2E76D

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
168
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 35
structure length 168
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e76D02
4OGQD 2E75C 3FOUA 5KKZC 1RIEA 2HMLA 4QDFA 1PP9E 2BMRA 2B24A 3GL2A 3EN1A 3GTSA 5AEUA 2B1XA 3VMGD 2YMKA 3L74E 3VCPA 5HL4A 3VMID 2GBXA 4NBFD 1G8KB 2FYNC 2JO6A 4HM2A 2ZT9D 4NB9D 3GL0A 4H13D 2XSOA 4QDCA 1BE3E 1SQPE 4P1BH 4H44C 2QPZA 1UUWA 1P84E 1NU1E 2YFLA 3AZCA 4AAYB 4HJLA 2Q3WA 1O7GA 3H1LE 1VCKA 3GKEA 1O7HA 2QJKC 3CWBE 4H44D 1ULIA 4NBGD 4EMJB 2IBZE 1NTZE 2HMMA 1KYOE 2E74C 1PPJE 4I7ZC 1JM1A 4NBHD 2D2CC 5BOKA 4QURA 1SJGA 1L0LE 1NTKE 3L75E 3CX5E 4NBAD 3GCEA 1EZVE 4QUPA 3VMHD 2QJPC 1BCCE 4HKVA 2QJYC 2D2CD 1SQXE 3H1KE 2DE5D 1ZRTE 3L70E 2E4PA 4H0LD 3H1JE 4NBDD 3BCCE 3L72E 2HMJA 2NUKA 2E76C 4HM8A 2E76D 1UUVA 3TGUE 3H1IE 4HM3A 2E4QA 3GTEA 2CKFA 2E75D 2HMKA 1VM9A 2BMQA 1SQQE 3N0QA 5CXMA 2YVJB 2FYUE 2NVFA 4QCKA 3CXHE 1EG9A 2A06E 4HM5A 3EQQA 1O7MA 5KLVE 1NDOA 3VCAA 4OGQC 2YFJA 1NYKA 2YIUC 4NBED 2JZAA 4HM7A 1G8JB 1L0NE 1KB9E 1Q90C 3GZYA 2ZYLA 2DE6D 1O7WA 1ULJA 4QDFB 3GZXA 2XSHA 2NUMA 4HM1A 2DE7D 2BCCE 2I7FA 4QDDA 2HMOA 3DQYA 2ZT9C 1O7NA 2NVEA 2XRXA 4QUQA 3C0DA 2BMOA 4AIVA 5AEWA 1FQTA 1RFSA 4PD4E 1SQBE 2XR8A 4HM6A 4HM4A 1WQLA 4HM0A 2GBWA 2NWFA 2E74D 4NB8D 2YFIA 1O7PA 1VF5D 4P1CH 4NBCD 4PV1C 1VF5C 3L71E 3L73E 3GOBA 2HMNA 1SQVE 3GB4A 4NBBD 5KLIC 2NVGA 3D89A 4H13C 3H1HE 4H0LC 4U3FE 4PV1D 1NTME
chains in the Genus database with same CATH superfamily
4HB1A 2HMLA 1FJPA 1NTZK 2WT7A 3L74E 3RBZA 3B71A 1Y9BA 2HLOA 3GL0A 4H44C 2Q3IA 3GMAA 4H44D 3M9QA 1PGOA 3P8CD 1LWUB 3TDKA 3M0DC 2QG4A 1BE3D 2D2CD 1N7SA 4L74A 4U3FJ 1QVFO 4LLHA 2IBZD 4GKGA 1K04A 1N7SD 3HUSA 1EDLA 3D6ZA 5AW3B 5APUA 2A45H 2YKPA 1O7MA 1AQTA 1R8EA 5K5GB 1DIPA 3VCAA 4OGQB 3A0HH 3BCCG 1EZVG 3RL0g 2RMZA 1GU4A 3EWKA 5M1BA 4QDFB 1Z56A 4QDDA 4WY4A 1H89A 2JEEA 4EIJA 2HPCA 2I8DA 3CCSP 1URQB 3AE8C 4NB8D 4HYTB 3LW5H 1G1IA 4KHXA 4C7NA 2WPRA 2D2CB 1KFMA 4I1LA 1JY3P 3GB4A 1E79H 3AEFC 4JQ0D 1CW5A 1JMBA 2IYOA 1FZFA 3UIAA 3WUUA 1YJWP 4NBFD 2H7HA 2ZYAA 1O7GA 2P7JA 4ZMDA 1M7LA 1K9MQ 3L4FA 1LT9A 2E74C 2KS1B 4I7ZC 3AECC 3C8VA 2E5YA 3L73J 3IAOA 1SQVK 1T2KC 1ZRTE 2P1JA 3L72E 4JF7A 1NU1J 4HKZH 1BGYD 2OQQA 3OA7A 4HM5A 1FOSE 5CJ0A 5KTBA 1GTWA 1PGJA 1ZP0C 1YJNP 4PD4D 2YFJA 5KAFE 5APYA 1BCCG 3U1CA 2FY8A 2FXPA 2UWJE 3CI9A 4YXDC 2DE6D 3M9HA 4EDFA 2RH0A 3TGUD 2DE7D 2ZT9C 2K3RA 2HG5D 1DD4A 2O3JA 4H13B 1IZNB 2IX7C 3F89A 1R5LA 3H1LD 2P58A 1M8OB 3HE4B 2M8RA 1H0TB 1VQMP 1NU1D 4PV1D 3EN1A 2BMRA 1FBMA 4BWNA 5AW5B 3TK1A 1HVVA 2FYNB 2H43A 2E5TA 4WWIA 3L74J 1DEEG 1OZHA 4GOFA 2L91A 3BASA 3D70A 4K35A 1XTCC 4EMJB 2XNDH 1L0NJ 1CSBA 2YNYA 4QUPA 3QH9A 3M91A 4I7ZB 2O1JA 1Y47A 3SSUA 1AVOA 2JWDA 3N4XA 1BGYG 1H88A 2CKFA 4W7ZA 1VM9A 4LC1A 3S1KA 3CMAP 1VDFA 3B4SA 1EG9A 1AV1A 1P84I 1SQQK 2WSCJ 1NDOA 1ZMEC 3FGAD 2W6AA 5AVUB 1VQOP 2ZYLA 1N7SC 2IFNA 3G71P 3C1LA 3P8CE 2O01H 5CBOA 5KKZB 5AEWA 1Q86Q 1NKZB 4PD4E 2XR8A 1KQGB 2MJZA 2IPPA 2WWWA 4HM0A 4I6MC 1PP9D 1RY3A 3CX5H 5CJ4A 2NWFA 3CCMP 1SQQD 2H8PD 5AVTB 2AXTH 2P67A 1NU1G 2QM7A 3E1RA 1WMKA 2IYPA 1KD1Q 1N8RQ 4WY4C 3CCQP 3GTSA 1SQBG 4WVZA 2XSOA 4P1BH 1QGKB 3H25A 1P84E 2WPQA 1OIPA 1S1CX 1SFCD 1X79B 3GKEA 2KSEA 4NBGD 1KB9H 5APTA 2KZIA 3L72J 2QIWA 4IFFA 4NBHD 3CX5E 4NBAD 4IL6E 3FWNA 3CX5D 4BRYA 1VQ5P 4BXLA 5AW6B 1URQC 4NPDA 5AVZB 3ZDMA 2M5AA 1NTZJ 1URQD 5AVQB 1IFMA 5KLVK 1KILC 1RQVA 3HD7A 1URQA 1T8ZA 2R3SA 4OH8B 1PL5A 3HTKA 1SQPJ 3IFMA 1YIJP 2C9NY 4R4LA 3AEBC 5APWA 1VQKP 1BGYE 4HM7A 1IFNA 1SQVJ 3GZYA 1KZUB 2AEFA 1A02J 2NUMA 4R4MA 2KP8A 1SQXJ 2G3AA 3BCCJ 1TU3F 1HGVA 4IL6H 5KLVD 2ITAA 4WY4D 2YO3A 2FYUG 1GDTA 4ASWA 1G2CB 1LTJA 2QA4P 1VF5C 4OWFA 2BCCJ 2QJKB 1JY2N 2G8YA 4H13C 3V5BA 1IJDB 3FOUA 5CCGA 4W80A 2ZT9B 2JJLA 4H44B 1RE4C 5AEUA 2YMKA 3PP5A 2GUSA 2W6JH 1SQPE 2AEJA 3IF4A 1NU1E 3TF5A 2Q3WA 5C39A 4DJGA 4YXWH 3JSVC 2HMMA 4KJMA 1KYOI 2KNCA 2O01J 1AFOA 2AEMA 3V4WA 1EZVE 2B89A 3AE7C 1SQBD 3RL0C 2W27A 