2E7CA

Solution structure of the 6th ig-like domain from human myosin-binding protein c, fast-type
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGTLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-binding protein C, fast-type
publication title Solution structure of the 6th Ig-like domain from human Myosin-binding protein C, fast-type
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 8
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7cA01
2JELH 5D1XA 3D5OF 2VDOL 2Y7QA 2WP3T 1S9YA 3CFBA 1QRKA 1A7QH 1GGUA 1AFVL 3GI9H 4BZ2H 5GJTL 4TTDC 1KBGH 1XAUA 1ZEAL 2B5IC 4LSQL 1FP5A 2P43B 2FL5B 2FYYB 4DAGH 4OBSA 1KJ2H 1BD2E 2QADB 2C7UB 1KPRA 4X0KA 4CVZA 1SJHA 5BZDB 3EYOB 4JFHE 1NFDE 4WEMB 3OKNA 3MC0A 5JIKA 1P69B 1JTOA 4LMQE 1JZ2A 5F97E 2H6PB 4KJPC 4NM4L 1JZ7A 5BXFA 1H3WM 4IRJD 4QWWC 1QFWM 1F3DH 4RFEB 1R3IH 2F19H 5ANME 1Y6NR 1RIVL 2ICWB 4LPYA 3U7YL 4P2QB 4LVNC 5F7MC 2FX9H 5F88B 3FQUA 4ELMB 1MCFA 5L9DL 3ES6B 1H8NA 3TCXA 4NRZB 1NGQH 5BVJB 1YYML 2D31B 4Z7VB 5KZCB 2EXYD 3GRWA 1M71A 1KJMA 1U8JA 4YPGB 4HPYL 5BJTA 2CO6B 1MVUB 5B39A 4ODSH 3CGTA 3GDBA 1WC7A 2BHUA 1KCVL 2GKIA 1R5WB 5IW6A 5D70L 2HJLA 1NBVL 4MQXC 5EC1B 1BVZA 4YAQA 5EOCH 3QXTA 1FORL 4IEFB 4CMMB 2CLZA 1QA9B 1AO7A 2FBOJ 4NQED 1N7MH 4CVXA 5C7XL 5BMFL 5EZLB 1AQKH 2R0LH 4OCMC 2C4FU 3CLEL 4HIJA 1NCBH 1MREH 5IHUL 1CWVA 4PGCB 1I4FB 1XGYH 3DROB 4IRJB 1IM3A 1WWCA 1ZMYA 5BO1L 2VMFA 1G7LA 4G8GA 3K8MA 5F6HI 1IRAY 3OXRB 2F54D 1UGNA 3WLWD 1AKJD 3PWJB 3NA9L 4UUJA 1A9BB 4M6OH 1D9KA 4P2RD 5CHNA 3NIGF 2YD4A 4DQOL 1KUMA 5EG6C 2MCPH 4BZYA 4XHJC 5E7FA 4JKWA 3ZDZF 4CNIA 1EEUA 1GHFH 2MKWA 4JGUA 4DCQA 2DJ4A 5TQ2H 2ESVD 5DA0B 4CW1B 4HUNB 2FEEI 3LKPA 5E94B 1KTRL 3ZKNC 4QRTB 4FABH 1M6OA 4KAQL 5F9JB 3OXSB 2ZG1A 4QYOB 3K74B 4TSAH 4LFHG 2CRMA 3BQUD 4HXAH 3RNKB 5C86A 3TNMA 5EPMA 1K85A 2O5XL 1X5JA 4GRMA 1ES0B 3FHAA 3O3AA 3BPNC 3ZKXB 1TETH 1XEDA 4FXLA 3VXQB 4HG4J 2AV7A 1A3LH 4QGTA 2P8LA 4NQEB 3SBWA 5DURB 4XRCB 1SM3H 4WHYG 3FTGB 2QJDA 1H8OA 3GJFB 4NQDE 3O0RH 3G5XA 4XVSL 2DQFA 3CFEA 5HXMA 3QDGE 4IRZH 4OLWL 1K3ZA 2V5TA 3KHOA 3RL1A 5C6PB 3UZQA 3NPZB 3LQAC 4U3HA 1AKJB 5ITBL 4B7LA 1O0VA 2D7QA 3EO1B 3VXSE 4YHYC 4X4XB 4P2RB 1BX2B 4U1NA 4WENB 3WS3A 1MLBB 5CGTA 1U8QA 4XVTL 4LVOC 2DLFH 2ESVB 5F9WB 1J7VR 3ZDXE 1A7RL 3FO1B 1EUTA 3V6OA 3TBSA 2CKNA 5D5MB 3HNSL 4GS7B 2YA2A 5C0IB 2XPGA 3BQUB 3V6FB 3QI9A 4MAYC 3VXTB 43C9A 4O5LL 3C5SA 4TNWF 3ARBD 3F7YB 3ARED 1U93A 3WN5C 1X5YA 5JMRA 5LGHL 4DZBA 4NOBA 2ZP0T 3U79A 2DM2A 3HNVL 1MJJB 3RAJH 5C0NC 3QQ3B 3CC5B 3QFJE 4Z7WA 2VLLA 4MA1C 3GMMA 4MAUL 5E5MA 4C56D 1T1WA 3FN9A 5EO9B 4R4FL 5HHOE 4A6YA 2HJFA 1XH3A 3HPJA 1ZWIA 4QKXB 3DWTA 5DQDH 3PG2A 4XP5L 2W59A 2N1KA 4K94H 4YEFA 2R9HC 1L6ZA 2FLBT 4IMLA 4F7TB 2OZ4A 1WUNT 1U42A 4PJCB 2IAND 2DN7A 5JLZB 2J4WH 5C08D 1GIGL 4LBEA 4E42A 4OQTL 2FJHA 3G08B 5F7EH 3R06B 3GBLA 1XIWB 2XG4A 4FQCL 1F58H 3ARBB 2CLRA 3AREB 3KPOB 4KKLD 3U0TB 4LAJH 4R4BA 4HXBH 4XAKD 3VE0B 3H9HB 3AFLA 3AC0A 5I1EL 4FTVA 2IBZY 4FQHB 4TPRL 4AM0B 4KK9C 3UJIH 1GZPB 2HTLD 4OLYL 3IXAB 4NQCA 2R0KH 2E7LC 3EIFA 4C56B 5D2NB 1PYWA 2Y9RT 2VOTA 4KHXL 4LOUD 4GLRH 3DVIA 3L9RA 4NKOA 2J8HA 2YPLE 3CFIC 3UROR 3LOWA 3MCKA 5HI4D 1YN6A 3HNTL 4Y2DA 1FFQA 4WW2B 5MERB 3NIFE 4AEIL 4J3TA 4ERSL 4U1SB 3UZEA 1FFNA 5EC2A 2IQ9L 4YXHL 4ZODA 5J7CC 5H37H 1EX0A 1DQJB 3ELAT 2FSEB 3Q6FA 4HUXA 3BT2H 3OKKB 5EBWB 5EU5A 2X4TB 4KUZL 4P3CL 5J0BA 4L9DA 2MJWA 3OKDB 3VWKA 5C08B 2E6JA 3PIQB 4HZAA 4XC1L 4KKBD 5GQBA 1KCLA 1KIQB 1UWEH 4YK4B 5DD0H 5ADPH 1FGNL 1JGUH 1W0VA 4KTEL 2DKSA 2ZUVA 2ZCHL 3HMXA 3W0WA 4YGVB 4PFEA 3D2UA 1LP9E 2G5RA 1KPVB 5GGRY 4JKKA 3UBXB 1BLNB 1S7RA 3HG1D 5E6YA 1D5ZA 1U3HC 1YY9C 2RCSL 3C60D 3GMNA 5F9DC 4H26A 1UZ6E 2DD8H 5CEXB 3SJVE 3QRFM 2XA3A 5CZVH 5IB1B 3BO8B 2ZUTA 3KXFA 1KXTB 3U6RA 3D0LB 3ZTJH 7CGTA 5FHAL 2X9XA 1CDUA 1BEYL 1AXTL 1XFPA 3FAWA 3MUHL 5C0AA 3GK8L 3EJYC 4M1CC 3CFDB 1LILA 3LIZL 4X98A 1CLOL 3M8OH 4UIMB 3IT8D 1QFWL 1GC1H 4XNXH 4PP2A 2PYEE 4YHKL 3V0WH 1ORSB 2ICCA 3UTQA 3SKOA 2IH1B 3TJHD 2BJMH 2FX8H 3QXAB 5IBUB 3V5KA 4RCAA 2IG2L 1M1SA 5E6IC 2WUBL 1CXKA 3SGKC 5IMLA 2D7NA 3DARA 3KPQA 4K3JL 3F6LA 1X44A 3KDMB 4P46D 2BVOB 3VA2C 1R5IA 5GGSY 1M7XA 5E1AB 2AI0L 4S1SL 1BBJA 4JM2F 5HDQL 1KNOB 1LDPL 5GSVB 1WFUA 2VE6B 2VDLL 2YPVL 1HN1A 1S5IL 1ZVYA 3TH4T 5HHPA 5CIPB 2Q8BH 4X8JA 4ZO9A 1A6ZA 1T21B 4D8PA 2YWYA 2ATKB 3NCBB 3R4DA 3WDJA 2XWBB 3WO4B 3VFUB 1OF2B 3K3QA 4XNMA 3CX2A 1ZVSB 1IBGL 4DUVA 1IJ9A 1RUKL 1QSEB 4GXVH 3T1WA 3H7LA 1JF5A 1YEIH 2B8OT 2DRUA 5DJZB 3ZE1F 2P8PA 1T0MB 1LEIA 4R3SB 2W9EH 4LCYB 2DQUH 5CD5D 3S96A 1X5XA 4FMKA 4ZUVB 1SJEB 1D5MB 2H26B 4QRPA 2DLIA 3HMWH 5E2UH 3B5GA 4GBXC 4WFGE 4P46B 1EERB 4HKJB 1NGYB 4R0LA 4NWUL 2ZOKA 1IE5A 5MEND 4YDLC 1JRHI 4IRSA 2BOBB 4J3SA 4XNYL 3LMJL 1OM3L 4NKDA 4DWHA 2BNQE 3V5DB 5DMIH 1F3DJ 5I15L 3QWRD 3DXAD 2OBGA 3Q48A 4Y4HB 2ADFL 3VFWB 4HFUL 5HGGS 2D2OA 3QEUA 5ILTL 1YNTB 3UAJC 5TDPB 1A1OB 1LNUA 3IDYB 3UJTH 1INEL 4MB5A 4OQTA 5CILL 1ZT4A 2F5BL 3ARUA 1J05B 2MQCA 2XQBH 1NCAL 4WFHE 3CDYA 4BQBA 4LSTL 2LABA 4O00A 4ZO8A 1Q9KB 3CPLA 2HKHL 2Z92A 3AMLA 1QKZL 3MLRL 1OAKL 3ARZA 