2E7DA

Crystal structure of a neat domain from staphylococcus aureus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'DQLTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDINT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein IsdH
publication title Structural basis for multimeric heme complexation through a specific protein-heme interaction: the case of the third neat domain of IsdH from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2e7dA00
4H8PA 2ITFA 3QUGA 3QUHA 3S48A 3SIKA 3OVUB 4H8QA 5D1QE 3QZLA 3QZOA 2Q7AA 2O6PA 2MOQA 5D1ZI 4YMPA 2Z6FA 2ITEA 3QZPA 3SZ6A 3QZNA 2K78A 5D1XE 2H3KA 3RURA 4MYPA 3VTMA 2E7DA 3QZMA 3SZKC 2O1AA 3VUAA 4FC3E 3RTLA 4NLAA 4WJG3
chains in the Genus database with same CATH superfamily
3QRGL 3GKZA 5IW1B 3ML9A 2QHRL 4JO4L 5J06A 1ICTA 1UZGA 2XPGA 3IMRA 3QORD 1E9PB 1ZLWK 4JUTA 2PPAA 3TURA 4GIAA 1OL0A 4OFYA 5FO2A 2GJJA 2BWDA 4IMLB 5SWSD 2ZWNA 5G4MA 2EYTB 4BCXA 5F9JA 1OKEA 4MA7L 4Q9RL 3TA4D 1XXDC 3BAJA 3K6DA 4LCWB 4BQ8A 3UGXA 2A6IA 4KPHH 3FBQA 4LFHD 4HUVB 5CFAA 2EDJA 2XV3A 1WRFA 3DTXB 3S34L 3SOBL 4NQDE 2ZNXA 3CVHB 4F2ME 1KWKA 3VYNA 4X0NA 1QTYT 2H0JA 2O4EA 1G6VK 3DX3A 4XB7A 4DEWA 4MD5B 4LSDA 1QPPA 2VLKD 1TU2B 4POZD 4Y0GA 1KB5A 2C3WA 3L95A 3LAFA 3QUYA 3VG9C 1MPAL 3MA7B 3GRBA 3BUPA 4PB9L 3TBYA 3ILPB 4YBQC 4LOEA 1FRGL 2E5EA 2L7QA 1T5XA 4UNIA 5AL8A 4X7SL 1UM5H 4JREC 1NMCB 3LYRA 2F19L 5HYSA 1J5OH 3E9UA 5CJ8A 2QQNH 3DXAB 5T5FH 1KTKE 4AWJC 4RWHA 2ZONA 3FQWA 4AV5A 4C4BA 5HI3C 3KG5A 5EPMB 4UQEA 1FL5A 4HS6A 4RRPM 4S2SB 2VXUH 4IKJA 4WNQA 1W8EA 1DBKH 5D9SB 3ZKMC 2IDFA 5AVYB 3EJTA 5GJTL 4GI8A 3QUZB 3WN6A 2HA1A 4N2AA 4YNYA 1FC1A 3CVCA 1JWMB 5B7EA 5KSAC 4EI5D 4M29A 2VSKB 2BNRD 3SJVA 3EOYG 3V4PB 3S37L 3FW6A 1EANA 5BV7B 4K4KA 4LDCA 2IGFH 3IDIA 3OGCA 5DD6A 3VVVA 5C6TL 1ED3A 4AQAA 5CN3A 5L2KE 3ZHKA 1HK6A 1CD1A 4JFDB 2A9MH 3LNHA 5DJZB 3R8QA 5GRYA 1TTUA 2HKFL 4QCIA 2P8MA 4XXDB 2BVOA 2IFFH 2YUWA 4GW5A 4PPTA 2EVHA 2J20A 4Y5XA 4HULB 2MH4A 2YIHA 3VFOB 3LNDA 4PRPD 2XWRA 3NZ8A 1PY0A 2QR0B 3QIBC 1OB0A 1KJ3L 3FFOA 2AXHA 1SLWA 5CLXA 3S35L 4PGCB 5FYJL 5I16A 4Y9BA 4G9FB 4KZDL 3VYOA 1GAFH 5ESQA 3LQAH 1M05B 3KNBB 3FQYA 4H40A 4LLYB 1SYSB 4LEXH 5FKAB 1X7QA 43C9B 5D1ZC 2CRMA 3HG3A 4TTDC 5E99H 4LRNL 3BESR 5BUPA 3BO8A 4M1GL 3L5IA 5D8JH 5DMJB 4N24A 3QUKB 5MEPA 3U7YH 5DMYA 5IQMA 3B34A 2XWBA 1PFOA 3LHPH 2J6WA 2ALAA 3JV6A 1MWOA 3BOVA 4PUBH 5A6LA 1FV1A 1OGTA 1E67A 3L9RA 3U1SH 3QNXB 4K94C 4WI4A 1XB6A 3WIHH 1ZVHA 2UUDK 5HVHC 