1LT9B 4ZKPA 3CCUP 4HM8A 1BDCA 1UUVA 1GZLA 2W83C 1HTLC 2HMKA 3O6QA 3MP7B 1XTGB 4TLFA 3C9IA 2OGUA 1PPJG 3BCCD 1D7MA 2WSEJ 1FC2C 1PPJD 2CK3H 5AW9B 2JZAA 1KQSO 1RE3C 2KIKA 3RK2C 2ZXEB 3L70G 3MIWA 1L0LJ 1RQUA 2KSJA 1ZR4A 1NTKK 4QUQA 1S9KE 3AE1C 2GBWA 5AVSB 1HF9A 1MUUA 4D6TJ 3SFDC 1FZAA 5TISH 3VP8A 2OARA 4I2LC 2Y0CA 3VMGD 3G9RA 2NPSA 2BCCG 4IL6X 2XU6A 4RKUJ 3VMID 1JCCA 1X8YA 3CXHI 3S9OA 1FJKA 1FDIA 3V2PA 4C7RA 1VQPP 3Q5PA 4UB6H 1LTGC 1LNQA 1NTZE 1NTZD 1IFIA 5KLIB 2L5GB 5CCHC 1EZVI 1M57D 2KOGA 1BCCE 1P84D 4NPEA 2R32A 3A2AA 1SQPG 3TNUA 4UB8H 1NAYA 3H1JE 4IFDK 1HJ0A 1NHLA 4JBZA 1P84H 1RF0C 4AYCA 5BU5A 1ZN5A 2OTKE 5KAFH 3HUSB 5CXMA 2NVFA 4DZOA 2RN0A 1MZ9A 2LXCB 1NTKG 1ZXGA 1T6AA 5AVRB 1LGHB 5APXA 4MN4C 1NU1K 3FXDA 5AW2B 3GZXA 2YXRB 2Z5IA 2WZ7A 2E76B 3KYQA 5B5EE 1N2DC 3EFFK 3M9BA 1HGZA 3T97B 2HODA 2YFIA 2WT7B 2YMYA 1LTIC 3RK3E 2OYIB 3GG2A 3A5TA 2ZJSE 1VQLP 5B66H 1SP4A 4TT3H 3H6PA 1IK7A 1J1DC 2B24A 1KC8Q 5DJUB 2N1TD 3L75J 2B1XA 2OYOA 2FYNC 2Q6QA 4M3LA 5AVVB 2K88A 2A45I 3PHLA 1N73B 1QLED 2POHA 2PFXA 3PJSK 5BOKA 3ABVC 3O6QB 3VMHD 1SQPD 3CCVP 5L8RJ 3RK2D 4PD4H 1S9KD 3D71A 2PAJA 1OFCX 2AXTE 1KB9D 1OVVA 3B5ND 4XE5B 2BMQA 3H1LG 1AQ5A 2A45G 2A06E 3CMEP 3AEDC 3GW6A 3A7OA 3M0DA 3H1KJ 2JDIH 4QMAA 2PGDA 1KQFB 1Q90C 1AA0A 2H88C 1KILD 3HE5A 2XRXA 2QRXA 4Z1MH 3C0DA 2BMOA 1SQBE 2FFDC 1WQLA 4YPCA 1NTKD 3BRVB 1Q81Q 3PLNA 2K9YA 3AE9C 3E1IA 4JPZB 5GTIE 1LP1B 4N78D 2HMNA 2N9YB 4NBBD 2IZ1A 5AVXB 3VOPA 5CBNA 3EQ2A 3CD6P 1IFPA 1E5WA 3OW2O 3JCUE 3H1LJ 4NB9D 1SQXD 1X9VA 3CXHH 1GW3A 1OVUA 3NXSA 3L72D 3RK3C 1RE3A 3B5NC 2D2CC 3MUDC 1HJBA 1KN7A 4GOEA 4PV1B 2M3BA 4RJTA 1QL2A 1OWAA 4DT0A 1PGPA 4C46A 2Z5HA 2FYZA 2JKVA 4BRYB 3Q3DA 2YVJB 2FYUE 1LT1A 1GMJA 2OYHC 3JCUH 1VL2A 3CC2P 3QWOC 2FYUK 2IZ0A 3USSA 3GHGB 1JTHB 2Y9YA 4OGQC 2KLVA 3TYYA 1PP9J 1ZR2A 1L0NE 1KB9E 2ZVNB 5APVA 3L73G 4HH2A 2Q5UA 2XKMA 4Y99B 5CCGD 4UB8E 3L73D 2I7FA 4AUWA 4L76A 1RF0A 1SVFA 3MZWB 3G4SP 2BEZF 1SQQG 3H1JD 1GL2B 5AVWB 3JC22 1LWUC 3CXHD 3V2QA 1YQ4C 2V4HA 3V6IA 4AAYB 1EDJA 4JYCA 3Q1MA 1RIEA 3GF3A 2LKMA 1EZVD 2NRGA 1T3UA 2J59M 1YTZT 1OX3A 1ZV8A 5H2FE 1JTHA 2C0XA 1UUWA 4HJLA 3LIEA 2DW3A 1O7HA 3H32B 5APSA 3TGUG 3CCLP 2V7QJ 3L71J 4AQRD 2ZYGA 1PPJE 1OW7A 1RF1C 4OVNF 3AE3C 3V2NA 3GCEA 1Q7YQ 1SQXE 2E42A 1CZQA 1JCDA 3L70E 3VYIA 1OW6A 1KV4A 1FOSF 3AE6C 2HFED 1FZCC 2E76D 2QJPB 1Q2NA 2LXBA 1OW8A 2E75B 4NBED 3VMXA 1L4AB 1SQVG 2NPSD 2BCCE 1VQ8P 1WT6A 3H1KD 2HR3A 1QVGO 4N6JA 2M0BA 2NPSC 3L73E 1NTZG 2QE7H 1EXIA 4PJ0E 3CCEP 1NTMD 1ZW0A 3I5CA 3TSIA 4GT1A 2ZFCA 2WPSA 2YKOA 3F5HA 5APQA 3H1JG 3VCPA 3A0HE 2R5BA 2GBXA 1ZRTD 3CWBJ 2JO6A 4HM2A 1SQPK 3H1KG 4QDCA 5CCHA 3KDPB 2XNXA 1GL2A 1USEA 5BVZA 2Q7CA 2YXQB 5CCHD 3WUTA 5KLVJ 1GL2D 1KB9I 1SQBJ 2KS1A 1NTKE 1LTTC 5AW4B 3Q5RA 4HKVA 1S72P 2B87A 5B5EH 1PP9G 4N3YB 1NWQA 2E4PA 1S5LX 1BDDA 1HBWA 4NBDD 1N73C 2KK7A 2QJYB 5TJHA 3TGUE 4B86A 3MTUE 1Q82Q 1RF1B 1KYOD 1N7LA 1DH3A 1NTMJ 2Q1KA 1N73A 2W8ZA 3VMYA 3EQQA 3B5NA 1FU1A 1J1EC 2YIUC 3Q2YA 3VTPC 1EDIA 1FDOA 4D6TD 3NFQA 3L75D 2WMMA 1BSHA 5DJTB 2HMOA 1JY3O 3L35A 2WSEH 5E79E 3I55P 2B88A 1NVOA 1MV8A 1NO4A 1KILA 2O01N 3AEAC 2Q9IA 2N9BA 5B66E 1VF5D 4NBCD 2OYHA 2QM8A 1IFDA 2HODB 2PRRA 3A3YB 3T97A 2J58A 2I1JA 2R3CA 1SQVE 1JUNA 1SQVD 1R5SA 1HUCA 1IK9A 2KZJA 2P10A 4OGQD 1OVRA 2XV5A 2I1KA 3H1HJ 1G8KB 1EC5A 2XZRA 1BE3E 1M1JA 1U57A 1G1JA 3H1LE 2PP6A 1LTJC 1VCKA 1M1JB 2C9LY 3V2RA 2A06G 1JO5A 1SQBK 1KORA 3H1HG 2FXMA 4ZKUA 3H1KE 3AEGC 1GD2E 2QVAA 1JMMA 5AW8B 1T2KD 2HMJA 2NUKA 3R2PA 3L37A 2WSFH 1IO4A 1NYHA 4WBAA 1HWTC 1AJYA 3L70D 1VQ4P 3AE4C 2NZ2A 2IBZG 4W7YA 2KLUA 3MHVA 3FWLA 1S5LH 3AEEC 5AW7B 2R5DA 3R4YA 1KFNA 1BCCJ 5GTIH 2K9JA 4AIVA 4YTPC 4HM4A 5E79H 2BASA 3RBXA 5GTHE 1PV3A 2BCCD 1FZGA 3L71E 2KYVA 3BATA 1NKNA 3MGNA 5AVYB 1GU5A 4H0LC 3ITKA 2E74D 2E75C 3CWBD 4RO0A 1SFCB 4GODA 1L0LG 4DCKA 3L70J 1ZOYC 1JB0J 1L0LD 3KQGA 2OYIA 1AVYA 2N1TB 1FZBA 1FZCB 1BGYJ 1PGQA 1ULIA 2KB7P 1VQ9P 3U1AA 1SJGA 2ZVOB 1L0ND 2WQYC 1EDKA 1L0NG 4GDOA 1BE3G 1KILE 2Y0EA 