5DJ6B 1JWSB 4PJ5A 4YFLF 4JFEA 3FAXA 1RZ8A 2MSPA 4XXCA 1I1AA 2H8PA 3GSWA 1DQMH 3RY5A 3SDDA 3AGVA 3ROOA 3L5XL 1W8OA 3ME0A 3FB5B 5DFVC 5EOCJ 2X40A 3D3VE 1TCMA 3P4MB 2FD6H 4XWOD 1XR9B 3DV6A 4XC3H 3BW9A 4M62L 4Z7OE 5GS0C 4IS6A 3ETBF 4MJ6B 4I4WA 4IIQC 2QHRL 4M8QB 4U0RC 3O2DL 5DEGA 2E6QA 1KB5L 5MENB 3WDIA 4X7SH 3IKCA 1CICC 1RQ5A 1UACH 2V2WA 1EIBA 2BSRA 5IJVB 1CU4H 4HJJH 3ARVA 3ULUF 3SDXE 4UOJA 5IVNA 4Y2OA 4PJGE 1E4XH 2XV6B 4PJHB 3K8LA 3DVNB 5I19H 1MCDA 4XZUB 2L7JA 4QHMB 4LKXA 1BF2A 1CFNA 3X13B 5GIRB 3F5WB 1B0RA 2DS4A 1KEML 4FFZL 5AYUH 4DW2H 3N06B 4XNUH 1MWAA 1T83C 1P6AB 4PJ8C 4Y1AE 5CIPH 4DUWA 4F57L 3IFLL 1NMBL 1YY8A 2O26U 5A2LH 1VFAA 1ZOXA 4RGMC 2K1MA 3IVKB 3FO2B 1EAPA 4H0GA 5C6TL 4K3GA 3PHQB 3BUYB 5DHYB 1P53A 4Y5VA 3ZL4L 1IGYB 1Z3GL 1DDHB 1PVHA 4U1JB 3GSRA 2GJZB 2Y4SA 1EVUA 1WAAE 2W1NA 4PJBE 3V4VL 4R7NA 1YYLH 4K7PY 1T20B 3VXNB 1E6JL 2X70A 1YJDH 3KJ6L 1RK0A 3U30B 3KGRA 5ICYB 4LNVA 1OTUD 1NAMB 5JW3L 4OZIA 2GY7B 3VG9B 5I73B 2Q8AH 4Z95L 4P5TA 3QUML 4FQ2L 4F9PC 4FFYH 4PB0H 3A0OA 4PRHA 5I17A 1YDPB 5DRNB 1I7RB 2XZQL 5CGYC 5C3LD 1F90L 4GG8A 2C9AA 4OV5B 2FH8A 3MRFB 2Z93A 2XRAL 1MFAL 2ICWJ 3MFGB 1E0OB 1WEJL 5DHXB 2FH6A 1BFVL 1F6AB 2MHAA 4U1GB 5AYQA 4R96B 1KJVA 2Y23A 3MRKA 1IEBB 5EZJA 3QH3A 4Q6IB 2FWOA 3L3JA 2QSCL 2WQRA 3FRPA 3RHWK 4ALAH 3SE3C 4I2XE 2XFXB 3CAFA 2VKWA 3KPSA 5SX4I 4BFBD 4GRLD 3HAEG 3CDGA 3O2WH 1OAXH 4NNXA 2ZUWA 5GGRA 5LWYH 1FNHA 3P30L 4YDVA 4AT6A 5DJ8B 5TF1L 5IT2L 1YC8A 4G42A 1YQVL 3V52H 4PB9H 5GGVH 1WCBB 3Q1SL 5KVFH 3NPSB 3VFSA 2MOVA 4O4YH 3PXHA 3B2VL 1OGTA 4MLSA 4R4ND 1MFDH 3SDCA 4X6EB 2BNRD 5BQ7A 5J9PB 4NUJA 3OAYK 4PPTA 5TE4L 4I77H 2HT2C 1Z9SA 2BOCA 1N3NB 2YMXH 1FO0B 4O51A 3MV8D 5E00B 3TPUB 3TVMA 5T1KD 5TFSH 5CWSA 1KCUH 4K7PL 1BZ7A 5FDWA 3K2MC 3V0VA 2QADC 2DOCA 3PJSB 2XN9E 2XOTA 5J89A 4NT6A 1G7HB 1FNEA 4ODUA 5FHBL 4M6NH 4S2SB 1IC5L 3GIZL 5DI8B 1WBXB 5IEKA 4GRLB 3CFKA 1RJLA 2C3GA 1JCKA 3GSUA 4I1NB 4W4NA 3ARFA 2P45B 5FUCC 4X6CA 1TFHA 4GSDH 4OI9A 4JHZA 3REVB 3PGFL 1M7IA 4O2CB 3VFMB 4KKCC 1AO7E 3OAYH 5FB8A 1JFQL 3RZCA 1OD9A 3U0WL 5J1AA 4JY4A 1RJCA 2DM7A 2KKQA 5F7NC 1N6VA 2BNRB 2P44B 4N0YH 5CSGA 1PGRB 1WISA 3D69B 1D6EA 1SJVA 2VDNL 5E2TL 1CLYH 1FVDA 1L9NA 4Y16A 4G8GE 4UIKL 5JXEA 4OUUA 1MCNA 5KW9L 3MV8B 2UUDK 3MXWH 3I6KB 5T1KB 4BK5A 3U4BL 1NAMH 4OD2A 2GTZB 4NKIL 5EBLB 4OLEA 3TBWB 4XAWL 4WUUA 1GGCL 5KSBB 4BSWA 1G9NL 5DRWB 3BOVA 3RWEB 3TV3H 1P7QD 2Z31A 3LS4L 4K7FB 1KTLA 4K94C 1GAFH 1L7IH 5FXCH 1HH6A 4JY5L 3TGXA 4HUKB 2QR0B 1A7NH 4ESKA 4IRJC 3STLA 5EUOF 4PJXF 5AWNH 4FP8H 5H2BB 1OQOA 3HS0B 3JWOH 1HSAA 4K07A 1BZ9A 4OGYL 3W9EB 3LEXB 2APTA 2CJUH 3L3GB 3EDKA 5D7SH 5LBSH 4PJDE 1TZGH 2WK2A 1V3MA 4OAWB 1BFOB 5C8JB 1OWRM 3OR7B 2BK8A 2UUDH 1BAFL 4ZS7L 1AQDB 5D2LE 2EXYC 3K2UH 4XNQB 5FIEA 2ITCB 4NOFA 3KPTA 4ZQKA 1HXYA 1YNLL 3RA7L 3MRHB 3RFZC 3DPBA 5K59F 3MV7B 15C8H 3LEYL 2B1AH 1KN2L 3QUMA 1NCCL 3CU7A 4HWEL 1BBDH 4U7SA 5FM8A 1OPGH 4WJ5A 1W0WB 1AY1H 1R24B 3EYFA 4XVUC 4FFWD 5FYKE 5ESAA 3QIUD 4QXWA 4JFFD 3WV0A 4HBCL 1ETZA 4JFQA 5ALBH 1BD2D 4RNRB 3QJFB 4ETYA 4HK3J 3WLWC 5ACZA 2PNDA 4NO0A 4JAMB 5CEZL 4X99A 3RVVD 2Q1EA 5ACMA 2EKSB 2VDPL 2CR3A 1I8MB 1CL7I 4JE4B 2DQTH 3MUZ1 4HWZB 3QNXA 2XKSA 3X12B 3QG6A 4Q0XH 1UM6H 5HHQA 5F9WC 3NZHL 4JRYA 2C4XA 2A74A 1G7QA 4YXKH 4GS7C 4QTHB 3BQUC 1HZHL 1N59A 4QLRA 4ETQB 4M3JA 3S3PA 4WY7L 2F53D 1S9WB 5FOBB 5EORH 2XXMB 3L5HA 1YEKH 2J8UE 4Y88A 1XF3B 3ZT6A 1GC1C 1OT2A 4HKZA 4EBQH 3OSKA 3PV6B 1QYGL 4UINL 4DVRL 4OD3L 1BMGA 3DMMA 2X4UA 2R2HB 4HIXL 3G6JE 5CLWA 1JI1A 2JK5A 3QIUB 5DD5L 1X4YA 2GK0B 4MWFB 4JFFB 4PGDA 4L3EA 4H25B 5TH2A 4PRDA 3VRJA 4FTVE 4XT1C 4LPWA 3TBYB 5FUOL 3VGGA 3B83A 4HK3N 3BPCA 1NL0L 4NQCE 4DKFL 2VLKD 3WL9B 4M9PA 1QACA 2BRRH 4PS4H 3TFKD 3LQMA 4POZD 5DGQA 3DX9B 1I1RA 1XZ0B 3EOAB 5JA9A 2R15A 4RWYL 1MJUL 4HC1H 3FT3B 5ICZB 4U1HB 1OAQH 5F70A 4HGWA 1TJIL 1MRDL 2C3VB 1KXQE 2Q7YB 1OCWH 1XIWC 1ZLVK 2F53B 5E6ZA 2COQA 5F3BA 5EU7C 3ARBC 3AREC 2IPKA 3MGOB 1I7TA 4GQ9L 4XPTL 5FO7B 1E4JA 3BZ4A 3IXTA 5JZ7D 3BEVA 2QQLL 4EXKA 4LCIL 3DGCR 5DQJB 3IJHA 3NAAH 4CDGC 5CKAA 3KLAB 4M48H 5IB3A 5KVEH 5IMKA 4ZFFB 3ZMRA 4H20L 1Y18A 4JG1H 1T2XA 3CH1B 4G9FA 5E9DD 3W0WE 4Z76B 2GJ6D 4OLVH 4QTIH 2DTMH 5LGJB 2VDMH 4ODHL 4NZTL 1SQ2N 2VLKB 1RVFH 3O3UN 1BHGA 3FOMA 1M05B 2AEQH 5DC9B 3KYAA 3KXFE 5D72L 5E2VL 3S34H 1CFVH 2EYTA 1DR9A 3BHBA 1LO5B 5C0AE 5T33H 3HUJA 3GJEB 4ZAKD 4YK4C 2DQEL 1YN7A 3GHBL 2Q76A 3VXSD 4JG0L 4Z78B 3VJ6B 4CJ1A 4JGMA 3HAEA 3SKMB 1DE4A 2HTLC 5DK0B 2O61B 4RSVA 3PWVA 5F21B 4G6KH 4NO2A 1F11A 2BY3A 1DUYA 4D9QE 4HH9A 4LOUC 2GUOA 2I24N 1ND0A 4O2FB 5HYEA 1INDH 5IKCA 4MNHA 4PJ9D 5E9DB 5HI4C 2VDKH 3KR3L 2GJ6B 2QLVB 1FVEA 3P4LA 3TLRA 4CN1A 1P4LA 5HHMD 5L2KA 5GHWH 4NQSA 3SE9L 4P5KA 3T4YB 2BX5A 5A3IC 2VQTA 4U4BA 3QFJD 1GGIH 5GISL 1VSCA 3QUYD 3JV5A 2UVEA 1CLZH 3IRPX 5JPNA 5HHOD 4F3FB 4MAYA 4W6XB 5FYLL 2X4NA 4KKBC 3ORJA 4YQXH 3WJLC 3WN5A 4KVCL 4ZAKB 4F7CA 3L3KB 4OZ4A 1A1NB 4J1UA 3VFTA 1G7MA 4UNUA 3A67L 5FO9A 3U0PB 4JM2A 4IHOA 1BREA 1IKNC 1XGUA 3C60C 1LD9B 2I60H 3ZE2E 2FBJL 3DX6B 3WO4C 1XF1A 4JN1H 5D1ZD 5CSZA 1JN6B 1U6AH 3TYFA 3CU1A 4PJ9B 