4YHMH 2X53A 1URZA 1W80A 5T1KB 4JCMA 1WSST 3CPLB 4YEFA 4UM9D 4OCSL 5EUKB 5F9JB 3CHRA 4HT1H 4OJCA 3W37A 2XZCH 2YOCA 4JPVL 3ZKND 1KV3A 4OJAA 4P2RD 1HAWA 1XL4A 4P2AA 4Z7VA 1G1OA 4G9DB 4CUCA 4TNWF 3ZE2F 3IDYB 1PKQA 2EYSA 1FBIH 4R4BA 3P11L 5DUBA 1CLYH 3ZL4H 4FKKA 5K9KB 1BQRA 3GRWA 5E9DA 1P2CA 1XSIA 1MWAA 4FQCH 1RXLA 4I18C 5LAXB 5IOKA 3ZYZA 3EYVB 3G9VA 2X41A 4Z1PA 3R0NA 4H8VA 2A74C 1P5VA 2XICA 2A9DA 2LHAA 3K7UA 2NY0C 2NY4D 1KB5B 1M6UA 1T7YA 2VUOA 2YMXH 3QUYB 4PMFA 5GQBA 2QMKA 1GKOA 1BEXA 3WDJA 2MRYA 2OR7A 3LH9A 4Z7VF 5D1ZI 1LO2L 1PL3A 3PWJA 4H25A 4J6RL 1WICA 1B4TA 4GKNA 4MX7A 2FJSA 4Q4IA 4DO5A 3WTTA 4P4KA 4IBUA 4OU3A 2X6CA 3UTQB 2V8MA 4Y9CA 2ZWYA 2XETA 3F7RA 4RWYL 1TCRA 4PRIE 4N8CH 4F9PA 5J89A 2Y5QA 3SQRA 5JA8B 5J5EA 1FNGA 4ZW6A 2UZPA 3OQRA 2Z31D 1GYVA 3KGSA 4FABH 1FL5B 2XIBA 1RVFH 1SFHA 4HS6B 4Z7AA 2VDRL 3HN8A 3KXFE 5B8CA 5DHVH 2BJML 5ETUB 2EKSA 2JQAA 1EA9C 4U0QB 5D6CA 3UBXA 1M6OB 2QELA 1W72H 1ZT1A 4Y5YA 2P9RA 4U6HA 1D2OA 1BZQK 3DSNB 2X2HA 4XCNA 1LO4H 4H0LC 4X8CA 5DMIH 4ZTEA 3RKDC 2VDMB 5CMAB 4XE0A 1ZLUH 1ZMYA 3SJVB 1F18A 5F7BA 2YAEA 3AVEA 1RZJH 2D03L 4HJJL 4XH2B 1WZMA 4AQAB 4IGBB 3H42L 1I53A 4BEIA 2JNZA 1XR9A 2QADD 1ML0A 2ZUSA 3GM8A 3MLVL 1G9EA 2NX5A 1AQDA 3WD5L 3GQFA 2P8MB 2NTFB 1GZHA 3AY4A 3ISRA 3MJ9H 3MNDA 1A6VL 3T2QA 3S88L 3CLEH 2QVTA 4RFNB 3HC0A 2F7QA 3FBKA 4LBAA 4CSSA 2Y7OA 2VO8A 3C08H 1FIEA 2P28B 4NZRH 4FHBD 3P2TA 4AE1A 3M1BB 1V7NL 3ZN6A 3B7UX 4P59L 1J86A 4N8VB 4HPHA 4KI1A 5ESQB 4ODHH 1ZT4A 2HJFA 3WL9A 2M2DA 4NLHA 3BT0A 3WIHA 4RFEA 2W9DL 2HJKA 3MXWL 4P99A 3C5ZD 1KZQA 3STZA 4TN9A 5KVFE 2RA1A 4G82A 3UERA 1U30A 3OR6A 4UOQA 5C6WH 3UAAA 3CAFA 3IXAA 1A9VA 6FABL 2X4UA 2HFGL 1TXKA 4GT0A 2YXVA 3ZE2B 5MEPB 2BP0B 4IK6A 3EW3B 4FRWA 3M7OA 4RDQG 5KSBF 1IMHC 1OGTB 3BAWA 4L5FL 2BP5M 5AAPA 4AJ0A 4KO9A 1WZ1L 1NBZB 3QAQA 3ABKB 3OKLA 4BFFA 2ITFA 1JN6B 5AG9A 3WEBA 4ENZA 2YAPA 4BELD 4EZKA 1U8LA 2O6CA 2ZXEB 4QGTA 1VADB 4GSRA 1UOLA 4DNLA 1ZA3B 1EEZA 2Z35B 1ADQH 2WVSA 1PKQB 2EYSB 4R4BB 5DUBB 5C0FB 5LDUA 2JKIS 2VWEC 2CLRB 3UTTB 4F80A 4IRSC 4WCYH 5E9DB 3ULVC 3OKOA 3EBAA 1E3ZA 4I0PC 4QKXB 2BSRB 1CG9A 3WN5C 4O5LH 1P5VB 2X1WL 4G7YH 4F57H 1R3KA 4XPFH 1AGCA 1X44A 1GY1A 3EADA 4N1HB 3IS1X 2KL6A 3NFNB 4U1MA 4WNSA 2Y06L 3U2SA 3NIDF 1XMEB 3US1A 4K55A 3QUGA 5DS1A 5FX3A 5B21A 3TA3C 1N3NA 5DHVA 2O30A 4QNPF 1BIIA 2G5BB 3AB0C 5HHMB 1ZTXE 4OM1L 3T0EC 1BXAA 3VVWA 3D2UD 4ISVA 1BSIA 1RK1B 2G60L 3T3MB 4WI8A 5D1XC 4HKXA 3MXVL 5D4IA 5HPMB 2GEQA 1PSKH 3TFKC 