2E76D

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
168
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 35
structure length 168
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e76D02
3N0QA 1FQTA 3BCCE 3GL2A 3EQQA 2E75C 4AAYB 1SQBE 2HMMA 1SQPE 1SQXE 4H44D 3CX5E 3GKEA 1SJGA 1UUWA 3FOUA 4H0LC 2A06E 2DE7D 2FYNC 3VCPA 2D2CD 2I7FA 4NB8D 2E76D 4U3FE 2E74D 2XSOA 1SQVE 1P84E 1PPJE 5KLVE 2YFJA 1O7GA 4H13C 4QUPA 2BMQA 4HM3A 3H1KE 3H1LE 4NBDD 1VF5C 3TGUE 2NVGA 3GB4A 2BMRA 3H1JE 1KB9E 2QJKC 2GBXA 1G8KB 2XR8A 3CWBE 3VMGD 3GTEA 4HM1A 2FYUE 4HM7A 1L0NE 4OGQD 1VF5D 2NVFA 2YFIA 3EN1A 3L73E 5AEUA 4H13D 4NBAD 3AZCA 3GTSA 1PP9E 3D89A 1BCCE 1UUVA 2ZT9C 2E4PA 5KLIC 3VMHD 4NBCD 4H0LD 3DQYA 5AEWA 4HM5A 2YFLA 1VCKA 2QPZA 4HKVA 2E75D 2JZAA 3CXHE 4NBBD 4QDFA 1O7PA 1L0LE 5CXMA 2CKFA 2NUMA 2XSHA 3VMID 4PD4E 2YIUC 3L74E 4QDDA 2DE5D 1G8JB 4QUQA 4EMJB 4NBED 1SQQE 2ZYLA 4NBHD 4NB9D 4AIVA 4HM0A 1O7MA 3C0DA 2ZT9D 4HJLA 4NBFD 3H1IE 5BOKA 4QDFB 4NBGD 1O7HA 1NTME 1RIEA 1NU1E 4OGQC 2HMNA 1O7WA 1NDOA 2NVEA 2YMKA 2QJPC 1VM9A 1BE3E 3GOBA 1Q90C 1RFSA 1NYKA 3GL0A 3GZYA 2B24A 3L71E 2E4QA 1EG9A 4I7ZC 2BCCE 5HL4A 1JM1A 2HMJA 1EZVE 3L70E 4HM4A 2BMOA 2GBWA 2E74C 2XRXA 2JO6A 2E76C 4P1CH 1O7NA 2B1XA 2D2CC 2IBZE 4HM8A 2NWFA 3GCEA 4HM2A 2Q3WA 4QDCA 4QURA 4H44C 3VCAA 2DE6D 5KKZC 2QJYC 4QCKA 3L75E 3GZXA 1ULIA 4HM6A 1NTKE 1NTZE 1WQLA 2HMLA 1KYOE 2YVJB 2HMKA 4PV1D 3H1HE 3L72E 1ZRTE 4P1BH 4PV1C 2NUKA 2HMOA 1ULJA
chains in the Genus database with same CATH superfamily
1FQTA 2OQQA 2Q6QA 3P7KA 1SQBE 1SQQK 1X0TA 1SJGA 3HE4A 4TLFA 2BASA 1SQVE 1U7MA 4Y99C 4JYBA 4DZOA 2PAJA 4UB6E 1T2KC 3KPEA 1NO4A 2ZAEB 4IFMA 4HM7A 2WPQA 1QX8A 5APUA 3RBXA 3MIWA 2HPCB 1DX7A 1L0LK 1RF0C 1L4AB 2JR8A 3KZIH 4HKZH 1M1JA 1EXIA 2Z5IA 4ASVA 3AE5C 3MHVA 2ZYLA 2N1TA 3OAKA 4NBFD 4PV1B 5CBNA 1M8OB 2Y0DA 2WT7A 3HD7D 3M0DC 3M9BA 1KILA 1LWUA 1NAYA 3P32A 1RE3C 3B5NB 3PTZA 2NZ2A 4EYYQ 1AV1A 1JY3N 2QJPB 5KKZB 3TGUD 4ASWA 3Q1MA 4C46A 2OTKE 2Q9IA 1PV3A 1KILD 1NTKG 3O6QB 1L0ND 4DJGA 2Q3EA 3M0DA 1IFJA 2QE7H 5AVXB 2YO2A 1ZOYC 2GUVA 2IBZI 2KXPB 1BE3J 3GHGB 3OA7A 2OYIA 1DH3A 1S5LH 3CX5E 5KJ7D 5CJ4A 1WRGA 3RK3E 1J1DC 1EZVI 3BRVB 1KYOI 5AW6B 1URQB 5B66E 3BCCG 1KB9E 2K1AA 1JTHB 2GBXA 1J1EC 1USDA 2K88A 4HM1A 2IBZD 4W80A 3SFEC 2HFED 3GW6A 2BCCD 3CWBG 2NPSA 5CBOA 2AXTH 1SQXD 3GG2A 1RQVA 4HM5A 4HKVA 3CXHE 1PGPA 1HUCA 1H89A 4RESB 1BE3D 3L74E 2E5TA 1GL2B 1IFNA 3U1CA 1FAVA 1MUUA 3L37A 1DEBA 1VQOP 3M9HA 4DCKA 1DD3A 1EC5A 2ZYAA 2FXMA 1LTTC 1O7HA 1O7WA 1BDCA 3H1JD 1IK9A 3CLQA 2P7JA 1H0TA 3A0HE 5HL4A 1SP4A 5KLVK 2WITA 3AE2C 1OW6A 1ZXGA 2AEJA 2IX7C 2M0BA 3L4FA 2C0WA 2W83C 1G1JA 1Q2NA 2LXCB 4XA4A 1S9KD 3KZIE 2JO1A 1VQ8P 2MJZA 3FWNA 3A2AA 4BXLA 2QEXP 2O01H 3VMYA 1OVRA 4NB8D 1NTMK 2E74D 4U3FE 2FKWB 1EDKA 3PJSK 1JMBA 3TGUE 5APVA 1L0LJ 3H1JE 3NTNA 1JY2P 3VMGD 3GLMA 1FZCA 1L0NE 1M90Q 2ITAA 1PP9E 2FXOA 2B87A 1GZLA 2E5YA 4PD4H 4OGQB 1KB9H 1UIXA 4U3FG 3CI9A 1ZMEC 3PRJA 5KLIB 4AQRD 3KXDA 1HF9A 5APYA 4JF7A 2KK7A 1UIIA 1QL2A 2N9BA 2R44A 1L0NG 2P10A 1AJYA 4GT1A 5B5EE 1VQ5P 2VRSA 4CPGA 4NBGD 2ZVNB 2V7QJ 3CC7P 5E79H 2QJPC 5KAFE 3V2PA 3HE4B 3GZYA 3D6ZA 4WY4D 5AVSB 1FDOA 2BCCE 3H32A 4IL6E 2XNDH 4HM8A 4M3LA 2W90A 4HM6A 1NTKE 1HJ0A 3AEFC 5KLVJ 3D70A 1CI6B 4L75A 3BVHA 5C39A 1ZR4A 4N6JA 1ZV8A 3VP8A 3V5BA 2I8DA 3GHGC 2BCCG 3CWBD 2J5UA 1YHQP 1OZHA 2DE7D 4NPEA 2I7FA 2B87B 2HODB 1NTKD 4GOEA 1N73B 1BCCD 2G3AA 1VQMP 2AXCA 3USSA 2ZXXA 3IF4A 2M5AA 4HM3A 4D6TE 3H1HJ 5H2FH 1FU1A 3GMAA 1LTJC 1SVFA 2JKVA 3AE4C 2O1KA 1NKZB 3EN1A 2NVFA 1SFCC 5AEUA 4H13D 1BGYG 1IFDA 1LTSC 4HYTB 2NPSD 2ZT9C 2N1TD 1IK7A 1SQVJ 5KJ7C 3RL0B 2QM8A 4U7JA 1VDFA 3L70D 3AE8C 1OMIA 3BCCD 2YKOA 4PD4E 2KZIA 4NBED 3IR9A 1JM0A 3RL0g 1S1CX 2ZT9D 2CPBA 4AYCA 2NPSC 3L75D 5BU8B 1BGYE 3HUSC 1LGHB 4Y99B 1MKMA 3CX5D 5CCHC 3L75J 1CI6A 5AW9B 2UWJE 1N73C 1LNQA 4Y28J 1AVYA 3GL0A 2HMJA 1KZUB 1EZVE 3CD6P 2XKMA 2XRXA 1ZN5A 3F5HA 4QDCA 3SWKA 2WSEH 1U57A 2IPPA 2OYHA 1Y8AA 1GK4A 3LW5J 4GOFA 2WWWA 2WZ7A 