A 2KSDA 2ILMA 5KHIA 4I7ZC 4JAVA 1SQPG 2AZ2A 1J5EO 1LGHB 2PYJA 2XUMA 2W8ZA 2IZ1A 4DR6B 5KKZC 3V2RA 5FPRA 5KHJA 4X8AA 2FB5A 4HAMA 1VQ8V 4EB6B 2XOKG 1JOYA 4K3AA 3C8VA 2P5OA 1N7SD 3D6ZA 3CYOA 2XAFA 4IFMA 1OVUA 2QEXV 3PHLA 4B08A 4BW5A 5K1PA 2K37A 5APQA 1AA0A 2DWEC 2HHHO 2UXCB 3L72D 4U3JB 5H6RA 4LCUC 2FYUH 5GTIH 2R9IA 3P30A 2DJVA 2XNDG 1JFFA 4DK0A 2QM4A 2W6IG 2PAJA 2R72A 1IK7A 1PGJA 1K73Q 5L3EA 4JI7B 1M1JA 2ODMA 2ZM6B 1S76D 3SYPA 1XHXA 2RN0A 4CH4A 3OW2U 2OQQA 5KLVJ 2QJPB 3THOA 5C39A 5ITZB 2LGWA 3CXHI 3TDKA 3OA7A 4AQRD 2RH0A 4ZOLB 1MG1A 4TUYB 3C3TA 2QSIA 1GKFA 2M7WA 1OMIA 3B5ND 1XTCC 2EIKB 3QO8A 2LO1A 1AJQA 1QU7A 2P22C 2FYUG 2HYNA 2UU9O 4J9ZB 1SA0A 5EK0A 3L71D 1IBKO 4CPGA 3JD0A 5LYJA 4YY3O 3L75G 1CXZB 3D36C 3HE4A 3A0HZ 2O3JA 3IC7A 3O6QA 1XUQA 1YIJV 1OIPA 4KUMA 3CMAP 4H0LC 3LSSA 3ASOC 1W2BO 1FDMA 3O9OA 1VQKV 3L74H 3ABMC 1BCCG 1GN2A 2KNCB 1GRJA 4UVBA 2E75B 1LTJA 3CX5D 1EXIA 3FD9A 1J1DC 4Q20A 3D3QA 2YEVB 1KILE 2CH7A 4MVRA 1AR5A 3CX5F 1NU1K 2YXRB 3ZMSA 3RK2D 2HG5C 3AE8C 1EDKA 3ZHRA 4J7ZA 3A0RA 1SQVK 4NTWA 2IBZD 1SQVE 1SF9A 3SYCA 3LNMB 2EIMB 1RF0C 2W0FC 1BSMA 5LA6A 4LF6O 1PKXA 4FLXA 5BMVB 1YTFD 1L0NJ 1EC5A 3E8FA 4E4EA 4X64B 1A02J 1TGOA 1OCCC 4RWUA 1M9NA 3V4QA 1P84F 1R1BA 3CRCA 4ABMA 2L35A 5B3SC 5JWPA 3FAVB 1KQFB 1H2SB 3VYIA 3PJSK 3CCUV 1NVPD 2YXHA 2IX7C 3DXRB 1YF2A 2K3RA 3P8CE 5APVA 3Q1MA 1SERA 3CE2A 3J7AU 4DR5O 3SWYA 5AW3B 3KZIZ 1SQQE 2NPSB 2Y4UA 1TU3F 2F4VO 4GUNA 2YMYA 2J58A 3BAAA 3K5NA 4OGQC 1LJ2A 2MW2B 3CHXA 2NZ2A 1YCIA 1B6QA 3IFMA 2HG5D 3TCUA 3S9OA 4YJ2A 1JOCA 4PJ0Z 2XDJA 2EZPA 1QR9A 2FYUD 2WPRA 1QVFO 2OTLV 1W59A 4F6RB 3GB7C 2KLVA 1H0TA 1GN6A 4JZGA 3HTKA 2Z5IA 3E1RA 3NFQA 5KKZB 1JY2O 1NT2B 5CN0A 4A5UB 4G28B 4Z1VA 5B5EZ 4U7NA 4AYCA 1IFDA 3EHBB 1S5LE 2C9NY 2QWNB 1N32O 2PZSA 1XOUA 5B66E 4PA9A 3H1HJ 1KQLA 2OIEA 2ZDIC 4PI2A 5KAFH 1Y66A 4PHZA 1WJZA 2ZD9A 1BT8A 4O4JB 1ZWIC 5FNVB 1YTFB 3H1LJ 4BIOA 3HKDA 2EINC 1EZVE 4XDJA 1L0NG 2M8RA 5JQGB 3SYAA 1X79B 3TK1A 1EXJA 1CSBA 4FMTA 4RO2A 4OXSA 3RW0A 3L71H 2Z3YA 2QWPB 4X66B 1WAZA 1YJWV 1U7JA 4BAYA 1P84D 2AZ0A 2ZCEA 1OVRA 1X9VA 4H13D 3T4ZA 1G8MA 2Q4PA 2IH3C 3DGEA 2GSMB 4JI7O 1LTTC 4I9QA 1SFCD 3OW2O 1NTMD 4LFBB 1ZOYC 4X64O 2ZR2A 2KS1B 5C8YA 4JI4O 1QVFU 1SP4A 2KS1A 1AROP 5CHXA 2QKAA 5H9CA 2FKXA 1XNRB 1ZV8A 5B1OA 1P7GA 3CCMV 5APSA 4L74A 5LOVA 1N2DC 1K4DC 2F93B 3HKBA 1J2JB 1IZ3A 3JD4A 2OCCC 2BOCC 2OIGA 3I55V 5GTHZ 3AG3B 1KQSU 3BRVB 4JI3O 1ZLLA 1EN4A 2A06E 3H1IJ 2A45I 4KHXA 1K9MW 1YZBA 3II6A 4PD4H 2PF4E 1ZP0C 3VOUA 3HD7C 2W27A 1QNMA 4NVPA 1XMOB 1AFOA 5BU5A 1K3EA 3FYEB 3W7TA 5DECA 1BCCE 2OYIA 3BCCE 2GUZB 2J5UA 2LXCB 1HR0O 1Q7YW 5H6QA 2KOGA 1FJGO 5LGNA 5KLVH 5LHHA 1T6AA 4G2KA 1OW8A 3LDCA 5H2FE 5IYBO 5HFMA 4JASA 5LMNO 1NQTA 2E74B 2OYHC 1SS1A 1H2LA 2WLLA 1GN4A 3H01A 3E2EA 1LR1A 1QCEA 2PGGA 3V2NA 2HVJC 4NXNB 1OJHA 2P1JA 4LF4B 3SPGA 1HUCA 4X88A 1FXHA 1Y76B 3U0ZA 2P7TC 1KILA 1S5HC 2N9YB 4JBZA 2YC0A 1YSCA 1ZSPA 3SPJA 1QLNA 1PGQA 1PV3A 3JSVC 4I5SA 4ZKIA 2RMZA 4DV3O 2IYPA 4DOJA 1K7DA 3I5DA 3E86A 3ZX6A 3CS5A 1BHBA 3DTUB 2P2UA 2WWWA 1S5JA 4J7JA 4J9YB 5CB4B 1L0LK 2ZVOB 3KZIH 2GM4A 2N1TA 3JALB 1SQBG 1BS3A 4EI2A 3H1IG 3B71A 1P4RA 4WVZA 2Q7GA 4EEQA 4WCEV 4LFAO 1LTSC 3RVZA 4JPZB 1KZUB 1SQVG 1YHQP 4N78E 5KX5B 2QJKC 1VQOP 3T1CA 3SDLA 2OARA 4UCVA 3ICXA 1KYOH 4I1LA 2KSEA 3MP7B 4NPDA 2FXOA 1ROPA 2NPSA 4TQDA 4CH6A 2UUBO 3OAKA 4NKGB 4JYAB 2N04A 1WP8A 1KYOI 5APUA 3E22A 2O01J 2V7QG 3K03A 2ZT9D 2Q7CA 1BQZA 2B9BA 2ZINA 4JV5B 1FYJA 1XMQB 4B3MB 1FXKB 1G1IA 1V9PA 5LXTB 5AVTB 3T97B 2JJ1G 3FXDA 2GTAA 3MIWA 3L70G 1VQ8P 1E1QG 1EZVG 3HTKB 1L0NE 4E2LA 2XZRA 2PTMA 4FLTA 2Q0AA 2DMXA 1H89A 2QJKB 4KP4A 4XE5B 4RQEA 1KORA 4B3TB 2WMMA 3P32A 3ZHUA 1RHZB 3K5BA 3RT3C 4W7YA 1ZMEC 2OTJP 1GK6A 1O9HA 3R4YA 4JF7A 2YIDA 2YNYA 3CCJV 2K9JA 3ZHSA 3ASNC 4WBNB 3QH9A 2DWDC 5CA3A 1EDIA 4JI8O 1KYOE 3N27A 4YTPC 2EINB 3H1KE 1EZVI 3L37A 2O57A 3RK3D 1B06A 4MSWC 1AB3A 2R70A 5KLVK 1N34B 1VQ5V 1JJ2U 1OW6A 1YDXA 3FB6C 1ZUQA 1AP6A 4PD4I 4DR7O 1AVOA 3BCCD 4XDKA 4R50A 1VF7A 5EC1C 3P3NA 1P84I 3TNUB 5CA1A 3CCRV 1RSOB 4LR3A 3STZC 1FDIA 3L73D 4IOIH 1HWTC 2I1KA 3A0BZ 1V54C 5L8RJ 4PDMA 3AK1A 4GKGA 4JTAB 1D5NA 5IYZA 1L4AD 1XL6A 3Q4HA 3IF4A 1QQCA 4DV0O 1PL5A 3K5LA 4FVMA 1K92A 2XKMA 2UUBB 2EIJC 4J41A 1N73C 1EM1A 4N21A 1FZBA 2KZIA 3VMYA 4FJCC 2ZE7A 2JWAA 3L74G 1SQFA 5J2TA 4Y99C 1N73A 4D7SA 4WFGA 1OZ0A 1CI6A 4CS2A 1JUNA 4UCOA 2K9YA 4X9QA 4JYYA 1NTMK 4TLFA 4Y99B 1NTME 2WSSH 2WSFJ 3JATA 4FK5C 4O2AA 5D5PA 1KFMA 1Q43A 2IJJA 4MT8A 4X62B 1FBMA 1M7LA 5KHGA 5LL6Y 1GTOA 1IZNB 1WLEA 3AEDC 2V1DA 4L8JA 3M8AA 2XV5A 1UJWB 1PD3A 4LFCB 2CAZC 2HVKC 1OCRB 4N23A 1SETA 3H1KH 2ZYAA 1JTHB 3N4XA 1SQXH 1JTHA 4X1YA 1Y76A 1ZXGA 3CX5I 2JKVA 1PPJE 4H44B 3J80N 3CC7P 3CLQA 1BL8A 4JI8B 1RQUA 2AXTH 1BGYE 4B7KA 2V4HA 3V2QA 1NOHA 2CTQA 1XNQO 4DR4O 2ADPA 2RDCA 3GF3A 1JX9A 1YBKA 1FZCC 2WLHA 1GN3A 2V7QH 1T2KD 5IYDO 5BU8B 3RYCB 2IFNA 2WLKA 