4L9LB 4JFDA 1NFIB 2QQKH 3HZVB 3P0YL 2GYSA 1RMFH 3CVHL 4X7EC 4LDEB 1JPGB 5KVDL 3UPRB 5HHMB 3W11D 4WV1C 2ZJSL 2BVYA 3TO2B 2IQAB 1YJDC 4CN6A 4JPWL 3TJHC 1I85C 3DHMA 3FQRA 5B3JE 4L1DA 2CIIA 1E4WH 3QUYB 4MD0A 4GUPA 1AGCB 4KU1A 2G60L 1Z9MA 1EEYB 5F8QC 1QP1A 4P46C 4PY7B 3PWLA 3UPAA 2ZSWB 4UQ3A 3QO0B 4X7TB 1MHCA 4JFEE 4KRPD 3AM8C 4S1DD 5E95B 3MLTA 4YNYA 1CQYA 5E8EA 3DGGA 2E9IA 1IGTB 4DFHA 2E7LA 4Y4HC 2VZ3A 4LK4A 2MCG1 4JO2H 5F96H 3FQXB 1N5AA 1RUPL 3IDYC 3IDNB 3RIAK 3ILPB 2NY5L 4LHUB 2JJUA 5D1ZB 4U6YA 5B38G 3ULVF 1FYTD 4ZUUA 1NUDA 4YDJB 4JANA 3IJYA 1I9RH 3RJQB 1KPUB 3U83A 5KSUA 4N8VA 1A7QL 1MIMH 4HULB 2OMNA 4BZ2L 5GZND 5CD5C 3NCCB 3LN4B 2BVQA 4K3EL 2BNUB 4JZJC 3MFFA 1I1YA 1GGYA 1KELL 5KSVA 2DLTA 3IFPB 4NHCH 5DHVA 4DAGL 2XZCL 2FZ3A 3R8QA 1FG9C 3EGSA 4JN2B 5DO2C 4G8EA 4J4PD 5KAQF 3WSQL 3V79C 1AE6H 4RQQA 1OSZA 4POUB 5EBGA 2EEDA 1IGFH 1H0DA 3VRIA 1PLGH 3PWPA 4QHLA 1ZA3B 4JQXA 3WHE0 5I1JH 4KMTH 1KIPB 2F19L 3GKWH 4A2MA 5EZOH 3OGCA 3PGCA 4R90H 2YRZA 3O3BA 5ID0A 5CFHA 1HQ4B 3TZVD 1PZ5A 4KK8D 2Y5TB 3BIBX 2E5EA 1FYTB 4X5XA 2O5YH 3WFBL 4TVPE 5DK3A 1I75A 3FFDA 4GW4B 3GGWA 3EOTL 3JZ7A 3HFMH 1KIRB 4NYLA 4PV9A 4Z18A 1RUAH 1UQSA 5E6IA 4YHMH 4YXLH 3SGKA 4KDWA 4HS8H 2IFGA 3CXHK 3HC0B 4OZIE 1JUFB 2EE2A 4QOKB 2Z8RA 1YMMA 2DL9A 4NN7B 4X7CC 4HHAA 4XWOC 3MLWH 1H9VA 5JXAH 2BY1A 4LQFL 3C8KB 2Z35A 1Q0XH 3RWFA 4Y19D 1FDLL 1AQKL 2R0LL 3MYJA 4ZPVA 5IQ9B 2AKRB 2XNAB 3B6SB 4PJIB 4U1KB 1QLFA 3U30C 5K9OA 3BVNB 1U58B 1GOGA 2AEIT 1BVKB 4RGOH 3KYMB 3SGDI 4F7MB 2A83B 5GRUH 1J11A 2HVJA 4PGBB 4OV6F 3VG9C 5I73C 5IK3A 3TZVB 1LO0H 3MLUL 1FCGA 2NNAB 2OK0H 3VRLE 3ET9F 2YD6A 2YUVA 4PTTA 4YGAB 5D1QD 5TF0A 3UDWA 2F58L 5MP6H 5DUMH 1DQQB 4N8CL 3AUVA 5TQ0L 1KF9B 5HGAB 2EICA 5TQ2L 4BFEA 2Q3AA 4YHOL 5F7KC 1EO7A 5C0DB 4WI3A 3MACL 3JWOC 1Q0YH 3FN0H 4NGHL 6FABH 4U1GC 1YPZF 2ADJA 2EYSA 1MPAH 3CVHA 1TETL 4RMSA 4Q6IC 4HGMA 1WBZB 4YO0B 4G80A 4RISL 3RVWD 1MCCA 2D7TH 2XKUA 4XCFL 5FCUH 5H37G 4Y19B 2QQQA 3VFVB 1MQKH 3IFOA 1I8IA 2UV3A 3QIBD 3TIEA 4H8WH 1IT9H 1MI5A 1KTDB 1QPPA 4M7KL 1CR9L 1CF8L 1CK0H 1PFCA 1R5VB 4IRZL 3KPPB 1OTUC 1NGZA 1IGJA 3NPSC 5I76A 2DM4A 4HKBB 3NN8B 2H3NA 2VR9A 5D1QB 1XGQB 3KYOA 5IHLB 2EKJA 4BELD 2QSTA 4YDIH 2Y6SD 5AD0B 3P2TA 4X6CE 4PRBA 3PWUA 2RBLA 3QWQB 4UT9H 4H5SA 5TGBB 5IF0A 5HGHA 1NQBA 5K9KA 2CGRL 4HUUB 1FFRA 3QT2A 4OT1L 2VH5H 3DV4A 1WTGT 3GUTA 4EIGB 5DVMA 4M8VA 4PLJD 3G04A 3FO9B 4TNVF 2YPKA 3LKNA 5HYJD 4IIQA 3OPZH 2MFNA 3O6LL 4HFWA 1ZLSH 3FB8B 4MA8L 1CICA 5C0CD 4Y1AD 3RAJL 3RDTD 3MJ8B 4GRLC 4HZLB 3QIBB 2F74A 1II4E 2UZIH 4ZUWB 4ODTL 4WUUE 1KJ2A 3UTTE 5CEYB 2CDFA 5JW4Q 1OSPL 2VXUL 2BSSB 2J12B 5DQDL 1N6QL 1JGEB 3O3DA 2YBRA 3FFCD 5HJ3A 1NBZA 1LO4L 4PJ8A 2XWTA 3T77A 3BZFA 2EIZB 3BGMB 1LE5B 3MRRB 1UH4A 4ZMAT 2J4WL 4I48A 2VRAA 5DEZA 3LEVH 5CBEB 1DANT 2NW3A 1IAOA 3K80A 1IGIL 1VCAA 4KC3B 4OCWH 4U6VL 1RUML 1F58L 1B2WH 3GMRB 5HYJB 4HXBL 1OQXA 3UJJL 3ROLA 2NY4D 3JSSA 1ZHBA 5C0CB 3UJIL 4G3YL 4JY6A 3DRQA 5IW1B 2OP4H 1GZQA 1NDGA 1VERA 2R0ZH 3LKOA 4F37K 5J57B 2BCKB 5T3XE 1V3KA 4LLVA 3IDGB 1EDQA 3PHOA 4WEUD 2AK4A 3QIWD 4D94A 5EIIB 4X6DA 2G75A 5DUPH 3FFCB 1BQSA 2DYPD 2X9YA 1Z2KA 4OLUL 5J56B 4DOHB 5LJYH 3BMVA 5INDB 2V5YA 4URTB 3ZE0E 3MQIA 1SEQL 3OG4B 3UTSD 3DURB 2UY6A 1DSFH 3MPCA 1TPXB 2OXGA 3QXDB 1PEWA 4OTXH 2IJ0C 1GSMA 4AJ0A 1UWEL 1VGKA 1FYHB 4O02H 4G6JH 5D7IB 4KTDL 4KTYA 3RWJA 4HWBH 3SE3A 1TJGH 4ISVA 1T04B 3U4EA 5DMKA 4JRYE 1EGJH 2NY4B 1N0XH 5JDSA 2DD8L 1U0QA 4KUCD 2EO9A 5FA4A 1ACZA 3SDYL 5DLMH 5CZVL 3S35H 2GCYB 1C5CL 2NY2D 3VXMA 1RJZA 5B38A 1MRFH 3AB0B 5E5RB 3QIWB 1G9MH 2YC1B 5FGCB 1S7WB 2GHWB 3MRMB 4RGND 1IL1A 2DYPB 1JNLH 3PP3K 3V0WL 5DZOA 2R2EB 5CJOL 2BJML 3VDAA 4L3EE 3K1KC 1KT2B 1B6UA 3UTSB 2EH7H 1S8DA 2FYYA 2R4RH 3FONB 1DL7L 5KG9B 3N9GH 1H3TA 3BP6B 4Z7NF 3N85H 3I6GB 2GTWB 1F2XK 5DR5L 1HCFX 1RZJH 3EYOA 1H15B 1NDMB 1QFWI 1IFHH 2IPUG 2RHEA 3I2CH 2Q86B 4O58L 2H6PA 1XCQB 2Q8BL 4FZ8L 4WI9A 1B88A 2BMKA 5FOJA 4RFEA 4MQSB 3QIUC 1D5BB 2ICWA 3PP3H 2NY2B 3GI8L 4P2QA 3LD8C 5F88A 3QDJE 2A6JB 4QT5B 3ES6A 3GNML 2AJ3B 3NTCH 5HYSB 3W9DA 2D31A 4PJ7F 4RGNB 3RVVC 1A6TA 1AGDA 3V4UL 5DSCB 1LK3L 1HCVA 3TH3T 5DJ2B 4YPGA 5CJ8A 2UWEF 3MRIB 1MVUA 2AXJA 4G9FE 1C12A 5HGDB 4ZFOB 3HMWL 5E2UL 3SDAB 2BVTA 2FJGB 5EC1A 2DLEA 3U7AA 4Y5XB 4CMMA 3EJZC 1QA9A 1JNNL 2JJVA 3DLQR 1BECA 4D3CH 4PG2C 5FECB 4R26L 3BGFB 4BH7A 1MLCA 3ULVL 5DMIL 4P57B 4PGCA 1I4FA 4YC2B 3DROA 5DZNA 3ARSA 4IRJA 3GO1H 3HUJE 2VTFA 4FQIL 2YSSB 4OBRA 5CZKA 3E2HB 4NFCA 3PWJA 3UMTA 1A9BA 3QDAA 5LGKA 3X3GH 4PG9A 3THMH 1KN4L 2BRQA 1T1ZB 2JB5H 1TZIB 2B4CL 5IHZB 1Q1JL 3SOBH 5K9QG 3HE6D 1ZVHA 2KBGA 4XMLH 5E94A 3UP1A 2JTDA 1J0ZA 3TFKC 1SJXA 3WKMH 5F9JA 3OXSA 2WINA 4G6ML 4PTUB 4KDTC 2IBZX 1DQML 4POZC 2RAMA 4QYOA 4JB9H 2F8VA 1OARH 4ZFZA 3RNKA 1FLRL 4OSUL 4DGYH 2FD6L 4LIQL 5BW7C 4X7FC 4UBDD 1ES0A 1ZLWK 1AIFA 3L7EB 4XPFL 5L2KE 1FNAA 1HHJA 4NQEA 1Q38A 5JZ7C 1P2CB 1KB9K 5TPWL 1U8HB 2NZIA 5T1LD 3FTGA 2AEWA 4HJJL 5GS1A 5DMYA 1WZLA 2Y72A 1E4XL 3FHQA 1PG7H 1DBJH 2FATH 3QUZD 5I19L 3DO3A 2F54A 4NQVA 1AKJA 4CADA 3CXHJ 4ONFH 4PJEB 5TDOA 5ACLA 1IILE 3EO1A 4X4XA 4P2RA 