2E76D

Crystal structure of the cytochrome b6f complex with tridecyl-stigmatellin (tds) from m.laminosus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
168
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 35
structure length 168
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e76D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e76D02
4H44D 3VMGD 2QJKC 2YFIA 4HKVA 3H1IE 1VCKA 5AEWA 1NTZE 2NWFA 3GTSA 1G8KB 4NBDD 3D89A 1EG9A 2BMOA 4P1BH 4QURA 3H1JE 4HM4A 4HM8A 4NBED 4I7ZC 3FOUA 1NYKA 1SQQE 4NB9D 3L75E 2CKFA 3N0QA 3VMHD 4QDDA 1PP9E 4HM1A 3AZCA 1NU1E 4QCKA 1SQXE 2QPZA 4U3FE 4HM3A 2E75D 2YFLA 5AEUA 2IBZE 2GBWA 5BOKA 3CWBE 2Q3WA 4PV1C 1ZRTE 4NB8D 2BMRA 2HMLA 5CXMA 4AIVA 2NVEA 4PV1D 3L71E 2NVFA 1O7NA 1VF5C 3C0DA 2YVJB 4QDFA 2E4QA 1VM9A 4HM6A 1NTKE 2GBXA 2HMNA 4PD4E 2YFJA 1VF5D 1O7MA 4HM2A 4NBGD 2JZAA 4OGQC 3EQQA 4HJLA 4NBAD 1ULIA 1JM1A 1SQPE 1WQLA 2HMOA 3L73E 3VMID 1O7HA 4OGQD 3H1LE 1O7PA 3VCPA 1Q90C 4NBHD 2E4PA 2FYUE 4AAYB 4NBCD 2B1XA 1RFSA 2ZT9C 3GCEA 2QJPC 1UUWA 1BE3E 3H1HE 4HM0A 3BCCE 1SJGA 2DE6D 4QUPA 1FQTA 2ZT9D 4P1CH 2XR8A 2XRXA 1SQVE 4HM7A 4H0LC 3GB4A 3CXHE 2YIUC 3GL2A 2HMMA 3L72E 4NBBD 2B24A 1SQBE 3VCAA 3GTEA 1G8JB 1RIEA 4HM5A 2I7FA 1ULJA 4NBFD 3GKEA 1UUVA 3H1KE 3L70E 2JO6A 1KB9E 4H13C 1BCCE 1P84E 1PPJE 3L74E 2NUMA 1EZVE 3GOBA 1O7WA 1KYOE 4H13D 5KLVE 3TGUE 4QDFB 3GL0A 2HMKA 2YMKA 2XSHA 2FYNC 2ZYLA 4QUQA 2E74C 2D2CC 5HL4A 2DE7D 5KKZC 2BMQA 2E75C 2E76C 2HMJA 4EMJB 3EN1A 4H0LD 2E74D 1L0LE 3DQYA 2QJYC 2DE5D 2D2CD 1NTME 2A06E 2NVGA 4QDCA 5KLIC 2BCCE 3GZXA 4H44C 1O7GA 2E76D 3CX5E 1NDOA 1L0NE 2XSOA 3GZYA 2NUKA
chains in the Genus database with same CATH superfamily
4EYYQ 2YXQB 3D71A 2QM7A 1BSNA 1KILC 4P1BH 2WZ7A 2ZAEB 1N7SD 3HTKA 3FOUA 3HD7A 2PP6A 3IFMA 1NTKG 1EDJA 2KB7P 2UWJE 2YO2A 4AYCA 2W83C 4U7JA 5BOKA 2M8RA 1GDTA 1AV1A 2NVFA 3VYIA 1R5LA 3C0DA 3H1ID 2YVJB 2OGUA 4ZKPA 3R4YA 5AVXB 2OTLP 3BRVB 1SQQJ 4OGQC 3AEAC 2HPCA 1PGPA 3N4XA 1E79H 4U3FD 4NBCD 2B1XA 2OYHA 1VQNP 3H1HE 2QJPC 2QSIA 1EZVG 4OVNF 2DE6D 2C0WA 4H13B 1QEXA 2OTJP 3L71D 3L72E 4R4LA 2R3SA 1IFPA 2B87A 1L0LG 2HODA 4L76A 5KLVG 1H8AA 1KFMA 1J1EC 5TISH 3R2PA 2NZ2A 3M9BA 1N8RQ 3S4RA 3H1JG 3GF3A 1EDIA 2KLVA 3AE7C 1NVOA 4WVZA 4NPDA 2XSOA 4PJ0H 1MFZA 2YKQA 1TU3F 2I1JA 5KJ7D 2BMOA 1BCCD 2H8PD 3H25A 2WVRA 2CKFA 2A45I 1KTMA 4QDDA 1WRGA 4HM1A 1KILB 1JEKA 1MV8A 2I8DA 1DIPA 2HLOA 4HM3A 3L73G 2XV5A 2L5GB 2GA1A 1RF0A 3WUTA 3H1IJ 2O1KA 2KK7A 3USSA 3GW6A 3V2RA 3L75D 4U3FJ 1GU5A 2Y0CA 3U1CA 3KDPB 1LT1A 2K9JA 3BCCE 3HTKB 4QUPA 4RO0A 3HD7B 3L71J 4HM7A 4H0LC 1VQMP 3TK1A 1KQFB 1NTKD 2FFDC 1USEA 1G2CA 2W6AA 3AE6C 3L74E 3CCSP 4BRYA 4DZOA 3MGNA 2RKLA 1Y47A 1LWUA 2QJKB 1S3JA 3CCEP 5APWA 2KLUA 1UIIA 2HPCB 3PH0A 1HTLC 4EMJB 2E74D 3PJSK 4D6TE 3O6QA 1QLED 2FYZA 2OYHB 3I56P 3RL0g 1NWQA 1BCCJ 3L35A 1SP4A 1OVUA 1HF9A 1EZVD 1HGZA 3B71A 2B87B 4GOEA 1PP9E 4HJGH 3AZCA 4QCKA 3T97A 2V7QH 2E75D 2O01N 1PP9D 3AEBC 1PIXA 1SQPK 4W7ZA 1LP1A 2FYUG 5KLVD 3V2PA 1VQKP 1CI6A 2QIWA 1ZV8A 3L75J 2JZAA 3EQQA 4CPGA 1WQLA 4N3YB 1X8YA 1QL2A 3BASA 2YKOA 1Y8AA 1VPCA 1HJ0A 1KQSO 1SVFA 3JCUH 1RF1C 4HM0A 4WWIA 3V6IA 2XR8A 3CMEP 1OFCX 1NTKJ 3L4FA 3GG2A 2M5AA 3VP9A 3VCAA 2PGDA 1DX7A 1JY2N 2MJZA 4H0LB 5BU8B 4IOIH 2MKVA 1XTCC 3H1KE 2J58A 2JO6A 3L73D 1YITP 3GOBA 3MUDA 1AQTA 3TGUE 1NTZG 3Q2YA 3I55P 2HMKA 1JM0A 2E74C 1T3UA 2YKPA 5CJ4A 1D7MA 3EN1A 1M1JC 5AVWB 1NU1G 3B8EB 3U59A 3EQ2A 1SQXK 2K9JB 2R5BA 2FXOA 2P67A 4LGDE 3D70A 4QURA 4ZMDA 3NMDA 5H2FE 2G3AA 1P84I 3AE5C 2XDJA 3K5BA 1FZAA 1RE4C 1YJWP 1L0LJ 1G2CB 4I2LC 1OIPA 5KLVJ 4BRYB 3KZIH 5APXA 2NVEA 1EXIA 2OYIA 3H1JJ 1SQVG 4ZKUA 3EFFK 3O6QB 4XE5B 3O8ZA 2HMOA 3TNUA 1HWTC 1SQBG 3H1LE 2YIUB 3AE8C 3C1LA 2YMYA 3P8MC 1BE3E 2V7QJ 3PRJA 2E43A 3CD6P 1PGQA 1ZN5A 3T97B 3SFDC 2P1JA 1OVVA 2FBWC 3AE1C 4A7PA 1G8JB 3L73J 1NTMG 2WSEH 1KYOH 1LP1B 3V2NA 5KKZB 1L0NK 4AUWA 1YJNP 5KAFE 1CI6B 1Z56A 4H13D 2FYUD 1VQ7P 1J1DC 3C8VA 2BMQA 1Q2NA 1OWAA 4EIJA 2BCCE 3MTUE 3AE2C 1N2DC 3A2AA 2Q7CA 3CXHI 1W2BO 1X9VA 3A0HE 