4IL6X 4WFHA 3NTNA 3JASA 5KMGA 2XAHA 4GX1A 1L4AC 2L91A 4G27B 1ZR4A 5BR8B 1FXKC 4ASUG 1FXVA 1I5YA 3U1AA 1AQTA 3OM3B 3ZBHA 1XREA 3B2EE 3C90A 3FB5C 4DR4B 4JYAO 1X4TA 2JVDA 1S4XA 1URQD 1S5LX 4WFEA 3RBXA 4WFAV 3AEEC 5KJ7A 3H25A 3EFFK 3HUSB 3OD4A 4O4IB 2FY8A 1NHLA 4CC5A 1R73A 2VWKA 4HZ3A 4D6TG 1MUUA 1PFIA 1KP3A 1MZEA 1GDTA 2W0XA 3NR7A 2VRSA 4YJ3B 2QM8A 1VF6C 4KT0J 1V55B 1LWUB 1IBLB 4LF9O 1K73W 2A06G 2FFDA 2EBOA 4OGQB 3UT5A 2LP7A 2OGUA 3K57A 1DD4A 1IBMO 4IT5A 1Z2GA 3A0HE 3E89A 1SQXD 5LHGA 4LGDE 1VEWA 3JSLA 4J80A 1VQLP 1H2KA 4GX2A 1DK1A 1N32B 3HD7B 3LSUA 3ZHTA 1SC5B 1XI1A 4P9PA 3RGBA 1I94B 3S1KA 2YUAA 1SQBD 4NXNO 5EFWB 5IDJA 1PP9E 1RM1B 4U3FJ 1ZR2A 1NTZD 4QJFB 1IO4A 2FXMA 1NTZJ 1NBMG 3A0BH 1K5SA 2M5AB 2CK3G 2UUAO 2E74C 2OYHB 2IW5A 1NTKJ 3SPHA 3GF7A 5DJTB 5FL7G 1W0JG 4ZKUA 4X1IB 1LTJC 4JGSA 3AEFC 1U7MA 4UVAA 3M0DA 3RK3B 1BCCH 1TUBB 1JY3P 1RF1A 1L0NK 3AK3A 5AW1B 5CA1B 2UXBO 4OH8B 4U7OA 3M0DC 4JYBA 1K04A 5KA6A 1D7MA 1PP9D 1URQA 4OGQD 1SFCB 4P9OA 1RF1C 4C7UA 3ZS8C 4M3LA 1N34O 3CXHD 4ZNCA 2YI9A 1B3QA 4FLZA 3T1HO 1VPCA 2YO2A
chains in the Genus database with same CATH topology
4Z1MH 3RL0g 4GDOA 2QJPC 4R4MA 1YQ3C 2JO1A 1VF5D 3AE4C 4IL6X 3Q2YA 1VF5B 1KORA 2YMKA 1OW7A 4H13B 1R8EA 3AE5C 2FYNC 4RKUJ 3GLMA 3Q3DA 1ZMEC 1HJ0A 4R4LA 1ZP0C 3R4YA 2MKVA 3AEGC 1KMIZ 3IAOA 2YIUC 1YQ4C 2E74D 3AECC 4U7JA 1NGMB 3AEAC 1GMJA 1KQFB 4I7ZB 4PV1D 1S5LX 2G8YA 4YTPC 1RQVA 3AEEC 3H25A 2J5UA 4H0LD 4XFJA 3Q1MA 1S1CX 4I7ZC 2QJYC 3AE1C 3Q5SA 2D2CD 1OW8A 2WSEJ 2FXPA 5KKZC 2E74B 2ZT9C 3SFDC 2H89C 1TU3F 3RK3E 3ABVC 2E76B 1OW6A 2WPVB 1U57A 3C8VA 3D6ZA 4OGQC 1DIPA 2E75C 4H44C 4KT0J 2NZ2A 1VL2A 2E76C 2WSCJ 3S9OA 4H13C 4OGQB 3AE2C 2JP3A 1FDIA 3IN6A 1DD4A 5L8RJ 2BEZF 4PV1B 1KQGB 1PV3A 3D6YA 3AE9C 2P10A 1IK7A 2IDBA 4H0LB 1PL5A 3Q5RA 3G9RA 2V7QJ 2QIWA 2FBWC 1DD3A 5M1BA 4TT3H 2OQQA 1WMKA 2H88C 1UIXA 2G3AA 2ZT9B 3EWKA 4YXDC 2D2CB 3FGAD 1VF5C 1JB0J 3B71A 2QSIA 1OMIA 1AJYA 3GMAA 2K9YA 2D2CC 1EXJA 1FDOA 1K05A 2BEQD 2QJKC 2WSFJ 2E74C 2E75D 3GF7A 4H44D 1NYHA 3SFEC 3D71A 1ZRTE 1Q90D 3AEDC 4PV1C 1Y9BA 2E76D 3AEBC 3O6QA 4H13D 3D70A 4H0LC 3AEFC 2O01J 2WQYC 1KTMA 5KLIC 3AE6C 1ZOYC 2ZT9D 1EXIA 2E75B 4H44B 1KILE 3AE3C 1RQUA 1K04A 4OGQD 3LW5J 3T97B 3AE7C 4Y28J 1MKMA 3AE8C 1HF9A 3GF3A 3Q5PA 1PIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  2WSE J;  2QJP C;  1Q90 D;  4IL6 X;  2E74 B;  2QIW A;  5KKZ C;  1VF5 B;  2E76 B;  2WPV B;  3C8V A;  4H13 B;  2FYN C;  4RKU J;  4KT0 J;  2O01 J;  2ZT9 B;  2D2C B;  5KLI C;  2YIU C;  2WSC J;  1JB0 J;  4OGQ B;  2E75 B;  4H44 B;  2QSI A;  4I7Z B;  2K9Y A;  5L8R J;  3LW5 J;  1S5L X;  2QJK C;  2WSF J;  4PV1 B;  4Y28 J;  2QJY C;  4H0L B; 
#chains in the Genus database with same CATH topology
 4AUW A;  3L70 J;  3JAW B;  1GL2 A;  1BMF G;  4DR7 B;  4FFB A;  1BGY J;  5K5G B;  4K0K B;  2WLI A;  5JQG A;  2JS5 A;  4FZ0 A;  1NJI Q;  3GHG B;  4C7N B;  1KYO F;  3AE5 C;  2QVA A;  4O2B A;  3K3W A;  5IJ9 A;  1IBL O;  5IE9 A;  3DC5 A;  4LP8 A;  1NGM B;  2Q6Q A;  2GA1 A;  4FZ1 A;  3ABT A;  1AI4 A;  3MDS A;  1L0L H;  1RFY A;  2FTK A;  2MK3 A;  3TSI A;  5JJJ B;  2VWJ A;  3H1J H;  1RQV A;  4U3F G;  4D6T H;  2EX3 A;  1JM0 A;  2NR5 A;  1M8O B;  1DF4 A;  3BY6 A;  4RO0 A;  2XT9 A;  4MVM A;  4NXM O;  1H2M A;  2OYO A;  1Q81 W;  3ABV C;  4QPJ A;  1FAV A;  1EZJ A;  1SQX E;  3E8G A;  1EN6 A;  1E1R G;  1JO5 A;  3VMA A;  1NTM G;  4IL6 Z;  1NH2 B;  2B1G A;  4X1Y B;  3WG7 B;  1E5W A;  1G1J A;  2YIA A;  1W5C E;  5BR8 O;  4DJG A;  1H8A A;  5CCG A;  2OYQ A;  2ATK C;  1SQP J;  1TVK A;  2R9A A;  1FZF A;  1NR7 A;  4DV5 B;  3CCR P;  1PZQ A;  1M93 A;  1JR9 A;  1M4U A;  4DV4 O;  2O1K A;  3B8M A;  1M90 W;  3ETQ A;  3BVH A;  3HPL C;  4GYC B;  2C0W A;  4ZOL A;  2E5Y A;  5AVV B;  4X66 O;  3TNU A;  3GVM A;  1VQ6 P;  4GIF A;  3OR7 C;  4O9B A;  2A0L A;  2HFE C;  1Y4M A;  3SSU A;  1QR8 A;  2KSJ A;  2XU6 A;  3H1J D;  2Y4T A;  1WMK A;  2IZ0 A;  3HE5 A;  1I08 A;  1WP7 A;  1BGY G;  1KV4 A;  4YIP A;  4ZI7 B;  2JWD A;  4FLU A;  3SWK A;  5AVU B;  3ZHQ A;  1Z5W A;  3CCQ P;  2DW3 A;  4X1K B;  4PDL A;  3CC2 V;  3L74 J;  3KCX A;  1X8Y A;  3O6Q B;  4KFM A;  2R44 A;  1B04 A;  3FFQ A;  2DOS A;  2Q5U A;  4XA4 A;  3I56 P;  4CH3 A;  2KG7 B;  3F5H A;  1Q6U A;  2E76 D;  2KB1 A;  1AIL A;  1KU9 A;  3OTO O;  3A7O A;  1GZL A;  2CH7 B;  4BWA A;  3VMZ A;  3G71 P;  2R9R B;  3AG4 C;  1RF0 A;  4PDR A;  3L75 H;  1FZE A;  3TF5 A;  1QBZ A;  3TGU D;  1PP9 G;  1RH5 B;  3CC7 V;  1VQ5 P;  1S3J A;  2XAQ A;  4GLX A;  1PIX A;  1USE A;  4ICG A;  1L0L E;  4Z1M H;  1BE3 D;  2GUS A;  2QTS A;  4WF9 V;  1SQV H;  3M99 B;  4BRY B;  1NS1 A;  3F5T A;  1I7F A;  3FAV A;  3ZMZ A;  1RM1 C;  2PYL A;  1FZC B;  1FOS F;  1US6 A;  1M57 D;  1N0J A;  3RYF B;  4B3M O;  3KPE A;  1J1D B;  4P30 A;  1NTK E;  2UXX A;  3N2G B;  4WFB V;  2OWO A;  1G2C A;  5AW6 B;  3TYY A;  3F5W C;  1JY2 