1LP1A 3CWBJ 1KN7A 1ULJA 2FYUJ 3C1LA 3BCCE 5AVVB 2AEFA 1E5WA 3EQQA 2J58A 2KB7P 1K04A 4H44D 1FOSF 1BCCJ 1JCDA 3AEGC 1OW8A 2KIKA 1PPJE 4WY4A 2YFJA 4LC1A 1RE4A 2N1TB 2FY8A 2YFIA 5L8RJ 1FJKA 1VQ4P 4A7PA 2E4PA 5KLIC 1JEKA 3MP7B 2Z4EA 2PFXA 1EZVD 1KYOD 1JNMA 2QJYB 1SQPK 1M7LA 2KUBA 1S72P 4AIVA 1LTBC 2K37A 4HM0A 5B66H 3H1IE 1YTZT 2OTLP 2NRGA 3H1HD 1FS0E 1GDTA 2YKQA 2H88C 3FXEA 3TSIA 2W6JH 3M91A 3WU2E 3L74J 5AVUB 1VQ6P 1SQBJ 2GBWA 2E76C 4L74A 2Q3WA 2FYZA 5AVWB 3M06A 3VCAA 2DE6D 2KSEA 2HMLA 3HTKA 1N7SA 1DD4A 2L5GB 4PV1C 2JWDA 1K8AQ 2IFMA 2RN0A 3GL2A 4DOJA 3HTKB 2CPSA 2IDBA 5EFWB 1U7JA 1IZNB 1S2EA 1L0NK 2WSEJ 1SFCD 2NVGA 2IFNA 1NJIQ 4O9BA 3CCMP 2XR8A 1FZCC 4N78E 4JYCA 4D6TG 2HR3A 2WSFH 2OARA 3CCRP 1JY2O 4YTPC 1W2BO 1N7LA 2PGDA 1A02F 1FBMA 1ZR2A 3V2QA 1K73Q 3AEEC 1AVOA 5CXMA 2R5DA 1KFNA 3GF7A 5APXA 2QM7A 3L73J 1PP9J 1PPJD 3SWYA 3P8MC 4DT0A 3CXHD 1NDOA 1RF1B 1LTIC 1LTGC 5K5GB 1DEEG 1FJPA 4K35A 1L0LG 3B5NA 1BDDA 2IBZG 1EG9A 1R8EA 3AE7C 1N7SD 3Q5PA 4HM4A 2FYUD 2OYOA 5TISH 3WU2H 1NU1J 4UB8E 2GUSA 2HMKA 3B8EB 3CXHI 3IFMA 1BE3G 4P1BH 4GDOA 1VF5B 3GHGA 3N0QA 3AE3C 3FWLA 2XNXA 1GW4A 2OYIB 5AW7B 3RK2C 3H25A 1Q82Q 2KI7B 3VOPA 4IFDK 1M1JB 2E76D 1W2EA 2JP3A 5KLVE 5CCGC 1O7GA 4QUPA 5APWA 1NTKK 1IC2A 3H1KE 3H1LE 3L74D 1QL1A 3B71A 2BMRA 3N4XA 3O6QA 1VQ7P 1KILE 3V2RA 2ZXEB 1SQQJ 3GTSA 1WMKA 1UUVA 1N2DC 2OGUA 1SQPD 3MUDA 1R5SA 2YFLA 1XTGB 2OTJP 4D6TJ 1J1DB 1Y47A 3VMID 1M1JC 1AA0A 2WSCH 3M9QA 2A45I 4YXDC 2IYPA 1S4XA 1YTZI 1RIEA 2HMNA 3KHUA 2GM4A 4I2LC 2N9YB 3IAOA 1RE3A 1PFIA 4HJGH 1LT9C 5AW1B 3I5CA 3JSVC 1SS1A 2QSIA 2QRXA 2XZRA 1XTCC 1HVVA 1SQXJ 2A06G 1BGYJ 4H44C 1OFCX 1NU1D 4GKGA 1LTAC 1ULIA 2FYNB 1NTZE 2KYVA 3CX5I 4I6MC 3H1JJ 1S5LX 4IFFA 4PD4I 2PRRA 1OWAA 2NPSB 2P2UA 2E75C 2KSJA 2HMMA 1D7MA 2BEQD 4EIJA 2A06E 4PJ0E 4H13C 4KHXA 2FFDB 1L4AC 3KQGA 3LIEA 2H89C 1FOSE 1MFTA 1N73A 3CWBE 2FYUE 4KT0J 3BCCJ 4PD4D 5GTIE 4NBAD 2W6AA 2O1JA 2E43A 2KLUA 3PLNA 1QGKB 1G2CB 2IYOA 2YKPA 3H1IG 3S1KA 2E75D 1KC8Q 1Q86Q 2CKFA 2OYHB 4N3YB 4QDDA 2V7QH 1G8JB 1VQNP 2FYUG 1ZLLA 1J2JB 1O7MA 1USEA 1JY3O 1KORA 2Y0CA 2AXTE 4QDFB 1JO5A 1BCCG 1MV8A 1EDIA 2WPRA 1M57D 4IL6H 4OGQC 1BSNA 2R32A 3SSUA 3UIAA 3GOBA 4WY4C 3P8CE 2WMMA 5AW5B 1PGJA 2RH0A 1SQPJ 4L76A 3S9OA 4P1CH 2IBZE 4WWIA 4BWNA 4QURA 1GU4A 2Y9YA 3HE5B 3G4SP 3GZXA 2P1JA 1J1EB 3VMXA 1Y9BA 3L70G 1L4AA 2WT7B 2NUKA 1YJNP 2OYIC 2K3RA 2ZJSE 4AAYB 2O01J 1SQQD 3E7KA 3V4WA 1WT6A 3B5ND 2BMQA 1KQLA 1Q90D 1JCCA 4R4MA 5KAIH 1GD2E 1OX3A 3H1KG 3A0HH 4WY4B 2G8YA 5CCGD 3AZCA 1KD1Q 1X79B 4YXWH 3DQYA 1SLQA 1E79H 2JZAA 1KFMA 1NH4A 4KJMA 1QVGO 3V2NA 2M3EA 3L74G 4I1LA 3W67A 1NU1G 4RJTA 3CXHH 1SQBD 3RK3D 1AFOA 3MUDC 4K3AA 1FZFA 3NXSA 2H7HA 2KS1A 1Q90C 3RL0C 1HTLC 3WUUA 1HBWA 3HUSB 3V4QA 2BMOA 2I1KA 2M5AB 3CL3D 1VPCA 3L71G 1H8AA 3L73D 1Q7YQ 1CZQA 3BASA 5DJUB 4QCKA 1FZGA 2P58A 1KMIZ 1EZVG 3JC22 1HH0A 4HB1A 1VQPP 1YI2P 1K9MQ 1QLED 3HE5A 3OW2O 3VCPA 5B5EH 3H1ID 1SQBK 2E76B 5CHXA 2A45H 3H1JG 3GB4A 2LKMA 3FGAD 1SQVK 4H13B 2FFDC 3D6YA 2KOGA 1GU5A 3K5BA 3G9RA 3VMHD 4NBCD 1NTMJ 1TU3F 3H1KJ 3H1LJ 4NBBD 4QDFA 4GODA 2POHA 1N7SB 3HRNA 5AVZB 1SQQE 1ZRTD 4NB9D 1ZP0C 3HUSA 3CCQP 2ZYDA 1T8ZA 3L35A 3CCSP 4OVNF 5APSA 1HGVA 2M3BA 3R2PA 1IJDB 3CCJP 5CMZA 2QVAA 4D6TD 2E4QA 4I7ZC 2JDIH 1KQSO 4JBZA 1SQQG 1W5CE 2W8ZA 1FZEA 2JO6A 2B1XA 3AE9C 3HD7C 4WBAA 2K9YA 2WSCJ 2YVJB 3BATA 4NPFX 1NU1K 2M8RA 1NOHA 3H1KD 4NPDA 1H88A 3HD7A 1SQXE 3GKEA 1PPJG 2KLVA 1NKNA 5AW4B 1JMMA 1KILC 1LWUC 1RF0A 4JQ0D 1IO4A 4H0LB 1PZQA 1PL5A 2JWAA 1NTZK 2HPCA 5AVQB 1T2KD 2V4HA 2RKLA 5M1BA 3L72D 3L73E 4UB8H 1OXZA 3CX5H 1QVFO 4W7ZA 2O01N 5AVYB 5BVZA 2IZ1A 2YNYA 4TT3H 2C9LY 3HD7B 3U59A 1RH5B 2E74B 3PP5A 3GF3A 3EFFK 1FDIA 2XSHA 2YIUC 4QUQA 4HH2A 3L71D 3L73G 3C0DA 5BOKA 1LJ2A 3CC2P 3TF5A 4EI2A 3VMZA 1NU1E 1GW3A 1T3UA 1GL2C 1VQLP 5GTHE 3PHLA 1N86A 4BRYB 5KAIE 3T97A 4UB6H 1P84H 1OW7A 1AQTA 3L70E 1PGOA 4ZKPA 1M56D 3II6A 1FZBA 1PP9D 3Q5SA 1Z56A 1ZW0A 3RK2D 5AVRB 1SQBG 5AW8B 1EXJA 1WQLA 2WVRA 2OYHC 1SFCB 3Q5RA 