2YO2A 3A0BE 1M56D 2Y9ZA 3W68A 4RESB 2E75D 4K3AA 1SQQE 1L4AC 1JY2O 5KJ7D 1MFZA 1FZEA 3WMM0 1G2CA 1LTJB 3I56P 2FFDA 2HYNA 4KT0J 1G8JB 1JM0A 2CPSA 2Y0DA 1S3JA 1GL2C 1JY3N 2WSCH 1YITP 1L2PA 4D6TE 1O7PA 1FS0E 2OTLP 5GTHH 2FYUJ 2M3EA 2NVGA 1LTSC 3D89A 2W6BA 5H2FH 1KQLA 3KPEA 3CC4P 4U3FE 1UIXA 1T3JA 1SQXG 3FX0A 2OYHB 3PTZA 3L71D 1OXZA 5CMZA 1KILB 3N7NA 3L71G 5TISE 1VQ7P 1RF1A 2QSIA 2YIUB 3H32A 3M06A 3V4QA 2YFLA 3AZCA 4O9BA 3K5BA 1X0TA 3CWBE 2VRSA 4CPGA 1CI6B 3II6A 1U7MA 2B87B 2M5AB 4EYYQ 1L0LE 3IN6A 1W5CE 1H8AA 2V7QH 1VQNP 1JEKA 1JY2P 2QJYC 3B5NB 5KLVG 3RK3B 1OMIA 4PD4I 3U59A 3LIDA 1ZLLA 1VPCA 4ZNCA 1YHQP 2C0WA 3H1IE 3RK2B 1GK4A 3RL0D 1NJIQ 1K73Q 2WSFJ 3CXHE 3B8EB 3SWKA 1PZQA 3D6YA 1GW4A 5KAIH 1MFTA 1FDMA 2H89C 1ULJA 3NTNA 5AW0B 3DQYA 1O7NA 1USDA 2KNCB 3GHGA 2NVEA 4U7JA 3GLMA 1LJ2A 1WRGA 2KI7B 2MKVA 5CCGC 4HM6A 3P32A 3G3ZA 3HD7D 1S4XA 1QX8A 1L4AD 3CCRP 4P1CH 4PV1C 2IFMA 1L4AA 4ASVA 4GIFA 3WU2E 1UIIA 1NTME 4EI2A 4DOJA 1PP9E 2N1TC 3GL2A 3KZIH 1BCCD 4N78E 3CCJP 1DD3A 3O8ZA 2WITA 4H13D 1LTAC 1SFCC 1FAVA 3VMAA 2QJKC 2FBWC 4U3FG 4H0LB 1KYOE 4WB4A 2AXCA 3RK3D 1VF5B 2XDJA 1U7JA 1EXJA 5CHXA 1IFJA 1YQ3C 2B9BA 2QJPC 4IOIH 4H0LD 2WSSH 1S2EA 3CPWO 3HTKB 1LP1A 4HM3A 3HD7B 2GM4A 3HE4A 2K1AA 1BSNA 2RKLA 1RHZB 5KLVE 3PH0A 1DEBA 1BE3J 3M0AA 3G6EP 2IBZI 3VP9A 3IR9A 3E7KA 3H1IG 1W2BO 3CL3D 5KAIE 2OYIC 4HM1A 2E43A 3L72G 1RH5B 1RE4A 1SLQA 3S4RA 1SQQJ 2ZYDA 2GA1A 2CPBA 3KZIE 4A7PA 4HJGH 3VMZA 3GOBA 3VN0A 4LGDE 2W90A 3SWFA 2JR8A 3H1HE 1JOCA 1NH4A 2YKQA 3H1ID 1M1JC 3BVHA 2JO1A 3A0BH 4Y99C 2OTJP 2LR2A 3CX5I 5HL4A 3HUSC 3KXDA 5EFWB 2J5UA 3MD0A 1KTMA 3GHGC 2KXPB 5AW1B 2A06D 1J1DB 4L73A 1S5LE 1NTMG 2IBZE 4IFMA 2O1KA 1PFIA 1CI6A 3L75E 3NMDA 4PJ0H 1M1KQ 3CLQA 3CC7P 1K8AQ 2Q3EA 1YTZI 4NPFX 2R44A 2E76C 1N86A 3AE5C 2KUBA 2E4QA 3N0QA 2Z4EA 4C7NB 3MUDA 4QCKA 3L74D 3P7KA 1JNMA 5KJ7A 2ZXXA 3SFEC 1J1EB 4EOTA 4JYBA 1SS1A 3EFGA 2HPCB 1DX7A 1IC2A 3OJAB 4WY4B 2P2UA 1PIXA 5KJ7C 1NTKJ 1FQTA 1L0LK 5BU8B 3PRJA 3L74G 1NAFA 3FXEA 1GK6A 1MKMA 2FFDB 2WPVB 3RGUA 5KLIC 4XFJA 1VQ6P 3TNUB 2JP3A 2FKWB 5KKZC 1LTBC 2JWAA 4QDFA 1H0TA 1EQ7A 4L75A 3Q5SA 1N7SB 1NTMK 3W67A 2ZT9D 1LWUA 2QPZA 3H1HD 3WUVA 4XA4A 3HE5B 3WU2H 3OAKA 1YYCA 3L36A 3HRNA 4Y28J 3BRTB 1JM1A 4QURA 2BEQD 1QL1A 2NPSB 3SWYA 2IDBA 2ZAEB 1NOHA 2DE5D 2N1TA 3P8MC 3BCCE 1KMIZ 1NGMB 1K05A 1M90Q 3GF7A 3GTEA 3KHUA 1SFCA 4UB6E 1HH0A 2QEXP 1YJ9P 4D6TG 1KYOH 3L75G 1Y8AA 3TGUJ 1X22A 1YI2P 1L0NK 1W2EA 1NYKA 1FZCA 3HD7C 1O7WA 2SPZA 2XSHA 4U3FD 1QEXA 2GUVA 1SQXK 1FE6A 2K9JB 2WVRA 1RFSA 1LT9C 1Q90D 3AE2C 2FXOA 3RL0B 2FYUD 3CWBG 2E74B 1J2JB 3H1JJ 3H1IJ 1A02F 3LW5J 2WTYA 1YBKA 2K37A
chains in the Genus database with same CATH topology
3FOUA 3Q1MA 1UIXA 1RIEA 2ZT9B 2HMLA 3GF3A 4H44B 5AEUA 2YMKA 3L74E 3B71A 1Y9BA 3GL0A 2QSIA 1SQPE 4H44C 2YFLA 1UUWA 1NU1E 3AZCA 4HJLA 2Q3WA 1O7HA 3CWBE 3GMAA 4H44D 2HMMA 2V7QJ 1PPJE 1OW7A 3AE3C 1L0LE 2O01J 3IN6A 3GCEA 1EZVE 2QJYC 2D2CD 1SQXE 3AE7C 3L70E 1OMIA 1OW6A 3AE6C 1K04A 4HM8A 2E76D 1UUVA 3H1IE 3D6ZA 2HMKA 3O6QA 2WSFJ 3CXHE 1O7MA 1OW8A 1R8EA 2E75B 2WSEJ 1DIPA 3VCAA 4OGQB 3D6YA 4NBED 3RL0g 2JZAA 3EWKA 5M1BA 2H89C 1ULJA 4QDFB 1RQUA 2BCCE 4QDDA 3DQYA 1O7NA 2NVEA 4U7JA 4QUQA 3GLMA 2MKVA 3AE1C 4HM6A 2GBWA 3AE8C 4NB8D 1HF9A 4P1CH 3SFDC 4PV1C 3L73E 1EXIA 2D2CB 3GB4A 3AEFC 3VMGD 3G9RA 1NTME 1PP9E 3GL2A 4IL6X 4RKUJ 3VCPA 3VMID 1DD3A 2GBXA 4NBFD 2JO6A 4HM2A 4QDCA 4H13D 3S9OA 1O7GA 1FDIA 2QJKC 2FBWC 3Q5PA 4H0LB 1NTZE 1KYOE 2E74C 1VF5B 4I7ZC 1EXJA 1YQ3C 1NTKE 3AECC 3C8VA 2QJPC 1BCCE 3Q5RA 3IAOA 4HKVA 1ZRTE 2E4PA 4H0LD 1S5LX 3H1JE 4NBDD 3L72E 1HJ0A 3TGUE 4HM3A 2OQQA 5CXMA 2NVFA 4HM5A 3EQQA 5KLVE 1ZP0C 2YFJA 2YIUC 3Q2YA 1FDOA 2FXPA 4YXDC 2DE6D 3GZXA 4HM1A 2DE7D 2HMOA 2ZT9C 1DD4A 4H13B 2E76B 3T97B 3AEAC 2YFIA 1VF5D 4NBCD 3RK3E 3GOBA 1SQVE 3H1HE 4PV1D 2P10A 3EN1A 4OGQD 4TT3H 1IK7A 2JO1A 2BMRA 2B24A 2B1XA 5HL4A 1G8KB 2FYNC 2J5UA 1BE3E 1KTMA 1U57A 3H1LE 1VCKA 3D70A 4EMJB 2IBZE 5BOKA 3ABVC 3L75E 1KORA 3VMHD 4QUPA 5L8RJ 