P;  1LP1 A;  5APX A;  1GO3 F;  1XL4 A;  1GD2 E;  3OAA G;  2VQF B;  4PV1 D;  5CCG D;  1YYC A;  2G8Y A;  5LGU A;  1EDL A;  4AI8 A;  1PPJ G;  4XFJ A;  3EQ2 A;  3H32 A;  5F2V O;  3CCE V;  3B8E B;  1COW G;  4EYY Q;  2WSE J;  3PRJ A;  2WLM A;  2Q7E A;  3K58 A;  4HH2 A;  5IYC O;  4YJ2 B;  2ZT9 C;  2CPB A;  3RK3 E;  2VQE B;  5FLX N;  2E76 B;  4QE7 A;  4ZHQ B;  4O4H A;  3B40 A;  4YXW H;  2WSC J;  4RES B;  5C8Y B;  2PRR A;  1ZL8 A;  4DV6 B;  2WIT A;  4JZ2 A;  1SFC A;  2DQ3 A;  2BEZ F;  1XNR O;  2O01 N;  1XIL A;  4DV2 B;  3QF7 A;  3CPW O;  4I4T A;  4FLY A;  4H33 A;  4JF3 A;  2IU0 A;  1M57 C;  3RL0 B;  3CCS V;  4H0L B;  2IDB A;  3CWB J;  3L75 D;  4CZZ A;  3JD1 A;  4GKJ O;  5KAF Z;  3CCL V;  2IJK A;  4B3R B;  1GM9 A;  2NLJ C;  2CK3 H;  3M9Q A;  3RK2 C;  2IH1 C;  1PNL A;  2QTO A;  4YHH B;  1M56 C;  1RE3 A;  2RNB A;  2ZE6 A;  1KKC A;  3OUS A;  4LBE C;  2UXB B;  5CBN A;  3EWK A;  1T2K C;  2D2C B;  2DYR B;  3OEE G;  2SPZ A;  3UM7 A;  1CI6 B;  1EQ7 A;  1LT9 C;  3W68 A;  4UFZ A;  3RYH A;  3MUD A;  4I50 B;  1S72 P;  3JD3 A;  4NPE A;  1AJY A;  4LWS B;  2R5D A;  2JGD B;  2YXQ B;  1XDC A;  2X7R B;  4X20 A;  1HNX O;  3OE7 G;  2LKM A;  1L2P A;  4J11 A;  1R6K A;  4IFD K;  3KHU A;  3D8C A;  1GK9 A;  2QA4 V;  4NTX A;  1M1K Q;  4F6E A;  1NTK G;  3G3Z A;  2JK5 C;  3F89 A;  3E7K A;  2F1M A;  2Y69 B;  3M7M X;  2WLN A;  1SQX K;  3O65 A;  4R8C A;  3H1J J;  2KK7 A;  3L72 G;  4JPR A;  2J59 M;  1NWQ A;  1USD A;  3TGU E;  1BHA A;  4GKK O;  1HDJ A;  4X1I A;  4EB6 A;  3ZMV A;  1BE3 J;  1MNG A;  3JAM N;  3JSN A;  5B1B B;  1DLB A;  1OCO B;  3MTU E;  1D5A A;  1UII A;  5D5Q A;  3L9D A;  1S9K E;  1SQG A;  4DV3 B;  2BCC H;  3QVN A;  4DRX A;  1SQP D;  3TGU J;  2ZIO A;  4BIZ A;  3JAS B;  5KMG B;  2VQE O;  5LA6 B;  3W7W A;  4O4L B;  3B5N C;  4IHJ A;  5E1A C;  4N3Y B;  1NTK H;  1Z5V A;  3FWN A;  3SPC A;  3CME V;  2WTY A;  3VTP C;  2MKV A;  1SA0 B;  3V5B A;  5LP6 B;  5AW9 B;  5LP6 A;  1VQN V;  3FXE A;  4W4K A;  2DYR C;  4LLH A;  5AW8 B;  3V4W A;  3H1L H;  2N1T D;  2Z5U A;  4JAU A;  3BA8 A;  1Q3E A;  3MZW B;  3H1H H;  5BZB A;  1R5L A;  3L74 D;  4UV8 A;  4IIJ B;  4TV8 A;  2W83 C;  2NN4 A;  4PA7 A;  2BTO A;  2A7W A;  2OTJ V;  2ZXW B;  2BSK B;  1Q86 W;  1O9G A;  2UXC O;  2B87 A;  4WY4 B;  5FPO A;  2IPP A;  4NYK A;  1VL2 A;  2HR3 A;  3A2A A;  5BVZ A;  5EIB D;  1ZN5 A;  4JTD B;  3TXS A;  3L75 J;  4HYT B;  2Q1K A;  1IBM B;  2XAJ A;  1R3J C;  5CA0 B;  2FML A;  1WA8 B;  3CJH B;  3OFN G;  3CMA V;  3L73 G;  1KD1 Q;  3MHS C;  4AHC A;  2QRX A;  5IJ0 A;  5LMU O;  5TIS H;  2XNX A;  2YIB A;  2ZM6 O;  2YKQ A;  3LID A;  3K59 A;  3VMX A;  1QLE D;  1NZ6 A;  3BCC G;  4ASV A;  1AJP A;  5A2Q N;  1VQ7 P;  2FBW C;  2IBZ E;  1BDC A;  3E35 A;  3KQG A;  2UXD O;  1PM9 A;  2FL4 A;  3LNN A;  5L3F A;  2G3A A;  4O4I A;  3L70 E;  1KIL D;  2P4V A;  1AQ5 A;  1HNZ B;  2UU9 B;  4LH6 A;  2X6A A;  5CB4 A;  3A5T A;  1IFP A;  1NTK D;  1K05 A;  3LUT B;  4PD4 D;  5B5E H;  2EIJ B;  2IFM A;  1OCR C;  4FM2 A;  1NYH A;  4QNH B;  2F95 B;  1I94 O;  3MGN A;  2C9L Y;  2K88 A;  2M6Y A;  1SQB J;  1N4C A;  2Y0C A;  3JCU H;  5LXT A;  3DXR A;  3JCU Z;  2JRI A;  1MZ9 A;  3ML0 A;  1I5X A;  2XTA A;  1OXZ A;  1RPO A;  3JAK B;  5JJN B;  4K8Z A;  4QE9 A;  1VQM V;  3L70 D;  3D36 A;  1ZTE A;  1SQB E;  2KUB A;  2Q6A A;  1SQX J;  1N8R Q;  2EIL C;  3VQV A;  3T1H B;  1N36 B;  1FKA O;  4IYH A;  3OUF A;  3CRM A;  1WN7 A;  3L73 J;  1M1K W;  2ZR3 A;  2JO1 A;  1LTB C;  1FOS E;  1OV9 A;  2IYO A;  3WB2 A;  3W7X A;  4WBN A;  3E8B A;  4PD4 E;  3RL0 D;  3E83 A;  3GLM A;  4R4L A;  5EZY B;  1KMI Z;  3IAO A;  3CPW U;  3FB7 C;  3CX5 H;  2JDI H;  2CTW A;  1SKV A;  3SWF A;  2ARH A;  4KL1 A;  1SS3 A;  2YI8 A;  3WU2 E;  1IFM A;  3ZRX A;  3OT7 A;  3RYF A;  3O8Z A;  4GKK B;  3H1K J;  1S1C X;  1SES A;  4FIP C;  1IBK B;  3WUV A;  3AG2 C;  3Q5S A;  3G6E P;  1LUW A;  1EBO A;  3C1L A;  1N33 O;  3MD0 A;  1F4N A;  1RSO A;  3C3S A;  4LFC O;  3VQY A;  2VS0 A;  3ZN0 A;  1URQ B;  1VQ4 P;  5B1A B;  2L5G B;  2HP8 A;  3R2P A;  2Q0O C;  2Y48 A;  4DK1 A;  4I55 A;  1XMQ O;  4LF4 O;  4L76 A;  1P84 H;  3RYI B;  1IFI A;  1M56 B;  2W90 A;  5IY5 B;  1G4Y B;  1XHZ A;  1M1J B;  4EDF A;  4BW9 A;  4CBC A;  2Y0D A;  2HOD B;  4DZO A;  4TWK A;  2R32 A;  2WLI B;  4TV9 A;  1IK9 A;  3GHG A;  1MSW D;  4C7N A;  4TV9 B;  3D6Y A;  1YJ9 P;  2WVR A;  4UB6 Z;  1V54 B;  4DRX B;  1NTK K;  1K33 A;  1Q8I A;  2PGD A;  1VQ9 V;  2CPS A;  1N7S B;  1THZ A;  3CWB G;  3AG2 B;  5BMV A;  4LF6 B;  1IXB A;  1OFC X;  3L71 J;  3JAL A;  4DV1 B;  4JI0 B;  3K9S A;  4GOF A;  1GL2 B;  1UFI A;  4OX9 B;  3HKD B;  1FZA A;  3DSQ A;  1Z56 A;  2X6C A;  1NO4 A;  3WG7 C;  3PH0 A;  2IJH A;  2PY5 A;  1WPX A;  3HD7 D;  1H8E G;  3CRR A;  1JCD A;  3LSQ A;  2AGA A;  1DTO A;  2QA4 P;  2ZXE B;  2Q68 A;  3RK2 B;  3SFE C;  2A45 H;  4MVU A;  2KB7 P;  4PV1 