1BX2A 2XY1A 1H3VA 5AYUL 4MA3A 5ADOH 2HWZH 2BDNL 1MLBA 5K93A 3Q3GB 1FJ1B 5I1HH 3QRGH 1I1CA 2HVKB 4DFIA 1OL0A 3HE6B 3HI5L 2ESVA 4X5LA 3OKEB 4I18B 4Z77B 2VISA 3B9AA 5T1MB 1ZLWH 2JLLA 1KV3A 3FO1A 1F8TH 2V7NB 5D5MA 1FHGA 1R3KB 1NGWB 1S3KL 3BQUA 4G7VL 4NNPL 4JFDE 4K23L 4N0RA 5E4EB 5I2IB 4PV8B 4ZAKC 2P5WD 5FV2A 4MZ2A 4HMCA 3OKMB 5GRXG 1PKQA 2BERA 3PWNA 3Q6GL 1T89C 1KENL 2ADGB 4WEBH 4CL7A 3QQ3A 3CC5A 3OB8A 5T1LB 4PRNB 5JUEH 1HINH 3T0EE 5EO9A 4XPHH 3KYNB 5FYJL 1LE9B 4I8DA 1GH7A 3BKJH 2K3TA 5D6DA 1S7VA 2P7TA 1F13A 4PJ9C 2DAVA 4L9LC 4LLWB 3VGEA 1UCBL 1RD6A 1JPST 4FFYL 4PB0L 5DK2B 3KPRD 4P2OD 5BV7L 2D9QB 4F7TA 2AS5M 5HHVL 4WRLA 5EFIB 1RAMA 1DBAH 5JTWA 3FJTA 3BDXA 4PJCA 5JLZA 3QUYC 1ZGLP 4S1QL 1U8MB 1DVFD 3QEQD 3R06A 2IAMD 5DD1L 1KC5L 4G7YH 5BVPL 3ARBA 3KPOA 3AREA 4X8XA 1X5GA 4ZTOH 3VE0A 3H9HA 4HX1B 4E0RB 2P24B 2P5WB 1U8OB 3ARRA 3C87A 4AM0A 2NY7L 4KI5D 1GZPA 1L7TL 1T66D 3V7MA 1XF5B 4U7KA 3H9ZA 3IXAA 2WWMD 2J5LC 3J7HA 3O2WL 3CFCL 1QSFD 1XCTB 4C56A 3P4OA 3F58H 3OKLB 3CSPA 3EZJB 5LWYL 4QEGA 4F7EA 5IM7B 3QCVL 5FF6A 2FO4B 2OJZL 3QG7H 3V6ZB 4NPYB 5D1ZC 4PB9L 5GGVL 5KVFL 5HI5D 1SY6H 1MFDL 3O81A 4U1SA 1EA9C 1NCDH 1DLFL 5E8PB 3N1MC 2JCCB 4XX1G 1DQJA 3KPRB 4P2OB 3MCLL 3VFOB 1VA9A 3OKKA 3W11C 4Y4FD 3FMGL 3PWPE 5EBWA 2X4TA 3S88H 1C7TA 4I77L 2YMXL 4H8WC 4P0DA 1OAZL 1A1MB 3BEWB 2IANA 4ODWB 5JQ6H 4YE4H 2YD8A 5C08A 1G84A 4Z5RB 1DVFB 3MODH 1P4IH 4OZFB 2IAMB 2PR4H 2FJFB 4ZOBA 1TZHB 2VNCA 1MHEA 2AXFB 1IGMH 2WW8A 4YGVA 1J8HE 1XT5A 1M7DA 2B1HH 4E41D 1KPVA 4OZHB 4S1DC 1AI1L 5EZIH 5CEXA 3T04D 1SVCP 2I25N 4LSUL 1IC4H 1QSFB 5IB1A 1YMME 3BO8A 2FNBA 4NO5A 35C8H 3BAEL 3RZWA 3TWCH 4LRNH 1ZV5A 1TQCB 3RIAF 3L3OA 4U33A 4Q58C 4GRWB 3CFDA 1I3UA 5DEFB 5DWUL 2VDQH 2W91A 1IM9D 4XCCH 3BKMH 1ORSA 4GG6E 4LDLB 1A6PA 3QXAA 3P73B 1CLYL 5GZNC 5FYLE 1J1PL 1S7XB 3MXWL 3MBXH 2YXFA 4MDIB 1LDSA 4OLXH 2Y5EA 2R4SH 3MSPA 5E1AA 2JJTA 1NC4D 2ARJQ 4J4PC 5GSVA 4MYWB 4RMTA 3L5WB 5EWIH 2VE6A 1CZ8H 4E41B 3ZDXF 3HG1A 5CIPA 3LVEA 1IKNA 1T21A 2ATKA 3C60A 1CI5A 5D7JD 3STBA 4RFOH 4NCDA 2XWBA 4UTAL 2VAAB 1OF2A 2IFFH 3MJGX 4HIHA 1ZVSA 2ITDA 2X4QA 5JQHC 4UDUB 1RZGB 1FAIH 3S7GA 4MMZC 3TZVC 5D7SL 4KK8C 5DJZA 1TZGL 2ZCLL 1T0MA 1T03L 4DN4H 4R3SA 2ZOLB 4WV1A 3V7AG 3CJJA 2R29H 4LCYA 5B4MD 3BFOA 3RNQB 6CGTA 1I85A 5C0BA 3K2UL 4ZUVA 1SJEA 2H26A 2FEDD 1EHLH 5EIVA 4K7PX 3WFEL 2C26A 1A0QL 2UYLA 4KWUA 2YD1A 4HEME 4IDJH 2HYMA 4Z7UA 2BHZA 4HKJA 4RX4A 1NC4B 5DYOA 5DFWH 3P4NB 3AM8A 1NGYA 1OPGL 3M1BA 1DP0A 4MNQB 5T3ZE 4JGJA 4WFFD 4OQ1A 3VFWA 1DBMH 2VLMD 1G1CA 4G9DA 5DXWA 5D7JB 3TT3H 5TDPA 1A1OA 3HHRB 4RAUA 1BJMA 3DIFA 4G8IB 1J05A 3HI1B 3RUGE 1YEEL 1CFQA 1Q9KA 4WI4A 4OB5H 3ABZA 3U7WH 1DLHB 4DGIH 5DJ6A 1YNKH 3L6FB 3T4AB 5D1QC 2DQTL 3RGVD 2PYFB 4JZJA 2R39A 3B5TA 3BKYH 5ISZD 4JDZB 1PX4A 4YHLL 4D9LH 2EDQA 3QA3B 1ZE3C 3NIFF 4YXKL 1CFBA 1MJ8L 3MNZB 3KJ4B 4LPTA 1XR9A 5L2JB 2OR7A 1G9MC 1V5JA 4GRWH 4MJ6A 3U46B 5IUSA 4TVPD 4M5YL 3VFPB 3Q5TA 5MHSE 5MENA 5GRJL 2NX5D 2FCBA 3O6KH 3OR6A 1DJSA 4P5MB 3RVWC 3QWRA 5ERWA 3DXAA 5IJVA 2VXQH 3WHXB 3QIBC 3MYZA 2I9TB 3T0DA 3KPLA 4LLAA 1L0XA 5ESQB 2XTJD 3DVNA 2A1WH 3T0XA 4XZUA 4QHMA 5EU6E 1I9EA 3DX8B 2EDRA 1LP9F 5J6HA 3X13A 5GIRA 2R0WL 2QHLA 2BVEA 1RZJC 2HA1A 4UT7L 3IU3A 5DJ0B 1FL5B 4V1DD 3D39D 1UZ6F 2VXSH 3TJEL 3WFHB 1RZKH 2VR4A 4NM8L 2DQCH 4PS4L 3IVKA 3FO2A 4LVEA 3RGVB 4JDTH 5DUBB 5ID1B 2JKXA 5ISZB 4FZEL 2AK4E 3PHQA 2F5AH 1OAQL 5DHYA 4X6DE 1IGYA 1UVQB 2H32H 1OP3K 2B7DT 3IDXL 4U1JA 1DDHA 1ZGLM 1GGTA 3SE8H 4TN9A 4PLJC 2GJZA 4MDJA 4AQOA 4L29B 2DQIL 3CMOL 4NZUH 4PUBH 2NX5B 4LPCA 3HR5B 2X2YA 1T20A 3NH7L 3KWWB 3VXNA 3RBSA 3F12B 1GCFA 3MNWA 1VEPA 4M48L 5DD3H 1V05A 3QZWG 5L8JB 1NAMA 2XTJB 5HY9B 1MOEA 1MH5B 4XTRD 3MR9A 4PY8J 1F4AA 2VDML 1RHFA 1IAKA 4I13B 1J5OH 3HZKA 4V1DB 3D39B 1I7RA 5IP4A 1ZANH 1OGAD 3TESA 2Z4QB 4EI5D 2AEQL 3MLVL 3LN5A 4U31A 3VXME 3S34L 2R1WB 1TPXC 1F6AA 4YFLI 4RFNB 4GKSB 4M43L 4R96A 1VB9A 4JM4L 2Z9TA 4Q6IA 3NCEB 2ZCKH 2XFXA 4JFZH 1FL6B 4F15B 3BDBA 4WGVB 3MX0A 3RY4A 5AUMB 2NY4C 4LCCB 2MTPA 2V7HA 4UV4H 1J86A 4G6KL 4N0FB 5DJ8A 2QQNH 4P9HL 4LARH 1X5IA 1WCBA 5H35A 1M4KA 3AB0C 4Z0XA 1NEZB 5I1KH 2AAVA 3DRTA 3LHPH 3QIWC 1NLDL 1FBIH 5IESL 4PR5A 5J9PA 5FUCE 4KJQD 4XBGA 1ORQB 3N1FC 4HCRH 2VAJA 1OGAB 3BZDA 4EI5B 1N3NA 3ZO0A 5JW4R 3DVFA 5E00A 1QG3A 4P2QE 2ADIB 4ELME 4JVPA 2PW2A 3LRSB 4QY8A 1T5XB 3UTTD 2ZUYA 2W60B 2C1PB 3PJSA 5IVXB 3TNNB 2IGFH 3AAZA 4MJ2A 2WANA 1G7HA 4S2SA 1UA6H 2X1WL 3JVGA 1WBXA 4KKAD 2AVGA 1K6QH 1YC7A 1DN2A 3QQNA 5FA3B 4KY1L 1C5DB 1A7BA 2AERT 2HT4D 3REVA 3MMEB 2EDXA 4LHJB 1QFOA 4Z7OF 3BE1H 4N9GB 4O2CA 1RHHB 2NY2C 4LSRH 4P9ML 1S5HB 1LO2H 4Q97A 4BH8B 3PP4L 2DIAA 3MGTB 1RMFL 4RGNC 1WLHA 4TVPH 2BNRA 2VYRE 3SDXF 2R1XA 4PJGF 1CGSL 2ZKHL 1RV6X 2LU7A 1CXLA 4NKMB 4TQEH 1NEUA 5L6YL 1GJIA 3MV8A 3I6KA 1VEOA 12E8H 5T1KA 5IB4B 2GTZA 3U2SB 2UWEA 1T1YB 3SDAC 1WFNA 3TBWA 3CXDH 5KSBA 1HIMH 5DRWA 3RWEA 3ALPA 4Y5XC 3O6FD 2BVPB 5IB2B 4K7FA 4EI6B 5F3HB 3BGFC 3WHE1 1F4YL 1BVLA 4JPVH 4YC2C 2QR0A 1RZIB 2Y36H 1JHLH 4HC1A 5ETUA 5IWLC 1C1EL 4OF6A 4ZOEA 1UZ8B 4HS6A 1XR8A 5C0ND 3E2HC 3LEXA 3B9VA 2C3XA 