4I7ZB 3H1KE 3AEGC 3D71A 2HMJA 2NUKA 2E76C 3AE5C 2E4QA 1NYHA 2CKFA 1VM9A 2BMQA 3N0QA 1AJYA 4QCKA 3AE4C 2NZ2A 1EG9A 2A06E 2WSCJ 1NDOA 3SFEC 1ZMEC 3AEDC 3FGAD 1KQFB 1Q90C 2ZYLA 3AEEC 3R4YA 1PIXA 2H88C 2XRXA 4Z1MH 3C0DA 2BMOA 4AIVA 5AEWA 1FQTA 4PD4E 4YTPC 1SQBE 2XR8A 1KQGB 4HM4A 1WQLA 4HM0A 2NWFA 2K9YA 3AE9C 1PV3A 3L71E 1MKMA 2HMNA 2WPVB 4NBBD 5KLIC 4XFJA 1WMKA 4H0LC 2JP3A 2E74D 2E75C 5KKZC 4QDFA 3GTSA 3Q5SA 1ZOYC 1JB0J 2ZT9D 4NB9D 2XSOA 4P1BH 2QPZA 3H25A 1P84E 1S1CX 3GKEA 1ULIA 4NBGD 2QIWA 4Y28J 1JM1A 4NBHD 2D2CC 4QURA 1SJGA 2BEQD 3CX5E 4NBAD 2WQYC 2IDBA 4PV1B 4GDOA 2DE5D 1KILE 3BCCE 1KMIZ 1NGMB 1K05A 3GF7A 3GTEA 2E75D 1SQQE 1RQVA 3Q3DA 2YVJB 2FYUE 1GMJA 1VL2A 1PL5A 4KT0J 4OGQC 1NYKA 4R4LA 3AEBC 4HM7A 1G8JB 1L0NE 1KB9E 3GZYA 1O7WA 2XSHA 2NUMA 2I7FA 4R4MA 2G3AA 1TU3F 1RFSA 2BEZF 1Q90D 3AE2C 1O7PA 1VF5C 2E74B 3LW5J 1YQ4C 2G8YA 2NVGA 3D89A 4H13C 4U3FE 4AAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ D;  2E75 C;  3FOU A;  5KKZ C;  1RIE A;  2HML A;  4QDF A;  1PP9 E;  2BMR A;  2B24 A;  3GL2 A;  3EN1 A;  3GTS A;  5AEU A;  2B1X A;  3VMG D;  2YMK A;  3L74 E;  3VCP A;  5HL4 A;  3VMI D;  2GBX A;  4NBF D;  1G8K B;  2FYN C;  2JO6 A;  4HM2 A;  2ZT9 D;  4NB9 D;  3GL0 A;  4H13 D;  2XSO A;  4QDC A;  1BE3 E;  1SQP E;  4P1B H;  4H44 C;  2QPZ A;  1UUW A;  1P84 E;  1NU1 E;  2YFL A;  3AZC A;  4AAY B;  4HJL A;  2Q3W A;  1O7G A;  3H1L E;  1VCK A;  3GKE A;  1O7H A;  2QJK C;  3CWB E;  4H44 D;  1ULI A;  4NBG D;  4EMJ B;  2IBZ E;  1NTZ E;  2HMM A;  1KYO E;  2E74 C;  1PPJ E;  4I7Z C;  1JM1 A;  4NBH D;  2D2C C;  5BOK A;  4QUR A;  1SJG A;  1L0L E;  1NTK E;  3L75 E;  3CX5 E;  4NBA D;  3GCE A;  1EZV E;  4QUP A;  3VMH D;  2QJP C;  1BCC E;  4HKV A;  2QJY C;  2D2C D;  1SQX E;  3H1K E;  2DE5 D;  1ZRT E;  3L70 E;  2E4P A;  4H0L D;  3H1J E;  4NBD D;  3BCC E;  3L72 E;  2HMJ A;  2NUK A;  2E76 C;  4HM8 A;  2E76 D;  1UUV A;  3TGU E;  3H1I E;  4HM3 A;  2E4Q A;  3GTE A;  2CKF A;  2E75 D;  2HMK A;  1VM9 A;  2BMQ A;  1SQQ E;  3N0Q A;  5CXM A;  2YVJ B;  2FYU E;  2NVF A;  4QCK A;  3CXH E;  1EG9 A;  2A06 E;  4HM5 A;  3EQQ A;  1O7M A;  5KLV E;  1NDO A;  3VCA A;  4OGQ C;  2YFJ A;  1NYK A;  2YIU C;  4NBE D;  2JZA A;  4HM7 A;  1G8J B;  1L0N E;  1KB9 E;  1Q90 C;  3GZY A;  2ZYL A;  2DE6 D;  1O7W A;  1ULJ A;  4QDF B;  3GZX A;  2XSH A;  2NUM A;  4HM1 A;  2DE7 D;  2BCC E;  2I7F A;  4QDD A;  2HMO A;  3DQY A;  2ZT9 C;  1O7N A;  2NVE A;  2XRX A;  4QUQ A;  3C0D A;  2BMO A;  4AIV A;  5AEW A;  1FQT A;  1RFS A;  4PD4 E;  1SQB E;  2XR8 A;  4HM6 A;  4HM4 A;  1WQL A;  4HM0 A;  2GBW A;  2NWF A;  2E74 D;  4NB8 D;  2YFI A;  1O7P A;  1VF5 D;  4P1C H;  4NBC D;  4PV1 C;  1VF5 C;  3L71 E;  3L73 E;  3GOB A;  2HMN A;  1SQV E;  3GB4 A;  4NBB D;  5KLI C;  2NVG A;  3D89 A;  4H13 C;  3H1H E;  4H0L C;  4U3F E;  4PV1 D;  1NTM E; 
#chains in the Genus database with same CATH topology
 4HB1 A;  2HML A;  1FJP A;  1NTZ K;  2WT7 A;  3L74 E;  3RBZ A;  3B71 A;  1Y9B A;  2HLO A;  3GL0 A;  4H44 C;  2Q3I A;  3GMA A;  4H44 D;  3M9Q A;  1PGO A;  3P8C D;  1LWU B;  3TDK A;  3M0D C;  2QG4 A;  1BE3 D;  2D2C D;  1N7S A;  4L74 A;  4U3F J;  1QVF O;  4LLH A;  2IBZ D;  4GKG A;  1K04 A;  1N7S D;  3HUS A;  1EDL A;  3D6Z A;  5AW3 B;  5APU A;  2A45 H;  2YKP A;  1O7M A;  1AQT A;  1R8E A;  5K5G B;  1DIP A;  3VCA A;  4OGQ B;  3A0H H;  3BCC G;  1EZV G;  3RL0 g;  2RMZ A;  1GU4 A;  3EWK A;  5M1B A;  4QDF B;  1Z56 A;  4QDD A;  4WY4 A;  1H89 A;  2JEE A;  4EIJ A;  2HPC A;  2I8D A;  3CCS P;  1URQ B;  3AE8 C;  4NB8 D;  4HYT B;  3LW5 H;  1G1I A;  4KHX A;  4C7N A;  2WPR A;  2D2C B;  1KFM A;  4I1L A;  1JY3 P;  3GB4 A;  1E79 H;  3AEF C;  4JQ0 D;  1CW5 A;  1JMB A;  2IYO A;  1FZF A;  3UIA A;  3WUU A;  1YJW P;  4NBF D;  2H7H A;  2ZYA A;  1O7G A;  2P7J A;  4ZMD A;  1M7L A;  1K9M Q;  3L4F A;  1LT9 A;  2E74 C;  2KS1 B;  4I7Z C;  3AEC C;  3C8V A;  2E5Y A;  3L73 J;  3IAO A;  1SQV K;  1T2K C;  1ZRT E;  2P1J A;  3L72 E;  4JF7 A;  1NU1 J;  4HKZ H;  1BGY D;  2OQQ A;  3OA7 A;  4HM5 A;  1FOS E;  5CJ0 A;  5KTB A;  1GTW A;  1PGJ A;  1ZP0 C;  1YJN P;  4PD4 D;  2YFJ A;  5KAF E;  5APY A;  1BCC G;  3U1C A;  2FY8 A;  2FXP A;  2UWJ E;  3CI9 A;  4YXD C;  2DE6 D;  3M9H A;  4EDF A;  2RH0 A;  3TGU D;  2DE7 D;  2ZT9 C;  2K3R A;  2HG5 D;  1DD4 A;  2O3J A;  4H13 B;  1IZN B;  2IX7 C;  3F89 A;  1R5L A;  3H1L D;  2P58 A;  1M8O B;  3HE4 B;  2M8R A;  1H0T B;  1VQM P;  1NU1 D;  4PV1 D;  3EN1 A;  2BMR A;  1FBM A;  4BWN A;  5AW5 B;  3TK1 A;  1HVV A;  2FYN B;  2H43 A;  2E5T A;  4WWI A;  3L74 J;  1DEE G;  1OZH A;  4GOF A;  2L91 A;  3BAS A;  3D70 A;  4K35 A;  1XTC C;  4EMJ B;  2XND H;  1L0N J;  1CSB A;  2YNY A;  4QUP A;  3QH9 A;  3M91 A;  4I7Z B;  2O1J A;  1Y47 A;  3SSU A;  1AVO A;  2JWD A;  3N4X A;  1BGY G;  1H88 A;  2CKF A;  4W7Z A;  1VM9 A;  4LC1 A;  3S1K A;  3CMA P;  1VDF A;  3B4S A;  1EG9 A;  1AV1 A;  1P84 I;  1SQQ K;  2WSC J;  1NDO A;  1ZME C;  3FGA D;  2W6A A;  5AVU B;  1VQO P;  2ZYL A;  1N7S C;  2IFN A;  3G71 P;  3C1L A;  3P8C E;  2O01 H;  5CBO A;  5KKZ B;  5AEW A;  1Q86 Q;  1NKZ B;  4PD4 E;  2XR8 A;  1KQG B;  2MJZ A;  2IPP A;  2WWW A;  4HM0 A;  4I6M C;  1PP9 D;  1RY3 A;  3CX5 H;  5CJ4 A;  2NWF A;  3CCM P;  1SQQ D;  2H8P D;  5AVT B;  2AXT H;  2P67 A;  1NU1 G;  2QM7 A;  3E1R A;  1WMK A;  2IYP A;  1KD1 Q;  1N8R Q;  4WY4 C;  3CCQ P;  3GTS A;  1SQB G;  4WVZ A;  2XSO A;  4P1B H;  1QGK B;  3H25 A;  1P84 E;  2WPQ A;  1OIP A;  1S1C X;  1SFC D;  1X79 B;  3GKE A;  2KSE A;  4NBG D;  1KB9 H;  5APT A;  2KZI A;  3L72 J;  2QIW A;  4IFF A;  4NBH D;  3CX5 E;  4NBA D;  4IL6 E;  3FWN A;  3CX5 D;  4BRY A;  1VQ5 P;  4BXL A;  5AW6 B;  1URQ C;  4NPD A;  5AVZ B;  3ZDM A;  2M5A A;  1NTZ J;  1URQ D;  5AVQ B;  1IFM A;  5KLV K;  1KIL C;  1RQV A;  3HD7 A;  1URQ A;  1T8Z A;  2R3S A;  4OH8 B;  1PL5 A;  3HTK A;  1SQP J;  3IFM A;  1YIJ P;  2C9N Y;  4R4L A;  3AEB C;  5APW A;  1VQK P;  1BGY E;  4HM7 A;  1IFN A;  1SQV J;  3GZY A;  1KZU B;  2AEF A;  1A02 J;  2NUM A;  4R4M A;  2KP8 A;  1SQX J;  2G3A A;  3BCC J;  1TU3 F;  1HGV A;  4IL6 H;  5KLV D;  2ITA A;  4WY4 D;  2YO3 A;  2FYU G;  1GDT A;  4ASW A;  1G2C B;  1LTJ A;  2QA4 P;  1VF5 C;  4OWF A;  2BCC J;  2QJK B;  1JY2 N;  2G8Y A;  4H13 C;  3V5B A;  1IJD B;  3FOU A;  5CCG A;  4W80 A;  2ZT9 B;  2JJL A;  4H44 B;  1RE4 C;  5AEU A;  2YMK A;  3PP5 A;  2GUS A;  2W6J H;  1SQP E;  2AEJ A;  3IF4 A;  1NU1 E;  3TF5 A;  2Q3W A;  5C39 A;  4DJG A;  4YXW H;  3JSV C;  2HMM A;  4KJM A;  1KYO I;  2KNC A;  2O01 J;  1AFO A;  2AEM A;  3V4W A;  1EZV E;  2B89 A;  3AE7 C;  1SQB D;  3RL0 C;  2W27 A;  1LT9 B;  4ZKP A;  3CCU P;  4HM8 A;  1BDC A;  1UUV A;  1GZL A;  2W83 C;  1HTL C;  2HMK A;  3O6Q A;  3MP7 B;  1XTG B;  4TLF A;  3C9I A;  2OGU A;  1PPJ G;  3BCC D;  1D7M A;  2WSE J;  1FC2 C;  1PPJ D;  2CK3 H;  5AW9 B;  2JZA A;  1KQS O;  1RE3 C;  2KIK A;  3RK2 C;  2ZXE B;  3L70 G;  3MIW A;  1L0L J;  1RQU A;  2KSJ A;  1ZR4 A;  1NTK K;  4QUQ A;  1S9K E;  3AE1 C;  2GBW A;  5AVS B;  1HF9 A;  1MUU A;  4D6T J;  3SFD C;  1FZA A;  5TIS H;  3VP8 A;  2OAR A;  4I2L C;  2Y0C A;  3VMG D;  3G9R A;  2NPS A;  2BCC G;  4IL6 X;  2XU6 A;  4RKU J;  3VMI D;  1JCC A;  1X8Y A;  3CXH I;  3S9O A;  1FJK A;  1FDI A;  3V2P A;  4C7R A;  1VQP P;  3Q5P A;  4UB6 H;  1LTG C;  1LNQ A;  1NTZ E;  1NTZ D;  1IFI A;  5KLI B;  2L5G B;  5CCH C;  1EZV I;  1M57 D;  2KOG A;  1BCC E;  1P84 D;  4NPE A;  2R32 A;  3A2A A;  1SQP G;  3TNU A;  4UB8 H;  1NAY A;  3H1J E;  4IFD K;  1HJ0 A;  1NHL A;  4JBZ A;  1P84 H;  1RF0 C;  4AYC A;  5BU5 A;  1ZN5 A;  2OTK E;  5KAF H;  3HUS B;  5CXM A;  2NVF A;  4DZO A;  2RN0 A;  1MZ9 A;  2LXC B;  1NTK G;  1ZXG A;  1T6A A;  5AVR B;  1LGH B;  5APX A;  4MN4 C;  1NU1 K;  3FXD A;  5AW2 B;  3GZX A;  2YXR B;  2Z5I A;  2WZ7 A;  2E76 B;  3KYQ A;  5B5E E;  1N2D C;  3EFF K;  3M9B A;  1HGZ A;  3T97 B;  2HOD A;  2YFI A;  2WT7 B;  2YMY A;  1LTI C;  3RK3 E;  2OYI B;  3GG2 A;  3A5T A;  2ZJS E;  1VQL P;  5B66 H;  1SP4 A;  4TT3 H;  3H6P