C;  3KDP B;  2Y0P A;  2WT7 A;  1WB7 A;  4X20 B;  1GMG A;  4OX9 O;  5AVZ B;  1FD9 A;  2LFR A;  2CGO A;  5JCO C;  2WQY C;  1JY3 O;  3CSX A;  3AE6 C;  1YVW A;  1BGY D;  1KC8 W;  4JYC A;  4U3F H;  3UO2 A;  3H1J G;  5CMU A;  4LH7 A;  3AE3 C;  5L3D A;  3RWR D;  4WY4 D;  3KZI E;  2KQX A;  3LIE A;  1N8R W;  1SQQ G;  3Q5P A;  1AV1 A;  5B1N A;  2B1I A;  2ITD C;  3RL0 g;  1S5L H;  5EBM C;  2HKO A;  3A8T A;  1HGV A;  4DT0 A;  1X22 A;  3AG1 B;  3BHP A;  2Q8V A;  2YMK A;  1R8E A;  3IFX A;  4GX0 A;  3X2Q B;  3P7K A;  5AG2 A;  3FX0 A;  2C2A A;  4UB8 E;  1MZF A;  1Y47 A;  3VN0 A;  1GU4 A;  3BFR A;  2B88 A;  5JH7 B;  1D2D A;  3VP8 A;  4YPC A;  3ETE A;  3ZMT A;  2OTL P;  2FFD C;  2GHY A;  1Q82 W;  1U97 A;  2N1T B;  5IWA B;  1NKZ B;  1KB9 H;  2ITA A;  1QVG O;  2QJY C;  2Q69 A;  3M0A A;  3CWB E;  3M91 A;  1N86 A;  1R3I C;  4K35 A;  1SQQ H;  3J81 N;  1S2E A;  4OVN F;  1PNK A;  3UO3 A;  3OJA B;  1UPG A;  2WPV B;  3G4S P;  4ZIB A;  1M1J C;  1IVS A;  3ABL B;  1GH6 A;  1KYO D;  1Q5O A;  2PI4 A;  2KXP B;  1TA8 A;  5LGT A;  2Q7H A;  1KN7 A;  3CRQ A;  4UUJ C;  3CCU P;  1BSH A;  3MHV A;  2FYZ A;  3E22 B;  1HWY A;  2JR8 A;  3N2K A;  1FS0 G;  3U11 A;  4W7Z A;  2YSU B;  3WU2 Z;  4LF5 O;  3GG2 A;  1K34 A;  4DUY O;  3Q5R A;  1LTI C;  5KAI H;  3OTF A;  1QLE B;  2YXL A;  2V7Q J;  4R6Z A;  1SQQ J;  3CWB D;  3QWO C;  3K06 A;  4K0K O;  1KB9 E;  2YO3 A;  2NNU A;  3AG3 C;  2ZT9 B;  1BE3 H;  4TUY A;  5KUM A;  5AVY B;  3RYH B;  2LR2 A;  2OTK E;  2LFS A;  3ZRW A;  3T1Y B;  4TSF G;  5CBO A;  3F7Y C;  4GCZ A;  3N2G A;  2Z4E A;  2UXN A;  1RE4 C;  4DR5 B;  1W2E A;  2K9J B;  3BRT B;  1VDF A;  4XBF A;  3D71 A;  4RUF A;  1FJG B;  1Y9B A;  3ETD A;  2F4V B;  1HP8 A;  5A9G A;  5LMN B;  4FM1 A;  5JJE B;  1JFF B;  3EVK A;  2HPC B;  1Y74 B;  1NTZ G;  2IBZ G;  4JI6 B;  5KLI C;  3HKC A;  3ZDM A;  4U3F E;  3RYI A;  1YJW P;  1R6T A;  4DUZ B;  4RUE A;  3G6B A;  2LJ2 A;  1HBW A;  1FJP A;  1VQM P;  1K8A W;  3AE7 C;  4O4H B;  2NPS C;  1OZH A;  5B66 H;  4UVC A;  1QX8 A;  3BPZ A;  3CCV V;  1SQX G;  1YQ3 C;  3U10 A;  3ZED A;  5IT9 N;  4DYL A;  3SJQ C;  4IYI A;  4HB1 A;  4GT1 A;  2QWQ B;  2GUZ A;  1LT1 A;  1QLE C;  3CRA A;  3UQ8 A;  2K1A A;  2AEM A;  3A0B E;  3CC4 P;  2D3O W;  2FKW B;  3T4D A;  3GWK C;  1NKN A;  1YQ4 C;  3AEC C;  1YJ9 V;  3JCU E;  2WZ7 A;  4I7Z B;  3CP1 A;  5E79 Z;  4HBN A;  4UCT A;  5KX5 A;  2M0B A;  2CDY A;  4WFF A;  1VQL V;  4D6T D;  3UIA A;  1OX3 A;  4H37 A;  5AW7 B;  1N36 O;  3EXA A;  4I50 A;  2WSE H;  3E8H A;  4UB8 H;  2H89 C;  4X65 O;  2YEV A;  1NU1 G;  2B87 B;  2Y0E A;  3A0H H;  2LQT A;  2Z0A A;  5LYJ B;  2M3E A;  3VQW A;  4MS2 A;  1YI2 V;  1U96 A;  2XAS A;  1QEX A;  1VMG A;  5GON A;  1AI6 A;  3WB0 A;  4F6R A;  3PP5 A;  5AW5 B;  4JAA A;  2N9B A;  2H43 A;  2ZKO A;  1OCC B;  1AI5 A;  2QSA A;  3CCE P;  2R5B A;  4ZKP A;  1KFN A;  3KCY A;  4NB5 A;  1RE3 C;  5KUK A;  4AIL C;  3L4F A;  2JS3 A;  2CE4 A;  2RJZ A;  2HEP A;  5E79 H;  1KKD A;  1SVF A;  1GW3 A;  3ABL C;  1LT9 A;  4MW3 A;  1K97 A;  2BTQ B;  3MHH C;  2NPS D;  5IY5 C;  4GOD A;  3VP9 A;  1FFX B;  2H88 C;  3QTC A;  4J7K A;  4YXD C;  4NR1 A;  5BXZ A;  1MMM A;  3FGA D;  3CME P;  3SJB C;  2F23 A;  1JB0 J;  4GZR B;  1OVV A;  2W6A A;  3PN1 A;  4AQY B;  3GMA A;  2G38 A;  2QJY B;  3RL0 C;  1SQQ K;  1L0L G;  5GTH H;  1VQN P;  2W6J H;  4RJT A;  2OYI B;  1JVM A;  4JI1 O;  2DQ0 A;  4YXW G;  1N7S C;  5HFL A;  4YY3 B;  3M9H A;  3WU2 H;  1R6N A;  1ZRT E;  2BAS A;  3SYQ A;  2DYS B;  1LTA C;  4X1K A;  2ETN A;  3H1L D;  1SZT A;  5EIB C;  4FLV A;  1YJN V;  1M90 Q;  1JCH A;  1ENV A;  4DUY B;  1NKD A;  1K8A Q;  5CA0 A;  3ZRS A;  3AG1 C;  1PL4 A;  1GU5 A;  3RFR A;  3MAQ A;  1LUV A;  3S4R A;  4LC1 A;  4BXL A;  2WT7 B;  1G6U A;  3CD6 V;  3G6E V;  1YHQ V;  3DC6 A;  4TQF A;  1OWA A;  5C93 A;  2A9H A;  3CXH F;  2ZAE B;  3HD7 A;  2IM9 A;  3BEH A;  4Y28 J;  1I0H A;  2Y9Y A;  1LNQ A;  3B5N A;  1GM8 A;  2ZXW C;  4R4M A;  2OYI C;  2FYN B;  1P84 E;  3RYC A;  4B3S B;  3SJA C;  3P8M C;  1KBH A;  2QKC A;  2ITC C;  4H13 B;  1VQ7 V;  3H1H E;  1FZG A;  1N73 B;  2OYH A;  1PP9 J;  1H38 A;  4PA4 A;  3AK2 A;  1DEE G;  1Y67 A;  4U7J A;  2ZFC A;  2IJI A;  1VQ9 P;  1VQ6 V;  3B09 A;  2QJ1 A;  3FKS G;  1Y8A A;  4C46 A;  1JPX A;  1Q86 Q;  1S5L Z;  1L4A A;  4J10 A;  1KIL C;  1ZW0 A;  3CL3 D;  2EIK C;  4JI5 B;  2BCC G;  1L4A B;  1SFC C;  3H1I H;  3U1C A;  2AXT E;  1RF1 B;  1HR0 B;  2POH A;  1XQ8 A;  4A7P A;  3A2F A;  4U3J A;  1GW4 A;  2XND H;  2LXB A;  3SFD C;  3L74 E;  3AEI A;  4C7R A;  3JYC A;  3ITK A;  4NXM B;  3P8C D;  4I55 B;  4EIJ A;  1X0T A;  4JV5 O;  2Q5Z A;  3HKC B;  1JJO A;  1WB8 A;  2KKW A;  2IBZ H;  1LTG C;  5KLV G;  3K0D A;  3K79 A;  1VP7 A;  2ZIM A;  1NAY A;  1CZQ A;  4AQY O;  1AJN A;  1CW5 A;  2N74 A;  3OR6 C;  3TET A;  1HW7 A;  2P10 A;  1KUQ A;  2JGU A;  1ORQ C;  1N0N