3L72E 1ZRTE 1A02J 2B89A 1OVVA 2WQYC 2YIUB 4ZKUA 1SQPE 1G1IA 2N1TC 3MTUE 2KNCB 1JTHA 4IL6X 1JY3P 4B86A 4OH8B 2WSFJ 3JCUH 1VF5C 1IFMA 4LLHA 3P8CD 3EFGA 3CCLP 1RQUA 1YIJP 2QJKC 1GMJA 2H43A 1NWQA 2A06D 1KQFB 1BSHA 2JEEA 2Q3IA 2SPZA 5AW3B 5AVTB 3A3YB 3Q3DA 1JY2N 1GL2A 4JPZB 4XFJA 3L71J 1OIPA 2DE5D 2R3SA 2WTYA 1YYCA 3EQ2A 5CCGA 2BEZF 1NTZJ 4I7ZB 1T3JA 5GTIH 3RBZA 3FX0A 2MKVA 1X9VA 2KZJA 2B24A 1RF1A 1JM1A 3VTPC 1HGZA 3ITKA 3ABVC 1BGYD 3PH0A 3AEAC 4HM2A 5KTBA 1YJWP 3WUTA 4C7RA 1NGMB 4LGDE 4PV1D 1VL2A 1MZ9A 1L2PA 3L72G 2HMOA 3G71P 3I55P 1RHZB 4AUWA 3AEBC 4L73A 3L75G 1UUWA 4H0LC 3I56P 2FYNC 1EDLA 4ZMDA 3H1LG 1S3JA 4XE5B 3A7OA 3N7NA 3OJAB 3SWFA 1S5LE 2IZ0A 1JUNA 4NBDD 5GTHH 2HYNA 1GL2D 3TGUG 3MD0A 2WPSA 3B5NC 3CMEP 1KTMA 4BRYA 3FXDA 2XDJA 2E75B 3C9IA 3TDKA 4H0LD 1MFZA 2QPZA 2GA1A 1O7PA 2NUMA 3L36A 1RF1C 4EMJB 1KYOH 3TYYA 3AEDC 1QEXA 1NTME 1NHLA 2YMKA 3MGNA 1CW5A 2JJLA 3LIDA 3RK2B 1PIXA 2QG4A 1URQC 1NTZG 2XV5A 1O7NA 5KJ7A 2YO3A 2ZYGA 2QJYC 1SQXG 5TJHA 2LXBA 1LT1A 5H2FE 1LTJA 3JCUE 4N78D 1FDMA 3B4SA 3IN6A 1IFPA 2XSOA 3H1HG 3O8ZA 1PP9G 1NTMD 1GTWA 1L0LD 3GTEA 3A5TA 5CCHD 1S9KE 2Q5UA 1FZAA 1LTJB 2K9JA 2W27A 3AE6C 1P84I 5CCHA 2HLOA 3CCUP 1KB9D 3TGUJ 1L0LE 3CC4P 3D71A 3VN0A 3SFDC 5KLVD 3M0AA 1RY3A 3VMAA 3KYQA 1X8YA 3E1RA 3U1AA 4H44B 1SQVD 1YQ3C 2FXPA 3QWOC 3CCEP 3W68A 2NVEA 1K05A 3E1IA 2CK3H 1P84D 2HODA 3KDPB 1BE3E 1KB9I 1OVUA 1R5LA 2FYUK 2HG5D 2D2CC 2NWFA 2LR2A 3T97B 3ZDMA 5KKZC 1SQPG 3C8VA 4U3FD 5APQA 1KYOE 3RK3B 3CPWO 1PGQA 1EDJA 1YBKA 1N8RQ 2YXRB 2ZT9B 4C7NB 2K9JB 3FOUA 2R3CA 5BU5A 2KS1B 1URQD 3R4YA 1T6AA 5CJ0A 3CCVP 2C0XA 3RL0D 2RMZA 2ZVOB 2H8PD 1RE4C 1G8KB 2QIWA 3CMAP 4PJ0H 2W6BA 3WUVA 2XU6A 2YMYA 1LP1B 5DJTB 3H1LD 3RGUA 2Y0EA 5TISE 3H6PA 1IFIA 2C9NY 1HWTC 1FE6A 1FZCB 3LW5H 2FBWC 4HJLA 1VQKP 1M1KQ 3G3ZA 3S4RA 4R4LA 1H0TB 1X22A 2J59M 1N7SC 1VM9A 1RFSA 2A45G 1NYKA 4MN4C 3L71E 1VQ9P 1NYHA 2E74C 1EQ7A 1GK6A 4EDFA 4U3FJ 3WMM0 3A0BH 3L75E 2DW3A 3VP9A 3F89A 3BRTB 1AQ5A 1G2CA 1FC2C 3AECC 2KP8A 1L0NJ 4WB4A 2R5BA 4EOTA 1JOCA 2D2CD 1NTZD 2O3JA 1YQ4C 3TNUB 1P84E 5E79E 4YPCA 4IOIH 1LT9A 1KV4A 5KAFH 5KLVG 5AW0B 3H32B 1HJBA 3A0BE 4OGQD 1VF5D 3QH9A 2Z5HA 1KILB 1LWUB 3G6EP 3D89A 1BCCE 4QMAA 3V6IA 5AEWA 1NVOA 1VCKA 1NTMG 4GIFA 1SFCA 2BCCJ 3VYIA 5APTA 3L70J 1SQXK 4NBHD 1CSBA 2AEMA 2P67A 1KQGB 1DIPA 5AW2B 2QJKB 2PP6A 2QA4P 1NTKJ 1Q81Q 2Q7CA 2YXQB 2WSSH 2KNCA 3Q2YA 4RKUJ 1YITP 2Y9ZA 2Q1KA 3L72J 1YJ9P 2E42A 1L4AD 2B88A 2D2CB 2FFDA 3MZWB 1URQA 2WPVB 4OWFA 4ZNCA 3H1IJ 4W7YA 4RO0A 3TNUA 3GCEA 2B9BA 1SQVG 3RK3C 1LT9B 3TK1A 2I1JA 4C7NA 3NMDA 4WVZA 4Z1MH 1JB0J 2ZFCA 3H1HE 1NAFA 3AE1C 3EWKA 2L91A 3NFQA
chains in the Genus database with same CATH topology
1FQTA 3BCCE 2OQQA 3EQQA 3AEBC 4AAYB 1SQBE 4H44D 1K04A 2O01J 1SJGA 1UUWA 4H0LC 2FYNC 1SQVE 3AEGC 1OW8A 1PPJE 2YFJA 2BMQA 4NBDD 1Q90D 4R4MA 4HM7A 2G8YA 2YFIA 5L8RJ 3AZCA 1KTMA 2E75B 2E4PA 5KLIC 4H0LD 3DQYA 2QPZA 2JZAA 1O7PA 2NUMA 1EXIA 3AE5C 4EMJB 2ZYLA 4AIVA 4HM0A 4NBFD 3AEDC 4PV1B 3H1IE 1NTME 2YMKA 2H88C 2NZ2A 1Q90C 1PIXA 3Q1MA 2BMOA 1PV3A 2GBWA 2E76C 1O7NA 2Q3WA 3VCAA 2DE6D 2QJYC 4QCKA 2HMLA 1KMIZ 1ZOYC 1DD4A 4PV1C 3GL2A 3IN6A 3CX5E 3VCPA 2XSOA 2IDBA 3RK3E 2E76B 2WSEJ 2NVGA 3GB4A 3FGAD 1KB9E 2GBXA 4H13B 2XR8A 3GTEA 4HM1A 3D6YA 3SFEC 4YTPC 3G9RA 3VMHD 4NBCD 3AE6C 1RQVA 4HM5A 4HKVA 3CXHE 1TU3F 4NBBD 4QDFA 1L0LE 3D71A 3AEEC 3SFDC 5CXMA 3GF7A 3L74E 1SQQE 4NB9D 4H44B 1ZP0C 1DD3A 1YQ3C 2FXPA 1O7HA 1O7WA 1NDOA 2NVEA 1K05A 1BE3E 1EG9A 4I7ZC 2E4QA 1R8EA 5HL4A 3AE7C 3Q5PA 4HM4A 2JO6A 2B1XA 2D2CC 3AE9C 2NWFA 3AE2C 3T97B 5KKZC 1OW6A 3C8VA 2K9YA 2WSCJ 2YVJB 1KYOE 2HMKA 4P1BH 4GDOA 1VF5B 2JO1A 3N0QA 3AE3C 2ZT9B 3H25A 1SQXE 3GKEA 3FOUA 4NB8D 2E76D 4U3FE 2E74D 3R4YA 4H0LB 2JP3A 1PL5A 5KLVE 1O7GA 4QUPA 3H1KE 3H1LE 3TGUE 3B71A 2BMRA 3H1JE 3O6QA 1G8KB 3VMGD 2QIWA 3GLMA 1KILE 1L0NE 5M1BA 3L73E 3GTSA 1PP9E 1WMKA 4OGQB 1UUVA 1UIXA 4TT3H 1ZMEC 2E74B 2YFLA 1HF9A 3GF3A 1FDIA 2XSHA 3VMID 2YIUC 4QUQA 2P10A 1AJYA 2FBWC 3C0DA 4HJLA 4YXDC 5BOKA 4R4LA 4NBGD 2V7QJ 1RIEA 1NU1E 2HMNA 2QJPC 1VM9A 3IAOA 1RFSA 1NYKA 3GZYA 3D6ZA 3L71E 1FDOA 2BCCE 1OW7A 3L70E 1NYHA 2QSIA 2E74C 4HM8A 3Q5SA 4H44C 3L75E 1ULIA 4HM6A 1EXJA 1NTKE 1NTZE 1HJ0A 1WQLA 3AEFC 3D70A 3Q5RA 1S5LX 3L72E 1ZRTE 3AECC 2WQYC 2J5UA 2E75C 2HMMA 1SQPE 2BEQD 2DE7D 2A06E 2D2CD 2I7FA 1YQ4C 1P84E 4IL6X 2G3AA 4H13C 2WSFJ 4HM3A 1VF5C 1RQUA 2H89C 2QJKC 3CWBE 1GMJA 3GMAA 3AE4C 2FYUE 4KT0J 4OGQD 1VF5D 2NVFA 3EN1A 5AEUA 4H13D 4NBAD 1KQFB 3D89A 1BCCE 2ZT9C 1IK7A 5AEWA 1VCKA 3Q3DA 2E75D 4U7JA 2CKFA 4XFJA 3AE8C 1OMIA 4PD4E 4QDDA 2DE5D 1G8JB 4NBED 4NBHD 3RL0g 1KQGB 1O7MA 1S1CX 2ZT9D 1DIPA 1KORA 4QDFB 2BEZF 1MKMA 4I7ZB 4OGQC 3Q2YA 4RKUJ 4Y28J 2MKVA 3GOBA 3GL0A 2B24A 1JM1A 2HMJA 2D2CB 1EZVE 3ABVC 2WPVB 2XRXA 4P1CH 3S9OA 2IBZE 3AEAC 4HM2A 3GCEA 4QDCA 4QURA 3GZXA 1NGMB 1U57A 4Z1MH 1JB0J 1Y9BA 4PV1D 3H1HE 3LW5J 1VL2A 3EWKA 3AE1C 2NUKA 2HMOA 1ULJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0Q A;  1FQT A;  3BCC E;  3GL2 A;  3EQQ A;  2E75 C;  4AAY B;  1SQB E;  2HMM A;  1SQP E;  1SQX E;  4H44 D;  3CX5 E;  3GKE A;  1SJG A;  1UUW A;  3FOU A;  4H0L C;  2A06 E;  2DE7 D;  2FYN C;  3VCP A;  2D2C D;  2I7F A;  4NB8 D;  2E76 D;  4U3F E;  2E74 D;  2XSO A;  1SQV E;  1P84 E;  1PPJ E;  5KLV E;  2YFJ A;  1O7G A;  4H13 C;  4QUP A;  2BMQ A;  4HM3 A;  3H1K E;  3H1L E;  4NBD D;  1VF5 C;  3TGU E;  2NVG A;  3GB4 A;  2BMR A;  3H1J E;  1KB9 E;  2QJK C;  2GBX A;  1G8K B;  2XR8 A;  3CWB E;  3VMG D;  3GTE A;  4HM1 A;  2FYU E;  4HM7 A;  1L0N E;  4OGQ D;  1VF5 D;  2NVF A;  2YFI A;  3EN1 A;  3L73 E;  5AEU A;  4H13 D;  4NBA D;  3AZC A;  3GTS A;  1PP9 E;  3D89 A;  1BCC E;  1UUV A;  2ZT9 C;  2E4P A;  5KLI C;  3VMH D;  4NBC D;  4H0L D;  3DQY A;  5AEW A;  4HM5 A;  2YFL A;  1VCK A;  2QPZ A;  4HKV A;  2E75 D;  2JZA A;  3CXH E;  4NBB D;  4QDF A;  1O7P A;  1L0L E;  5CXM A;  2CKF A;  2NUM A;  2XSH A;  3VMI D;  4PD4 E;  2YIU C;  3L74 E;  4QDD A;  2DE5 D;  1G8J B;  4QUQ A;  4EMJ B;  4NBE D;  1SQQ E;  2ZYL A;  4NBH D;  4NB9 D;  4AIV A;  4HM0 A;  1O7M A;  3C0D A;  2ZT9 D;  4HJL A;  4NBF D;  3H1I E;  5BOK A;  4QDF B;  4NBG D;  1O7H A;  1NTM E;  1RIE A;  1NU1 E;  4OGQ C;  2HMN A;  1O7W A;  1NDO A;  2NVE A;  2YMK A;  2QJP C;  1VM9 A;  1BE3 E;  3GOB A;  1Q90 C;  1RFS A;  1NYK A;  3GL0 A;  3GZY A;  2B24 A;  3L71 E;  2E4Q A;  1EG9 A;  4I7Z C;  2BCC E;  5HL4 A;  1JM1 A;  2HMJ A;  1EZV E;  3L70 E;  4HM4 A;  2BMO A;  2GBW A;  2E74 C;  2XRX A;  2JO6 A;  2E76 C;  4P1C H;  1O7N A;  2B1X A;  2D2C C;  2IBZ E;  4HM8 A;  2NWF A;  3GCE A;  4HM2 A;  2Q3W A;  4QDC A;  4QUR A;  4H44 C;  3VCA A;  2DE6 D;  5KKZ C;  2QJY C;  4QCK A;  3L75 E;  3GZX A;  1ULI A;  4HM6 A;  1NTK E;  1NTZ E;  1WQL A;  2HML A;  1KYO E;  2YVJ B;  2HMK A;  4PV1 D;  3H1H E;  3L72 E;  1ZRT E;  4P1B H;  4PV1 C;  2NUK A;  2HMO A;  1ULJ A; 
#chains in the Genus database with same CATH topology
 1FQT A;  2OQQ A;  2Q6Q A;  3P7K A;  1SQB E;  1SQQ K;  1X0T A;  1SJG A;  3HE4 A;  4TLF A;  2BAS A;  1SQV E;  1U7M A;  4Y99 C;  4JYB A;  4DZO A;  2PAJ A;  4UB6 E;  1T2K C;  3KPE A;  1NO4 A;  2ZAE B;  4IFM A;  4HM7 A;  2WPQ A;  1QX8 A;  5APU A;  3RBX A;  3MIW A;  2HPC B;  1DX7 A;  1L0L K;  1RF0 C;  1L4A B;  2JR8 A;  3KZI H;  4HKZ H;  1M1J A;  1EXI A;  2Z5I A;  4ASV A;  3AE5 C;  3MHV A;  2ZYL A;  2N1T A;  3OAK A;  4NBF D;  4PV1 B;  5CBN A;  1M8O B;  2Y0D A;  2WT7 A;  3HD7 D;  3M0D C;  3M9B A;  1KIL A;  1LWU A;  1NAY A;  3P32 A;  1RE3 C;  3B5N B;  3PTZ A;  2NZ2 A;  4EYY Q;  1AV1 A;  1JY3 N;  2QJP B;  5KKZ B;  3TGU D;  4ASW A;  3Q1M A;  4C46 A;  2OTK E;  2Q9I A;  1PV3 A;  1KIL D;  1NTK G;  3O6Q B;  1L0N D;  4DJG A;  2Q3E A;  3M0D A;  1IFJ A;  2QE7 H;  5AVX B;  2YO2 A;  1ZOY C;  2GUV A;  2IBZ I;  2KXP B;  1BE3 J;  3GHG B;  3OA7 A;  2OYI A;  1DH3 A;  1S5L H;  3CX5 E;  5KJ7 D;  5CJ4 A;  1WRG A;  3RK3 E;  1J1D C;  1EZV I;  3BRV B;  1KYO I;  5AW6 B;  1URQ B;  5B66 E;  3BCC G;  1KB9 E;  2K1A A;  1JTH B;  2GBX A;  1J1E C;  1USD