3O4LE 3SE3A 1K3ZA 2DQIL 2HRGA 2PLTA 2VSMB 3R1GL 4P0DA 2F8IA 1Q1PA 4L0PB 5K39A 3WKML 1M1XA 1QYGL 3UBXB 3KPNB 2YFOA 3FQUA 4A39A 2R2HA 1S6NA 4Y4KD 3ECUA 3H7LA 4U6HB 5L4MA 4XCNB 4R7NA 1JCVA 1OWRM 5E1HB 4HPOL 3VXPB 4AV0A 1WAAA 2P5WB 1MSPA 2OW7A 1AZRA 4OJDH 1B3JA 3B2XA 2XN9A 4OCXL 1SYVA 2XTLA 5IQ7H 5FYJD 2WVTA 2R8SH 2NMSA 3VXRB 1U2CA 2DV6A 3TOPA 2DPKA 2JWYA 2ATAA 2NX5B 5IEKA 1AQDB 1FH5L 5DA0B 1RU9H 1MJUH 2WWMC 4YFLF 1FH2A 1KC5L 4WU5A 1WFJA 1W0WB 2YLKA 3TWCH 1JZ6A 4XNYH 1NEZG 5HI4D 4JM2D 2DWSA 3GNMH 3SPGA 2CG9X 4LCCA 1DTUA 1QSEE 5ILTL 3TWYA 1WAAF 2FJFA 4WK4B 2YPVL 5F1NB 2ITCA 4MCZB 4BGDA 1JPEA 3EO1A 1GHFH 4AENA 1N4XL 4CSZA 3LB6C 3IDUA 3MLUL 1QPXA 5KSBB 4NQVA 2Z34A 5LJYH 1RUAH 2NYYC 3FCTA 2HJFB 3BGFC 4LEOA 3T4YB 3ATAA 3LIZA 3EYUL 4HJGB 3MLWH 4JE0A 4RFEB 3MV11 1ACZA 1N19A 4NN6C 3STZB 2WB1A 5DJ6B 3FHEA 1JF6A 2FGZA 1WS7A 3HFFA 2AXWA 1ZOXA 3PWNA 1YMMA 3CUPB 1U3HB 2QGBA 3DV6A 5J13B 5E70A 4HF5L 1QVOA 2R1YB 3OZ9L 3VSVA 3DOSA 1X5AA 5E6IA 1ADQA 5E8PA 1KJ2H 4PWIA 2XC8A 2GYSA 2Z0BA 3HS9A 4UQAA 1O5DT 4YC2B 2AQPA 4PP1C 5FA4B 4AEIH 2CDFB 2EE9A 3ZE0F 3Q0HA 1FZKA 5LBSL 3APNA 1PYWB 1T3FB 5C0NC 1SDYA 4XGZB 1M7IA 4MS8D 3V6OA 3LS5H 1KXQE 1BFOB 5HYEA 2VJXA 1P4BH 2I25N 4E41D 2VM9A 2Z8VC 2HFTA 3OKOB 4TVPE 1OE3A 3TFBA 1LEKA 1L0YA 1CL7I 1CC3A 1CDBA 5MERA 3W1ZA 3G7TA 4PRBA 4U2ZA 2E59A 2VDOL 1CG9B 1UD5A 3DGGB 1HH9A 3CFNA 5EBMA 4IEFB 1R3KB 3QIWA 4WY7H 4U1MB 3V7MA 3R7RA 3BP7A 4NEHB 1E50A 3MUGB 4RAUA 1IRAY 4WVRA 1MCLA 5LCVL 2O6EA 3KM2A 1FNLA 3T0VA 1XCTA 5DHVB 2BRRH 2IDSA 4JW3A 4OLVL 4O9HH 1MJJA 2AMUA 1W72B 4JQVA 2BERA 3FTZA 1UB5A 3WS3B 5EO9A 4C83B 1T03H 1H15A 4BXSV 5CZVH 3RGBA 4ISVB 3NOIA 3NPSB 3MRMA 4PSPA 1X5FA 1T1ZA 4HKXB 4MAYC 4KI5D 3PAVA 5BMFL 3QDJD 2QHLA 1ZT7B 4XC1H 5IZ7A 1CI3M 1M1XB 1XVSA 3DA0A 4M1DH 4HS3A 1DN2A 3FQUB 1EZLA 5DC0A 3M46A 2J6EH 5JQ6L 3LRGA 2QEJA 4N26A 5I1JH 3T2LA 5INDA 5MEOA 4CW1A 3BSZA 1F90H 3RLSA 1B0GA 3B9KC 2VE6A 1P7BA 2H32A 2XN9B 3TYFA 1SYVB 3U0TA 3P9MA 1HDMB 5ADOH 1XGUB 4H8WC 2DS4A 2XOTA 3H9SB 4MXQC 2Y6TE 2ZKHH 3BT2L 3MCKA 1J8HD 4N5EC 5J12B 3HG1A 5I8OH 1YEJH 4PJCE 2NDGA 3DETD 2BCKB 3KJ6L 4D8OA 4ZMPA 4QTIL 3HBZA 2FB4L 2GFBA 1BGXL 3PIQA 5HJ3A 1S3KL 1E3FA 4LCCB 2IH1A 2LABA 4DN4H 1OTUC 2A6DA 4M5ZH 3BVWA 1LK2B 4PD4J 5CWSB 3UZEC 3FRPA 1FP5A 2AQ3A 4NZTL 5F71A 1ZSDA 1OVZA 2ITCB 5IMKA 3U4AA 4KO6A 5DRZB 2J5LB 2CZNA 4PQXA 1CZ8H 5ESVA 3GB7B 4YXLL 1MQKL 3FO0L 4ZW3A 3L45A 4OFQA 4EN3D 3D87B 3MODH 3ZE0B 5AYQA 1JPST 4G8EB 3MGOA 4WU7B 1TTBA 1WA0X 