A;  4O4L A;  1VQO V;  1SQP E;  1DD3 A;  3G71 V;  3HRN A;  4TT3 H;  3ABK C;  2YIU B;  5LOV B;  3Q4H B;  3N2K B;  2RN9 A;  1KB9 I;  4ZI7 A;  2EUL A;  4RAI A;  4JI2 B;  4O4J A;  5FNV A;  5LHI A;  1N7L A;  3BAS A;  3M9B A;  3CX5 E;  2EIL B;  3SPI A;  4UCS A;  2B5U A;  3IC9 A;  3S3X A;  3KG2 A;  1BCC J;  4QMA A;  2H8P C;  3QG5 A;  4LFA B;  4NPF X;  2OT5 A;  1URF A;  2E3C A;  2GDS A;  1F7Y A;  1FS0 E;  2DN9 A;  1SQV D;  2BCC J;  2E5L O;  4RQF A;  2ADQ B;  4I0X B;  2PFX A;  1J1E C;  4I0X A;  1KTM A;  2B89 A;  1T5E A;  2F43 G;  2HHH B;  4LF9 B;  3JD2 A;  5B1A C;  5GON B;  4DV2 O;  1IJD B;  3AG4 B;  1PPJ D;  1WRG A;  1NVO A;  2BCC E;  2PUS A;  5KJ7 D;  2Z5H A;  4DR1 B;  1Q6I A;  3SYO A;  5AVS B;  1ZAU A;  3I56 V;  1JCC A;  4LNU B;  4GDO A;  3HUS C;  1YI2 P;  1JY2 N;  1VF5 D;  1ZLZ A;  4MVS A;  1XBL A;  2BTQ A;  3L75 E;  1NTM J;  2YIB D;  1PL0 A;  2Y0I A;  1R5S A;  3L71 E;  3B8N A;  5AVW B;  4MTF A;  5KLV E;  1IXM A;  1BE3 G;  3HUS A;  2RMK B;  3IGA C;  4DR2 O;  1TAE A;  3BCC H;  5IJ9 B;  2HFE D;  2RCV A;  3AEA C;  1GMJ A;  2R3C A;  2QE7 H;  1MSD A;  4QIW F;  5EBL C;  3L36 A;  3B77 A;  3TGU G;  1RPR A;  1K5Q A;  2HJD A;  1JQ0 A;  2KP8 A;  2CTP A;  3CCS P;  5JVD A;  4FLW A;  2UUA B;  3AE1 C;  1PV0 A;  2D2C D;  2GV9 A;  2OCH A;  3IR9 A;  3OEH G;  4MVO A;  2WPS A;  3HE4 B;  1YIT V;  1P49 A;  3OGI B;  2KI7 B;  2WLL B;  2AXC A;  3CWB H;  4QPK A;  1FJK A;  3WFV A;  2CGN A;  4H44 C;  1CP9 A;  1FFT B;  3C9I A;  4DCK A;  3K08 A;  4JQ0 D;  1OHH G;  2QKS A;  2E76 C;  3GHG C;  4JI2 O;  3H1H G;  3AE2 C;  1XNQ B;  4MVZ A;  5IWA O;  4DV4 B;  1OCZ C;  2V4D A;  1TVK B;  4PDV A;  1GAX A;  1BZK A;  3H1L G;  3ABU A;  1NI8 A;  2N05 A;  2YS8 A;  2K1E A;  1FPO A;  3AE9 C;  4WY4 A;  3CCJ P;  4Z1M G;  3B5N B;  3UT5 B;  2P6J A;  4LF5 B;  3UKM A;  4DR3 O;  1EZV H;  3BA9 A;  3TGU H;  1S77 D;  4DXW A;  1VQ4 V;  1L0L D;  5BY1 A;  4WY4 C;  3P3P A;  1JY3 N;  5M1B A;  1H0T B;  1NAF A;  4O2B B;  2HLD G;  5H2F Z;  5CJ0 A;  5CCG C;  2AEJ A;  4D6T E;  3VQX A;  4L75 A;  3AG7 A;  1VF5 C;  2IBZ I;  1FAF A;  2F66 C;  5GW7 A;  3IJ4 A;  1A02 F;  1KP2 A;  3G67 A;  2XHB A;  1YTZ T;  4HNA A;  2JGD A;  1AVY A;  2D2C C;  1HTL C;  3T1Y O;  3BAT A;  5GTI Z;  1FDO A;  1AVM A;  5GTH E;  2WPQ A;  2A06 H;  4OPH A;  2E75 D;  2JDI G;  3BAB A;  3SR2 C;  1Q90 D;  3TXQ A;  1YEW A;  4MTG A;  2ZXX A;  1BDD A;  1GL2 D;  1M57 B;  3D70 A;  2RKL A;  2M5A A;  2AEF A;  5J9P C;  2UUC O;  1L0N D;  2DE0 X;  3JCZ A;  2Q3E A;  1XEQ A;  5IYZ B;  3CC2 P;  1JMK C;  4DR2 B;  2WPD G;  3H32 B;  4N78 D;  5KTB A;  4JI6 O;  2CUG A;  5E79 E;  2QR4 A;  3PTZ A;  3W7S A;  1NU1 D;  3BVO A;  4U3F D;  5AW0 B;  4L73 A;  3H9V A;  1FXK A;  4FM0 A;  1JEK A;  4PA3 A;  4DV5 O;  2OCC B;  5CBG A;  3CD6 P;  4BIU A;  1T3U A;  2EJ7 A;  2QWO B;  1JA8 A;  3L73 H;  3APO A;  3ZN1 A;  4B3T O;  5AVQ B;  2JEX A;  1SQP K;  3AE4 C;  1NTZ K;  1QL1 A;  1OW7 A;  4L87 A;  3HKB B;  3JC2 2;  4MN4 C;  4DV1 O;  1HNW O;  3W67 A;  4CS4 A;  4N6J A;  2E5L B;  1HVV A;  2JIZ G;  1JMB A;  5KA5 A;  1VF6 A;  1T8Z A;  2W6J G;  1SLQ A;  4EOT A;  5KAF E;  1Q7Y Q;  5CCH D;  4H0L D;  1MOF A;  3H1J E;  1KB9 D;  1J5E B;  1Y74 A;  3ZHV A;  3ASO B;  1QGK B;  1OCO C;  1DH3 A;  5DJU B;  3GWO A;  1KIL B;  1G1X B;  2AHY A;  4B3S O;  2ZVN B;  2QE7 G;  1RP3 B;  4X89 A;  1U57 A;  1VQK P;  1LWU A;  2JEE A;  2JJL A;  2X0L A;  4ZHQ A;  5DED A;  4UB6 H;  1KEC A;  1V55 C;  3HKE A;  1ZL8 B;  4P2Z A;  1LWU C;  3CCQ V;  1WA8 A;  3CJH A;  3WB1 A;  1TUE B;  4EFE A;  4ASW A;  2E43 A;  4B3R O;  2H7H A;  4DV0 B;  3N7N A;  1M5I A;  5AW4 B;  4MVQ A;  1SQV J;  4FFK A;  5LMU B;  4KHP O;  2LW1 A;  4LNU A;  1E79 H;  4HYO A;  3L72 J;  3G4S V;  2UUC B;  2BE3 A;  1Q81 Q;  1GK4 A;  1IUR A;  2Q9I A;  1HJB A;  4DW0 A;  4D6T J;  3RGU A;  3V2P A;  1BCC D;  1PNM A;  1Y6X A;  2K9P A;  5J2T B;  5TIS Z;  1SZX A;  4DW1 A;  2ZDI A;  4EKW A;  1RE4 A;  5JCO A;  1HNZ O;  4LF8 B;  1MA1 A;  4IL6 E;  1DEB A;  2O01 H;  1PP9 H;  3G80 A;  4WBA A;  1H88 A;  1Q82 Q;  5KHH A;  2BSK A;  3L35 A;  2A06 D;  1H2G A;  1L8D A;  3OMI B;  1URQ C;  3L71 G;  5EYP B;  3NMD A;  1BE3 E;  5L3G A;  2N1T C;  4UB6 E;  2CTR A;  3MUD C;  2YXY A;  4DR3 B;  1AR1 B;  4TOI A;  5B3S B;  1QL2 A;  4GOE A;  3F7V C;  3B4S A;  1HNW B;  5H2F H;  3M06 A;  4GX5 A;  4JI1 B;  1VQP P;  2AHZ A;  1FC2 C;  4YJ3 A;  1QVG U;  2R3S A;  1NR1 A;  1JMM A;  3R66 A;  4MTO A;  4DV6 O;  1F4M A;  1MKM A;  4I9W A;  1PGO A;  2EIM C;  2W6B A;  3VOP A;  3GW6 A;  4QGP A;  1SQB H;  3SJC C;  5EC2 C;  3U59 A;  2WA3 A;  3KKY A;  4DO2 A;  3Q2Y A;  4ZBM A;  5LBQ A;  1VF5 B;  4CH5 A;  3OMA B;  1EDJ A;  3STL C;  3ZIA G;  3HB3 B;  2FYN C;  1DF5 A;  3AEG C;  3HE5 B;  2P90 A;  2E74 D;  2DW4 A;  1YIJ P;  1EN5 A;  5APY A;  5TJH A;  3CCV P;  2QGN A;  1NTZ E;  3A3Y B;  3BCC J;  3VBB A;  1NH4 A;  4Q6G