A;  2K88 A;  4HM1 A;  2IBZ D;  4W80 A;  3SFE C;  2HFE D;  3GW6 A;  2BCC D;  3CWB G;  2NPS A;  5CBO A;  2AXT H;  1SQX D;  3GG2 A;  1RQV A;  4HM5 A;  4HKV A;  3CXH E;  1PGP A;  1HUC A;  1H89 A;  4RES B;  1BE3 D;  3L74 E;  2E5T A;  1GL2 B;  1IFN A;  3U1C A;  1FAV A;  1MUU A;  3L37 A;  1DEB A;  1VQO P;  3M9H A;  4DCK A;  1DD3 A;  1EC5 A;  2ZYA A;  2FXM A;  1LTT C;  1O7H A;  1O7W A;  1BDC A;  3H1J D;  1IK9 A;  3CLQ A;  2P7J A;  1H0T A;  3A0H E;  5HL4 A;  1SP4 A;  5KLV K;  2WIT A;  3AE2 C;  1OW6 A;  1ZXG A;  2AEJ A;  2IX7 C;  2M0B A;  3L4F A;  2C0W A;  2W83 C;  1G1J A;  1Q2N A;  2LXC B;  4XA4 A;  1S9K D;  3KZI E;  2JO1 A;  1VQ8 P;  2MJZ A;  3FWN A;  3A2A A;  4BXL A;  2QEX P;  2O01 H;  3VMY A;  1OVR A;  4NB8 D;  1NTM K;  2E74 D;  4U3F E;  2FKW B;  1EDK A;  3PJS K;  1JMB A;  3TGU E;  5APV A;  1L0L J;  3H1J E;  3NTN A;  1JY2 P;  3VMG D;  3GLM A;  1FZC A;  1L0N E;  1M90 Q;  2ITA A;  1PP9 E;  2FXO A;  2B87 A;  1GZL A;  2E5Y A;  4PD4 H;  4OGQ B;  1KB9 H;  1UIX A;  4U3F G;  3CI9 A;  1ZME C;  3PRJ A;  5KLI B;  4AQR D;  3KXD A;  1HF9 A;  5APY A;  4JF7 A;  2KK7 A;  1UII A;  1QL2 A;  2N9B A;  2R44 A;  1L0N G;  2P10 A;  1AJY A;  4GT1 A;  5B5E E;  1VQ5 P;  2VRS A;  4CPG A;  4NBG D;  2ZVN B;  2V7Q J;  3CC7 P;  5E79 H;  2QJP C;  5KAF E;  3V2P A;  3HE4 B;  3GZY A;  3D6Z A;  4WY4 D;  5AVS B;  1FDO A;  2BCC E;  3H32 A;  4IL6 E;  2XND H;  4HM8 A;  4M3L A;  2W90 A;  4HM6 A;  1NTK E;  1HJ0 A;  3AEF C;  5KLV J;  3D70 A;  1CI6 B;  4L75 A;  3BVH A;  5C39 A;  1ZR4 A;  4N6J A;  1ZV8 A;  3VP8 A;  3V5B A;  2I8D A;  3GHG C;  2BCC G;  3CWB D;  2J5U A;  1YHQ P;  1OZH A;  2DE7 D;  4NPE A;  2I7F A;  2B87 B;  2HOD B;  1NTK D;  4GOE A;  1N73 B;  1BCC D;  2G3A A;  1VQM P;  2AXC A;  3USS A;  2ZXX A;  3IF4 A;  2M5A A;  4HM3 A;  4D6T E;  3H1H J;  5H2F H;  1FU1 A;  3GMA A;  1LTJ C;  1SVF A;  2JKV A;  3AE4 C;  2O1K A;  1NKZ B;  3EN1 A;  2NVF A;  1SFC C;  5AEU A;  4H13 D;  1BGY G;  1IFD A;  1LTS C;  4HYT B;  2NPS D;  2ZT9 C;  2N1T D;  1IK7 A;  1SQV J;  5KJ7 C;  3RL0 B;  2QM8 A;  4U7J A;  1VDF A;  3L70 D;  3AE8 C;  1OMI A;  3BCC D;  2YKO A;  4PD4 E;  2KZI A;  4NBE D;  3IR9 A;  1JM0 A;  3RL0 g;  1S1C X;  2ZT9 D;  2CPB A;  4AYC A;  2NPS C;  3L75 D;  5BU8 B;  1BGY E;  3HUS C;  1LGH B;  4Y99 B;  1MKM A;  3CX5 D;  5CCH C;  3L75 J;  1CI6 A;  5AW9 B;  2UWJ E;  1N73 C;  1LNQ A;  4Y28 J;  1AVY A;  3GL0 A;  2HMJ A;  1KZU B;  1EZV E;  3CD6 P;  2XKM A;  2XRX A;  1ZN5 A;  3F5H A;  4QDC A;  3SWK A;  2WSE H;  1U57 A;  2IPP A;  2OYH A;  1Y8A A;  1GK4 A;  3LW5 J;  4GOF A;  2WWW A;  2WZ7 A;  1LP1 A;  3CWB J;  1KN7 A;  1ULJ A;  2FYU J;  3C1L A;  3BCC E;  5AVV B;  2AEF A;  1E5W A;  3EQQ A;  2J58 A;  2KB7 P;  1K04 A;  4H44 D;  1FOS F;  1BCC J;  1JCD A;  3AEG C;  1OW8 A;  2KIK A;  1PPJ E;  4WY4 A;  2YFJ A;  4LC1 A;  1RE4 A;  2N1T B;  2FY8 A;  2YFI A;  5L8R J;  1FJK A;  1VQ4 P;  4A7P A;  2E4P A;  5KLI C;  1JEK A;  3MP7 B;  2Z4E A;  2PFX A;  1EZV D;  1KYO D;  1JNM A;  2QJY B;  1SQP K;  1M7L A;  2KUB A;  1S72 P;  4AIV A;  1LTB C;  2K37 A;  4HM0 A;  5B66 H;  3H1I E;  1YTZ T;  2OTL P;  2NRG A;  3H1H D;  1FS0 E;  1GDT A;  2YKQ A;  2H88 C;  3FXE A;  3TSI A;  2W6J H;  3M91 A;  3WU2 E;  3L74 J;  5AVU B;  1VQ6 P;  1SQB J;  2GBW A;  2E76 C;  4L74 A;  2Q3W A;  2FYZ A;  5AVW B;  3M06 A;  3VCA A;  2DE6 D;  2KSE A;  2HML A;  3HTK A;  1N7S A;  1DD4 A;  2L5G B;  4PV1 C;  2JWD A;  1K8A Q;  2IFM A;  2RN0 A;  3GL2 A;  4DOJ A;  3HTK B;  2CPS A;  2IDB A;  5EFW B;  1U7J A;  1IZN B;  1S2E A;  1L0N K;  2WSE J;  1SFC D;  2NVG A;  2IFN A;  1NJI Q;  4O9B A;  3CCM P;  2XR8 A;  1FZC C;  4N78 E;  4JYC A;  4D6T G;  2HR3 A;  2WSF H;  2OAR A;  3CCR P;  1JY2 O;  4YTP C;  1W2B O;  1N7L A;  2PGD A;  1A02 F;  1FBM A;  1ZR2 A;  3V2Q A;  1K73 Q;  3AEE C;  1AVO A;  5CXM A;  2R5D A;  1KFN A;  3GF7 A;  5APX A;  2QM7 A;  3L73 J;  1PP9 J;  1PPJ D;  3SWY A;  3P8M C;  4DT0 A;  3CXH D;  1NDO A;  1RF1 B;  1LTI C;  1LTG C;  5K5G B;  1DEE