2R59A 4H4NA 4MQ7A 3RWIB 4AV4A 2PCPB 5D71L 4Y16B 3HI6L 4F2MA 4AMKH 5L8KB 4AIXA 5I1LA 1G7PA 3CXHJ 3M8OL 1G0YR 3FQXB 2EUVA 3FPYA 3PGFL 5T3XE 4ELDA 2WYZA 3CVIL 5KN5B 3SDDA 4DGIH 4KBPA 3HE6D 1P9MA 2ZF8A 2ICWA 4OLXH 4PGEA 1PD0A 5JHMA 5D96B 1OGAE 4YSQA 3QJUB 4DZ8B 2X9ZA 3RBGA 4RESB 4XCFL 3QEUB 3O0RL 1HHGB 1WH0A 4ZS6C 3IAPA 1A7PH 3C2AH 3VACA 3ZMEA 1LEKB 3JT0A 2QZ5A 4PRBB 4X8XA 2ZICA 5EBMB 5IWLA 1HH9B 5EWIL 5TF0A 4TF4A 3IS0X 3QIWB 5FHAL 1P6AB 1TQVA 3MLXL 2UZIL 4YDJA 4LOUC 5FHBL 3CDZB 2NLJA 2Z6FA 5D70L 1E8YA 4P23D 2B4CC 3W0WE 1XCTB 3BWAB 3O3EA 4R5TA 4NPYA 3PHQA 4MA8L 5JW4M 4S1DC 1NC4A 2FIRT 2J6EA 3CFJA 2K7QA 4FHKA 5EO9B 1H15B 1KGIA 2YMOA 2WTPA 4YHZH 5CJOL 5L2KA 4KY1H 2Y5TB 3VD9A 2R4SL 3JWNC 3MRGA 3SGDI 3MOBH 4KVNL 1QA9B 1HJCA 4OAWB 5HI5D 2DEYX 1UOWA 5I0DA 5IFAH 4W4NA 5I1DA 4CBPA 5A3IC 3L1GA 1UJ3C 3QDGE 1IT9L 1XSJA 4B3EA 2W9EL 3EJYD 1D6VH 1XF2A 4HS3B 4GO8A 3OHXB 4V33A 3ZLQC 4AQOA 1P84K 4M43H 1S7QA 3M1OA 3CBJB 4ONGH 4Z7WA 5INDB 4MYPA 1YQVH 5SV3A 2GJ6E 4GKOA 4CW1B 1E27B 3C87A 3JWOL 1QHOA 1AS7A 4YUEH 3JVGC 4OT1H 3RIFF 3TYFB 1T80A 3CXDL 3HC4L 3JWDC 1JDCA 2NUTB 3OPZL 3RTQD 4GQ9L 4MJHA 4NXSA 5DQ9A 3WENA 1QI3A 3MCKB 1A4KB 1FFOB 4GAAA 5KTEL 1T2JA 2FD6H 1KEGH 4LEBA 3HG1B 4L48A 1IC7H 4GSXA 3ILQD 3VH8B 1QNZH 4U3SB 3FMGH 2GC4C 2GFBB 4U31A 3PIQB 4Z7WF 3BQUD 5HJ3B 3UTSE 2JE8A 3TN0D 3ABLB 2J8UE 3BRDA 2A6DB 4N2FA 5EOCH 3N40P 3HLKA 3BWSA 1NL0H 5JIQA 3QULB 2GEEA 2CXGA 4LIQL 3INUL 5LNEA 4F7TA 1KJ2B 3G5VA 5GS2D 1YQ2A 1CLOH 5FCUL 1M9SA 3VFRA 1V8HA 2G9KA 1SM3L 1JGVL 4TXVB 1QWUA 1CLCA 4CADA 5DYFA 1KTRL 1D9KD 3BE1L 4H1LH 3EFDL 2HX9A 4UUJB 2YAQA 1WQVT 1G7PB 4B7IA 1NUFA 3FTGB 5GRWA 4QO1B 3CG8A 1P53A 1LHZA 2UZXA 1DQKA 1JMXA 4XPGH 4XVUC 3LQZB 1IFRA 3KYNB 4BFIB 2E86A 2ICWB 3GXMA 3KYAA 4LLVB 4YFEA 3CDCA 3IRCA 1Y18B 2DLEA 2VWEE 1D5IL 4HAFA 3U0WL 3NSYA 1V5JA 4C57C 3ULVE 5C0JA 2CPUA 2OL3L 1D7DA 1G4MA 4N0YH 2J1YA 3BPNC 3MFGB 5E5RB 3TEZA 1G7HB 3DK0A 2CLVB 1U8HA 3JTSA 4KVCL 3W56A 2QQLH 4MCNA 3QR1A 2D2CC 2PXYD 3ARFB 5HDQL 3GC3A 5MP6H 4ZJ9A 3WEMA 4Z3TA 3KXFA 3WJJA 3C8HA 3F7YB 5CCKL 3I6GB 4XZ4A 5SWZE 4ENED 1MVYA 2YZ1A 4TQEH 4Q52A 5C08E 4NP4L 2F7PA 4DKEH 4WFGE 3T0EE 1MNNA 1IM3B 1KGJA 1HFUA 3PHQB 2AXGA 3MRRB 1QMUA 3BN9D 1CYGA 5DF0A 4A37A 2CM6A 5D1XE 3KPPA 3GSUA 4M4PA 1ZGLB 3L3KA 4JFYA 1IQWH 3MRGB 1FA4A 2P5ED 1OANA 2K7PA 2HXAA 3GRGA 2HLEB 5I1DB 3L3DB 4XNUL 3W2DL 5DFAA 4XMZA 1IBDA 5ITBH 4O02L 1WZAA 1S7QB 3EFFA 4LL4A 4Z7WB 2EYRA 4Y8DC 1UT9A 5J4MA 2Q20A 4O2EA 5JPMC 3ZO9A 