2VRSA 4UB6H 2K37A 1M1JB 1IFJA 2JWDA 1IO4A 3H1IG 4NBDD 1JMBA 2Q3EA 1KYOD 1VF5B 3F5HA 1OZHA 3FX0A 5B66E 3HRNA 3IAOA 2JEEA 1YBKA 3P8CE 3H1HG 1O7NA 1MFTA 1KV4A 2E4QA 1NTZD 3Q5RA 1KILD 2KNCA 2P10A 5AVQB 3L72G 2RH0A 3CCLP 3D6YA 1NU1D 1VQLP 1RFSA 1FOSE 2Y0DA 1M8OB 1GL2A 4UB8E 4YXWH 2C0XA 3N7NA 2FYNB 1QX8A 1FBMA 2V4HA 2N1TA 2D2CB 1R8EA 3H32B 5CBOA 1M57D 1SFCA 5EFWB 2QG4A 4PD4I 4EI2A 1CSBA 1DEEG 4H13C 1P84E 2Y9ZA 1ZW0A 1PL5A 5KLIB 1OW7A 2FYUJ 1PZQA 3HD7D 3PTZA 4KJMA 1P84D 5AW0B 3V4QA 5GTIE 3CX5H 2WQYC 4Y28J 1T8ZA 3P7KA 3TNUB 3CPWO 1SQVD 1Y9BA 2P7JA 1J1DB 1NKNA 3VMGD 2E5YA 1FDIA 1LTGC 1VCKA 1L4AB 2WSEJ 4PV1B 1BSHA 4NBED 3MZWB 1OXZA 1K9MQ 1IK9A 3L75G 2IFMA 3FXDA 3CWBE 4O9BA 1NTMD 3E7KA 2BMRA 5CXMA 3CX5D 5KAIE 3G71P 1NTZJ 3HE5A 4GOFA 3BCCG 2KUBA 4HM6A 3OAKA 3S1KA 2ZVOB 3FWLA 1GMJA 1DD4A 1PGOA 1NU1J 2K9YA 2JO1A 1H0TA 2XKMA 3L74G 2XU6A 2NPSA 1GD2E 2IZ1A 3CXHE 1YTZT 3OJAB 4B86A 4M3LA 2CPSA 4K3AA 1KD1Q 1VQ6P 2DW3A 4D6TG 2HG5D 3W68A 2KS1A 3HD7C 1A02J 4C46A 3KQGA 1LTJA 1O7WA 2B88A 3NTNA 2ZYLA 2W90A 2KNCB 1SQVJ 3H1HD 4LC1A 4GODA 2IYPA 2M3EA 4H0LD 3A0BE 1T6AA 1SQQK 1SQBJ 1PP9G 3L72D 5KTBA 1S9KE 1U57A 1S1CX 2QJKC 3AEFC 1Q7YQ 3Q1MA 1KORA 1GL2B 1S9KD 3FXEA 1EG9A 2O01H 1NYKA 2AEFA 3VMHD 1N7SA 1LTSC 2OYHC 1X0TA 2N1TB 1S5LX 4BWNA 1NTMJ 1SFCB 3WU2E 1K8AQ 3CCUP 1ZRTE 2KSEA 3VMZA 3CC2P 3CC4P 1NGMB 4PD4E 4HJLA 1NOHA 2K1AA 1SQPE 3VCPA 4IFFA 3H1KG 1RY3A 4XFJA 2A45G 1N86A 1E5WA 1KQLA 1H88A 3TGUG 3RBZA 1M7LA 3P32A 2BEQD 2XNXA 1MZ9A 2Q6QA 1IZNB 1LJ2A 3L70E 1AFOA 3RK2B 3VTPC 1IFMA 3HE5B 3VOPA 3H1HJ 4TLFA 1JOCA 3Q3DA 5BVZA 2PFXA 3BCCD 1RF0C 3HUSA 3L72J 1IK7A 2GUVA 2PRRA 5CCGA 1FJPA 1ZP0C 3EFGA 1OW6A 1H0TB 4HH2A 5APVA 3SWKA 2NPSB 3A7OA 3L74D 4HM4A 1LTBC 3KYQA 1KB9I 5KJ7A 1Q81Q 1SQXE 3A3YB 4RKUJ 1ZMEC 2QPZA 2KS1B 3Q5PA 1URQA 4ASVA 3H1LG 2IYOA 4D6TD 1LTJB 4DOJA 3TSIA 2AXTE 1IC2A 1MKMA 1T3JA 2ZXEB 4R4MA 1BE3G 2WPSA 1FC2C 3GHGA 2BEZF 3M9QA 3RGUA 1VF5D 1O7MA 1U7MA 2ZVNB 3L37A 1JM1A 2Q3IA 2HODB 4Z1MH 2O01J 1LWUC 5AW2B 2Y9YA 3QWOC 1Q90D 3WUVA 2E5TA 1WMKA 1UUWA 1Q82Q 2IBZI 4JPZB 1N7SB 2YIUC 3GL2A 1NO4A 3G4SP 4WY4A 2WMMA 2A45H 2WWWA 2BCCG 2XNDH 3JC22 1UUVA 3LW5H 1EDKA 1CZQA 5AVRB 3ABVC 3BCCJ 3CCJP 3CCVP 1VDFA 4XA4A 1KFNA 1RH5B 5HL4A 1H89A 1S5LE 3AECC 5L8RJ 5KKZC 1EC5A 4NPFX 1VQ4P 2D2CD 2A06E 4HYTB 3GLMA 1L0NE 1SLQA 3SFEC 3VMYA 3AE4C 4RESB 1FU1A 2R3CA 3W67A 2A06D 5TJHA 4HKVA 5H2FH 3L74J 1GW3A 1HJBA 2IFNA 5E79E 3NXSA 2JWAA 3H1KD 1S72P 4GKGA 3M91A 3TGUD 3SWYA 1NTKK 2J5UA 4D6TJ 3H6PA 2AEMA 2GBWA 2SPZA 3V5BA 2QEXP 5B5EE 4JYBA 1L4AD 1M1KQ 4PV1D 1QL1A 3E1IA 3V2QA 1OX3A 1VF5C 1BGYE 1NJIQ 3HUSB 2KP8A 4ZNCA 1QVFO 3LIDA 1PP9J 1JNMA 2N9YB 1O7PA 1Q90C 4NBHD 2M0BA 4BXLA 2N9BA 3AE9C 2ZYDA 1LWUB 1USDA 2B89A 2XRXA 4LLHA 4N78E 2OARA 3QH9A 3CCRP 5CCHA 3HE4A 3BVHA 2G8YA 1YIJP 2NRGA 1URQB 5KAFH 1LT9A 2I7FA 1L0LK 2E76B 2WTYA 1KB9E 2QM8A 4ASWA 5KLVK 3H1LD 2QA4P 5CMZA 3GHGB 1KB9D 2FYNC 4W7YA 5APUA 1BE3D 1X79B 2D2CC 3M06A 3A0HH 3DQYA 4K35A 5DJUB 5KLIC 3M0DA 1FS0E 2OYIC 3H1KJ 3CWBG 5AEWA 2E42A 1S2EA 2ZYAA 2C9NY 1YTZI 3TGUJ 2YO3A 4HM8A 3LW5J 1JTHA 3II6A 2J59M 4WY4B 1OVRA 5CJ0A 4L75A 5AW7B 5B66H 5AVTB 2IBZE 1L4AC 1GL2D 3GMAA 4PV1C 2IX7C 2BCCD 3G6EP 2IBZD 1ZR4A 4WBAA 1YQ3C 4HB1A 2JP3A 2M5AB 2N1TD 4NBGD 1A02F 1SFCD 3B5NA 1LTAC 4UB8H 2IZ0A 2Q5UA 5GTHE 3RK3E 1FZCA 1K04A 2ZYGA 1PGJA 4P1CH 5AW3B 1AQ5A 1FZBA 2HMMA 3P8CD 2KZJA 2POHA 3OW2O 1P84H 2IDBA 1K73Q 1JY3O 2L91A 3FGAD 3H1LJ 1N7LA 1PPJE 5GTIH 2NUMA 1RE3C 1BE3J 1PPJD 4DJGA 3G9RA 4YTPC 2Y0EA 2CPBA 1FDMA 3LIEA 2NVGA 4IFMA 4I7ZB 4JBZA 1SS1A 2NUKA 3RK2D 1OW8A 4HKZH 1VL2A 3MIWA 3GTSA 1YHQP 2OYIB 4Y99B 1AVYA 5APTA 4OWFA 2ZFCA 1SQQE 1G1JA 3HE4B 3KPEA 2B9BA 3AEDC 3NFQA 1GL2C 5KAIH 1SQPG 2BCCJ 5AEUA 5C39A 2FKWB 3B4SA 4DCKA 4JF7A 1PFIA 2WT7A 2NPSD 4NB8D 2P58A 3EWKA 2FYUK 1YI2P 1N73A 2O1JA 2LXBA 2N1TC 1SFCC 3KXDA 2ZT9B 3RL0B 1KILA 2H7HA 1IFIA 1MUUA 3CL3D 3L70G 3CXHH 5AW8B 3GCEA 3CWBD 2WSCH 4WB4A 3GB4A 3VMXA 1JCCA 4OH8B 2WPQA 1M90Q 1YYCA 4IL6E 3D6ZA 2WPRA 2Q9IA 1ZR2A 3PHLA 