3QHZL 4NQEE 2ED8A 4PYHA 3ZHKA 2APFA 4OAWA 5C8JA 4IOSD 2A6DB 1V8HA 3S37L 3V4PL 1AQDA 1EEZA 2PKDA 4XNQA 4KGJA 1K8DB 3MRHA 5J6GA 2EXWD 3CH8A 1H3PL 1ADQL 1T2QL 3SKJH 5MEPB 5L7XH 4NHCL 3FZUD 4P2RE 3C8HA 1HEZB 2AQ2A 3VXRD 4TRPH 4DKDC 3HRZB 3X14B 5KBNC 2W9LA 3O6FB 4WUKH 1GRWA 1P7QA 1W0WA 2YD2A 5JR1H 3HPLA 4NN6B 4QXUL 1R24A 3W81A 2ESVE 4JKPL 5HI3C 1JRHH 3WKNA 1MFEH 1MEXH 3QUKB 4RMWA 4J3WA 2HFGH 1F4HA 5D5ME 3RL2B 1PLGL 1NMAH 5JW5B 4NJAH 5I1JL 1SEBA 4KMTL 3GKWL 1U9KA 3QJFA 1TTUA 4JR9H 1QFPA 1PX3A 4CU6A 3RVTD 1CE1H 3T0WA 2X42A 2O5YL 3NCJH 2EKSA 1P1ZB 5GRZA 1CD8A 5ICXB 4HWZA 3EDFA 1T0NB 3EYQD 4QF1B 3HFML 3X12A 1WQVT 4I0PD 3HE6C 5HVHB 4YHML 4KRLB 4I18C 4LVHB 1P7KB 2HLAB 4HS8L 1DEDA 2LVEA 2GI7A 4Z9KB 2V5MA 4KVNL 4MJID 4QTHA 2D0FA 3LKSB 1FRGL 4H88H 1S9WA 3QDJD 5FOBA 1H5BA 1XGRB 3CDFA 5E4EC 5KS9B 4UBDC 2CK0H 5JXAL 3VXRB 1XF3A 4AMKH 4JFXB 5DJYB 3MRNB 3TYGL 2WIIB 4PJCE 1JGDB 1JPSL 2FECL 2OL3B 1HHGB 2SEBB 5LAXB 2ZUUA 1DFBH 4MXQD 3QIUA 5F6HJ 2CKBB 1FH5L 1OLLA 2GK0A 5GGUB 4MWFA 4JFFA 2DQHL 3MV9D 5EU7E 1X6NA 1BD2A 5GRUL 5C0GB 3C2AL 2YEZA 3T08A 4P4RA 2OK0L 4X9IA 3SGEH 1MCOH 1NFDA 1N5YH 3RPKA 3SY0B 3VH8B 3WL9A 3S8WA 5DUML 2R1YB 4C56E 5E08H 5D2NE 1CT8B 1NJ9B 3UO1H 1NSNL 5K9JH 1XZ0A 1FNGB 3EOAA 1NGPH 4I0PB 1JMXA 3FT3A 4UQ2A 4U1HA 5ICZA 3RWIA 3RWCA 2YUZA 1Q94B 2Q7YA 5ANMA 4MJIB 1KCRL 1Q0YL 3MLSH 3UTPD 4OF7A 2F53A 3TBTA 1FL3B 4WI7A 3MGOA 5FO7A 1D5IL 2O93L 1GL4B 2CIKB 1XGPB 4F58H 1F4WH 4PG2A 1LWRA 4OCYH 1UXWB 1MQKL 5DQJA 5C08E 3KLAA 3VI3E 4H8WL 3CK0L 4FNLL 2NLJB 3RI5F 3CH1A 3IDIB 3MV9B 4RA0C 2MMXA 4XAKE 1T3FB 4QXGH 3GBMH 2VN4A 5I8OL 5IOPB 3P9WB 4XBEH 3KLDA 2DQJL 1U3YA 3H7BB 4HGKC 4LAQL 1DQTA 4P2OC 1M05A 3MXVL 2HKFL 5KSAB 4KDTA 4U3XA 1FPTL 3BWUC 5BZWB 1J87A 3T2PA 3B9DA 1FE8H 1DVFC 3WIIH 5BW7A 2B2XL 2IAMC 3G5ZB 3W5NA 1RZFH 3DUSA 3Q2CA 1OLZA 1G7PB 3ILQD 5D2LF 1S7SB 2IALB 3VJ6A 2WWKT 1I8LC 1ZLSL 2VABB 1INQB 1LO3L 4DTGL 1WBYB 4KI5C 5SX4H 5DK0A 1T66C 4P3DA 2H2SD 2WWMC 3GMLA 3G5YB 1N0LA 3QNYA 1KTKE 1R0AH 4O2FA 5HHNB 1CD0A 3S36X 1QR4A 2NTFB 3PABB 5E9DA 1TQCC 5GPRA 4U1LA 1XGTA 4PGZA 2FIRT 5HYIA 2Q7NA 5HI5C 2BP3A 4HQQH 1CFSB 5SWQB 2I5YH 5I16B 3T4YA 1ZS8B 2OL3H 1J0JA 4YFDB 4Y4FC 2FR4B 4NQDA 5IQ7H 1T0PB 4S11A 3G6AB 3T0ED 5JDJA 1QSEE 1JNHB 2CKBH 4GKNA 4F3FA 7FABH 5C92A 2YD9A 2ICEB 4M7LH 4ZAKA 3L3KA 4MHHG 3VXPB 4KZEH 3VXSA 2J6EH 2E27H 1T89A 4Y4KD 1JGVH 3U0PA 1RZKC 1A9EA 1HHKB 1LD9A 1U8IB 5LVEA 3DX6A 1OB1B 4N8PA 4NWTL 2KL6A 4NC2B 5JIIA 4L4TD 3D9AH 3P9MB 1JN6A 5GGQH 3B3IB 2J8UF 4PJ9A 4L9LA 5TE6L 2EEBA 1NFIA 3HZVA 3BN3B 4AY0A 4JO1L 3UPRA 3K46A 4EUPB 2FB4H 3VFRA 3G6JF 1BIHA 4HUWB 1V7NL 2IQAA 3QAZB 4MGXA 3QFJA 4MB4A 1ZGLA 4L3CB 4PGJA 1AGCA 4XBPA 4M7JH 1GYAA 4G6AD 1EEYA 5HHOA 3GSOB 5D6CB 1WSST 5TE7L 3O6ML 4KRMB 2ZSWA 4YHZH 3QO0A 4X7TA 5C0EB 1QQDA 1RZ7H 1WICA 4XCNB 1T7YA 1U3HD 1ZAGA 4YHNA 4G6JL 2NMSA 1KLUA 3HE7B 1NMCB 4HWBL 5D1XD 4QRSA 2PCPB 4Y4KB 1JL8A 1IGTA 3BESR 1MNUL 5D7JC 3FQXA 4JFOB 1CFTB 3IDNA 5IHBA 3EKCA 3OX8B 3ILPA 4PRID 1ZSDA 5D1ZA 4L4TB 3L5JA 5JORB 2APXA 3O45A 4O2EA 1KULA 4MXWH 4ZSOB 1U8KA 1MCJA 5MENE 1G9ML 4OCSH 1I7UA 1U91B 3TBVA 4YDJA 5CINH 1IEAB 5I18L 1D6VH 1KPUA 2P5EB 3V2AR 1JNLL 2YRLA 4I3RH 5B4MC 3N1PC 5FGBC 4PJHE 2PETA 3LN4A 2VIRA 1X5ZA 2WBJD 3HB3D 1C5BL 3ARWA 2PO6A 2FEDC 1RFDL 3KYKL 3KJ4C 5I30H 5ITFB 3WS6C 3H9SB 1A4KB 1JZ4A 5D1XB 3UYPA 1F3JA 1A6UH 1S9YB 2R2CA 3CFBB 5CLTA 5C9JB 4OM1H 4WHDA 1ZA3A 4HG4K 4GAJL 3QEHB 4PRIB 3IJSB 5CBAB 4R6UA 2MWCA 2ZUQB 4XXDA 5EOTB 2C4FT 4JQIH 1FYTA 1NANI 1HNGA 1TTFA 1KPRB 3BSZH 2J2ZA 4QXTA 4X0KB 1PEZA 4GW4A 4K3DH 1SJHB 2H45A 1KIRA 3S35X 4HJ0D 4MMXC 1Y0LB 3K0WA 4V2CB 3B9KD 3U82B 1CXEA 4GBXD 3RGVC 2WBJB 3HC0A 4JPIA 1JUFA 2BSTB 3L3HB 2G9HB 3I84A 1DQLL 4BUHA 4K9EL 1PBYA 2VWEC 3VDCA 1TCRB 1F3RB 2YA0A 5F1NA 1MCIA 3C8KA 3QCUH 1BOGA 4EUPH 2OR9H 5IQ9A 2A2QT 2AKRA 2XNAA 3MLYH 5IBTH 4PJIA 4U1KA 5A2KH 1M71B 1BM3L 4I9WD 3X11B 1U58A 1U8JB 1BVKA 3QDMD 5B39B 2A83A 2FIKB 2XTJC 1WC7B 3RVXD 3G6DH 5LG1A 4PGBA 3TZVA 2HJLB 4JRXD 4AG4L 3ZZ1A 3AS1A 2JB5L 4YAQB 4W6WB 1DQQA 1JZ5A 3ZE2F 1DUZB 2L7UA 3SOBL 2DICA 4KK5D 4XMLL 4CVUA 4HIIA 1K4CB 1HHIB 4HIJB 3B9KB 5C0DA 4EZMA 2JJSC 4U1MB 3OMZA 1OARL 4LLUB 5D7KD 4RFNC 4M1GH 1U8PB 4F8TA 1KG0B 4R2GD 4LASL 1G6RB 3V5HB 4LP5A 2Q6WB 4W81A 4YO0A 1W0YT 5CHNB 4XWGH 3W5MA 1X6LA 4Y19A 4B5EA 2VLJD 5B3JF 4F15C 3WO3B 4PGEA 9CGTA 1FFOA 4LCCC 5DRZA 3G5VB 1KTDA 1R5VA 3C08H 2VITB 3ARPA 3QDMB 2FATL 5FGSA 3HLAA 1UEMA 5E8NB 4HKBA 4XTRC 5CUSH 4HWBA 3NN8A 3GHEH 4JRXB 4J12A 2HFEA 1J1XH 2X41A 1XGQA 2VZSA 5D1QA 4BKLB 5I1GH 1EGJA 5AD0A 5I1HL 2AV7B 1FC1A 5EN2B 4EI5C 4HUUA 2B0SL 4YIQB 2KQNA 3VGBA 1E4XI 2JJWA 1YZZA 2DQFB 1MF2H 4WO4D 5EU6D 2YK1H 4KV5E 3FO9A 4X7DC 1OTSD 3CVIL 4UAOB 5DDHB 3QB7C 1EFQA 5DT1H 2BNRE 1UCTA 1WT5A 5AAWA 1MQ8A 3QFDA 3GRWL 3FB8A 3SQOH 4WI8A 2ATPB 1F4XL 2IBBA 4WEBL 2VLJB 3MJ8A 3MV8E 2E9JA 3K81A 4B7IA 4HZLA 5JUEL 3QIBA 1YMHB 4ZUWA 2P42B 5E99H 3E6FB 5F1KC 5KSBE 2BC4A 4XPBH 5CEYA 3TBSB 3M45A 1SYVB 2BSSA 1JGEA 3C5SB 4M03A 5IFAH 4FQPA 3MOBL 4OJFL 4DZBB 4ODBD 1PG7X 4KJQC 3WCYA 3STZB 3ZE1E 1FIGL 3DO7A 4W6YB 3SDXA 3MRRA 