4WW2A 2GK2A 2FEDC 2QL1A 4L1HA 5E6RB 3IJEA 3NZUA 5AUMB 1SGKA 4B3VA 1DEEB 3O45B 5FV1L 2UWEE 3SDYL 5FGBC 2CMRL 5IUSA 3TH2T 5B3SB 4YN3A 1E4HA 2VMDA 3J27A 3KYOA 4NGHL 1Y6MR 2EEAA 2J88H 2QVMA 1DO5A 2VCOA 4XCYA 2F74A 5INCA 1Q9OA 3ARVA 2PP9A 1MJ8H 3EJUA 2AS5M 1PNCA 4WW2F 4IIQB 3AUVA 1YEDA 3PQYB 4X0KA 3EJCA 3UIYA 1F8TH 1FNSH 1RI8A 5DD5L 3RHWK 2JELL 1QSVA 3MC0A 3O3UN 5F96H 4F7TB 2HX8A 5GZOD 3TS8A 3ZKQD 2XQYG 4DFIA 3GSNA 4M62H 5E6UB 5GGVY 2OS7A 1Y0LA 4CC4A 5L2JB 1W8NA 1P69B 4IJ3C 4L2YA 4O4YH 4Y19B 4WJG3 1RPKA 4U4BA 3RPIB 4PD4K 3HB3B 3VFPB 5C0DB 5EB9A 4L2LA 4CADB 5IKCA 1J0HA 4LP8A 4GUPA 1U41A 2Q1EA 1AQHA 4BV1A 5ECJE 1C1EH 3DHPA 4S10A 1E42A 3VFSA 3PGCA 3QCUL 1INDL 1F3DJ 2YUVA 1GCYA 5LGHL 5D1QD 2D7MA 2VSDA 1E28A 4MJIE 1FAIL 4G1EA 3DVGB 3QEGH 4LFHG 5EZOH 3DKHA 1QR1A 3DURA 4Z0BH 3ZDXE 3N06B 6PCYA 3WY4A 3OKMA 5EBLA 4GG6A 1NINA 4TLSA 5A2KH 2ED7A 2XG4A 2J55A 1DJYA 3ERXA 2VXQL 3CXHK 3NRFA 2OM5A 1AXSA 1IGCL 2IQ9H 1U8HB 1SN0A 1XIWD 4IBSA 3PNRB 1ZWIA 3OZLA 3TBWA 4ETYA 3F00A 1O7DE 4YPJA 4NKOA 4JQIL 1E6OL 4IMKC 1X5XA 3AROA 4EUPG 3EOAA 1R3JA 5EIQA 4L8SA 1H6EA 4A7TA 3MUZ1 4YSCA 4GG6F 2EUWA 3BLPX 3UJTH 2OYKA 1ADWA 1GYUA 4N90D 4NHCH 2MMXA 4POYA 5AW8B 1MCHA 2MPAL 1BFSA 2J5WA 1AJ7H 4QHNB 3FHQA 2AXGB 2VDPL 2F5BL 4TM9A 4JY4A 4JO3L 3RFRA 2D7NA 2Z91A 3KM1A 4RMVA 3RBSA 3TL5A 5ISZD 3QQ9C 4ALAL 1NDTA 4KKZA 5CEZL 1A7NL 5TPWL 1NGPL 1MFDH 4EI6A 3UGEA 2H41A 1TKWA 3N1MC 4KKCD 1E9QB 3NA9L 5BQDA 5TQ0L 2IAMD 3JZYA 3CDYA 1XEUA 1GKEA 1EXUA 1QSEA 4M7LL 1EMTH 1U3YA 3LKRA 3NABL 2YPLB 2VT0A 2EYRB 1JI2A 3AREC 1MZYA 1QSFD 4O2EB 4PJ9D 3H3PH 3CK0L 4WW2B 5CM1A 2WQWA 3ATFA 2JJTA 3IJEB 1XD0A 2X7LA 1MCFA 5I82A 1A5FL 4H26B 1ID5I 2QVIA 2VJ0A 3ARGA 3GI8L 3S97C 2YXWA 4HWEH 2QDVA 2ZE0A 3KYOB 5IHBA 3O11B 5HGDB 2BSCA 3QDMD 1TJXA 4RDBA 3QXWA 4XCYB 4M6OH 5AKTA 5INCB 3KL3A 1E65A 2MSPA 2WZ6A 4JO1H 2X0UA 4I1NB 2VN4A 3KPOB 4MKTA 5FGSA 4YHLL 4R83A 5KWYC 4X0KB 4NI3A 1M7DA 1E7VA 4PJHE 4FKEA 4H1LB 3MCLL 5I19L 3PXJA 2C26A 5C2BH 5I1CL 3K3QA 1EIBA 3ZDZF 2R83A 1VFOA 5E94A 1S9WA 4U33A 4FMFA 1RZFL 2HTKD 1Y0LB 2FWSA 5I75C 4FX5A 1DBBL 2J1XA 4JRYE 3B5GA 5F93C 1BYNA 2EIEA 2BZ7A 3CFCH 5FCSH 4ONFH 1KXQA 5FYJU 3H1ZA 4TS6A 4Q97A 2ADJA 4GUPB 1JWSA 1EJ8A 1SOKA 2JKJA 3AQDA 4YSRA 5CZXD 3C2SA 3PGCB 4AZ8A 4AEHL 4M9OA 5E8EA 2XIDA 4N0CC 4PJ5E 3EJRA 1E28B 4G1EB 5FGCE 3ROLA 3LKSB 4BFEA 1QR1B 2BDNH 1E6JH 5F9WB 1QTSA 5I1KH 4GG6B 3AWFA 4GP5B 1G7MA 2KPWA 1L7TH 4X9YA 2WUBH 4ZUUA 4EDXB 5IBLD 1TETL 3BAEH 1U2YA 5FWRA 