2QJYB 2AXCA 1JY3P 3A5TA 1FZEA 3A0BH 1NTZK 2FY8A 2W8ZA 4QUQA 5BU5A 1NYHA 3WMM0 3B5NB 2DE7D 2HYNA 4NPEA 3OA7A 3RK2C 3CXHD 1R5SA 1RQUA 1SQXG 1UIXA 1NU1K 1YQ4C 3SWFA 3TYYA 2WSFH 1FZCB 2W6BA 5APQA 2YFIA 3H1IE 2NWFA 1AA0A 2JKVA 1J2JB 1KC8Q 3D89A 2Z5IA 2PAJA 3WU2H 1EZVI 1S4XA 4AQRD 1GK4A 3IR9A 4U3FE 3RBXA 1JY3N 2NPSC 4MN4C 1NAYA 4PD4H 2P2UA 5AW5B 3L71E 1VM9A 3M9HA 2YXRB 2JJLA 2HMNA 1SQVK 1K05A 1VQOP 1LTJC 4NBAD 1ULIA 5APYA 2OQQA 2CK3H 1LTTC 1SQBK 4C7RA 1KN7A 5APSA 2E4PA 4RJTA 3CWBJ 1DEBA 1ZRTD 1JMMA 2GM4A 1JCDA 2FXPA 5CCGD 3RK3B 1AJYA 3GTEA 1RHZB 2KYVA 4PD4D 2A06G 2WT7B 1NTMK 1L0NG 1SQPD 1BCCE 1N73B 1N7SC 1Q86Q 4H44B 3GF7A 2HFED 4IFDK 5TISE 2KIKA 3VMAA 1URQD 2WSCJ 1JY2O 3G3ZA 3GZXA 2E76D 2WITA 4YPCA 2R44A 2C9LY 2ZJSE 4PJ0E 1M56D 3L70D 5AW1B 2FFDA 1G8KB 2W6JH 3TF5A 3L75E 1BGYG 1HH0A 1L2PA 2AXTH 4GIFA 3AE3C 4OGQB 2O3JA 1BDDA 2BASA 4WY4D 1X22A 3VN0A 2WSFJ 1T2KD 1NTKE 2QJPB 2Z5HA 4EOTA 3VP8A 3M0AA 1GW4A 4AAYB 1SQXD 3HUSC 1OMIA 5AVZB 3CC7P 2QVAA 1EXJA 5CCGC 3C9IA 1J1EB 4NBBD 1KMIZ 1SQPJ 1FDOA 5K5GB 2QE7H 3GKEA 5DJTB 5KJ7C 2ITAA 1EZVE 1QGKB 3V4WA 1S5LH 5AW6B 1URQC 1LTIC 2E76C 1L0LE 1RF1A 2DE5D 5AVVB 5AVYB 5AVUB 1LNQA 5E79H 5KLVE 3GHGC 1L0LD 1DH3A 2AEJA 2IBZG 1JY2P 3L70J 2OYOA 2JDIH 4L74A 2I1KA 3H1JE 1HUCA 4KT0J 3CCQP 3UIAA 3H1JD 1JO5A 1G1IA 1KYOI 5B5EH 2Q3WA 1GU4A 4EDFA 1EDLA 1L0ND 3WUUA 4WY4C 1VQ5P 1QVGO 1M1JA 1T2KC 5CCHD 5CBNA 4QDFA 1AVOA 1HVVA 3I5CA 1XTGB 2YFJA 4HM2A 2K3RA 2KZIA 1WT6A 3L73E 1SQXJ 1HBWA 2M3BA 2FFDB 1RE4A 1PPJG 2Q1KA 1VQ8P 1SJGA 2ZT9D 1GTWA 3PLNA 1IFNA 3JCUE 3RL0D 2H89C 4N6JA 1KB9H 1BGYD 3MUDC 1RIEA 4HM5A 4NBFD 2Z4EA 3IN6A 2W27A 3Q5SA 2YNYA 3GL0A 1NH4A 1KQGB 1SQQG 2E75C 3CI9A 2HMJA 1FZGA 4N78D 1GZLA 2R5DA 1NDOA 3GZYA 3H32A 5M1BA 4C7NA 2HR3A 4L73A 3B5ND 4I7ZC 4KHXA 4NB9D 2QRXA 1RQVA 4I6MC 3IF4A 4TT3H 2WPVB 2H43A 2YFLA 1FZFA 1L0NJ 3JSVC 4Y99C 1FE6A 2XZRA 4IL6X 4GDOA 2HMLA 4AIVA 5CCHC 5AVSB 1ZXGA 3CX5I 1L4AA 2RMZA 3KZIE 1LT9C 3L36A 2GBXA 2LKMA 4I1LA 1RF1B 2GUSA 1DD3A 5GTHH 1FOSF 1O7HA 5AW9B 1FAVA 2FYUE 3F89A 2ZT9C 3PP5A 2IPPA 3M0DC 3FWNA 3RL0C 2KI7B 1W2EA 1BGYJ 2B24A 3S9OA 2E74B 1ULJA 3TDKA 1VQPP 2ZXXA 2K88A 1KYOE 4QDFB 1HGVA 2YMKA 2XSHA 3RK3D 3KHUA 1RE3A 2LR2A 2QJYC 4GT1A 3CMAP 4QDCA 2OTKE 2JR8A 3CLQA 4U3FG 3BRTB 1YJ9P 4H44D 2E75B 3SSUA 1IFDA 1NTZE 2R32A 1KILE 1JB0J 3B5NC 2FXMA 3L71G 4UB6E 1BDCA 3N0QA 2KXPB 3MP7B 3ITKA 1FZCC 1NU1E 2WSSH 5AW4B 2LXCB 1CW5A 1KZUB 1ZOYC 5CHXA 1VQ9P 3MD0A 1NKZB 1W5CE 2KSJA 2KOGA 1NAFA 2RN0A 3VMID 1LT9B 1SQQD 3MHVA 4OGQD 4YXDC 4JYCA 1EQ7A 1JUNA 2H88C 4C7NB 3ZDMA 1BCCG 1FQTA 1SQVE 3AEEC 4IL6H 1SQBE 4DT0A 3CCMP 1SQBD 1NHLA 1PV3A 1IJDB 3BATA 1ZLLA 3RK3C 3U1AA 1LGHB 1JTHB 1U7JA 4JQ0D 4QMAA 3AEGC 1FJKA 1NTME 1N73C 3CX5E 3E1RA 4H44C 1O7GA 1GK6A 4W80A
chains in the Genus database with same CATH topology
3D71A 4HKVA 1G8KB 4NBDD 4P1BH 3FOUA 3L75E 1VF5B 2J5UA 4U7JA 2GBWA 5BOKA 3AE3C 4OGQB 3IAOA 4PV1D 2NVFA 1O7NA 1VF5C 3C0DA 2YVJB 2WSFJ 2E4QA 3R4YA 1NTKE 3Q5RA 4OGQC 3AEAC 2P10A 3D6YA 1O7PA 1Q90C 4NBHD 4AAYB 4NBCD 2B1XA 1RFSA 1OMIA 3AE9C 3H1HE 2QJPC 2QSIA 2DE6D 1EXJA 2XRXA 4H13B 3L72E 4NBBD 4R4LA 2G8YA 1KMIZ 1FDOA 2I7FA 2D2CB 1R8EA 3GKEA 2E76B 1KB9E 4H13C 1P84E 1PL5A 1OW7A 1EZVE 2NZ2A 2FYNC 2WQYC 2D2CC 3GF3A 4Y28J 2E76C 3DQYA 1L0LE 3AE7C 2DE5D 1Y9BA 5KLIC 2XSOA 5KLVE 3VMGD 1FDIA 1VCKA 1TU3F 5AEWA 2WSEJ 2BMOA 3H1JE 4PV1B 4HM8A 3H25A 3LW5J 4NBED 4KT0J 2CKFA 1KTMA 4QDDA 4HM1A 1DIPA 4HM3A 2IBZE 3CWBE 3GMAA 2Q3WA 4PV1C 2BMRA 5CXMA 1YQ3C 4QDFA 4HM6A 2JP3A 2YFJA 4HM2A 1GMJA 1DD4A 4NBGD 3L73E 2K9YA 2JO1A 3RK3E 1K04A 3BCCE 1SJGA 4QUPA 2ZT9D 4P1CH 4HM7A 4H0LC 3CXHE 2HMMA 2H89C 1KQFB 2IDBA 1RIEA 4HM5A 3FGAD 4NBFD 3AE6C 3IN6A 3L74E 1PPJE 3Q5SA 2NUMA 1O7WA 3GL0A 3G9RA 2ZYLA 4YTPC 1KQGB 2E75C 2HMJA 4EMJB 4H0LD 2E74D 2NVGA 3O6QA 4I7ZB 1NDOA 3GZYA 2NUKA 1OW8A 1U57A 1S1CX 2QJKC 3AEFC 3Q1MA 1KORA 3RL0g 1VL2A 3GTSA 5M1BA 1EG9A 1HF9A 4I7ZC 1NYKA 1SQQE 4NB9D 3B71A 1RQVA 3VMHD 3AEDC 1PP9E 3AZCA 4QCKA 1S5LX 4TT3H 2WPVB 2E75D 2YFLA 5AEUA 3AEBC 