A;  1IK7 A;  1J1D C;  2B24 A;  1KC8 Q;  5DJU B;  2N1T D;  3L75 J;  2B1X A;  2OYO A;  2FYN C;  2Q6Q A;  4M3L A;  5AVV B;  2K88 A;  2A45 I;  3PHL A;  1N73 B;  1QLE D;  2POH A;  2PFX A;  3PJS K;  5BOK A;  3ABV C;  3O6Q B;  3VMH D;  1SQP D;  3CCV P;  5L8R J;  3RK2 D;  4PD4 H;  1S9K D;  3D71 A;  2PAJ A;  1OFC X;  2AXT E;  1KB9 D;  1OVV A;  3B5N D;  4XE5 B;  2BMQ A;  3H1L G;  1AQ5 A;  2A45 G;  2A06 E;  3CME P;  3AED C;  3GW6 A;  3A7O A;  3M0D A;  3H1K J;  2JDI H;  4QMA A;  2PGD A;  1KQF B;  1Q90 C;  1AA0 A;  2H88 C;  1KIL D;  3HE5 A;  2XRX A;  2QRX A;  4Z1M H;  3C0D A;  2BMO A;  1SQB E;  2FFD C;  1WQL A;  4YPC A;  1NTK D;  3BRV B;  1Q81 Q;  3PLN A;  2K9Y A;  3AE9 C;  3E1I A;  4JPZ B;  5GTI E;  1LP1 B;  4N78 D;  2HMN A;  2N9Y B;  4NBB D;  2IZ1 A;  5AVX B;  3VOP A;  5CBN A;  3EQ2 A;  3CD6 P;  1IFP A;  1E5W A;  3OW2 O;  3JCU E;  3H1L J;  4NB9 D;  1SQX D;  1X9V A;  3CXH H;  1GW3 A;  1OVU A;  3NXS A;  3L72 D;  3RK3 C;  1RE3 A;  3B5N C;  2D2C C;  3MUD C;  1HJB A;  1KN7 A;  4GOE A;  4PV1 B;  2M3B A;  4RJT A;  1QL2 A;  1OWA A;  4DT0 A;  1PGP A;  4C46 A;  2Z5H A;  2FYZ A;  2JKV A;  4BRY B;  3Q3D A;  2YVJ B;  2FYU E;  1LT1 A;  1GMJ A;  2OYH C;  3JCU H;  1VL2 A;  3CC2 P;  3QWO C;  2FYU K;  2IZ0 A;  3USS A;  3GHG B;  1JTH B;  2Y9Y A;  4OGQ C;  2KLV A;  3TYY A;  1PP9 J;  1ZR2 A;  1L0N E;  1KB9 E;  2ZVN B;  5APV A;  3L73 G;  4HH2 A;  2Q5U A;  2XKM A;  4Y99 B;  5CCG D;  4UB8 E;  3L73 D;  2I7F A;  4AUW A;  4L76 A;  1RF0 A;  1SVF A;  3MZW B;  3G4S P;  2BEZ F;  1SQQ G;  3H1J D;  1GL2 B;  5AVW B;  3JC2 2;  1LWU C;  3CXH D;  3V2Q A;  1YQ4 C;  2V4H A;  3V6I A;  4AAY B;  1EDJ A;  4JYC A;  3Q1M A;  1RIE A;  3GF3 A;  2LKM A;  1EZV D;  2NRG A;  1T3U A;  2J59 M;  1YTZ T;  1OX3 A;  1ZV8 A;  5H2F E;  1JTH A;  2C0X A;  1UUW A;  4HJL A;  3LIE A;  2DW3 A;  1O7H A;  3H32 B;  5APS A;  3TGU G;  3CCL P;  2V7Q J;  3L71 J;  4AQR D;  2ZYG A;  1PPJ E;  1OW7 A;  1RF1 C;  4OVN F;  3AE3 C;  3V2N A;  3GCE A;  1Q7Y Q;  1SQX E;  2E42 A;  1CZQ A;  1JCD A;  3L70 E;  3VYI A;  1OW6 A;  1KV4 A;  1FOS F;  3AE6 C;  2HFE D;  1FZC C;  2E76 D;  2QJP B;  1Q2N A;  2LXB A;  1OW8 A;  2E75 B;  4NBE D;  3VMX A;  1L4A B;  1SQV G;  2NPS D;  2BCC E;  1VQ8 P;  1WT6 A;  3H1K D;  2HR3 A;  1QVG O;  4N6J A;  2M0B A;  2NPS C;  3L73 E;  1NTZ G;  2QE7 H;  1EXI A;  4PJ0 E;  3CCE P;  1NTM D;  1ZW0 A;  3I5C A;  3TSI A;  4GT1 A;  2ZFC A;  2WPS A;  2YKO A;  3F5H A;  5APQ A;  3H1J G;  3VCP A;  3A0H E;  2R5B A;  2GBX A;  1ZRT D;  3CWB J;  2JO6 A;  4HM2 A;  1SQP K;  3H1K G;  4QDC A;  5CCH A;  3KDP B;  2XNX A;  1GL2 A;  1USE A;  5BVZ A;  2Q7C A;  2YXQ B;  5CCH D;  3WUT A;  5KLV J;  1GL2 D;  1KB9 I;  1SQB J;  2KS1 A;  1NTK E;  1LTT C;  5AW4 B;  3Q5R A;  4HKV A;  1S72 P;  2B87 A;  5B5E H;  1PP9 G;  4N3Y B;  1NWQ A;  2E4P A;  1S5L X;  1BDD A;  1HBW A;  4NBD D;  1N73 C;  2KK7 A;  2QJY B;  5TJH A;  3TGU E;  4B86 A;  3MTU E;  1Q82 Q;  1RF1 B;  1KYO D;  1N7L A;  1DH3 A;  1NTM J;  2Q1K A;  1N73 A;  2W8Z A;  3VMY A;  3EQQ A;  3B5N A;  1FU1 A;  1J1E C;  2YIU C;  3Q2Y A;  3VTP C;  1EDI A;  1FDO A;  4D6T D;  3NFQ A;  3L75 D;  2WMM A;  1BSH A;  5DJT B;  2HMO A;  1JY3 O;  3L35 A;  2WSE H;  5E79 E;  3I55 P;  2B88 A;  1NVO A;  1MV8 A;  1NO4 A;  1KIL A;  2O01 N;  3AEA C;  2Q9I A;  2N9B A;  5B66 E;  1VF5 D;  4NBC D;  2OYH A;  2QM8 A;  1IFD A;  2HOD B;  2PRR A;  3A3Y B;  3T97 A;  2J58 A;  2I1J A;  2R3C A;  1SQV E;  1JUN A;  1SQV D;  1R5S A;  1HUC A;  1IK9 A;  2KZJ A;  2P10 A;  4OGQ D;  1OVR A;  2XV5 A;  2I1K A;  3H1H J;  1G8K B;  1EC5 A;  2XZR A;  1BE3 E;  1M1J A;  1U57 A;  1G1J A;  3H1L E;  2PP6 A;  1LTJ C;  1VCK A;  1M1J B;  2C9L Y;  3V2R A;  2A06 G;  1JO5 A;  1SQB K;  1KOR A;  3H1H G;  2FXM A;  4ZKU A;  3H1K E;  3AEG C;  1GD2 E;  2QVA A;  1JMM A;  5AW8 B;  1T2K D;  2HMJ A;  2NUK A;  3R2P A;  3L37 A;  2WSF H;  1IO4 A;  1NYH A;  4WBA A;  1HWT C;  1AJY A;  3L70 D;  1VQ4 P;  3AE4 C;  2NZ2 A;  2IBZ G;  4W7Y A;  2KLU A;  