2R23A 2XNAA 3V0VB 2B77A 1FYTD 2BNQD 4HYTB 1AXSB 5J6HA 4HCRA 1J87A 4QOKB 1OTSD 2P8LA 3C9NB 1FCCA 1EAJA 2ADYA 3EHBC 1NGXA 4BFKA 1LYQA 5AFAA 4JO2H 4R90H 5C0AE 1KN2H 3POHA 1R3JB 4QAWA 2ZSVB 3P3RA 4L8SB 1P5UB 1YC8A 3FO1B 5I1AB 5KSAA 4MXWH 4OSUH 1FPTH 1MQ8A 4G6FB 3VDBA 4I9WD 3R06A 5FUOL 1NAKH 3G9AB 1JVLA 4XMTA 3VI4E 3RY6C 3JWNE 1OCRB 2QKIC 3EYFA 4PVBA 4ZX6A 2Z91B 5EIVA 4OGYH 4W6WB 3T1FB 3PWUA 3LH8A 3X1NA 5MI0C 3Q2VA 4BZ2L 5HGHB 2WNGA 3SKMB 1EFXD 2EIMB 3AW5A 4XZUA 3T8VA 4EI6B 4PJCA 2QLVB 2R0ZH 5D7JD 1N12A 2ID5A 1JNLH 5GIRA 1KFGA 1CF1A 2AV1A 3QIBA 2EDKA 4X4YB 3FB8A 3ZE1F 3THML 4XP1H 1LP9F 3U0PA 1P4LA 4M8QA 3MFFA 1B6DA 4LHUD 5C0BB 1WEJL 2EO9A 4CSPA 3OKKB 4ZTPL 4HJTA 5D1ZA 2F6AA 2XVLA 3ZDZB 2AJXL 3OKDA 1IGIL 1JGUH 2AK1H 3HLAB 5T3ZE 3UO1L 2H45A 1EDQA 3NK4A 4XBEH 3QC5X 3DNKA 1ID2A 4JFPA 4R2GB 3KDMB 1DCLA 2BZDA 1F4WH 5F9OH 2IWFA 5CKGA 4HMCA 1GS8A 1NSNH 2Y7SA 4DGYH 3CGTA 3GMLA 2NXYB 5B3JF 5CP7A 5DQDH 3L3JA 4P9HC 3O4OC 2UXFA 1IARB 2MQCA 3ULUC 1S9WB 1KFAL 3HHSA 3L1FA 5KUKA 4GRWH 3US9A 2P48B 4GB9A 2VN6A 3O9WD 4P5TB 1F41A 4XI5D 1N68A 2V6HA 4I18A 4C4UA 2ADJB 3FT0A 5IVXE 3FUIA 1JWSB 2A74A 2ZUQC 4AZ8B 2OTPA 1M7XA 3VSTA 1EAOA 2A4CA 5B7MA 5E4OA 5AWNL 1P6FA 2JKWA 3A6CL 1YPZF 3CZFA 4FP8L 2V7HA 2W65B 4IOIB 4RSYA 3ROLB 2ARJA 4K3GA 5GRZA 3PHSA 3W0WA 1F11A 1G7MB 1VGKA 3BZFA 4Q0XH 1W16A 4ZUUB 1SN5A 4PJFA 4D7BA 1QSZA 2PTTA 5JOPE 3MDJA 4BA0A 3SYAA 4EXPX 1QX1A 3DRQA 3L7EB 4X7TB 5AAWC 2IQAB 4BFJA 2ROYA 5JA9A 1DQTA 2YAMA 1A8JH 1ET5A 1UHVA 4NQCE 5IB5A 2BOBA 3DHMA 3NP3A 2DBLL 4IHBA 1F5WA 1YEWA 2ZIDA 5I66A 3ES6A 2V7NA 4PJFF 4DGWC 1ZCRA 1LQSR 4TUJA 4A2LA 1A6AA 3BLKA 4QRSB 4YEEA 3ZE1B 1LP9B 1WA1X 3VMPA 3HAEG 4FFZA 5EZIH 4HS8H 4N4YB 4Y9FA 2WBJC 2PO6B 4KJQD 4NJ9L 3IJ7A 1CYXA 1MCSA 5IMMA 3IJHB 4NQXB 5HHPB 3L7FA 4CMHC 4GG8B 2WTRA 1HWWA 5F7HA 1E4WH 1RUML 4XZUB 3FONB 3RFZC 2A1WH 3TVMD 4K8RL 2MTPA 3DSFH 5GIRB 2EVGA 1OM9A 2RCSH 3ORJA 4BE6A 3RVVD 2ZOOA 3FB8B 4JB9H 4X5XB 3UTSA 1ACXA 4GOSA 4B96A 4I9XA 2J8UA 1MCJA 1JF1A 3MFFB 1A7QL 4NT6A 2XXCB 3K5SA 1OPGL 1JPSH 1OCCB 3UC2A 1G7QA 4D3CH 1JYWA 4MNQE 1UM6L 2AK4E 5D1ZB 1FL3A 3CVDA 3L4WA 2NY1B 2AJ3A 3S98A 1HXYB 1CL7H 1QUNA 3STLB 3BAXA 4AC4A 3OKDB 4KKLD 5LG6A 2HN7B 3BEVA 1B9KA 3CU7A 2DN7A 1JPTH 1NCGA 3U6RA 2J8UF 5FA3A 2ZXBA 4APXA 4HUWA 3F8UB 1RUPH 3LKQB 1UB6B 1NCNA 1IC1A 4G8IA 2J25A 5CR8A 2CKBL 2JJUA 1IQDA 3QJVB 3G5YB 3HRPA 1HZHH 3QXDA 2Q9OA 4HFUH 3KPSD 1NBVH 3KWVA 4YAQA 3TBTA 4H20H 4TNFA 2UYLA 1O6SB 4QXUL 1RZPA 1YPZB 3ARRA 