1PIXA 4IL6X 1ZRTE 4NB8D 4GDOA 2HMLA 4AIVA 3EWKA 2QIWA 2GBXA 1NGMB 4PD4E 2ZT9B 1DD3A 2JZAA 3EQQA 4HJLA 1WQLA 1SQPE 1O7HA 3VCPA 1HJ0A 2FYUE 2ZT9C 4XFJA 3GCEA 4HM0A 2XR8A 3GB4A 2BEQD 2B24A 3VCAA 3S9OA 4H0LB 2E74B 1ULJA 3D6ZA 2MKVA 3H1KE 3L70E 2JO6A 3GOBA 1KYOE 3Q2YA 3TGUE 4QDFB 3Q3DA 2HMKA 2YMKA 2XSHA 4QUQA 2E74C 1NYHA 2DE7D 3EN1A 2QJYC 1IK7A 4QDCA 1RQUA 1ZP0C 1UIXA 1OW6A 1YQ4C 4H44D 2E75B 2YFIA 3H1IE 1NTZE 2NWFA 1KILE 1JB0J 3D70A 3D89A 4QURA 4HM4A 2G3AA 3N0QA 3AE5C 1NU1E 4RKUJ 1SQXE 2QPZA 1ZMEC 4U3FE 3Q5PA 1ZOYC 2NVEA 1MKMA 3L71E 4R4MA 1EXIA 2BEZF 1VM9A 2HMNA 1VF5D 1O7MA 1K05A 4NBAD 1ULIA 1JM1A 2HMOA 2OQQA 3VMID 4OGQD 4Z1MH 4YXDC 3H1LE 2O01J 3AE8C 2E4PA 1Q90D 2H88C 1WMKA 1UUWA 1BE3E 2V7QJ 1FQTA 1SQVE 3AEEC 2YIUC 3GL2A 2FXPA 3T97B 3SFDC 1SQBE 1AJYA 2FBWC 3AE1C 3GTEA 1G8JB 1PV3A 1UUVA 1BCCE 4H44B 3GF7A 4H13D 3ABVC 5HL4A 3C8VA 2BMQA 3AECC 3AEGC 5L8RJ 5KKZC 2WSCJ 2D2CD 1NTME 2A06E 3GLMA 2BCCE 3GZXA 4H44C 1O7GA 2E76D 3CX5E 1L0NE 3SFEC 3AE2C 3AE4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H44 D;  3VMG D;  2QJK C;  2YFI A;  4HKV A;  3H1I E;  1VCK A;  5AEW A;  1NTZ E;  2NWF A;  3GTS A;  1G8K B;  4NBD D;  3D89 A;  1EG9 A;  2BMO A;  4P1B H;  4QUR A;  3H1J E;  4HM4 A;  4HM8 A;  4NBE D;  4I7Z C;  3FOU A;  1NYK A;  1SQQ E;  4NB9 D;  3L75 E;  2CKF A;  3N0Q A;  3VMH D;  4QDD A;  1PP9 E;  4HM1 A;  3AZC A;  1NU1 E;  4QCK A;  1SQX E;  2QPZ A;  4U3F E;  4HM3 A;  2E75 D;  2YFL A;  5AEU A;  2IBZ E;  2GBW A;  5BOK A;  3CWB E;  2Q3W A;  4PV1 C;  1ZRT E;  4NB8 D;  2BMR A;  2HML A;  5CXM A;  4AIV A;  2NVE A;  4PV1 D;  3L71 E;  2NVF A;  1O7N A;  1VF5 C;  3C0D A;  2YVJ B;  4QDF A;  2E4Q A;  1VM9 A;  4HM6 A;  1NTK E;  2GBX A;  2HMN A;  4PD4 E;  2YFJ A;  1VF5 D;  1O7M A;  4HM2 A;  4NBG D;  2JZA A;  4OGQ C;  3EQQ A;  4HJL A;  4NBA D;  1ULI A;  1JM1 A;  1SQP E;  1WQL A;  2HMO A;  3L73 E;  3VMI D;  1O7H A;  4OGQ D;  3H1L E;  1O7P A;  3VCP A;  1Q90 C;  4NBH D;  2E4P A;  2FYU E;  4AAY B;  4NBC D;  2B1X A;  1RFS A;  2ZT9 C;  3GCE A;  2QJP C;  1UUW A;  1BE3 E;  3H1H E;  4HM0 A;  3BCC E;  1SJG A;  2DE6 D;  4QUP A;  1FQT A;  2ZT9 D;  4P1C H;  2XR8 A;  2XRX A;  1SQV E;  4HM7 A;  4H0L C;  3GB4 A;  3CXH E;  2YIU C;  3GL2 A;  2HMM A;  3L72 E;  4NBB D;  2B24 A;  1SQB E;  3VCA A;  3GTE A;  1G8J B;  1RIE A;  4HM5 A;  2I7F A;  1ULJ A;  4NBF D;  3GKE A;  1UUV A;  3H1K E;  3L70 E;  2JO6 A;  1KB9 E;  4H13 C;  1BCC E;  1P84 E;  1PPJ E;  3L74 E;  2NUM A;  1EZV E;  3GOB A;  1O7W A;  1KYO E;  4H13 D;  5KLV E;  3TGU E;  4QDF B;  3GL0 A;  2HMK A;  2YMK A;  2XSH A;  2FYN C;  2ZYL A;  4QUQ A;  2E74 C;  2D2C C;  5HL4 A;  2DE7 D;  5KKZ C;  2BMQ A;  2E75 C;  2E76 C;  2HMJ A;  4EMJ B;  3EN1 A;  4H0L D;  2E74 D;  1L0L E;  3DQY A;  2QJY C;  2DE5 D;  2D2C D;  1NTM E;  2A06 E;  2NVG A;  4QDC A;  5KLI C;  2BCC E;  3GZX A;  4H44 C;  1O7G A;  2E76 D;  3CX5 E;  1NDO A;  1L0N E;  2XSO A;  3GZY A;  2NUK A; 
#chains in the Genus database with same CATH topology
 4EYY Q;  2YXQ B;  3D71 A;  2QM7 A;  1BSN A;  1KIL C;  4P1B H;  2WZ7 A;  2ZAE B;  1N7S D;  3HTK A;  3FOU A;  3HD7 A;  2PP6 A;  3IFM A;  1NTK G;  1EDJ A;  2KB7 P;  2UWJ E;  2YO2 A;  4AYC A;  2W83 C;  4U7J A;  5BOK A;  2M8R A;  1GDT A;  1AV1 A;  2NVF A;  3VYI A;  1R5L A;  3C0D A;  3H1I D;  2YVJ B;  2OGU A;  4ZKP A;  3R4Y A;  5AVX B;  2OTL P;  3BRV B;  1SQQ J;  4OGQ C;  3AEA C;  2HPC A;  1PGP A;  3N4X A;  1E79 H;  4U3F D;  4NBC D;  2B1X A;  2OYH A;  1VQN P;  3H1H E;  2QJP C;  2QSI A;  1EZV G;  4OVN F;  2DE6 D;  2C0W A;  4H13 B;  1QEX A;  2OTJ P;  3L71 D;  3L72 E;  4R4L A;  2R3S A;  1IFP A;  2B87 A;  1L0L G;  2HOD A;  4L76 A;  5KLV G;  1H8A A;  1KFM A;  1J1E C;  5TIS H;  3R2P A;  2NZ2 A;  3M9B A;  1N8R Q;  3S4R A;  3H1J G;  3GF3 A;  1EDI A;  2KLV A;  3AE7 C;  1NVO A;  4WVZ A;  4NPD A;  2XSO A;  4PJ0 H;  1MFZ A;  2YKQ A;  1TU3 F;  2I1J A;  5KJ7 D;  2BMO A;  1BCC D;  2H8P D;  3H25 A;  2WVR A;  2CKF A;  2A45 I;  1KTM A;  4QDD A;  1WRG A;  4HM1 A;  