A;  1TUB A;  1BSN A;  3UCS C;  1H2N A;  1NTM H;  1SQQ D;  4PEL A;  3FYI B;  1LP1 B;  2FXP A;  2JEU A;  4K8X A;  3OTO B;  3QO7 A;  4JTC B;  4R7C A;  1WPB A;  2NRG A;  5LP6 C;  3H1I E;  3OMN B;  1N33 B;  2DYS C;  2A45 G;  1L1F A;  3ZCC A;  1K9M Q;  2KYV A;  1A32 A;  5CBF A;  4ZMD A;  2LGQ A;  3LW5 H;  1PGP A;  2FYU E;  4H13 C;  5GTI E;  2QEX P;  2JP3 A;  4LF8 O;  4KJM A;  3IN6 A;  4IFF A;  1R3L C;  1GM7 A;  3CEI A;  1KQG B;  4B86 A;  3FWL A;  3H1H D;  4CC6 A;  2ZYG A;  4Z2W A;  3WUU A;  1BGY H;  4BWN A;  1S72 V;  4UCU A;  4I2L C;  5AVX B;  1F23 A;  3K0G A;  2QIW A;  1J1E B;  1FE6 A;  3KXD A;  5APW A;  3HR0 A;  3PLN A;  2O1J A;  3USS A;  3RN4 A;  2A3Q A;  2ZE5 A;  4I4T B;  2WLJ A;  2WA4 A;  4W80 A;  3ZMU A;  1H8H G;  1UIX A;  2E42 A;  2Y69 C;  1AI7 A;  2YKP A;  2I8D A;  5L3B A;  1X59 A;  2LW7 A;  4JI0 O;  2WSC H;  2L6L A;  1R3K C;  1YXB A;  2Q9L A;  3BRC A;  5J2U A;  5EBW C;  4IGG A;  3EFG A;  1MFT A;  4PJ0 H;  1GTW A;  4JI4 B;  3V6I A;  4D7T A;  1IX9 A;  3H1L E;  1WNS A;  4FPP A;  3ZRW B;  4X65 B;  2WSS G;  1DGS A;  2VRZ A;  3E1I A;  1MAB G;  3CXH E;  3CB2 A;  3FB8 C;  2GBO A;  3APQ A;  4UXN A;  2Y9Z A;  1OCZ B;  2YDE A;  3T2M A;  3CXC U;  4LFB O;  5B66 Z;  2QG4 A;  2ZQM A;  4J42 A;  4I6M C;  3H1K G;  3JAR A;  1DX7 A;  3LW5 J;  3JAR B;  3QO5 A;  5TIS E;  4DV7 O;  1XMO O;  1IDS A;  2IU3 A;  4GKJ B;  3WUT A;  1HF9 A;  3R65 A;  2UWJ E;  2H3O A;  2XAG A;  2FYU K;  4BR6 A;  4MW8 A;  4JI5 O;  2ZE8 A;  4HJG H;  2QJP C;  1Q2N A;  2Q73 A;  1YJN P;  1ZRT D;  3WMM 0;  4JI3 B;  2HOD A;  3K04 A;  3LDE A;  4FFB B;  4YHH O;  3OGC C;  2RQ6 A;  5ITZ A;  3Q3D A;  5KHK A;  4LF7 B;  4PI0 A;  3SGI A;  1T3J A;  2H8P D;  1G2C B;  2A79 B;  1VIB A;  3ABK B;  2YIU C;  5B1B C;  3H6P A;  3KYQ A;  4DV7 B;  3L73 E;  5APT A;  2KG7 A;  3K5O A;  1EZV D;  4WWI A;  5H5N A;  3K5M A;  1HNX B;  3L72 E;  4IHJ B;  4LWS A;  3FX7 A;  2QM7 A;  5B5E E;  4KHP B;  2B9Z A;  2M3B A;  3ASN B;  4X62 O;  4B7E A;  1F51 A;  1SRY A;  3ZJZ A;  1EFR G;  2QWR B;  5EYP A;  1IFN A;  2I1J A;  3L70 H;  5KLI B;  3CCM P;  4CS3 A;  3ABM B;  1E79 G;  1DIP A;  2E75 C;  3CXH H;  5KAI Z;  1P7B A;  4DUZ O;  5KJ7 C;  3I55 P;  2Q67 A;  5DN6 G;  1LTJ B;  2MJZ A;  2KNC A;  1SQB K;  1MFZ A;  3RVY A;  3D3I A;  4UB8 Z;  1RY3 A;  3I5C A;  1LT9 B;  2ZNJ A;  1L0N H;  4UV9 A;  3LDD A;  3ZRV A;  2HLO A;  1YIT P;  4PV1 B;  5KLV D;  1KD1 W;  3NXS A;  2ZJS E;  3H1I D;  5CMZ A;  2PP6 A;  1VAR A;  1PPJ H;  1NU1 J;  3HKE B;  1K4C C;  2P67 A;  5DM6 V;  1NU1 H;  3G9R A;  2X6B A;  1KC8 Q;  1WT6 A;  2P4K A;  1N7S A;  1AR4 A;  2ZYD A;  1HGZ A;  1S9K D;  2GUV A;  5IJ0 B;  1VQP V;  2EJR A;  3H1K D;  5L3C A;  4UCR A;  2KIK A;  1NVP B;  2YKO A;  5JVD B;  5AW2 B;  1SQP H;  2BCC D;  3RBZ A;  2H94 A;  2E5T A;  3IAY A;  1NTZ H;  1NU1 E;  4BRY A;  2HJF C;  4HNA B;  5K1X A;  3RK3 C;  2C0X A;  2GTS A;  4OPA A;  2YIC A;  4NTY A;  4OWF A;  1QHT A;  1FFX A;  2BEQ D;  2QDO A;  2PI5 A;  2P58 A;  2P7J A;  1NH2 D;  2KLU A;  2WAM A;  1NJI W;  1HH0 A;  4DR1 O;  4H44 D;  1CPY A;  3K9A A;  5JH7 A;  3JAK A;  4IIJ A;  4TV8 B;  5CBH A;  3TJT A;  3AEB C;  1YTZ I;  5CCH C;  4WB4 A;  4EFB A;  2WSF H;  1KB9 F;  2HPC A;  3CC4 V;  2EZO A;  4LF7 O;  1W0K G;  1L0L J;  3CCL P;  5CCH A;  2FFD B;  3S3W A;  4PA6 A;  3JAW A;  4TT3 G;  2ZNI A;  3CI9 A;  3W7U A;  3QNE A;  1MV8 A;  2AXT Z;  3T97 A;  1CEZ A;  1J95 A;  4YIO A;  3ETG A;  5CJ4 A;  4XDL A;  1JNM A;  4MTX A;  4HKZ H;  4W4L A;  5EZY A;  3L72 H;  1Q6H A;  1AP5 A;  3X2Q C;  2AW9 A;  1S0V A;  5AVR B;  5KAI E;  1XTG B;  2UXD B;  1FZC A;  1ZX3 A;  1W2B U;  4PJ0 E;  1FU1 A;  4RKU J;  2KZJ A;  1HJ0 A;  3JAT B;  4DR6 O;  2Q3I A;  2BOB C;  4KXR A;  4O2A B;  4IL6 H;  2FYU J;  1BQ0 A;  1IFJ A;  1KQS O;  2JJ2 G;  1M56 D;  4F4L A;  2VQF O;  2P06 A;  4PD4 F;  1GL2 C;  5J2U B;  1IC2 A;  2KSD A;  2ILM A;  5KHI A;  4I7Z C;  4JAV A;  1SQP G;  2AZ2 A;  1J5E O;  1LGH B;  2PYJ A;  2XUM A;  2W8Z A;  2IZ1 A;  4DR6 B;  5KKZ C;  3V2R A;  5FPR A;  5KHJ A;  4X8A A;  2FB5 A;  4HAM A;  1VQ8 V;  4EB6 B;  2XOK G;  1JOY A;  4K3A A;  3C8V A;  2P5O A;  1N7S D;  3D6Z A;  3CYO A;  2XAF A;  4IFM A;  1OVU A;  2QEX V;  3PHL A;  4B08 A;  4BW5 A;  5K1P A;  2K37 A;  5APQ A;  1AA0 A;  2DWE C;  2HHH O;  2UXC B;  3L72 D;  4U3J B;  5H6R A;  4LCU C;  2FYU H;  5GTI H;  2R9I A;  3P30 A;  2DJV A;  2XND G;  1JFF A;  4DK0 A;  2QM4 A;  2W6I G;  2PAJ A;  2R72 A;  1IK7 A;  1PGJ A;  1K73 Q;  5L3E A;  4JI7 B;  1M1J A;  2ODM A;  2ZM6 B;  1S76 D;  3SYP A;  1XHX A;  2RN0 A;  4CH4 A;  3OW2 U;  2OQQ A;  5KLV J;  2QJP B;  3THO A;  5C39 A;  5ITZ B;  2LGW A;  3CXH I;  3TDK A;  3OA7 A;  4AQR D;  2RH0 A;  4ZOL B;  1MG1 A;  4TUY B;  3C3T A;  2QSI A;  1GKF A;  2M7W A;  1OMI A;  3B5N D;  1XTC C;  2EIK B;  3QO8 A;  2LO1 A;  1AJQ A;  1QU7 A;  2P22 C;  2FYU G;  2HYN A;  2UU9 O;  4J9Z