G;  1FJP A;  4K35 A;  1L0L G;  3B5N A;  1BDD A;  2IBZ G;  1EG9 A;  1R8E A;  3AE7 C;  1N7S D;  3Q5P A;  4HM4 A;  2FYU D;  2OYO A;  5TIS H;  3WU2 H;  1NU1 J;  4UB8 E;  2GUS A;  2HMK A;  3B8E B;  3CXH I;  3IFM A;  1BE3 G;  4P1B H;  4GDO A;  1VF5 B;  3GHG A;  3N0Q A;  3AE3 C;  3FWL A;  2XNX A;  1GW4 A;  2OYI B;  5AW7 B;  3RK2 C;  3H25 A;  1Q82 Q;  2KI7 B;  3VOP A;  4IFD K;  1M1J B;  2E76 D;  1W2E A;  2JP3 A;  5KLV E;  5CCG C;  1O7G A;  4QUP A;  5APW A;  1NTK K;  1IC2 A;  3H1K E;  3H1L E;  3L74 D;  1QL1 A;  3B71 A;  2BMR A;  3N4X A;  3O6Q A;  1VQ7 P;  1KIL E;  3V2R A;  2ZXE B;  1SQQ J;  3GTS A;  1WMK A;  1UUV A;  1N2D C;  2OGU A;  1SQP D;  3MUD A;  1R5S A;  2YFL A;  1XTG B;  2OTJ P;  4D6T J;  1J1D B;  1Y47 A;  3VMI D;  1M1J C;  1AA0 A;  2WSC H;  3M9Q A;  2A45 I;  4YXD C;  2IYP A;  1S4X A;  1YTZ I;  1RIE A;  2HMN A;  3KHU A;  2GM4 A;  4I2L C;  2N9Y B;  3IAO A;  1RE3 A;  1PFI A;  4HJG H;  1LT9 C;  5AW1 B;  3I5C A;  3JSV C;  1SS1 A;  2QSI A;  2QRX A;  2XZR A;  1XTC C;  1HVV A;  1SQX J;  2A06 G;  1BGY J;  4H44 C;  1OFC X;  1NU1 D;  4GKG A;  1LTA C;  1ULI A;  2FYN B;  1NTZ E;  2KYV A;  3CX5 I;  4I6M C;  3H1J J;  1S5L X;  4IFF A;  4PD4 I;  2PRR A;  1OWA A;  2NPS B;  2P2U A;  2E75 C;  2KSJ A;  2HMM A;  1D7M A;  2BEQ D;  4EIJ A;  2A06 E;  4PJ0 E;  4H13 C;  4KHX A;  2FFD B;  1L4A C;  3KQG A;  3LIE A;  2H89 C;  1FOS E;  1MFT A;  1N73 A;  3CWB E;  2FYU E;  4KT0 J;  3BCC J;  4PD4 D;  5GTI E;  4NBA D;  2W6A A;  2O1J A;  2E43 A;  2KLU A;  3PLN A;  1QGK B;  1G2C B;  2IYO A;  2YKP A;  3H1I G;  3S1K A;  2E75 D;  1KC8 Q;  1Q86 Q;  2CKF A;  2OYH B;  4N3Y B;  4QDD A;  2V7Q H;  1G8J B;  1VQN P;  2FYU G;  1ZLL A;  1J2J B;  1O7M A;  1USE A;  1JY3 O;  1KOR A;  2Y0C A;  2AXT E;  4QDF B;  1JO5 A;  1BCC G;  1MV8 A;  1EDI A;  2WPR A;  1M57 D;  4IL6 H;  4OGQ C;  1BSN A;  2R32 A;  3SSU A;  3UIA A;  3GOB A;  4WY4 C;  3P8C E;  2WMM A;  5AW5 B;  1PGJ A;  2RH0 A;  1SQP J;  4L76 A;  3S9O A;  4P1C H;  2IBZ E;  4WWI A;  4BWN A;  4QUR A;  1GU4 A;  2Y9Y A;  3HE5 B;  3G4S P;  3GZX A;  2P1J A;  1J1E B;  3VMX A;  1Y9B A;  3L70 G;  1L4A A;  2WT7 B;  2NUK A;  1YJN P;  2OYI C;  2K3R A;  2ZJS E;  4AAY B;  2O01 J;  1SQQ D;  3E7K A;  3V4W A;  1WT6 A;  3B5N D;  2BMQ A;  1KQL A;  1Q90 D;  1JCC A;  4R4M A;  5KAI H;  1GD2 E;  1OX3 A;  3H1K G;  3A0H H;  4WY4 B;  2G8Y A;  5CCG D;  3AZC A;  1KD1 Q;  1X79 B;  4YXW H;  3DQY A;  1SLQ A;  1E79 H;  2JZA A;  1KFM A;  1NH4 A;  4KJM A;  1QVG O;  3V2N A;  2M3E A;  3L74 G;  4I1L A;  3W67 A;  1NU1 G;  4RJT A;  3CXH H;  1SQB D;  3RK3 D;  1AFO A;  3MUD C;  4K3A A;  1FZF A;  3NXS A;  2H7H A;  2KS1 A;  1Q90 C;  3RL0 C;  1HTL C;  3WUU A;  1HBW A;  3HUS B;  3V4Q A;  2BMO A;  2I1K A;  2M5A B;  3CL3 D;  1VPC A;  3L71 G;  1H8A A;  3L73 D;  1Q7Y Q;  1CZQ A;  3BAS A;  5DJU B;  4QCK A;  1FZG A;  2P58 A;  1KMI Z;  1EZV G;  3JC2 2;  1HH0 A;  4HB1 A;  1VQP P;  1YI2 P;  1K9M Q;  1QLE D;  3HE5 A;  3OW2 O;  3VCP A;  5B5E H;  3H1I D;  1SQB K;  2E76 B;  5CHX A;  2A45 H;  3H1J G;  3GB4 A;  2LKM A;  3FGA D;  1SQV K;  4H13 B;  2FFD C;  3D6Y A;  2KOG A;  1GU5 A;  3K5B A;  3G9R A;  3VMH D;  4NBC D;  1NTM J;  1TU3 F;  3H1K J;  3H1L J;  4NBB D;  4QDF A;  4GOD A;  2POH A;  1N7S B;  3HRN A;  5AVZ B;  1SQQ E;  1ZRT D;  4NB9 D;  1ZP0 C;  3HUS A;  3CCQ P;  2ZYD A;  1T8Z A;  3L35 A;  3CCS P;  4OVN F;  5APS A;  1HGV A;  2M3B A;  3R2P A;  1IJD B;  3CCJ P;  5CMZ A;  2QVA A;  4D6T D;  2E4Q A;  4I7Z C;  2JDI H;  1KQS O;  4JBZ A;  1SQQ G;  1W5C E;  2W8Z A;  1FZE A;  2JO6 A;  2B1X A;  3AE9 C;  3HD7 C;  4WBA A;  2K9Y A;  2WSC J;  2YVJ B;  3BAT A;  4NPF X;  1NU1 K;  2M8R A;  1NOH A;  3H1K D;  4NPD A;  1H88 A;  3HD7 A;  1SQX E;  3GKE A;  1PPJ G;  2KLV A;  1NKN A;  5AW4 B;  1JMM A;  1KIL C;  1LWU C;  1RF0 A;  4JQ0 D;  1IO4 A;  4H0L B;  1PZQ A;  1PL5 A;  2JWA A;  1NTZ K;  2HPC A;  5AVQ B;  1T2K D;  2V4H A;  2RKL A;  5M1B A;  3L72 D;  3L73 E;  4UB8 H;  1OXZ A;  3CX5 H;  1QVF O;  