1KIL B;  1JEK A;  1MV8 A;  2I8D A;  1DIP A;  2HLO A;  4HM3 A;  3L73 G;  2XV5 A;  2L5G B;  2GA1 A;  1RF0 A;  3WUT A;  3H1I J;  2O1K A;  2KK7 A;  3USS A;  3GW6 A;  3V2R A;  3L75 D;  4U3F J;  1GU5 A;  2Y0C A;  3U1C A;  3KDP B;  1LT1 A;  2K9J A;  3BCC E;  3HTK B;  4QUP A;  4RO0 A;  3HD7 B;  3L71 J;  4HM7 A;  4H0L C;  1VQM P;  3TK1 A;  1KQF B;  1NTK D;  2FFD C;  1USE A;  1G2C A;  2W6A A;  3AE6 C;  3L74 E;  3CCS P;  4BRY A;  4DZO A;  3MGN A;  2RKL A;  1Y47 A;  1LWU A;  2QJK B;  1S3J A;  3CCE P;  5APW A;  2KLU A;  1UII A;  2HPC B;  3PH0 A;  1HTL C;  4EMJ B;  2E74 D;  3PJS K;  4D6T E;  3O6Q A;  1QLE D;  2FYZ A;  2OYH B;  3I56 P;  3RL0 g;  1NWQ A;  1BCC J;  3L35 A;  1SP4 A;  1OVU A;  1HF9 A;  1EZV D;  1HGZ A;  3B71 A;  2B87 B;  4GOE A;  1PP9 E;  4HJG H;  3AZC A;  4QCK A;  3T97 A;  2V7Q H;  2E75 D;  2O01 N;  1PP9 D;  3AEB C;  1PIX A;  1SQP K;  4W7Z A;  1LP1 A;  2FYU G;  5KLV D;  3V2P A;  1VQK P;  1CI6 A;  2QIW A;  1ZV8 A;  3L75 J;  2JZA A;  3EQQ A;  4CPG A;  1WQL A;  4N3Y B;  1X8Y A;  1QL2 A;  3BAS A;  2YKO A;  1Y8A A;  1VPC A;  1HJ0 A;  1KQS O;  1SVF A;  3JCU H;  1RF1 C;  4HM0 A;  4WWI A;  3V6I A;  2XR8 A;  3CME P;  1OFC X;  1NTK J;  3L4F A;  3GG2 A;  2M5A A;  3VP9 A;  3VCA A;  2PGD A;  1DX7 A;  1JY2 N;  2MJZ A;  4H0L B;  5BU8 B;  4IOI H;  2MKV A;  1XTC C;  3H1K E;  2J58 A;  2JO6 A;  3L73 D;  1YIT P;  3GOB A;  3MUD A;  1AQT A;  3TGU E;  1NTZ G;  3Q2Y A;  3I55 P;  2HMK A;  1JM0 A;  2E74 C;  1T3U A;  2YKP A;  5CJ4 A;  1D7M A;  3EN1 A;  1M1J C;  5AVW B;  1NU1 G;  3B8E B;  3U59 A;  3EQ2 A;  1SQX K;  2K9J B;  2R5B A;  2FXO A;  2P67 A;  4LGD E;  3D70 A;  4QUR A;  4ZMD A;  3NMD A;  5H2F E;  2G3A A;  1P84 I;  3AE5 C;  2XDJ A;  3K5B A;  1FZA A;  1RE4 C;  1YJW P;  1L0L J;  1G2C B;  4I2L C;  1OIP A;  5KLV J;  4BRY B;  3KZI H;  5APX A;  2NVE A;  1EXI A;  2OYI A;  3H1J J;  1SQV G;  4ZKU A;  3EFF K;  3O6Q B;  4XE5 B;  3O8Z A;  2HMO A;  3TNU A;  1HWT C;  1SQB G;  3H1L E;  2YIU B;  3AE8 C;  3C1L A;  2YMY A;  3P8M C;  1BE3 E;  2V7Q J;  3PRJ A;  2E43 A;  3CD6 P;  1PGQ A;  1ZN5 A;  3T97 B;  3SFD C;  2P1J A;  1OVV A;  2FBW C;  3AE1 C;  4A7P A;  1G8J B;  3L73 J;  1NTM G;  2WSE H;  1KYO H;  1LP1 B;  3V2N A;  5KKZ B;  1L0N K;  4AUW A;  1YJN P;  5KAF E;  1CI6 B;  1Z56 A;  4H13 D;  2FYU D;  1VQ7 P;  1J1D C;  3C8V A;  2BMQ A;  1Q2N A;  1OWA A;  4EIJ A;  2BCC E;  3MTU E;  3AE2 C;  1N2D C;  3A2A A;  2Q7C A;  3CXH I;  1W2B O;  1X9V A;  3A0H E;  2VRS A;  4UB6 H;  2K37 A;  1M1J B;  1IFJ A;  2JWD A;  1IO4 A;  3H1I G;  4NBD D;  1JMB A;  2Q3E A;  1KYO D;  1VF5 B;  3F5H A;  1OZH A;  3FX0 A;  5B66 E;  3HRN A;  3IAO A;  2JEE A;  1YBK A;  3P8C E;  3H1H G;  1O7N A;  1MFT A;  1KV4 A;  2E4Q A;  1NTZ D;  3Q5R A;  1KIL D;  2KNC A;  2P10 A;  5AVQ B;  3L72 G;  2RH0 A;  3CCL P;  3D6Y A;  1NU1 D;  1VQL P;  1RFS A;  1FOS E;  2Y0D A;  1M8O B;  1GL2 A;  4UB8 E;  4YXW H;  2C0X A;  3N7N A;  2FYN B;  1QX8 A;  1FBM A;  2V4H A;  2N1T A;  2D2C B;  1R8E A;  3H32 B;  5CBO A;  1M57 D;  1SFC A;  5EFW B;  2QG4 A;  4PD4 I;  4EI2 A;  1CSB A;  1DEE G;  4H13 C;  1P84 E;  2Y9Z A;  1ZW0 A;  1PL5 A;  5KLI B;  1OW7 A;  2FYU J;  1PZQ A;  3HD7 D;  3PTZ A;  4KJM A;  1P84 D;  5AW0 B;  3V4Q A;  5GTI E;  3CX5 H;  2WQY C;  4Y28 J;  1T8Z A;  3P7K A;  3TNU B;  3CPW O;  1SQV D;  1Y9B A;  2P7J A;  1J1D B;  1NKN A;  3VMG D;  2E5Y A;  1FDI A;  1LTG C;  1VCK A;  1L4A B;  2WSE J;  4PV1 B;  1BSH A;  4NBE D;  3MZW B;  1OXZ A;  1K9M Q;  1IK9 A;  3L75 G;  2IFM A;  3FXD A;  3CWB E;  4O9B A;  1NTM D;  3E7K A;  2BMR A;  5CXM A;  3CX5 D;  5KAI E;  3G71 P;  1NTZ J;  3HE5 A;  4GOF A;  3BCC G;  2KUB A;  4HM6 A;  3OAK A;  3S1K A;  2ZVO B;  3FWL A;  1GMJ A;  1DD4 A;  1PGO A;  1NU1 J;  2K9Y A;  2JO1 A;  1H0T A;  2XKM A;  3L74 G;  2XU6 A;  2NPS A;  1GD2 E;  2IZ1 A;  3CXH E;  1YTZ T;  3OJA B;  4B86 A;  4M3L A;  2CPS A;  4K3A A;  1KD1 Q;  1VQ6 P;  2DW3 A;  4D6T G;  2HG5 D;  3W68 A;  2KS1 A;  3HD7 C;  1A02 J;  4C46 A;  3KQG A;  1LTJ A;  1O7W A;  