1J1OL 4Z7WB 3FB6B 5E5MB 2LTQB 4FQXD 1MRCH 5CBEA 1B9ZA 4J2XA 3FB7B 3MRQB 4WO4B 4UILL 4TUKL 5KJRH 3IF1A 1S7QA 2HJFB 1XH3B 1HDMB 3PUCA 5IIEB 4PJAB 5HYJA 1OP9A 2XG5A 1KACB 2P1YA 2V9TA 4LU5H 3JTTB 3F7VB 5C0CA 4Y1AA 3RDTA 3FOLB 3MV7E 4OZIF 1ZHNA 4JO3H 3UYOD 1WK0A 4IMLB 4OF8A 4X4ZA 4Z0BL 1BP3B 1AR1D 3VWKD 4OCRH 3IDGA 4L5FH 4ZOAA 3QG7L 4OIIL 4E42B 5EIIA 2FJHB 4EDXB 4AIZB 2VXTL 5E2WH 1G6RH 3FFCA 1NCDL 1QLEH 3TT1L 1WAAA 4PJBA 4GMSL 4UTBH 5BRZD 5AEAA 5INDA 3HA0A 1RU9L 3F6IA 4P48A 4PJFB 1Z9LA 2CRIA 2E9WA 4F2MB 3H2WA 5I8KL 5LQBH 4NQTA 2NY1D 4RMUA 5FFLA 3L1OH 4FQXB 3QXDA 1PYWB 3O4OB 2AJYH 5F1IB 3VRLF 3RPIB 3LY6A 1I3RA 2PR4L 4MSWB 3VG0L 1A6VH 2VQ1B 5D7IA 3GBNH 3RU8L 3O6FC 2B1HL 2NY0D 1T04A 5E0QA 4CBPA 4NHUB 4NN6C 3MZGB 3RWDB 3WFCL 5EC2B 1Z9OA 5EZIL 2WWKO 3Q6FB 5DFTA 1JMZA 4JPKH 2XY2A 4KKCD 4NP4L 5FYKL 3MRGA 2GCYA 4FQLL 3FT2B 3VWKB 3SKNB 3GSXA 1SBSL 4K2UH 5AZ2H 3IETB 2R56H 2DQGH 2Y1VA 3QIWA 2YC1A 1BGXH 1S7WA 4QHKI 4XVJH 5KZCD 1T4KB 2RR3A 2DYPA 5AZEL 3PE9A 4XCCL 1I9IH 2L0DA 4I2XA 5BRZB 1S7RB 2ZSVB 5JHLL 1D5ZB 4JFFE 5HVHC 3NABH 4KROB 1YEGL 1G0YR 1KT2A 2VN7A 3OZ9L 1NAKL 3OJMB 4H26B 4LVHC 3FONA 2EXWC 1JI2A 4A6YL 2NY1B 3I50H 4OLXL 1CGVA 3FZUC 5GSRA 3U6RB 5F1SA 2GTWA 3UZVB 2FGWH 4U7MA 5DTFB 1KLFA 1CTOA 3ARGD 3PGDB 4X6CF 1NDMA 2X89D 4AEHH 1CZ8L 2NY0B 2OZ4L 3RIFF 4L8DA 1XCQA 3EO0B 32C2A 3DJ9A 5D96B 2E7MA 2UZXB 2VZVA 1AFVH 4ELKA 5KTEL 3UTQB 5GJTH 3SKOB 1PD6A 2IFFL 5I0ZA 2QKIB 1D5BA 3N50A 4LSQH 1RJYB 2F53E 4GXUN 1CBVH 2A6JA 2J88L 4UMGA 2D03L 1J88A 3RVTC 1FAIL 2AJ3A 2XN9A 1FVCA 5HYSA 1U92B 2MNUA 1QHOA 3B9EA 5DSCA 1B6DA 3T2QA 3EYQC 5DJ2A 5A2FA 1NLBL 1HKLH 5E5UB 4I0PC 1A6ZB 4D8PB 4M6MH 1EHLL 4M3KB 4ZPTB 5HGDA 4ZFOA 3WEXA 5F7DA 3P9LB 1RIVH 3EFFB 3QPXL 2FJGA 2EH8L 4IDJL 3U7YH 4Y5XA 4XVUD 3ARGB 1X5LA 2VLKE 5DURD 3SKUD 5L9DH 1V3JA 3K1DA 5FECA 3D18B 1YYMH 2P8PB 4LLYB 4NUGL 4QHNB 4P57A 4TUOA 5D9SB 1DBML 4WGWB 4HPYH 3DNKA 4MXQC 2YSSA 4LFHD 4AENB 4HLZH 4QRPB 4LF3A 1ZHLB 1D7FA 5JIHA 4OB5L 3HMXL 1DZBA 3MRCB 1NBVH 2A6KB 1T1ZA 3SE4C 1FORH 3OJDB 4J6RL 3OB0K 4DGIL 1TZIA 5IHZA 3ZTNL 5C7XH 4R0LB 5EUKA 2OCFD 2M2DA 4PRAB 5KSAC 3LKQB 4PTUA 3MRPB 2DQDL 4FQQB 1EAJA 3BKYL 5E9DE 4D9LL 3GKZA 4NZRL 3B4NA 3MTRA 5GRWA 2GJ6E 4WI2A 4LRIC 2F8XC 5BO1H 2W9DL 1LMKA 3L7EA 1SY6A 5CP3A 5E24E 4PJDA 2DWEA 3A6OA 4E9LA 3ZE0F 1P2CA 4DQOH 1U8HA 5D2LA 1U3JA 4PJ5B 2V17L 3BWAA 5M95B 1RZ8B 4G6FD 1RSFA 4KAQH 3SGJC 3VXOA 2H8PB 3BGAA 3OB0H 2OTWB 4LCWD 3TH2T 4P2CG 3W2DL 3BP5B 1AD0B 1A6WL 3DV6B 4WW1A 4MJ5B 1ITCA 1QNZL 3A6BL 5D4QA 1IQDA 3ZSTA 5DEGB 3HE6A 1F2QA 3JWDL 3OKEA 4Z77A 1AC6A 5T1MA 4DJMA 2V2WB 3BX7C 2V7NA 4XVSH 1R3KA 1XIWD 1RPQA 3FT4A 2F5AL 1JGLL 5SX5K 4OLWH 5FKPA 1Y6KR 1EO5A 5CMAB 5I2IA 3INUL 4PV8A 5HHME 3P77B 3GSQA 3RJDA 4F33A 5ITBH 1CFNB 3OKMA 3ILQC 2I27N 3LKRA 1OP5K 2KQMA 3EJJX 5C70A 1YECL 1OY3B 5EB9A 4HS3A 5T1LA 1IGCL 4OCNC 4L3AA 5JNYA 2H2SC 1VPOL 5DD3L 1YY8B 4G6FB 5I1DB 1PQZB 3KYNA 1IEHA 4KQ4L 1EAPB 2VZOA 3QUZA 4Q9CA 3HNSH 3BH9B 4LCWB 4ENED 4X5WA 4JZNB 1HYSD 4P59L 4LLWA 1PKOA 2G2RB 4HPOH 1HOCA 2J8UA 3GSRB 2BXZA 3GIVA 3PV7A 4R7DA 4AH2A 5D7LD 1ZANL 5SX5H 1VFOA 3QAZC 1FQ9C 1VFBB 2CDEB 1X7QB 1L4IA 2JIXD 3G6JA 2AJSL 4MAUH 3T0EC 1RK0B 1U8MA 3FO0L 3GJFK 4R4FH 2HRPL 1CGTA 1OP5H 4K8RL 4FN0A 4UV7L 2Q3ZA 1IZJA 4FS0A 1HHHA 4I3SH 2DKUA 5E56A 4D2NA 4QHUB 3C9NB 5EIQA 2P24A 2P5WA 3FRPG 3HE7C 1NMCC 3HCVA 3T09A 2ZPKL 4XP5H 3SEPA 5HBBA 4Y4KC 4JFZL 4PRHB 1XF5A 1V7MH 3QUXD 4BFGA 2EDWA 1G1YA 2X4SB 1XCTA 4KHTH 4L4JA 3MREB 3OKLA 4UV4L 4M6AA 5CS7A 5IM7A 2OSLB 4M4PA 2ARJA 3V6ZA 4LARL 4NPYA 4OQTH 1KGCD 3K4ZA 1NEZG 1MHHB 4YPJA 1BJ1J 5E8PA 1KJVB 1CGWA 2JCCA 5A3ID 2R23B 5KVGL 2XKNB 2ZWLT 3KPRA 4P2OA 4I0CC 3VFOA 4JO4L 3GJFH 4OZGA 5I1EH 3HUJF 4HCRL 5D7LB 5LCVL 5IFHL 4OLYH 3KPSB 5I0DA 1A1MA 3BEWA 4ODWA 2JIXB 1IQWH 2NZ9D 5GGRB 4Z5RA 2APVA 1DVFA 2LAGB 3QEQA 1FYTE 4G6AC 2IAMA 4YDVB 1NGXB 1OTTD 2FJFA 1TZHA 1JWUB 4XPGL 4TSBH 3HNTH 2AXFA 2IGFL 4RMVA 1MWAL 1RUQL 3GMQB 4OFPA 4ERSH 1I8LA 4OZHA 4Z7QE 1MUJA 2F15A 3CSYB 5D1XC 2IQ9H 3ESUF 3MBED 2HH0L 3QUXB 5BQ7B 4XP1L 4NUJB 4QOKE 4KUZH 1EO8L 4AEEA 2WAHA 3LZFH 4ODVH 1QSED 5JXED 4KDVA 3RKDD 1HXMB 3UTOA 4Q9RH 2WLYA 2ZUQC 4XC1H 5CWSB 4WU5B 1TITA 1BZ7B 1LO2L 2XWJB 4U2YA 2GT9B 4N0UB 1F45A 1FGNH 2G5BB 4PJIE 4F7PA 4LLMA 4NT6B 4TVPL 5F8RC 3M17B 5GGSB 4Y4FA 4LMQI 3P73A 3MNVB 5I8EA 2RCSH 5IEKB 1NUNB 3CFKB 2VSDA 3TEUA 2WBJC 3HB3C 4FQ1L 1CDHA 2DMBA 2EDBA 2VL5B 2WQ8A 3ARFB 2C3WA 3BXNB 1ONQB 4KZDH 3LB6C 4PD4K 5FHAH 3SO3B 1BEYH 1AXTH 3L5WA 1UYWH 4E41A 1IKFL 4DN3L 2DB8A 3LIZH 1QBMH 1CLOH 2WUCL 3DTXB 3P0VH 4GXUM 4Y4HD 5J1AB 1AXSB 1KB5B 2RFXB 1I3VA 1CXHA 3MBEB 3KPMB 3LQZB 4JPVL 3U1SH 2NR6D 1D6EB 2HLFD 4NDMB 5T1DL 2VAAA 1LEGB 2OLDA 4TYUA 1WZKA 1A2YB 5HPMA 4OUUB 2H32A 5GS2D 2Q20A 4KI1A 1HSBB 5FAAA 3MGAA 4BM7A 3OHXA 4Y19E 2AI0H 4S1SH 5ALCH 5HDQH 2ZOLA 1LDPH 3N1QC 1IM9A 2UY7A 3QNZB 2YPVH 2OJEB 2Z31B 4YDKL 3O3EA 4WIQA 4HJ0C 4G5ZL 4JZOB 3B9KC 1UKQA 5DO2D 3SKJL 3STLB 1QPXA 3TCLB 1IBGH 1NC4A 1RUKH 4JREB 4XH2A 1UFUA 4TRPL 4FA8A 5JR1L 5I8CB 3PQYD 1LVEA 4V2BA 2HFGL 3WUWG 3WYRA 5D7JA 3E3QC 3NMEA 4NJAL 3VA6A 