4W7Z A;  2O01 N;  5AVY B;  5BVZ A;  2IZ1 A;  2YNY A;  4TT3 H;  2C9L Y;  3HD7 B;  3U59 A;  1RH5 B;  2E74 B;  3PP5 A;  3GF3 A;  3EFF K;  1FDI A;  2XSH A;  2YIU C;  4QUQ A;  4HH2 A;  3L71 D;  3L73 G;  3C0D A;  5BOK A;  1LJ2 A;  3CC2 P;  3TF5 A;  4EI2 A;  3VMZ A;  1NU1 E;  1GW3 A;  1T3U A;  1GL2 C;  1VQL P;  5GTH E;  3PHL A;  1N86 A;  4BRY B;  5KAI E;  3T97 A;  4UB6 H;  1P84 H;  1OW7 A;  1AQT A;  3L70 E;  1PGO A;  4ZKP A;  1M56 D;  3II6 A;  1FZB A;  1PP9 D;  3Q5S A;  1Z56 A;  1ZW0 A;  3RK2 D;  5AVR B;  1SQB G;  5AW8 B;  1EXJ A;  1WQL A;  2WVR A;  2OYH C;  1SFC B;  3Q5R A;  3L72 E;  1ZRT E;  1A02 J;  2B89 A;  1OVV A;  2WQY C;  2YIU B;  4ZKU A;  1SQP E;  1G1I A;  2N1T C;  3MTU E;  2KNC B;  1JTH A;  4IL6 X;  1JY3 P;  4B86 A;  4OH8 B;  2WSF J;  3JCU H;  1VF5 C;  1IFM A;  4LLH A;  3P8C D;  3EFG A;  3CCL P;  1RQU A;  1YIJ P;  2QJK C;  1GMJ A;  2H43 A;  1NWQ A;  2A06 D;  1KQF B;  1BSH A;  2JEE A;  2Q3I A;  2SPZ A;  5AW3 B;  5AVT B;  3A3Y B;  3Q3D A;  1JY2 N;  1GL2 A;  4JPZ B;  4XFJ A;  3L71 J;  1OIP A;  2DE5 D;  2R3S A;  2WTY A;  1YYC A;  3EQ2 A;  5CCG A;  2BEZ F;  1NTZ J;  4I7Z B;  1T3J A;  5GTI H;  3RBZ A;  3FX0 A;  2MKV A;  1X9V A;  2KZJ A;  2B24 A;  1RF1 A;  1JM1 A;  3VTP C;  1HGZ A;  3ITK A;  3ABV C;  1BGY D;  3PH0 A;  3AEA C;  4HM2 A;  5KTB A;  1YJW P;  3WUT A;  4C7R A;  1NGM B;  4LGD E;  4PV1 D;  1VL2 A;  1MZ9 A;  1L2P A;  3L72 G;  2HMO A;  3G71 P;  3I55 P;  1RHZ B;  4AUW A;  3AEB C;  4L73 A;  3L75 G;  1UUW A;  4H0L C;  3I56 P;  2FYN C;  1EDL A;  4ZMD A;  3H1L G;  1S3J A;  4XE5 B;  3A7O A;  3N7N A;  3OJA B;  3SWF A;  1S5L E;  2IZ0 A;  1JUN A;  4NBD D;  5GTH H;  2HYN A;  1GL2 D;  3TGU G;  3MD0 A;  2WPS A;  3B5N C;  3CME P;  1KTM A;  4BRY A;  3FXD A;  2XDJ A;  2E75 B;  3C9I A;  3TDK A;  4H0L D;  1MFZ A;  2QPZ A;  2GA1 A;  1O7P A;  2NUM A;  3L36 A;  1RF1 C;  4EMJ B;  1KYO H;  3TYY A;  3AED C;  1QEX A;  1NTM E;  1NHL A;  2YMK A;  3MGN A;  1CW5 A;  2JJL A;  3LID A;  3RK2 B;  1PIX A;  2QG4 A;  1URQ C;  1NTZ G;  2XV5 A;  1O7N A;  5KJ7 A;  2YO3 A;  2ZYG A;  2QJY C;  1SQX G;  5TJH A;  2LXB A;  1LT1 A;  5H2F E;  1LTJ A;  3JCU E;  4N78 D;  1FDM A;  3B4S A;  3IN6 A;  1IFP A;  2XSO A;  3H1H G;  3O8Z A;  1PP9 G;  1NTM D;  1GTW A;  1L0L D;  3GTE A;  3A5T A;  5CCH D;  1S9K E;  2Q5U A;  1FZA A;  1LTJ B;  2K9J A;  2W27 A;  3AE6 C;  1P84 I;  5CCH A;  2HLO A;  3CCU P;  1KB9 D;  3TGU J;  1L0L E;  3CC4 P;  3D71 A;  3VN0 A;  3SFD C;  5KLV D;  3M0A A;  1RY3 A;  3VMA A;  3KYQ A;  1X8Y A;  3E1R A;  3U1A A;  4H44 B;  1SQV D;  1YQ3 C;  2FXP A;  3QWO C;  3CCE P;  3W68 A;  2NVE A;  1K05 A;  3E1I A;  2CK3 H;  1P84 D;  2HOD A;  3KDP B;  1BE3 E;  1KB9 I;  1OVU A;  1R5L A;  2FYU K;  2HG5 D;  2D2C C;  2NWF A;  2LR2 A;  3T97 B;  3ZDM A;  5KKZ C;  1SQP G;  3C8V A;  4U3F D;  5APQ A;  1KYO E;  3RK3 B;  3CPW O;  1PGQ A;  1EDJ A;  1YBK A;  1N8R Q;  2YXR B;  2ZT9 B;  4C7N B;  2K9J B;  3FOU A;  2R3C A;  5BU5 A;  2KS1 B;  1URQ D;  3R4Y A;  1T6A A;  5CJ0 A;  3CCV P;  2C0X A;  3RL0 D;  2RMZ A;  2ZVO B;  2H8P D;  1RE4 C;  1G8K B;  2QIW A;  3CMA P;  4PJ0 H;  2W6B A;  3WUV A;  2XU6 A;  2YMY A;  1LP1 B;  5DJT B;  3H1L D;  3RGU A;  2Y0E A;  5TIS E;  3H6P A;  1IFI A;  2C9N Y;  1HWT C;  1FE6 A;  1FZC B;  3LW5 H;  2FBW C;  4HJL A;  1VQK P;  1M1K Q;  3G3Z A;  3S4R A;  4R4L A;  1H0T B;  1X22 A;  2J59 M;  1N7S C;  1VM9 A;  1RFS A;  2A45 G;  1NYK A;  4MN4 C;  3L71 E;  1VQ9 P;  1NYH A;  2E74 C;  1EQ7 A;  1GK6 A;  4EDF A;  4U3F J;  3WMM 0;  3A0B H;  3L75 E;  2DW3 A;  3VP9 A;  3F89 A;  3BRT B;  1AQ5 A;  1G2C A;  1FC2 C;  3AEC C;  2KP8 A;  1L0N J;  4WB4 A;  2R5B A;  4EOT A;  1JOC A;  2D2C D;  1NTZ D;  2O3J A;  1YQ4 C;  3TNU B;  1P84 E;  5E79 E;  4YPC A;  4IOI H;  1LT9 A;  1KV4 A;  5KAF H;  5KLV G;  5AW0 B;  3H32 B;  1HJB A;  3A0B E;  4OGQ D;  1VF5 D;  3QH9 A;  2Z5H A;  1KIL B;  1LWU B;  3G6E P;  3D89 A;  1BCC E;  4QMA A;  3V6I A;  5AEW A;  1NVO A;  1VCK A;  1NTM G;  4GIF A;  1SFC A;  2BCC J;  3VYI A;  5APT A;  3L70 J;  1SQX K;  4NBH D;  1CSB A;  2AEM A;  2P67 A;  1KQG B;  1DIP A;  5AW2 B;  2QJK B;  2PP6 A;  2QA4 P;  1NTK J;  1Q81 Q;  2Q7C A;  2YXQ B;  2WSS H;  2KNC A;  3Q2Y A;  4RKU J;  1YIT P;  2Y9Z A;  2Q1K A;  3L72 J;  1YJ9 P;  2E42 A;  1L4A D;  2B88 A;  2D2C B;  2FFD A;  3MZW B;  1URQ A;  2WPV B;  4OWF A;  4ZNC A;  3H1I J;  4W7Y A;  4RO0 A;  3TNU A;  3GCE A;  2B9B A;  1SQV G;  3RK3 C;  1LT9 B;  3TK1 A;  2I1J A;  4C7N A;  3NMD A;  4WVZ A;  4Z1M H;  1JB0 J;  2ZFC A;  3H1H E;  1NAF A;  3AE1 C;  3EWK A;  2L91 A;  3NFQ A; 