2B88 A;  3NTN A;  2ZYL A;  2W90 A;  2KNC B;  1SQV J;  3H1H D;  4LC1 A;  4GOD A;  2IYP A;  2M3E A;  4H0L D;  3A0B E;  1T6A A;  1SQQ K;  1SQB J;  1PP9 G;  3L72 D;  5KTB A;  1S9K E;  1U57 A;  1S1C X;  2QJK C;  3AEF C;  1Q7Y Q;  3Q1M A;  1KOR A;  1GL2 B;  1S9K D;  3FXE A;  1EG9 A;  2O01 H;  1NYK A;  2AEF A;  3VMH D;  1N7S A;  1LTS C;  2OYH C;  1X0T A;  2N1T B;  1S5L X;  4BWN A;  1NTM J;  1SFC B;  3WU2 E;  1K8A Q;  3CCU P;  1ZRT E;  2KSE A;  3VMZ A;  3CC2 P;  3CC4 P;  1NGM B;  4PD4 E;  4HJL A;  1NOH A;  2K1A A;  1SQP E;  3VCP A;  4IFF A;  3H1K G;  1RY3 A;  4XFJ A;  2A45 G;  1N86 A;  1E5W A;  1KQL A;  1H88 A;  3TGU G;  3RBZ A;  1M7L A;  3P32 A;  2BEQ D;  2XNX A;  1MZ9 A;  2Q6Q A;  1IZN B;  1LJ2 A;  3L70 E;  1AFO A;  3RK2 B;  3VTP C;  1IFM A;  3HE5 B;  3VOP A;  3H1H J;  4TLF A;  1JOC A;  3Q3D A;  5BVZ A;  2PFX A;  3BCC D;  1RF0 C;  3HUS A;  3L72 J;  1IK7 A;  2GUV A;  2PRR A;  5CCG A;  1FJP A;  1ZP0 C;  3EFG A;  1OW6 A;  1H0T B;  4HH2 A;  5APV A;  3SWK A;  2NPS B;  3A7O A;  3L74 D;  4HM4 A;  1LTB C;  3KYQ A;  1KB9 I;  5KJ7 A;  1Q81 Q;  1SQX E;  3A3Y B;  4RKU J;  1ZME C;  2QPZ A;  2KS1 B;  3Q5P A;  1URQ A;  4ASV A;  3H1L G;  2IYO A;  4D6T D;  1LTJ B;  4DOJ A;  3TSI A;  2AXT E;  1IC2 A;  1MKM A;  1T3J A;  2ZXE B;  4R4M A;  1BE3 G;  2WPS A;  1FC2 C;  3GHG A;  2BEZ F;  3M9Q A;  3RGU A;  1VF5 D;  1O7M A;  1U7M A;  2ZVN B;  3L37 A;  1JM1 A;  2Q3I A;  2HOD B;  4Z1M H;  2O01 J;  1LWU C;  5AW2 B;  2Y9Y A;  3QWO C;  1Q90 D;  3WUV A;  2E5T A;  1WMK A;  1UUW A;  1Q82 Q;  2IBZ I;  4JPZ B;  1N7S B;  2YIU C;  3GL2 A;  1NO4 A;  3G4S P;  4WY4 A;  2WMM A;  2A45 H;  2WWW A;  2BCC G;  2XND H;  3JC2 2;  1UUV A;  3LW5 H;  1EDK A;  1CZQ A;  5AVR B;  3ABV C;  3BCC J;  3CCJ P;  3CCV P;  1VDF A;  4XA4 A;  1KFN A;  1RH5 B;  5HL4 A;  1H89 A;  1S5L E;  3AEC C;  5L8R J;  5KKZ C;  1EC5 A;  4NPF X;  1VQ4 P;  2D2C D;  2A06 E;  4HYT B;  3GLM A;  1L0N E;  1SLQ A;  3SFE C;  3VMY A;  3AE4 C;  4RES B;  1FU1 A;  2R3C A;  3W67 A;  2A06 D;  5TJH A;  4HKV A;  5H2F H;  3L74 J;  1GW3 A;  1HJB A;  2IFN A;  5E79 E;  3NXS A;  2JWA A;  3H1K D;  1S72 P;  4GKG A;  3M91 A;  3TGU D;  3SWY A;  1NTK K;  2J5U A;  4D6T J;  3H6P A;  2AEM A;  2GBW A;  2SPZ A;  3V5B A;  2QEX P;  5B5E E;  4JYB A;  1L4A D;  1M1K Q;  4PV1 D;  1QL1 A;  3E1I A;  3V2Q A;  1OX3 A;  1VF5 C;  1BGY E;  1NJI Q;  3HUS B;  2KP8 A;  4ZNC A;  1QVF O;  3LID A;  1PP9 J;  1JNM A;  2N9Y B;  1O7P A;  1Q90 C;  4NBH D;  2M0B A;  4BXL A;  2N9B A;  3AE9 C;  2ZYD A;  1LWU B;  1USD A;  2B89 A;  2XRX A;  4LLH A;  4N78 E;  2OAR A;  3QH9 A;  3CCR P;  5CCH A;  3HE4 A;  3BVH A;  2G8Y A;  1YIJ P;  2NRG A;  1URQ B;  5KAF H;  1LT9 A;  2I7F A;  1L0L K;  2E76 B;  2WTY A;  1KB9 E;  2QM8 A;  4ASW A;  5KLV K;  3H1L D;  2QA4 P;  5CMZ A;  3GHG B;  1KB9 D;  2FYN C;  4W7Y A;  5APU A;  1BE3 D;  1X79 B;  2D2C C;  3M06 A;  3A0H H;  3DQY A;  4K35 A;  5DJU B;  5KLI C;  3M0D A;  1FS0 E;  2OYI C;  3H1K J;  3CWB G;  5AEW A;  2E42 A;  1S2E A;  2ZYA A;  2C9N Y;  1YTZ I;  3TGU J;  2YO3 A;  4HM8 A;  3LW5 J;  1JTH A;  3II6 A;  2J59 M;  4WY4 B;  1OVR A;  5CJ0 A;  4L75 A;  5AW7 B;  5B66 H;  5AVT B;  2IBZ E;  1L4A C;  1GL2 D;  3GMA A;  4PV1 C;  2IX7 C;  2BCC D;  3G6E P;  2IBZ D;  1ZR4 A;  4WBA A;  1YQ3 C;  4HB1 A;  2JP3 A;  2M5A B;  2N1T D;  4NBG D;  1A02 F;  1SFC D;  3B5N A;  1LTA C;  4UB8 H;  2IZ0 A;  2Q5U A;  5GTH E;  3RK3 E;  1FZC A;  1K04 A;  2ZYG A;  1PGJ A;  4P1C H;  5AW3 B;  1AQ5 A;  1FZB A;  2HMM A;  3P8C D;  2KZJ A;  2POH A;  3OW2 O;  1P84 H;  2IDB A;  1K73 Q;  1JY3 O;  2L91 A;  3FGA D;  3H1L J;  1N7L A;  1PPJ E;  5GTI H;  2NUM A;  1RE3 C;  1BE3 J;  1PPJ D;  4DJG A;  3G9R A;  4YTP C;  2Y0E A;  2CPB A;  1FDM A;  3LIE A;  2NVG A;  4IFM A;  4I7Z B;  4JBZ A;  1SS1 A;  2NUK A;  3RK2 D;  1OW8 A;  4HKZ H;  1VL2 A;  3MIW A;  3GTS A;  1YHQ P;  2OYI B;  4Y99 B;  1AVY A;  5APT A;  4OWF A;  2ZFC A;  1SQQ E;  1G1J A;  3HE4 B;  3KPE A;  2B9B A;  3AED C;  3NFQ A;  1GL2 C;  5KAI H;  