3MHV A;  3FWL A;  1S5L H;  3AEE C;  5AW7 B;  2R5D A;  3R4Y A;  1KFN A;  1BCC J;  5GTI H;  2K9J A;  4AIV A;  4YTP C;  4HM4 A;  5E79 H;  2BAS A;  3RBX A;  5GTH E;  1PV3 A;  2BCC D;  1FZG A;  3L71 E;  2KYV A;  3BAT A;  1NKN A;  3MGN A;  5AVY B;  1GU5 A;  4H0L C;  3ITK A;  2E74 D;  2E75 C;  3CWB D;  4RO0 A;  1SFC B;  4GOD A;  1L0L G;  4DCK A;  3L70 J;  1ZOY C;  1JB0 J;  1L0L D;  3KQG A;  2OYI A;  1AVY A;  2N1T B;  1FZB A;  1FZC B;  1BGY J;  1PGQ A;  1ULI A;  2KB7 P;  1VQ9 P;  3U1A A;  1SJG A;  2ZVO B;  1L0N D;  2WQY C;  1EDK A;  1L0N G;  4GDO A;  1BE3 G;  1KIL E;  2Y0E A;  2YO2 A;  3A0B E;  1M56 D;  2Y9Z A;  3W68 A;  4RES B;  2E75 D;  4K3A A;  1SQQ E;  1L4A C;  1JY2 O;  5KJ7 D;  1MFZ A;  1FZE A;  3WMM 0;  1G2C A;  1LTJ B;  3I56 P;  2FFD A;  2HYN A;  4KT0 J;  1G8J B;  1JM0 A;  2CPS A;  2Y0D A;  1S3J A;  1GL2 C;  1JY3 N;  2WSC H;  1YIT P;  1L2P A;  4D6T E;  1O7P A;  1FS0 E;  2OTL P;  5GTH H;  2FYU J;  2M3E A;  2NVG A;  1LTS C;  3D89 A;  2W6B A;  5H2F H;  1KQL A;  3KPE A;  3CC4 P;  4U3F E;  1UIX A;  1T3J A;  1SQX G;  3FX0 A;  2OYH B;  3PTZ A;  3L71 D;  1OXZ A;  5CMZ A;  1KIL B;  3N7N A;  3L71 G;  5TIS E;  1VQ7 P;  1RF1 A;  2QSI A;  2YIU B;  3H32 A;  3M06 A;  3V4Q A;  2YFL A;  3AZC A;  4O9B A;  3K5B A;  1X0T A;  3CWB E;  2VRS A;  4CPG A;  1CI6 B;  3II6 A;  1U7M A;  2B87 B;  2M5A B;  4EYY Q;  1L0L E;  3IN6 A;  1W5C E;  1H8A A;  2V7Q H;  1VQN P;  1JEK A;  1JY2 P;  2QJY C;  3B5N B;  5KLV G;  3RK3 B;  1OMI A;  4PD4 I;  3U59 A;  3LID A;  1ZLL A;  1VPC A;  4ZNC A;  1YHQ P;  2C0W A;  3H1I E;  3RK2 B;  1GK4 A;  3RL0 D;  1NJI Q;  1K73 Q;  2WSF J;  3CXH E;  3B8E B;  3SWK A;  1PZQ A;  3D6Y A;  1GW4 A;  5KAI H;  1MFT A;  1FDM A;  2H89 C;  1ULJ A;  3NTN A;  5AW0 B;  3DQY A;  1O7N A;  1USD A;  2KNC B;  3GHG A;  2NVE A;  4U7J A;  3GLM A;  1LJ2 A;  1WRG A;  2KI7 B;  2MKV A;  5CCG C;  4HM6 A;  3P32 A;  3G3Z A;  3HD7 D;  1S4X A;  1QX8 A;  1L4A D;  3CCR P;  4P1C H;  4PV1 C;  2IFM A;  1L4A A;  4ASV A;  4GIF A;  3WU2 E;  1UII A;  1NTM E;  4EI2 A;  4DOJ A;  1PP9 E;  2N1T C;  3GL2 A;  3KZI H;  1BCC D;  4N78 E;  3CCJ P;  1DD3 A;  3O8Z A;  2WIT A;  4H13 D;  1LTA C;  1SFC C;  1FAV A;  3VMA A;  2QJK C;  2FBW C;  4U3F G;  4H0L B;  1KYO E;  4WB4 A;  2AXC A;  3RK3 D;  1VF5 B;  2XDJ A;  1U7J A;  1EXJ A;  5CHX A;  1IFJ A;  1YQ3 C;  2B9B A;  2QJP C;  4IOI H;  4H0L D;  2WSS H;  1S2E A;  3CPW O;  3HTK B;  1LP1 A;  4HM3 A;  3HD7 B;  2GM4 A;  3HE4 A;  2K1A A;  1BSN A;  2RKL A;  1RHZ B;  5KLV E;  3PH0 A;  1DEB A;  1BE3 J;  3M0A A;  3G6E P;  2IBZ I;  3VP9 A;  3IR9 A;  3E7K A;  3H1I G;  1W2B O;  3CL3 D;  5KAI E;  2OYI C;  4HM1 A;  2E43 A;  3L72 G;  1RH5 B;  1RE4 A;  1SLQ A;  3S4R A;  1SQQ J;  2ZYD A;  2GA1 A;  2CPB A;  3KZI E;  4A7P A;  4HJG H;  3VMZ A;  3GOB A;  3VN0 A;  4LGD E;  2W90 A;  3SWF A;  2JR8 A;  3H1H E;  1JOC A;  1NH4 A;  2YKQ A;  3H1I D;  1M1J C;  3BVH A;  2JO1 A;  3A0B H;  4Y99 C;  2OTJ P;  2LR2 A;  3CX5 I;  5HL4 A;  3HUS C;  3KXD A;  5EFW B;  2J5U A;  3MD0 A;  1KTM A;  3GHG C;  2KXP B;  5AW1 B;  2A06 D;  1J1D B;  4L73 A;  1S5L E;  1NTM G;  2IBZ E;  4IFM A;  2O1K A;  1PFI A;  1CI6 A;  3L75 E;  3NMD A;  4PJ0 H;  1M1K Q;  3CLQ A;  3CC7 P;  1K8A Q;  2Q3E A;  1YTZ I;  4NPF X;  2R44 A;  2E76 C;  1N86 A;  3AE5 C;  2KUB A;  2E4Q A;  3N0Q A;  2Z4E A;  4C7N B;  3MUD A;  4QCK A;  3L74 D;  3P7K A;  1JNM A;  5KJ7 A;  2ZXX A;  3SFE C;  1J1E B;  4EOT A;  4JYB A;  1SS1 A;  3EFG A;  2HPC B;  1DX7 A;  1IC2 A;  3OJA B;  4WY4 B;  2P2U A;  1PIX A;  5KJ7 C;  1NTK J;  1FQT A;  1L0L K;  5BU8 B;  3PRJ A;  3L74 G;  1NAF A;  3FXE A;  1GK6 A;  1MKM A;  2FFD B;  2WPV B;  3RGU A;  5KLI C;  4XFJ A;  1VQ6 P;  3TNU B;  2JP3 A;  2FKW B;  5KKZ C;  1LTB C;  2JWA A;  4QDF A;  1H0T A;  1EQ7 A;  4L75 A;  3Q5S A;  1N7S B;  1NTM K;  3W67 A;  2ZT9 D;  1LWU A;  2QPZ A;  3H1H D;  3WUV A;  4XA4 A;  3HE5 B;  3WU2 H;  3OAK A;  1YYC A;  3L36 A;  3HRN A;  4Y28 J;  3BRT B;  1JM1 A;  4QUR A;  2BEQ D;  1QL1 A;  2NPS B;  3SWY A;  2IDB A;  2ZAE B;  1NOH A;  2DE5 D;  2N1T A;  3P8M C;  3BCC E;  1KMI Z;  1NGM B;  1K05 A;  1M90 Q;  3GF7 A;  3GTE A;  3KHU A;  1SFC A;  4UB6 E;  1HH0 A;  2QEX P;  1YJ9 P;  4D6T G;  1KYO H;  3L75 G;  1Y8A A;  3TGU J;  1X22 A;  1YI2 P;  1L0N K;  1W2E A;  1NYK A;  1FZC A;  3HD7 C;  1O7W A;  2SPZ A;  2XSH A;  4U3F D;  1QEX A;  2GUV A;  1SQX K;  1FE6 A;  2K9J B;  2WVR A;  1RFS A;  1LT9 C;  1Q90 D;  3AE2 C;  2FXO A;  3RL0 B;  2FYU D;  3CWB G;  2E74 B;  1J2J B;  3H1J J;  3H1I J;  1A02 F;  3LW5 J;  2WTY A;  1YBK A;  2K37 A; 