#chains in the Genus database with same CATH homology
 1FQT A;  3BCC E;  2OQQ A;  3EQQ A;  3AEB C;  4AAY B;  1SQB E;  4H44 D;  1K04 A;  2O01 J;  1SJG A;  1UUW A;  4H0L C;  2FYN C;  1SQV E;  3AEG C;  1OW8 A;  1PPJ E;  2YFJ A;  2BMQ A;  4NBD D;  1Q90 D;  4R4M A;  4HM7 A;  2G8Y A;  2YFI A;  5L8R J;  3AZC A;  1KTM A;  2E75 B;  2E4P A;  5KLI C;  4H0L D;  3DQY A;  2QPZ A;  2JZA A;  1O7P A;  2NUM A;  1EXI A;  3AE5 C;  4EMJ B;  2ZYL A;  4AIV A;  4HM0 A;  4NBF D;  3AED C;  4PV1 B;  3H1I E;  1NTM E;  2YMK A;  2H88 C;  2NZ2 A;  1Q90 C;  1PIX A;  3Q1M A;  2BMO A;  1PV3 A;  2GBW A;  2E76 C;  1O7N A;  2Q3W A;  3VCA A;  2DE6 D;  2QJY C;  4QCK A;  2HML A;  1KMI Z;  1ZOY C;  1DD4 A;  4PV1 C;  3GL2 A;  3IN6 A;  3CX5 E;  3VCP A;  2XSO A;  2IDB A;  3RK3 E;  2E76 B;  2WSE J;  2NVG A;  3GB4 A;  3FGA D;  1KB9 E;  2GBX A;  4H13 B;  2XR8 A;  3GTE A;  4HM1 A;  3D6Y A;  3SFE C;  4YTP C;  3G9R A;  3VMH D;  4NBC D;  3AE6 C;  1RQV A;  4HM5 A;  4HKV A;  3CXH E;  1TU3 F;  4NBB D;  4QDF A;  1L0L E;  3D71 A;  3AEE C;  3SFD C;  5CXM A;  3GF7 A;  3L74 E;  1SQQ E;  4NB9 D;  4H44 B;  1ZP0 C;  1DD3 A;  1YQ3 C;  2FXP A;  1O7H A;  1O7W A;  1NDO A;  2NVE A;  1K05 A;  1BE3 E;  1EG9 A;  4I7Z C;  2E4Q A;  1R8E A;  5HL4 A;  3AE7 C;  3Q5P A;  4HM4 A;  2JO6 A;  2B1X A;  2D2C C;  3AE9 C;  2NWF A;  3AE2 C;  3T97 B;  5KKZ C;  1OW6 A;  3C8V A;  2K9Y A;  2WSC J;  2YVJ B;  1KYO E;  2HMK A;  4P1B H;  4GDO A;  1VF5 B;  2JO1 A;  3N0Q A;  3AE3 C;  2ZT9 B;  3H25 A;  1SQX E;  3GKE A;  3FOU A;  4NB8 D;  2E76 D;  4U3F E;  2E74 D;  3R4Y A;  4H0L B;  2JP3 A;  1PL5 A;  5KLV E;  1O7G A;  4QUP A;  3H1K E;  3H1L E;  3TGU E;  3B71 A;  2BMR A;  3H1J E;  3O6Q A;  1G8K B;  3VMG D;  2QIW A;  3GLM A;  1KIL E;  1L0N E;  5M1B A;  3L73 E;  3GTS A;  1PP9 E;  1WMK A;  4OGQ B;  1UUV A;  1UIX A;  4TT3 H;  1ZME C;  2E74 B;  2YFL A;  1HF9 A;  3GF3 A;  1FDI A;  2XSH A;  3VMI D;  2YIU C;  4QUQ A;  2P10 A;  1AJY A;  2FBW C;  3C0D A;  4HJL A;  4YXD C;  5BOK A;  4R4L A;  4NBG D;  2V7Q J;  1RIE A;  1NU1 E;  2HMN A;  2QJP C;  1VM9 A;  3IAO A;  1RFS A;  1NYK A;  3GZY A;  3D6Z A;  3L71 E;  1FDO A;  2BCC E;  1OW7 A;  3L70 E;  1NYH A;  2QSI A;  2E74 C;  4HM8 A;  3Q5S A;  4H44 C;  3L75 E;  1ULI A;  4HM6 A;  1EXJ A;  1NTK E;  1NTZ E;  1HJ0 A;  1WQL A;  3AEF C;  3D70 A;  3Q5R A;  1S5L X;  3L72 E;  1ZRT E;  3AEC C;  2WQY C;  2J5U A;  2E75 C;  2HMM A;  1SQP E;  2BEQ D;  2DE7 D;  2A06 E;  2D2C D;  2I7F A;  1YQ4 C;  1P84 E;  4IL6 X;  2G3A A;  4H13 C;  2WSF J;  4HM3 A;  1VF5 C;  1RQU A;  2H89 C;  2QJK C;  3CWB E;  1GMJ A;  3GMA A;  3AE4 C;  2FYU E;  4KT0 J;  4OGQ D;  1VF5 D;  2NVF A;  3EN1 A;  5AEU A;  4H13 D;  4NBA D;  1KQF B;  3D89 A;  1BCC E;  2ZT9 C;  1IK7 A;  5AEW A;  1VCK A;  3Q3D A;  2E75 D;  4U7J A;  2CKF A;  4XFJ A;  3AE8 C;  1OMI A;  4PD4 E;  4QDD A;  2DE5 D;  1G8J B;  4NBE D;  4NBH D;  3RL0 g;  1KQG B;  1O7M A;  1S1C X;  2ZT9 D;  1DIP A;  1KOR A;  4QDF B;  2BEZ F;  1MKM A;  4I7Z B;  4OGQ C;  3Q2Y A;  4RKU J;  4Y28 J;  2MKV A;  3GOB A;  3GL0 A;  2B24 A;  1JM1 A;  2HMJ A;  2D2C B;  1EZV E;  3ABV C;  2WPV B;  2XRX A;  4P1C H;  3S9O A;  2IBZ E;  3AEA C;  4HM2 A;  3GCE A;  4QDC A;  4QUR A;  3GZX A;  1NGM B;  1U57 A;  4Z1M H;  1JB0 J;  1Y9B A;  4PV1 D;  3H1H E;  3LW5 J;  1VL2 A;  3EWK A;  3AE1 C;  2NUK A;  2HMO A;  1ULJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...