1SQP G;  2BCC J;  5AEU A;  5C39 A;  2FKW B;  3B4S A;  4DCK A;  4JF7 A;  1PFI A;  2WT7 A;  2NPS D;  4NB8 D;  2P58 A;  3EWK A;  2FYU K;  1YI2 P;  1N73 A;  2O1J A;  2LXB A;  2N1T C;  1SFC C;  3KXD A;  2ZT9 B;  3RL0 B;  1KIL A;  2H7H A;  1IFI A;  1MUU A;  3CL3 D;  3L70 G;  3CXH H;  5AW8 B;  3GCE A;  3CWB D;  2WSC H;  4WB4 A;  3GB4 A;  3VMX A;  1JCC A;  4OH8 B;  2WPQ A;  1M90 Q;  1YYC A;  4IL6 E;  3D6Z A;  2WPR A;  2Q9I A;  1ZR2 A;  3PHL A;  2QJY B;  2AXC A;  1JY3 P;  3A5T A;  1FZE A;  3A0B H;  1NTZ K;  2FY8 A;  2W8Z A;  4QUQ A;  5BU5 A;  1NYH A;  3WMM 0;  3B5N B;  2DE7 D;  2HYN A;  4NPE A;  3OA7 A;  3RK2 C;  3CXH D;  1R5S A;  1RQU A;  1SQX G;  1UIX A;  1NU1 K;  1YQ4 C;  3SWF A;  3TYY A;  2WSF H;  1FZC B;  2W6B A;  5APQ A;  2YFI A;  3H1I E;  2NWF A;  1AA0 A;  2JKV A;  1J2J B;  1KC8 Q;  3D89 A;  2Z5I A;  2PAJ A;  3WU2 H;  1EZV I;  1S4X A;  4AQR D;  1GK4 A;  3IR9 A;  4U3F E;  3RBX A;  1JY3 N;  2NPS C;  4MN4 C;  1NAY A;  4PD4 H;  2P2U A;  5AW5 B;  3L71 E;  1VM9 A;  3M9H A;  2YXR B;  2JJL A;  2HMN A;  1SQV K;  1K05 A;  1VQO P;  1LTJ C;  4NBA D;  1ULI A;  5APY A;  2OQQ A;  2CK3 H;  1LTT C;  1SQB K;  4C7R A;  1KN7 A;  5APS A;  2E4P A;  4RJT A;  3CWB J;  1DEB A;  1ZRT D;  1JMM A;  2GM4 A;  1JCD A;  2FXP A;  5CCG D;  3RK3 B;  1AJY A;  3GTE A;  1RHZ B;  2KYV A;  4PD4 D;  2A06 G;  2WT7 B;  1NTM K;  1L0N G;  1SQP D;  1BCC E;  1N73 B;  1N7S C;  1Q86 Q;  4H44 B;  3GF7 A;  2HFE D;  4IFD K;  5TIS E;  2KIK A;  3VMA A;  1URQ D;  2WSC J;  1JY2 O;  3G3Z A;  3GZX A;  2E76 D;  2WIT A;  4YPC A;  2R44 A;  2C9L Y;  2ZJS E;  4PJ0 E;  1M56 D;  3L70 D;  5AW1 B;  2FFD A;  1G8K B;  2W6J H;  3TF5 A;  3L75 E;  1BGY G;  1HH0 A;  1L2P A;  2AXT H;  4GIF A;  3AE3 C;  4OGQ B;  2O3J A;  1BDD A;  2BAS A;  4WY4 D;  1X22 A;  3VN0 A;  2WSF J;  1T2K D;  1NTK E;  2QJP B;  2Z5H A;  4EOT A;  3VP8 A;  3M0A A;  1GW4 A;  4AAY B;  1SQX D;  3HUS C;  1OMI A;  5AVZ B;  3CC7 P;  2QVA A;  1EXJ A;  5CCG C;  3C9I A;  1J1E B;  4NBB D;  1KMI Z;  1SQP J;  1FDO A;  5K5G B;  2QE7 H;  3GKE A;  5DJT B;  5KJ7 C;  2ITA A;  1EZV E;  1QGK B;  3V4W A;  1S5L H;  5AW6 B;  1URQ C;  1LTI C;  2E76 C;  1L0L E;  1RF1 A;  2DE5 D;  5AVV B;  5AVY B;  5AVU B;  1LNQ A;  5E79 H;  5KLV E;  3GHG C;  1L0L D;  1DH3 A;  2AEJ A;  2IBZ G;  1JY2 P;  3L70 J;  2OYO A;  2JDI H;  4L74 A;  2I1K A;  3H1J E;  1HUC A;  4KT0 J;  3CCQ P;  3UIA A;  3H1J D;  1JO5 A;  1G1I A;  1KYO I;  5B5E H;  2Q3W A;  1GU4 A;  4EDF A;  1EDL A;  1L0N D;  3WUU A;  4WY4 C;  1VQ5 P;  1QVG O;  1M1J A;  1T2K C;  5CCH D;  5CBN A;  4QDF A;  1AVO A;  1HVV A;  3I5C A;  1XTG B;  2YFJ A;  4HM2 A;  2K3R A;  2KZI A;  1WT6 A;  3L73 E;  1SQX J;  1HBW A;  2M3B A;  2FFD B;  1RE4 A;  1PPJ G;  2Q1K A;  1VQ8 P;  1SJG A;  2ZT9 D;  1GTW A;  3PLN A;  1IFN A;  3JCU E;  3RL0 D;  2H89 C;  4N6J A;  1KB9 H;  1BGY D;  3MUD C;  1RIE A;  4HM5 A;  4NBF D;  2Z4E A;  3IN6 A;  2W27 A;  3Q5S A;  2YNY A;  3GL0 A;  1NH4 A;  1KQG B;  1SQQ G;  2E75 C;  3CI9 A;  2HMJ A;  1FZG A;  4N78 D;  1GZL A;  2R5D A;  1NDO A;  3GZY A;  3H32 A;  5M1B A;  4C7N A;  2HR3 A;  4L73 A;  3B5N D;  4I7Z C;  4KHX A;  4NB9 D;  2QRX A;  1RQV A;  4I6M C;  3IF4 A;  4TT3 H;  2WPV B;  2H43 A;  2YFL A;  1FZF A;  1L0N J;  3JSV C;  4Y99 C;  1FE6 A;  2XZR A;  4IL6 X;  4GDO A;  2HML A;  4AIV A;  5CCH C;  5AVS B;  1ZXG A;  3CX5 I;  1L4A A;  2RMZ A;  3KZI E;  1LT9 C;  3L36 A;  2GBX A;  2LKM A;  4I1L A;  1RF1 B;  2GUS A;  1DD3 A;  5GTH H;  1FOS F;  1O7H A;  5AW9 B;  1FAV A;  2FYU E;  3F89 A;  2ZT9 C;  3PP5 A;  2IPP A;  3M0D C;  3FWN A;  3RL0 C;  2KI7 B;  1W2E A;  1BGY J;  2B24 A;  3S9O A;  2E74 B;  1ULJ A;  3TDK A;  1VQP P;  2ZXX A;  2K88 A;  1KYO E;  4QDF B;  1HGV A;  2YMK A;  2XSH A;  3RK3 D;  3KHU A;  1RE3 A;  2LR2 A;  2QJY C;  4GT1 A;  3CMA P;  4QDC A;  2OTK E;  2JR8 A;  3CLQ A;  4U3F G;  3BRT B;  1YJ9 P;  4H44 D;  2E75 B;  3SSU A;  1IFD A;  1NTZ E;  2R32 A;  1KIL E;  1JB0 J;  3B5N C;  2FXM A;  3L71 G;  4UB6 E;  1BDC A;  3N0Q A;  2KXP B;  3MP7 B;  3ITK A;  1FZC C;  1NU1 E;  2WSS H;  5AW4 B;  2LXC B;  1CW5 A;  1KZU B;  1ZOY C;  5CHX A;  1VQ9 P;  3MD0 A;  1NKZ B;  1W5C E;  2KSJ A;  2KOG A;  1NAF A;  2RN0 A;  3VMI D;  1LT9 B;  1SQQ D;  3MHV A;  4OGQ D;  4YXD C;  4JYC A;  1EQ7 A;  1JUN A;  2H88 C;  4C7N B;  3ZDM A;  1BCC G;  1FQT A;  1SQV E;  3AEE C;  4IL6 H;  1SQB E;  4DT0 A;  3CCM P;  1SQB D;  1NHL A;  1PV3 A;  1IJD B;  3BAT A;  1ZLL A;  3RK3 C;  3U1A A;  1LGH B;  1JTH B;  1U7J A;  4JQ0 D;  4QMA A;  3AEG C;  1FJK A;  1NTM E;  1N73 C;  3CX5 E;  3E1R A;  4H44 C;  1O7G A;  1GK6 A;  4W80 A; 