4G8IA 4ZQKB 3HI1A 4F8QA 3OV6A 3RVXC 3SCMD 3OWEA 1NBYB 1CE1L 4GAYB 3HI6H 4HAGA 3DOSA 3HR6A 3QP3A 3NCJL 3QUMB 3D0VB 3L6FA 3T4AA 2EEAA 1HI6A 4NWUH 2XZAH 2IH3B 4WJ5B 5FGBA 1OM3H 3EYFB 3LDBB 2PYFA 4KK5C 4JDZA 3MRLA 2ADFH 4OFVA 5ILTH 2XI9A 3QA3A 1Z5LB 5ESAB 3WLBA 2DBLH 1INEH 1RIUH 3MNZA 5CILH 5CD3B 2F5BH 5L2JA 1FNSH 1W72B 1YEJH 1HWGB 3WS6A 4UAOC 4LSTH 1L6XA 5L88H 2HKHH 4R2GC 3VFPA 1QKZH 2CD0A 4X99B 4HCRA 43CAA 1ZHKA 4KGLA 3PQYB 3WHXA 2NXZB 2R69L 1DFBL 1K8IB 1PW3A 3EYSL 2I9TA 3QG6B 2OI9B 2QL1A 5FKAA 2B5IB 5IVZB 4JLRB 3OTTA 1MFCL 3L5XH 4MD5B 3DX8A 1K9TA 1QO3A 3V6OC 5HYJE 3SCMB 3EO9H 4M61B 4NQUA 4M62H 5DJ0A 2P49B 1FL5A 5C0CE 1AGEA 2NTSP 3QJHB 5EO1A 1MCOL 1N5YL 4ZS6D 1IMHC 4FFVC 3VH8G 3O2DH 4X83A 1KB5H 5E08L 4HKZB 2FECI 3UO1L 4LQ1A 5K9JL 3ZHLA 3RGVA 1NGPL 5DUBA 4UT6H 3D25B 5ISZA 5ID1A 1G0DA 3C5JA 2DWDA 2FHFA 3DMMB 2LTQC 2X4UB 3LH2L 3LSOA 1Q9WB 1VFUA 1ZKAA 1IAMA 3MLSL 3FFCE 4WO4C 5IFJA 1VACB 4M02A 4PRDB 1OTSC 4DOHE 4L29A 3TO4D 1GPOL 4GG6F 4F58L 3O11B 1F4WL 5IB5A 4FFZH 4OCYL 1I1FB 3KWWA 4O9HL 3TA3D 3BPOC 3F12A 5E7BA 3IFLH 1NMBH 1EV2E 1NCTA 3BZEB 2YR3A 2M8XA 4CDHA 1QBLL 5HY9A 5C6TH 5J11B 2FX7H 3VI4E 4UZGA 5T3XL 4X6BA 5D7IE 1T6VN 2K7PA 2OMBA 3GBML 1N64L 1A5FH 1VESA 1WCQA 2UVFA 4V1DA 5F3BB 3D39A 4S1RL 4WWID 1I7TB 3EUUA 3GSVB 5LKNA 1QLRB 4HMEA 3V4VH 2Z4QA 2IBGA 1JPFB 1E6JH 4CMHB 25C8L 2JJSA 2APBA 2L4OA 1FE8L 5FGCE 4FQXC 4GKSA 3O4OC 2RGSA 4JHAL 4WVRA 3S5LB 5GS2H 3GM0A 1UENA 1FCCA 1PSKL 1RZFL 4XP4L 3TO4B 4Z95H 4L8BA 1AGFB 2I26N 4FQ2H 3QO1B 1CDJA 1FL6A 1GGBL 3UTSE 1MFNA 2XZQH 3TA3B 1MHPH 2W0FB 4PRPD 4N0FA 1YUHA 2AV1B 4MJ4A 1AR1C 3VWKC 3VFGL 3WE6B 1ZK9A 2EYTB 1BFVH 4TNWK 1NEZA 3BHBB 1W72H 2OM5A 2LV4A 4FXKA 3ESVF 5DJCA 1CE6B 5CEZD 4A2LA 2QSCH 2AJZB 3LS5L 4GW5A 1LK2B 1OGAA 4JM2D 1O7SA 4EI5A 4L8SB 1DE4B 5IQ7L 4KROC 3RUGF 5J1TC 2ADIA 3PWVB 2GSGB 4KQ3H 4NO2B 1T5XA 2NY1C 1F11B 2PW1A 4LL9A 2W60A 2C1PA 5TF1H 1QRND 5IVXA 5IT2H 3TNNA 5KVMC 4RGNE 2VDRH 1NCWL 4MA7L 3Q1SH 5IKCB 4MNHB 4KZEL 2IF7A 2J6EL 1FVEB 4BQ8A 4YHYB 5JOPD 5IG7B 2NY0C 3TP4A 1P4LB 4Z6AT 4YH6A 5D96C 1F42A 2RIKA 3DYOA 5J1SC 1C5DA 5DF0A 5TE4H 4PRPB 4LGPB 3FQTB 3GSNL 3MMEA 4P49A 4N9GA 5JOFB 1RHHA 5DC4B 1CGUA 2GY5A 4MVBD 3PHSA 1S5HA 4K7PH 4LSVL 5FO8A 2Y07L 4BH8A 5TDNB 5I6XB 3MA7A 4M1DL 3GMPB 1E4KA 1IC5H 3O41A 4J1UB 3GIZH 1G7MB 3MV7D 3CLFL 1R3HB 4NKMA 3BD4A 4JM2B 1EJOH 4WDIB 5IB4A 4GT7A 4M7JL 3U2SA 3VWJD 4OI7A 4TULH 1IAIH 1T1YA 1KYOK 4HWUA 3PGFH 3UTTA 5A16B 5C07D 1QRNB 5CSZB 4Q9QH 1KIUA 4TSCL 1RZ7L 3U4AA 3ARGC 4ONGL 2GFBB 3D85D 3U0WH 4EI6A 2E7BA 1UWGH 1QEWB 4WNQB 5F3HA 1EZVX 4DK6A 4ZD3H 5F72S 4D0BA 1RZIA 5GZOD 2VDNH 4X6DF 5E2TH 5EU3B 3AVEA 4XMPL 2AGJH 1IC7L 3CDCA 1MJ7L 3EFDL 4EDWH 3FQRB 3QR2A 5KW9H 1TNNA 2CIIB 4G8FB 3U4BH 4GUPB 4QCIB 4BSVA 1JV5A 1ZT7A 4GAGH 1QFHA 1DN0A 3MOAL 4XAWH 2DKMA 1GGCH 1CDCA 4MLIA 1G9NH 4N8VG 1J9CT 4I3RL 1T5WB 2Y06L 4R0LC 5E8EB 4JY5H 1K8DA 3DGGB 3I3BA 3WIHH 5CCKH 1JPTL 1CG9B 4PJEE 3U9PL 3LQAL 5HVWA 3VWJB 1ODAA 3ZKXC 5I30L 3ULUD 5LXGH 4FMFA 1HEZA 5C07B 3ZKMD 2GQHA 3HRZA 3O6FA 2GSIA 4U6YB 4ZUUB 3D85B 5C0JA 3V8OA 4JANB 3IJYB 3WUWA 1FO0H 3K4AA 4ZS7H 5KSUB 1X5KA 4QNPE 2A9NL 4Y5YA 5JW5A 1JHTB 1YNLH 3RA7H 2BVQB 2XZZA 2IPTL 3RX7A 1Q9OA 4BSJA 1B4JH 5KSVB 1R6VA 3LEYH 1I8KB 3F62A 1HNFA 5IMOB 1KN2H 4JQIL 5I1LA 1JE6A 1P1ZA 3BSZL 4G8EB 4H1LB 5GRYA 4HWEH 1FFPA 4PD4J 1T0NA 4K3DL 3QPQD 1KEGL 3CCHB 1DBBL 4LPUA 1C16B 2HLAA 2PTUA 2EDNA 3VRIB 1UXSB 2FHCA 3JBG7 4TOYH 3LKSA 3EJZD 4NRXB 5KS9A 4JVWA 4KPHH 3O3BB 5C09D 3VXRA 2YZ1A 5IW3A 2ORBL 5CEZH 2VXVL 3I75A 4N1HB 3VGHA 5DJYA 3MRNA 4XP9H 1JGDA 2OL3A 1HHGA 2SEBA 3FFDB 5IBTL 4ELMF 1K2DA 4NYLB 1SMOA 2VL4A 4PV9B 4KJWD 1A3RL 5GGUA 4RDQF 3M07A 3NZHH 1U8NB 2M26A 4LGSB 1A7PH 4KH2A 4LHQB 5C0GA 1FNLA 2P5WE 1HZHH 4WY7H 1EUUA 2J6EA 5F7WC 4HHAB 3KAAA 3SY0A 3VH8A 2R1YA 2FDBP 3ECBB 1NJ9A 2VC2H 1QYGH 3QWOB 4YUEH 4ZPVB 1OD7A 3MYJB 3KS0H 4UINH 4MX7B 3S3SA 4DVRH 2XA8L 3GSNA 4RAHA 5K9OB 1Q94A 5DD5H 4MJIA 1HQRA 3NFSH 5SWSD 5E8DL 3Q5YA 2JCCE 3OJVC 1A7OH 1FL3A 3QDJA 4JEGB 3KPRE 4PREB 5C09B 1H3UA 4OZGE 2CIKA 2AJUH 5FUOH 4M7ZB 2CMRH 1NL0H 1OAYH 4DKFH 1FZMB 3U9UB 2GAZB 5D2NC 1UM4L 5MI0B 2ERJB 3QEQE 4X9HA 4FQJH 2NLJA 1UB5B 1MJUH 2A77L 4WW2C 4BQ9A 1CIDA 3CZJA 1TJIH 1MRDH 4WHCA 1T3FA 3A6CL 3L95B 4OZHE 3OAUL 2AK1L 4LLDB 5IOPA 4ENEC 1HYSC 3SE4A 4KI5E 5CUSL 1U41A 5GS3A 1YA5A 3QULA 3CVHB 4XPTH 3QBTB 3ARDD 4DKEH 1B90A 1QSFE 4ODXA 2QQLH 4G80B 5AG8A 5BZWA 1FGVL 1I8IB 5FUZH 3UYRH 4LRIA 4GRWE 3ZHDA 1MI5B 4H20H 4GAFB 5SWSB 5HYQB 3ULSB 3H42L 1T7VA 1NGZB 1G7PA 3EYVB 1IGJB 1YEHH 2EC9U 5I76B 2IALA 4H1LH 5BS0D 4ODHH 3IDMA 4OD1L 3SQOL 4YWGL 4NZTH 1J8KA 1INQA 1WBYA 2H3NB 1QD0A 1NH6A 3GB7A 3R8BB 3KYOB 3AU1A 3QUXC 1FZJB 3MJ6A 4PRBB 3PWUB 3SGJA 4H5SB 5IF0B 3LRHA 5E99L 5HGHB 1I3GL 5E70A 5HHNA 2WIMA 3PABA 1FN4A 4C83B 2YN3A 4E41E 3GUTB 3JV4A 3ULUH 1WZ1H 3G04B 2H9GA 3MA9L 3GHBH 1CFSA 5D5MF 4JG0H 5SWQA 4RWHA 2PF6A 2XACC 1ZS8A 1DQDL 2ARWA 2QV2A 3ARDB 3HZMA 4WFED 2EE3A 5JO5A 4X80L 4U6HA 1B3JA 2IMMA 1JNHA 2ED7A 1FG2B 3ARFC 1MRCL 2F74B 2NZ9C 4L1HA 3E6HA 3MLXL 3SO3C 1OTTC 1L9MA 4NQXB 2CDFB 2HN7B 