#chains in the Genus database with same CATH homology
 3FOU A;  3Q1M A;  1UIX A;  1RIE A;  2ZT9 B;  2HML A;  3GF3 A;  4H44 B;  5AEU A;  2YMK A;  3L74 E;  3B71 A;  1Y9B A;  3GL0 A;  2QSI A;  1SQP E;  4H44 C;  2YFL A;  1UUW A;  1NU1 E;  3AZC A;  4HJL A;  2Q3W A;  1O7H A;  3CWB E;  3GMA A;  4H44 D;  2HMM A;  2V7Q J;  1PPJ E;  1OW7 A;  3AE3 C;  1L0L E;  2O01 J;  3IN6 A;  3GCE A;  1EZV E;  2QJY C;  2D2C D;  1SQX E;  3AE7 C;  3L70 E;  1OMI A;  1OW6 A;  3AE6 C;  1K04 A;  4HM8 A;  2E76 D;  1UUV A;  3H1I E;  3D6Z A;  2HMK A;  3O6Q A;  2WSF J;  3CXH E;  1O7M A;  1OW8 A;  1R8E A;  2E75 B;  2WSE J;  1DIP A;  3VCA A;  4OGQ B;  3D6Y A;  4NBE D;  3RL0 g;  2JZA A;  3EWK A;  5M1B A;  2H89 C;  1ULJ A;  4QDF B;  1RQU A;  2BCC E;  4QDD A;  3DQY A;  1O7N A;  2NVE A;  4U7J A;  4QUQ A;  3GLM A;  2MKV A;  3AE1 C;  4HM6 A;  2GBW A;  3AE8 C;  4NB8 D;  1HF9 A;  4P1C H;  3SFD C;  4PV1 C;  3L73 E;  1EXI A;  2D2C B;  3GB4 A;  3AEF C;  3VMG D;  3G9R A;  1NTM E;  1PP9 E;  3GL2 A;  4IL6 X;  4RKU J;  3VCP A;  3VMI D;  1DD3 A;  2GBX A;  4NBF D;  2JO6 A;  4HM2 A;  4QDC A;  4H13 D;  3S9O A;  1O7G A;  1FDI A;  2QJK C;  2FBW C;  3Q5P A;  4H0L B;  1NTZ E;  1KYO E;  2E74 C;  1VF5 B;  4I7Z C;  1EXJ A;  1YQ3 C;  1NTK E;  3AEC C;  3C8V A;  2QJP C;  1BCC E;  3Q5R A;  3IAO A;  4HKV A;  1ZRT E;  2E4P A;  4H0L D;  1S5L X;  3H1J E;  4NBD D;  3L72 E;  1HJ0 A;  3TGU E;  4HM3 A;  2OQQ A;  5CXM A;  2NVF A;  4HM5 A;  3EQQ A;  5KLV E;  1ZP0 C;  2YFJ A;  2YIU C;  3Q2Y A;  1FDO A;  2FXP A;  4YXD C;  2DE6 D;  3GZX A;  4HM1 A;  2DE7 D;  2HMO A;  2ZT9 C;  1DD4 A;  4H13 B;  2E76 B;  3T97 B;  3AEA C;  2YFI A;  1VF5 D;  4NBC D;  3RK3 E;  3GOB A;  1SQV E;  3H1H E;  4PV1 D;  2P10 A;  3EN1 A;  4OGQ D;  4TT3 H;  1IK7 A;  2JO1 A;  2BMR A;  2B24 A;  2B1X A;  5HL4 A;  1G8K B;  2FYN C;  2J5U A;  1BE3 E;  1KTM A;  1U57 A;  3H1L E;  1VCK A;  3D70 A;  4EMJ B;  2IBZ E;  5BOK A;  3ABV C;  3L75 E;  1KOR A;  3VMH D;  4QUP A;  5L8R J;  4I7Z B;  3H1K E;  3AEG C;  3D71 A;  2HMJ A;  2NUK A;  2E76 C;  3AE5 C;  2E4Q A;  1NYH A;  2CKF A;  1VM9 A;  2BMQ A;  3N0Q A;  1AJY A;  4QCK A;  3AE4 C;  2NZ2 A;  1EG9 A;  2A06 E;  2WSC J;  1NDO A;  3SFE C;  1ZME C;  3AED C;  3FGA D;  1KQF B;  1Q90 C;  2ZYL A;  3AEE C;  3R4Y A;  1PIX A;  2H88 C;  2XRX A;  4Z1M H;  3C0D A;  2BMO A;  4AIV A;  5AEW A;  1FQT A;  4PD4 E;  4YTP C;  1SQB E;  2XR8 A;  1KQG B;  4HM4 A;  1WQL A;  4HM0 A;  2NWF A;  2K9Y A;  3AE9 C;  1PV3 A;  3L71 E;  1MKM A;  2HMN A;  2WPV B;  4NBB D;  5KLI C;  4XFJ A;  1WMK A;  4H0L C;  2JP3 A;  2E74 D;  2E75 C;  5KKZ C;  4QDF A;  3GTS A;  3Q5S A;  1ZOY C;  1JB0 J;  2ZT9 D;  4NB9 D;  2XSO A;  4P1B H;  2QPZ A;  3H25 A;  1P84 E;  1S1C X;  3GKE A;  1ULI A;  4NBG D;  2QIW A;  4Y28 J;  1JM1 A;  4NBH D;  2D2C C;  4QUR A;  1SJG A;  2BEQ D;  3CX5 E;  4NBA D;  2WQY C;  2IDB A;  4PV1 B;  4GDO A;  2DE5 D;  1KIL E;  3BCC E;  1KMI Z;  1NGM B;  1K05 A;  3GF7 A;  3GTE A;  2E75 D;  1SQQ E;  1RQV A;  3Q3D A;  2YVJ B;  2FYU E;  1GMJ A;  1VL2 A;  1PL5 A;  4KT0 J;  4OGQ C;  1NYK A;  4R4L A;  3AEB C;  4HM7 A;  1G8J B;  1L0N E;  1KB9 E;  3GZY A;  1O7W A;  2XSH A;  2NUM A;  2I7F A;  4R4M A;  2G3A A;  1TU3 F;  1RFS A;  2BEZ F;  1Q90 D;  3AE2 C;  1O7P A;  1VF5 C;  2E74 B;  3LW5 J;  1YQ4 C;  2G8Y A;  2NVG A;  3D89 A;  4H13 C;  4U3F E;  4AAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...