#chains in the Genus database with same CATH homology
 3D71 A;  4HKV A;  1G8K B;  4NBD D;  4P1B H;  3FOU A;  3L75 E;  1VF5 B;  2J5U A;  4U7J A;  2GBW A;  5BOK A;  3AE3 C;  4OGQ B;  3IAO A;  4PV1 D;  2NVF A;  1O7N A;  1VF5 C;  3C0D A;  2YVJ B;  2WSF J;  2E4Q A;  3R4Y A;  1NTK E;  3Q5R A;  4OGQ C;  3AEA C;  2P10 A;  3D6Y A;  1O7P A;  1Q90 C;  4NBH D;  4AAY B;  4NBC D;  2B1X A;  1RFS A;  1OMI A;  3AE9 C;  3H1H E;  2QJP C;  2QSI A;  2DE6 D;  1EXJ A;  2XRX A;  4H13 B;  3L72 E;  4NBB D;  4R4L A;  2G8Y A;  1KMI Z;  1FDO A;  2I7F A;  2D2C B;  1R8E A;  3GKE A;  2E76 B;  1KB9 E;  4H13 C;  1P84 E;  1PL5 A;  1OW7 A;  1EZV E;  2NZ2 A;  2FYN C;  2WQY C;  2D2C C;  3GF3 A;  4Y28 J;  2E76 C;  3DQY A;  1L0L E;  3AE7 C;  2DE5 D;  1Y9B A;  5KLI C;  2XSO A;  5KLV E;  3VMG D;  1FDI A;  1VCK A;  1TU3 F;  5AEW A;  2WSE J;  2BMO A;  3H1J E;  4PV1 B;  4HM8 A;  3H25 A;  3LW5 J;  4NBE D;  4KT0 J;  2CKF A;  1KTM A;  4QDD A;  4HM1 A;  1DIP A;  4HM3 A;  2IBZ E;  3CWB E;  3GMA A;  2Q3W A;  4PV1 C;  2BMR A;  5CXM A;  1YQ3 C;  4QDF A;  4HM6 A;  2JP3 A;  2YFJ A;  4HM2 A;  1GMJ A;  1DD4 A;  4NBG D;  3L73 E;  2K9Y A;  2JO1 A;  3RK3 E;  1K04 A;  3BCC E;  1SJG A;  4QUP A;  2ZT9 D;  4P1C H;  4HM7 A;  4H0L C;  3CXH E;  2HMM A;  2H89 C;  1KQF B;  2IDB A;  1RIE A;  4HM5 A;  3FGA D;  4NBF D;  3AE6 C;  3IN6 A;  3L74 E;  1PPJ E;  3Q5S A;  2NUM A;  1O7W A;  3GL0 A;  3G9R A;  2ZYL A;  4YTP C;  1KQG B;  2E75 C;  2HMJ A;  4EMJ B;  4H0L D;  2E74 D;  2NVG A;  3O6Q A;  4I7Z B;  1NDO A;  3GZY A;  2NUK A;  1OW8 A;  1U57 A;  1S1C X;  2QJK C;  3AEF C;  3Q1M A;  1KOR A;  3RL0 g;  1VL2 A;  3GTS A;  5M1B A;  1EG9 A;  1HF9 A;  4I7Z C;  1NYK A;  1SQQ E;  4NB9 D;  3B71 A;  1RQV A;  3VMH D;  3AED C;  1PP9 E;  3AZC A;  4QCK A;  1S5L X;  4TT3 H;  2WPV B;  2E75 D;  2YFL A;  5AEU A;  3AEB C;  1PIX A;  4IL6 X;  1ZRT E;  4NB8 D;  4GDO A;  2HML A;  4AIV A;  3EWK A;  2QIW A;  2GBX A;  1NGM B;  4PD4 E;  2ZT9 B;  1DD3 A;  2JZA A;  3EQQ A;  4HJL A;  1WQL A;  1SQP E;  1O7H A;  3VCP A;  1HJ0 A;  2FYU E;  2ZT9 C;  4XFJ A;  3GCE A;  4HM0 A;  2XR8 A;  3GB4 A;  2BEQ D;  2B24 A;  3VCA A;  3S9O A;  4H0L B;  2E74 B;  1ULJ A;  3D6Z A;  2MKV A;  3H1K E;  3L70 E;  2JO6 A;  3GOB A;  1KYO E;  3Q2Y A;  3TGU E;  4QDF B;  3Q3D A;  2HMK A;  2YMK A;  2XSH A;  4QUQ A;  2E74 C;  1NYH A;  2DE7 D;  3EN1 A;  2QJY C;  1IK7 A;  4QDC A;  1RQU A;  1ZP0 C;  1UIX A;  1OW6 A;  1YQ4 C;  4H44 D;  2E75 B;  2YFI A;  3H1I E;  1NTZ E;  2NWF A;  1KIL E;  1JB0 J;  3D70 A;  3D89 A;  4QUR A;  4HM4 A;  2G3A A;  3N0Q A;  3AE5 C;  1NU1 E;  4RKU J;  1SQX E;  2QPZ A;  1ZME C;  4U3F E;  3Q5P A;  1ZOY C;  2NVE A;  1MKM A;  3L71 E;  4R4M A;  1EXI A;  2BEZ F;  1VM9 A;  2HMN A;  1VF5 D;  1O7M A;  1K05 A;  4NBA D;  1ULI A;  1JM1 A;  2HMO A;  2OQQ A;  3VMI D;  4OGQ D;  4Z1M H;  4YXD C;  3H1L E;  2O01 J;  3AE8 C;  2E4P A;  1Q90 D;  2H88 C;  1WMK A;  1UUW A;  1BE3 E;  2V7Q J;  1FQT A;  1SQV E;  3AEE C;  2YIU C;  3GL2 A;  2FXP A;  3T97 B;  3SFD C;  1SQB E;  1AJY A;  2FBW C;  3AE1 C;  3GTE A;  1G8J B;  1PV3 A;  1UUV A;  1BCC E;  4H44 B;  3GF7 A;  4H13 D;  3ABV C;  5HL4 A;  3C8V A;  2BMQ A;  3AEC C;  3AEG C;  5L8R J;  5KKZ C;  2WSC J;  2D2C D;  1NTM E;  2A06 E;  3GLM A;  2BCC E;  3GZX A;  4H44 C;  1O7G A;  2E76 D;  3CX5 E;  1L0N E;  3SFE C;  3AE2 C;  3AE4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...