B;  1SA0 A;  5EK0 A;  3L71 D;  1IBK O;  4CPG A;  3JD0 A;  5LYJ A;  4YY3 O;  3L75 G;  1CXZ B;  3D36 C;  3HE4 A;  3A0H Z;  2O3J A;  3IC7 A;  3O6Q A;  1XUQ A;  1YIJ V;  1OIP A;  4KUM A;  3CMA P;  4H0L C;  3LSS A;  3ASO C;  1W2B O;  1FDM A;  3O9O A;  1VQK V;  3L74 H;  3ABM C;  1BCC G;  1GN2 A;  2KNC B;  1GRJ A;  4UVB A;  2E75 B;  1LTJ A;  3CX5 D;  1EXI A;  3FD9 A;  1J1D C;  4Q20 A;  3D3Q A;  2YEV B;  1KIL E;  2CH7 A;  4MVR A;  1AR5 A;  3CX5 F;  1NU1 K;  2YXR B;  3ZMS A;  3RK2 D;  2HG5 C;  3AE8 C;  1EDK A;  3ZHR A;  4J7Z A;  3A0R A;  1SQV K;  4NTW A;  2IBZ D;  1SQV E;  1SF9 A;  3SYC A;  3LNM B;  2EIM B;  1RF0 C;  2W0F C;  1BSM A;  5LA6 A;  4LF6 O;  1PKX A;  4FLX A;  5BMV B;  1YTF D;  1L0N J;  1EC5 A;  3E8F A;  4E4E A;  4X64 B;  1A02 J;  1TGO A;  1OCC C;  4RWU A;  1M9N A;  3V4Q A;  1P84 F;  1R1B A;  3CRC A;  4ABM A;  2L35 A;  5B3S C;  5JWP A;  3FAV B;  1KQF B;  1H2S B;  3VYI A;  3PJS K;  3CCU V;  1NVP D;  2YXH A;  2IX7 C;  3DXR B;  1YF2 A;  2K3R A;  3P8C E;  5APV A;  3Q1M A;  1SER A;  3CE2 A;  3J7A U;  4DR5 O;  3SWY A;  5AW3 B;  3KZI Z;  1SQQ E;  2NPS B;  2Y4U A;  1TU3 F;  2F4V O;  4GUN A;  2YMY A;  2J58 A;  3BAA A;  3K5N A;  4OGQ C;  1LJ2 A;  2MW2 B;  3CHX A;  2NZ2 A;  1YCI A;  1B6Q A;  3IFM A;  2HG5 D;  3TCU A;  3S9O A;  4YJ2 A;  1JOC A;  4PJ0 Z;  2XDJ A;  2EZP A;  1QR9 A;  2FYU D;  2WPR A;  1QVF O;  2OTL V;  1W59 A;  4F6R B;  3GB7 C;  2KLV A;  1H0T A;  1GN6 A;  4JZG A;  3HTK A;  2Z5I A;  3E1R A;  3NFQ A;  5KKZ B;  1JY2 O;  1NT2 B;  5CN0 A;  4A5U B;  4G28 B;  4Z1V A;  5B5E Z;  4U7N A;  4AYC A;  1IFD A;  3EHB B;  1S5L E;  2C9N Y;  2QWN B;  1N32 O;  2PZS A;  1XOU A;  5B66 E;  4PA9 A;  3H1H J;  1KQL A;  2OIE A;  2ZDI C;  4PI2 A;  5KAF H;  1Y66 A;  4PHZ A;  1WJZ A;  2ZD9 A;  1BT8 A;  4O4J B;  1ZWI C;  5FNV B;  1YTF B;  3H1L J;  4BIO A;  3HKD A;  2EIN C;  1EZV E;  4XDJ A;  1L0N G;  2M8R A;  5JQG B;  3SYA A;  1X79 B;  3TK1 A;  1EXJ A;  1CSB A;  4FMT A;  4RO2 A;  4OXS A;  3RW0 A;  3L71 H;  2Z3Y A;  2QWP B;  4X66 B;  1WAZ A;  1YJW V;  1U7J A;  4BAY A;  1P84 D;  2AZ0 A;  2ZCE A;  1OVR A;  1X9V A;  4H13 D;  3T4Z A;  1G8M A;  2Q4P A;  2IH3 C;  3DGE A;  2GSM B;  4JI7 O;  1LTT C;  4I9Q A;  1SFC D;  3OW2 O;  1NTM D;  4LFB B;  1ZOY C;  4X64 O;  2ZR2 A;  2KS1 B;  5C8Y A;  4JI4 O;  1QVF U;  1SP4 A;  2KS1 A;  1ARO P;  5CHX A;  2QKA A;  5H9C A;  2FKX A;  1XNR B;  1ZV8 A;  5B1O A;  1P7G A;  3CCM V;  5APS A;  4L74 A;  5LOV A;  1N2D C;  1K4D C;  2F93 B;  3HKB A;  1J2J B;  1IZ3 A;  3JD4 A;  2OCC C;  2BOC C;  2OIG A;  3I55 V;  5GTH Z;  3AG3 B;  1KQS U;  3BRV B;  4JI3 O;  1ZLL A;  1EN4 A;  2A06 E;  3H1I J;  2A45 I;  4KHX A;  1K9M W;  1YZB A;  3II6 A;  4PD4 H;  2PF4 E;  1ZP0 C;  3VOU A;  3HD7 C;  2W27 A;  1QNM A;  4NVP A;  1XMO B;  1AFO A;  5BU5 A;  1K3E A;  3FYE B;  3W7T A;  5DEC A;  1BCC E;  2OYI A;  3BCC E;  2GUZ B;  2J5U A;  2LXC B;  1HR0 O;  1Q7Y W;  5H6Q A;  2KOG A;  1FJG O;  5LGN A;  5KLV H;  5LHH A;  1T6A A;  4G2K A;  1OW8 A;  3LDC A;  5H2F E;  5IYB O;  5HFM A;  4JAS A;  5LMN O;  1NQT A;  2E74 B;  2OYH C;  1SS1 A;  1H2L A;  2WLL A;  1GN4 A;  3H01 A;  3E2E A;  1LR1 A;  1QCE A;  2PGG A;  3V2N A;  2HVJ C;  4NXN B;  1OJH A;  2P1J A;  4LF4 B;  3SPG A;  1HUC A;  4X88 A;  1FXH A;  1Y76 B;  3U0Z A;  2P7T C;  1KIL A;  1S5H C;  2N9Y B;  4JBZ A;  2YC0 A;  1YSC A;  1ZSP A;  3SPJ A;  1QLN A;  1PGQ A;  1PV3 A;  3JSV C;  4I5S A;  4ZKI A;  2RMZ A;  4DV3 O;  2IYP A;  4DOJ A;  1K7D A;  3I5D A;  3E86 A;  3ZX6 A;  3CS5 A;  1BHB A;  3DTU B;  2P2U A;  2WWW A;  1S5J A;  4J7J A;  4J9Y B;  5CB4 B;  1L0L K;  2ZVO B;  3KZI H;  2GM4 A;  2N1T A;  3JAL B;  1SQB G;  1BS3 A;  4EI2 A;  3H1I G;  3B71 A;  1P4R A;  4WVZ A;  2Q7G A;  4EEQ A;  4WCE V;  4LFA O;  1LTS C;  3RVZ A;  4JPZ B;  1KZU B;  1SQV G;  1YHQ P;  4N78 E;  5KX5 B;  2QJK C;  1VQO P;  3T1C A;  3SDL A;  2OAR A;  4UCV A;  3ICX A;  1KYO H;  4I1L A;  2KSE A;  3MP7 B;  4NPD A;  2FXO A;  1ROP A;  2NPS A;  4TQD A;  4CH6 A;  2UUB O;  3OAK A;  4NKG B;  4JYA B;  2N04 A;  1WP8 A;  1KYO I;  5APU A;  3E22 A;  2O01 J;  2V7Q G;  3K03 A;  2ZT9 D;  2Q7C A;  1BQZ A;  2B9B A;  2ZIN A;  4JV5 B;  1FYJ A;  1XMQ B;  4B3M B;  1FXK B;  1G1I A;  1V9P A;  5LXT B;  5AVT B;  3T97 B;  2JJ1 G;  3FXD A;  2GTA A;  3MIW A;  3L70 G;  1VQ8 P;  1E1Q G;  1EZV G;  3HTK B;  1L0N E;  4E2L A;  2XZR A;  2PTM A;  4FLT A;  2Q0A A;  2DMX A;  1H89 A;  2QJK B;  4KP4 A;  4XE5 B;  4RQE A;  1KOR A;  4B3T B;  2WMM A;  3P32 A;  3ZHU A;  1RHZ B;  3K5B A;  3RT3 C;  4W7Y A;  1ZME C;  2OTJ P;  1GK6 A;  1O9H A;  3R4Y A;  4JF7 A;  2YID A;  2YNY A;  3CCJ V;  2K9J A;  3ZHS A;  3ASN C;  4WBN B;  3QH9 A;  2DWD C;  5CA3 A;  1EDI A;  4JI8 O;  1KYO E;  3N27 A;  4YTP C;  2EIN B;  3H1K E;  1EZV I;  3L37 A;  2O57 A;  3RK3 D;  1B06 A;  4MSW C;  1AB3 A;  2R70 A;  5KLV K;  1N34 B;  1VQ5 V;  1JJ2 U;  1OW6 