4WWKD 4UQIM 4J1UB 1LLAA 2MQ0A 5BRZE 5JXED 2B14A 4KJYA 4M7KH 5F7DA 3S48A 1RIUL 3HKFA 1NH6A 2ZG2A 1PIFA 2YOAA 3CFDA 4BBWA 4V1DE 2CBTA 4IRSA 1SLUA 4GRWF 1YUHA 4MA1B 4I0PA 2UV3A 4PMEA 4UBDC 3VWKB 3WN5A 5KYXA 2A74B 4KHTL 2WUCH 4AL8L 4ZUTA 5EU6B 3DV4A 1ZDQA 3T2NL 2EXWD 1CWVA 2YD1A 1OE2A 3V4VL 4B9GA 1I7ZB 2K8MA 1I1AB 2YK1L 1JERA 3TA3A 1AI1L 3L08A 2VQUA 4OLYL 5SWZA 3EOBB 1ITCA 3B5HA 2W1NA 2X4OA 3QZWA 5C08A 1F11B 4WKZA 3ULVF 1HHKA 2DOCA 3T0EA 3I9IA 4OFDA 4UIKL 4PJFB 2ZPKH 4PB0L 3ZDYB 2PTTB 3D0AA 5D1XA 2F5AH 2BFGA 4F7CA 2HVJB 1WITA 2OMWA 1XHHA 2ED8A 3DRQB 1ZLWH 2FGWL 1T1WA 5DK2A 3FDWA 4YJZL 2KERA 2W07A 4YSAA 3SKOA 4KX7A 5D93C 4NO2A 1VCBC 1KACB 1EEYA 3FT3B 1E2ZA 4PIBA 5I66B 4MJ5A 3SKJL 2D2OA 3VFUA 1CTOA 4GAGL 4FGMA 4TUJB 1VJSA 2KHAA 5TGBB 5T33L 2DTMH 1MVUB 5CP3H 4GXUM 2IH8A 2IOOA 2PW1B 3JT2A 4N2IA 3NJLA 2ZCHH 3ARTA 3KLQA 3MU3A 4FTVD 4PJ8C 3H8NA 3VXSB 3AQXA 4Y2DB 2N0KA 4WHDA 5F6IC 1I1YA 2UWEA 5DUMH 1ZLSH 2AI0L 5GGRA 4ZNEE 3HJEA 2WTRB 1KCRH 1FAKT 1MVFA 4O2FB 3SPVB 2I7SA 3V5DB 3ZTJH 4DQAA 1DQML 3R8BB 4ONHA 2BY3A 3ARPA 1MI5D 5DYOB 1KPUA 1E4XI 5EU7C 1A14L 3VDAA 4Q9QH 1KBPA 3WLWD 2GUOB 4FZ8L 3OF6A 1XGRA 3HRZB 2Q8BL 4HXBH 2Y72A 1N7MH 3ELAT 3IE4A 2EDNA 2CHNA 1ZGLP 2DMBA 1MW2A 3EH2A 4NO5A 4NT6B 4P49A 4QRFA 1KELH 3U36B 3HNSL 4J2XA 1G87A 1JK9B 1G7QB 2UWEF 4L4VE 2C9QA 1ZHNA 3RWJA 2B59A 5A2IH 4FCHA 2ZXGA 1MCEA 1XF4B 2E76C 3PLYA 5HGBB 1T20B 2DQHH 4ZXBD 3UG4A 5DTFA 1D5RA 2H2PC 3GI9H 4JG1L 2X2JA 5GSVA 1OP4A 1TZGL 3P0GB 5BZXA 4IRJC 2APSA 3ZKXC 3UYRH 4QRQB 3IGKA 2E9IA 3U6RB 3IMTA 5FA3B 2KBGA 1NCAH 4APXB 4GRWB 1BVLA 5T1DH 3IETA 5FDWA 4G8IB 2O5YH 5K5YA 1DJHA 1L6XA 4TYUA 2N4IA 4XOBA 4KH9A 2DM3A 2P80D 1CXFA 3ESMA 4WHYG 2JFCA 3QG7H 4MJIA 4AH2B 4JG0L 2HH0L 4U2YA 1TTAA 2KLTA 4NX0A 1XGPA 3MJ8B 4JDTL 3L3HA 3ULAB 2CR3A 4OJFH 4P5KA 1JNHA 4P46B 3WDHA 3NJJA 5C0CB 4ERSL 4IRSB 1V3JA 4Y1AD 5HYFA 1U2HA 3IE9A 4DT2A 1QLFA 4HC1L 3WN5B 4MJJA 3CBKB 2ZXCA 1PLCA 4YSTA 4HEPG 3SN6N 5KYXB 3FTUA 2Y36L 3GK8H 1D5XA 3A4DA 2B0SH 3SO3C 1L9MA 4HBCL 3C60B 3OHMB 2ZXWB 2RB8A 4F20A 2YRPA 2ZP8A 1EV2E 4IOSD 4L3EE 4JFEE 5SWZB 2ED9A 3RDTB 3WJMA 4QRRA 4FA6A 3QZWB 2X4OB 3PY9A 1HIML 1MCDA 1TYRA 1MIMH 4JPIA 4OZGE 5C08B 3GXTA 1TSHA 1UA6H 1VA9A 3MBEB 1JCKA 3B3IA 5EBWA 4H5SA 4GMSH 4PLOB 5D1XB 4MAYA 4F7CB 3IMUA 2G3MA 5DDHB 1GMIA 2OMWB 2NY6D 2CDEA 1E2VA 1MOEA 3Q2WA 5ERWA 2J21A 2UUDH 5DK2B 4AW4A 5T5NG 3MYJA 1KYOJ 3RYMA 2W07B 4PTUB 3CPUA 3JBG7 4ZK8A 2AJUL 3HHMA 5E1AB 1L9OA 1NFKA 1ZVSB 4K8RD 4I4WA 