3KR3H 5C2BL 1T1XA 1DBKL 5CP7A 5D71L 5I1CH 3RWHB 3O3DB 4XCYB 4CGTA 5HJ3B 4LU5L 5BS0B 1NBZB 2AABL 2YKLL 3SE9H 1FV1A 3MBEC 1HHKA 4KMQA 4JO3L 4FRWA 4IOIA 4EQ3A 1U8IA 3T77B 1MCPL 4LHUD 1Q72L 2A9ML 3QHTC 3H0TB 1N4XL 4GW1B 4ORZC 5DVKA 3PL6D 4OCRL 5JXEC 4C55A 3OG6B 3RKDC 3WFDL 3B3IA 4I48B 4MNQE 4ZNEA 2ZZUT 2AJXL 2H2PD 4KVCH 4MS8D 2DDQL 2W65A 4PJCF 5E2WL 1G6RL 4BA8A 4C4KT 4EUPA 5EA0L 1UJ3B 4UTBL 4HUWA 1QVOA 2Z31C 3AY4C 4K3HA 4OM0L 1URLA 2AXGA 3PF2A 3ROLB 4L3CA 3T0EA 5MEOB 5LQBL 4NNYB 5SV3A 2FBJH 4N1CA 1S9XB 3GSOA 2WBKA 5D6CA 5EO0B 2AJYL 4HLZG 4LLVB 5GGTH 1E27A 4LP4A 3H8NA 3PHOB 1A14H 4XCNA 5CJQL 4JREC 1F97A 3EOBB 5EUOB 2G75B 4PJXB 1KCSL 5T3ZL 1QFUH 2IMNA 4P2YA 5ENWA 2ZJSH 3QCTH 4AIXA 1JHKL 4DEPB 4JFOA 1CFTA 4JPWH 2AEPH 2NR6C 2HLFC 3OX8A 4YX2L 3IFNL 2CLVA 5IEHB 2OTUB 4L4TA 3PL6B 1KJ3L 2YA1A 5BCAA 3R1GL 5GS0L 2OQJB 5JORA 2G60H 4ZSOA 2JELL 3BMWA 2DTSA 1U91A 1BGXL 1VFMA 4G43B 1VGKB 4WFFE 1SHMA 4D0CB 3GI9L 1I9IL 2VLME 3VI3F 1KBGL 1KCKA 4WI5A 5J12B 2V2TB 3WNOA 4ISVB 3U4EB 3LDBC 4QOKD 2K7QA 1KJ2L 2W07A 2AQ1A 2NY5H 2QSVA 2ILLA 3E1F1 5ITFA 3W39A 1KLGA 1RJZB 5B38B 1U3HA 1HILB 2Z8VC 4IDLA 1A4KA 1AP2A 5H94A 4PBVC 5J8OA 1IL1B 5SV4A 5ISZE 2E8ZA 3IKKA 5C9JA 5IR1A 1R3IL 2NXZC 1TDQA 2CRZA 3QEHA 2VWEE 4K3EH 2OI9C 5DQ9B 3MJ7B 4PRIA 1KELH 2FX9L 3IJSA 3V8CA 5CBAA 1S8DB 4PYGA 2XZCH 5EOTA 1CBVL 5C6WH 1NGQL 4HF5H 3SCMC 2EZ0D 4RDQG 5I1AB 2NX5E 3WSQH 1J8HA 1KYOJ 4I3GA 1Y0LA 2I9LB 4NFBA 2GW5A 4ODSL 3WUZA 3DI3B 1HKLL 2XTJE 3VFNA 2EIEA 2WBJA 3MUGB 2BSTA 3L3HA 2BMKB 4M6ML 2G9HA 3DMMC 3JV0A 4GQPH 5EOCL 1D5XA 1TCRA 2B39A 4F80A 4NBYB 4V1DE 3D39E 3VXUD 1X9QA 1JNJA 1N7ML 1AJ7H 3WFBH 1NCBL 3W9DB 1MREL 1A6TB 1XGYL 4GG6A 3EOTH 1AGDB 1JP5A 5CJBA 4OF3A 2RJMA 3X11A 2GK2A 1N8ZA 3L3DB 2HAZA 1S7UA 2FIKA 5J11C 1C12B 4M6OL 4TUJB 4UNVA 3KG5A 4J8RB 4U1IB 2XQYK 4RIRB 2MCPL 3EZ8A 3DX7A 4GKZA 4LQFH 4ZFGH 1GHFL 1DUZA 5CAYB 4K55A 1CIUA 4ZS6C 4FABL 2FLRT 1ZT1B 1FDLH 1K4CA 3TN0D 4Z7UF 1HHIA 3T3ME 4BH7B 1MLCB 4TSAL 3B9KA 4CMHC 3HZYA 4GBXA 1BIIA 4HXAL 2ENSA 4U1MA 3RKPA 1UH3A 4JFPA 4LLUA 5SWZD 1QSZA 5HVGB 5CJXC 3IDJB 1U8PA 1KG0A 3S36H 3GMOA 1G6RA 3O8XD 1A3LL 2Q6WA 3V5HA 3VXUB 5F44A 3MLUH 3TO4C 1G9NC 1OGAE 4PG9B 1EHAA 1PDKA 1SM3L 5F7YC 2VUOA 2F58H 2KZWA 3O0RL 1HH9B 4LLQA 4N8CH 5DD6B 4OCLC 5TQ0H 3TA3C 5MEQA 2BY0A 1AD9A 5J4MA 2X09A 3G5VA 2GITA 3SHSA 1AXIB 3PXJA 5IVXE 2VITA 4YHOH 2WINB 2E9BA 3QDMA 4POYA 3C5ZD 3MACH 4ZFZB 4NGHH 5I1IH 1P5VA 5E8NA 1C08B 4JRXA 1AIFB 4BKLA 4YR6B 2APWA 4HUVB 2CUIA 2DLFL 3KS0J 1MCLA 4RISH 1HHJB 5DA4A 2NCMA 4XCFH 5DC0A 3I6LE 5EN2A 3TN0B 1Z0MA 4L8SC 4YIQA 3ZTJG 1J18A 5GS1B 4M7KH 5SWZB 2A6IA 1CR9H 1CF8H 5J13B 5HGBB 3RUGA 3PDDA 5DDHA 1SYSB 3TM6A 3VD3A 1FZOB 2F54B 4NQVB 4RZCA 4CADB 1H8SA 3O8XB 3RRQA 5TDOB 4ACPA 4PJHF 4D9RE 5CZXC 3RHWF 2ATPA 4OCXH 4MA3B 4KFZC 2VLJA 4DUXA 3AROA 3BH8B 1YMHA 1TTGA 4LNRB 1Q8MA 3E6FA 1UJTA 2CGRH 2VISB 4HKXA 1R3LB 4OT1H 4ZUSB 3MRDB 1VHPA 3C5ZB 1A22B 2EYRB 1SYVA 1T83A 5I6XC 4K94L 4AZ8A 4RBPK 4HPOL 3ARYA 3O6LH 3BIKB 1PKQB 4MA8H 3PWNB 1XF2A 3STZA 2GJJA 1EEQA 4JM2C 4M00A 3FB6A 1RK1A 2CPCA 5F7EL 2V2XB 2D7PA 3FB7A 4NSKA 4HJGA 3MRQA 4ODTH 4WO4A 5EU6A 3ISWA 1HDMA 5IIEA 4PJAA 1TIUA 4I3SL 1S7VB 2P7TB 1OSPH 2VXUH 1N6QH 5DJAA 3JTTA 3F7VA 1LO4H 2CXGA 3IGAA 2R0KL 3FOLA 3CFJB 3MRJB 3ULVD 1V7ML 2BSED 4JDVB 1TVBB 1JYWA 3MCG1 4KHTL 1S78D 4HLJA 4RBPH 2NXYD 5GRVK 3EBAA 4OF0A 5EBMB 4F9PA 1G0XA 4AIZA 4EDXA 4MVBC 3H3BC 3H6JA 5BOZG 4U6VH 1IGIH 1RUMH 3BT2L 4CN4A 4J3UA 1FC2D 3UJJH 4YZFE 5IMMA 4P23D 4PJFA 4G3YH 3DVGB 4UB0H 4F2MA 3CSBA 1MCSA 5DMJB 1IQWL 4ORGB 4FQXA 3P4OB 3DBXB 5F1IA 5DD0L 3VWJC 5ADPL 1JGUL 4F7EB 3RPIA 5I71B 5B22A 5FF6B 4MSWA 4TSBL 2VQ1A 3UBXG 4NHUA 1QSVA 3RWDA 4OLUH 2EE6A 2LQRA 4EKXA 3NACH 4CRPA 5GZOC 3LZFL 4ODVL 1SEQH 2EDHA 3FT2A 1S9VB 5KS9E 3SKNA 2NXYB 2IANB 3VXRE 4Q9RL 3IETA 3M8OL 1GC1L 4XNXL 1T4KA 2A73B 2XXCB 3MOQA 1MHEB 4KTDH 4ZYKB 1U8LB 4HV8B 2FX8L 1M7DB 3LAFA 3QEGH 5IBUG 5BRZA 3DUUB 2ZSVA 2XTLA 4P23B 4XGZB 2FL5A 2BVUA 5KN5B 3JUZA 3SDAD 3CX5K 1B0GB 2DLGA 3SDYH 2C7UA 2LU3A 4JQXC 4NO5B 1ERNA 1C5CH 2V5SA 4EVNB 4KZDL 5BZDA 4MD4B 5DTFA 3ULUC 5F93C 2MPAH 3PGDA 2X7LB 3L3OB 3ZKMC 2VJXA 4ZDHB 4BQ6A 2X4OB 1UYWL 4KMLB 1QBML 3P0VL 3EO0A 3JTSB 3O4LD 3T1FB 2EIBA 2X05A 5CJOH 5C0BD 3U1SL 4MJIE 4KV5F 3DYMA 2QKIA 2YRPA 4X4YB 1RJYA 4ELMA 5FYJD 4GXVL 1DL7H 4U0QB 4NRZA 1YEIL 5BVJA 1NBQA 1JVKA 1TQBB 2R2BB 4Z7VA 1NANH 4RX4D 1U92A 2W9EL 3V95A 1BFTA 5ALCL 1IAIM 5DR5H 2DQUL 2E7CA 2D0HA 4C4KO 4O58H 3QPQC 2VLRD 3HG1B 3MO1B 3OF6D 4FZ8H 5KSBF 1C8PA 3WBDA 3MV9E 3C60B 3TF7C 1R5WA 4ZPTA 5C3TA 3IS0X 3P9LA 3EFFA 2LU4A 4LKCB 4HIHB 3GI8H 2ITDB 5HI3D 5C9KA 3ARGA 1Q9LB 2X4QB 5EZLA 3GNMH 3BISA 2EDTA 1FNFA 2X89A 3D18A 4M7ZC 8FABB 4LLYA 4FXGB 4QHNA 3V4UH 1LK3H 4WV1B 5D9SA 3UDWC 5JHDD 3O4LB 3UJTL 1X3DA 5MI0C 2ERJC 5C0BB 2XQBL 3OXRA 4KJWC 3UTPE 4AENA 1A47A 4S0TD 3T65B 3R0MA 4ZXBD 1ZHLA 4FHBD 3MRCA 2UYLB 2A6KA 3HI6L 5FK9B 4Z7UB 3OJDA 5DYOB 1JNNH 4CW1A 3M1BB 4QRTA 2XZAL 1YPZB 4R26H 5BV7B 4PRAA 1FSKB 3LKQA 3ULVH 2VLRB 3MRPA 4FQQA 1TLKA 5DGRA 4MB3A 1WZMA 4G9DB 2W38A 4RAUB 2DBLL 4FQIH 4XC3L