A;  1YDX A;  3FB6 C;  1ZUQ A;  1AP6 A;  4PD4 I;  4DR7 O;  1AVO A;  3BCC D;  4XDK A;  4R50 A;  1VF7 A;  5EC1 C;  3P3N A;  1P84 I;  3TNU B;  5CA1 A;  3CCR V;  1RSO B;  4LR3 A;  3STZ C;  1FDI A;  3L73 D;  4IOI H;  1HWT C;  2I1K A;  3A0B Z;  1V54 C;  5L8R J;  4PDM A;  3AK1 A;  4GKG A;  4JTA B;  1D5N A;  5IYZ A;  1L4A D;  1XL6 A;  3Q4H A;  3IF4 A;  1QQC A;  4DV0 O;  1PL5 A;  3K5L A;  4FVM A;  1K92 A;  2XKM A;  2UUB B;  2EIJ C;  4J41 A;  1N73 C;  1EM1 A;  4N21 A;  1FZB A;  2KZI A;  3VMY A;  4FJC C;  2ZE7 A;  2JWA A;  3L74 G;  1SQF A;  5J2T A;  4Y99 C;  1N73 A;  4D7S A;  4WFG A;  1OZ0 A;  1CI6 A;  4CS2 A;  1JUN A;  4UCO A;  2K9Y A;  4X9Q A;  4JYY A;  1NTM K;  4TLF A;  4Y99 B;  1NTM E;  2WSS H;  2WSF J;  3JAT A;  4FK5 C;  4O2A A;  5D5P A;  1KFM A;  1Q43 A;  2IJJ A;  4MT8 A;  4X62 B;  1FBM A;  1M7L A;  5KHG A;  5LL6 Y;  1GTO A;  1IZN B;  1WLE A;  3AED C;  2V1D A;  4L8J A;  3M8A A;  2XV5 A;  1UJW B;  1PD3 A;  4LFC B;  2CAZ C;  2HVK C;  1OCR B;  4N23 A;  1SET A;  3H1K H;  2ZYA A;  1JTH B;  3N4X A;  1SQX H;  1JTH A;  4X1Y A;  1Y76 A;  1ZXG A;  3CX5 I;  2JKV A;  1PPJ E;  4H44 B;  3J80 N;  3CC7 P;  3CLQ A;  1BL8 A;  4JI8 B;  1RQU A;  2AXT H;  1BGY E;  4B7K A;  2V4H A;  3V2Q A;  1NOH A;  2CTQ A;  1XNQ O;  4DR4 O;  2ADP A;  2RDC A;  3GF3 A;  1JX9 A;  1YBK A;  1FZC C;  2WLH A;  1GN3 A;  2V7Q H;  1T2K D;  5IYD O;  5BU8 B;  3RYC B;  2IFN A;  2WLK A;  4IL6 X;  4WFH A;  3NTN A;  3JAS A;  5KMG A;  2XAH A;  4GX1 A;  1L4A C;  2L91 A;  4G27 B;  1ZR4 A;  5BR8 B;  1FXK C;  4ASU G;  1FXV A;  1I5Y A;  3U1A A;  1AQT A;  3OM3 B;  3ZBH A;  1XRE A;  3B2E E;  3C90 A;  3FB5 C;  4DR4 B;  4JYA O;  1X4T A;  2JVD A;  1S4X A;  1URQ D;  1S5L X;  4WFE A;  3RBX A;  4WFA V;  3AEE C;  5KJ7 A;  3H25 A;  3EFF K;  3HUS B;  3OD4 A;  4O4I B;  2FY8 A;  1NHL A;  4CC5 A;  1R73 A;  2VWK A;  4HZ3 A;  4D6T G;  1MUU A;  1PFI A;  1KP3 A;  1MZE A;  1GDT A;  2W0X A;  3NR7 A;  2VRS A;  4YJ3 B;  2QM8 A;  1VF6 C;  4KT0 J;  1V55 B;  1LWU B;  1IBL B;  4LF9 O;  1K73 W;  2A06 G;  2FFD A;  2EBO A;  4OGQ B;  3UT5 A;  2LP7 A;  2OGU A;  3K57 A;  1DD4 A;  1IBM O;  4IT5 A;  1Z2G A;  3A0H E;  3E89 A;  1SQX D;  5LHG A;  4LGD E;  1VEW A;  3JSL A;  4J80 A;  1VQL P;  1H2K A;  4GX2 A;  1DK1 A;  1N32 B;  3HD7 B;  3LSU A;  3ZHT A;  1SC5 B;  1XI1 A;  4P9P A;  3RGB A;  1I94 B;  3S1K A;  2YUA A;  1SQB D;  4NXN O;  5EFW B;  5IDJ A;  1PP9 E;  1RM1 B;  4U3F J;  1ZR2 A;  1NTZ D;  4QJF B;  1IO4 A;  2FXM A;  1NTZ J;  1NBM G;  3A0B H;  1K5S A;  2M5A B;  2CK3 G;  2UUA O;  2E74 C;  2OYH B;  2IW5 A;  1NTK J;  3SPH A;  3GF7 A;  5DJT B;  5FL7 G;  1W0J G;  4ZKU A;  4X1I B;  1LTJ C;  4JGS A;  3AEF C;  1U7M A;  4UVA A;  3M0D A;  3RK3 B;  1BCC H;  1TUB B;  1JY3 P;  1RF1 A;  1L0N K;  3AK3 A;  5AW1 B;  5CA1 B;  2UXB O;  4OH8 B;  4U7O A;  3M0D C;  4JYB A;  1K04 A;  5KA6 A;  1D7M A;  1PP9 D;  1URQ A;  4OGQ D;  1SFC B;  4P9O A;  1RF1 C;  4C7U A;  3ZS8 C;  4M3L A;  1N34 O;  3CXH D;  4ZNC A;  2YI9 A;  1B3Q A;  4FLZ A;  3T1H O;  1VPC A;  2YO2 A; 
#chains in the Genus database with same CATH homology
 4Z1M H;  3RL0 g;  4GDO A;  2QJP C;  4R4M A;  1YQ3 C;  2JO1 A;  1VF5 D;  3AE4 C;  4IL6 X;  3Q2Y A;  1VF5 B;  1KOR A;  2YMK A;  1OW7 A;  4H13 B;  1R8E A;  3AE5 C;  2FYN C;  4RKU J;  3GLM A;  3Q3D A;  1ZME C;  1HJ0 A;  4R4L A;  1ZP0 C;  3R4Y A;  2MKV A;  3AEG C;  1KMI Z;  3IAO A;  2YIU C;  1YQ4 C;  2E74 D;  3AEC C;  4U7J A;  1NGM B;  3AEA C;  1GMJ A;  1KQF B;  4I7Z B;  4PV1 D;  1S5L X;  2G8Y A;  4YTP C;  1RQV A;  3AEE C;  3H25 A;  2J5U A;  4H0L D;  4XFJ A;  3Q1M A;  1S1C X;  4I7Z C;  2QJY C;  3AE1 C;  3Q5S A;  2D2C D;  1OW8 A;  2WSE J;  2FXP A;  5KKZ C;  2E74 B;  2ZT9 C;  3SFD C;  2H89 C;  1TU3 F;  3RK3 E;  3ABV C;  2E76 B;  1OW6 A;  2WPV B;  1U57 A;  3C8V A;  3D6Z A;  4OGQ C;  1DIP A;  2E75 C;  4H44 C;  4KT0 J;  2NZ2 A;  1VL2 A;  2E76 C;  2WSC J;  3S9O A;  4H13 C;  4OGQ B;  3AE2 C;  2JP3 A;  1FDI A;  3IN6 A;  1DD4 A;  5L8R J;  2BEZ F;  4PV1 B;  1KQG B;  1PV3 A;  3D6Y A;  3AE9 C;  2P10 A;  1IK7 A;  2IDB A;  4H0L B;  1PL5 A;  3Q5R A;  3G9R A;  2V7Q J;  2QIW A;  2FBW C;  1DD3 A;  5M1B A;  4TT3 H;  2OQQ A;  1WMK A;  2H88 C;  1UIX A;  2G3A A;  2ZT9 B;  3EWK A;  4YXD C;  2D2C B;  3FGA D;  1VF5 C;  1JB0 J;  3B71 A;  2QSI A;  1OMI A;  1AJY A;  3GMA A;  2K9Y A;  2D2C C;  1EXJ A;  1FDO A;  1K05 A;  2BEQ D;  2QJK C;  2WSF J;  2E74 C;  2E75 D;  3GF7 A;  4H44 D;  1NYH A;  3SFE C;  3D71 A;  1ZRT E;  1Q90 D;  3AED C;  4PV1 C;  1Y9B A;  2E76 D;  3AEB C;  3O6Q A;  4H13 D;  3D70 A;  4H0L C;  3AEF C;  2O01 J;  2WQY C;  1KTM A;  5KLI C;  3AE6 C;  1ZOY C;  2ZT9 D;  1EXI A;  2E75 B;  4H44 B;  1KIL E;  3AE3 C;  1RQU A;  1K04 A;  4OGQ D;  3LW5 J;  3T97 B;  3AE7 C;  4Y28 J;  1MKM A;  3AE8 C;  1HF9 A;  3GF3 A;  3Q5P A;  1PIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...