3GSQB 2HUEA 4FG0A 1SPDA 2YGVA 3JWNH 3I6KA 3K72A 4OLEA 3ZHFA 3VD2A 4PJ6A 3B9KA 1U8QB 2I32A 5C0GA 1E90A 2NY3D 3FYEB 2NY2B 5I73B 2YEZA 3DHJA 1U8NA 5D7KD 1MAJA 2QKSA 1I1YB 3H0TB 3VXUB 4IU3B 5I17A 1C7TA 1BF8A 3E8VA 3OR7A 1NCWL 3TF7C 1EO8L 3Q44A 3G6DH 4FNRA 1NCIA 5HTSA 5F7AA 3EBGA 4WWNA 5MEND 1OAXH 3AWGA 2BX5A 3BX7C 3ARBD 3UZEA 4K3DH 1KTCA 1XGRB 3QIUD 2PPFA 2VERN 3N0PB 4RMTA 2A83B 1BQKA 5ID1A 5JZ7D 2ZWLT 3RQ3A 5JPNB 1J0YA 1DQDL 3LEYH 3VE0B 4QY8A 4PJHA 1YN7A 3X3GL 4PY7A 2R0LH 3HG5A 2B59B 4ZO9A 1OCWH 3BUDA 3HZMA 5ICYB 1UC6A 4B9JA 1LMKA 1WC7B 2WXGA 3FT9A 1OCZB 3DO4A 3SDAC 3U6XS 1IBBA 4JRYA 3FO9A 1KDJA 5HSFA 1S9YB 1KLGA 1EK3A 3BZ5A 4PRHB 2BSSA 5KYUA 1NKGA 5L7XL 4ZAKC 4X4KA 2YC1B 1UJTA 1BVLB 2WTOA 4N25A 1I9RL 3RZCC 5FDWB 4HW6A 3HE7C 4UILL 5EEWA 4FZEH 2WCPA 1KCBA 4PJHF 4E9RA 4I77L 1KN4H 4PJ5A 5I1EH 2PYFB 4LVOC 3ZSSA 3ULUE 2AANA 2NZIA 5I26A 2A6KA 4JANB 4CGUB 1XGPB 1S9XA 2O6DA 4N1CA 4UTBH 3P40A 4DPBX 1CD9B 1ORQB 4KRPC 3ZHNA 1Q72H 4EO5A 5IV2B 5CINL 3B9DA 1BV8A 1IBGH 3CMOH 4P5KB 2WV3A 5C7ZA 3CFTA 3CQFA 3SCMC 5EZPA 4ODUA 1URIA 5ICUA 2ZSWB 4NZDA 4XVOA 1ZSHA 1YYML 3FT1A 3QPXL 5CEYB 1QLFB 4U49A 2H1PH 5CGYC 3VG0L 5ICZA 1M71A 1VCAA 2Y2WA 1DQLH 4UF7C 1UD4A 3WNLA 3C8KB 3FUNA 3MLTB 4YDVB 5C0AA 4E42A 4ZMVA 5AOKA 4NKIH 1KJVB 3TXAA 5EDXA 1J1OL 5F1IB 5IQ9A 3WJMB 4QRRB 3H54A 2PWFA 2W0FB 5LHDA 3G6AA 2HTLC 3EH5B 4JPIB 5IGXH 4KJPD 1T5WB 1Z9PA 4AYEC 4Z7QE 2W91A 2FLBT 5C6PB 1KXTB 1I7UB 3D0VB 4XWOD 3VI4A 2XACC 3B3IB 4FXKB 4RQQA 3JV0A 2R29L 3ML8A 3F3HA 1CFVH 1CPUA 2GTZA 2P52A 4HIXL 4KK9C 5J6GB 1UJ3A 1HU8A 5ERWB 1SN2A 1QFUH 5E2VL 1T0NA 4XVTL 4WAFA 2BC4A 2YS4A 3BKML 1BZ8A 1E5UI 3UTPE 5DEFA 1S7SA 2ZAIA 1FDLH 4I4WB 1V10A 4UQ2A 4N85A 4FF9A 4U1GC 3I6KB 5FB8B 1MH5A 5ABAA 3VFTB 2EDEA 3B9KB 3JVGA 5FO7A 3C8DA 5EC1B 5FGRA 3VGEA 4MDJB 3AT0A 2XZQH 2VLME 3CSYA 2QGCA 3QJHA 1TENA 3FB5B 4G3YH 4A7GA 1CS6A 2VZVA 3I6LD 1KBWA 2GBVA 2OPCA 1CIDA 4K9EC 5L9DH 1JS4A 3SDXB 1AKJD 3NG5A 3VSQA 4J3SA 1BBDL 3VI3E 1THCA 2QSCH 4QXVA 5DZ9A 4AQEB 4CVUA 4UV4L 2M26A 3MRFB 4ZX3A 4B9YA 1NCCL 4MMXA 2V17L 3RVUC 4A2EA 3NIFF 5HJBA 5CBAA 3NTCL 3ECBA 3DUUA 3G5ZA 5CGTA 3IFLH 2KZWA 2D4DA 4NRZA 5DMGD 3OAZK 4GINA 1X5JA 1AHWC 4A7GF 5AW6B 4HCGA 4OQTH 4BH7B 4GNKB 4YX2H 3HFML 3DHUA 1CFSB 1KIQA 5F9DC 4GBXD 1VGEL 1N6QL 1YJDC 3K6FA 3N0AA 2NXZB 4QHPA 4DJMA 2VN5A 1G9MC 2DEWX 1E43A 1CK0L 5KOVC 3EG9A 5LXVA 2B2XL 1GGUA 1RJYA 2MOGA 5HDOA 3O0LA 1GGBH 2R39A 1FC2D 1CVRA 1KLGB 1X5KA 2YQBA 2BSSB 3PWLA 5IVZA 2F54D 1PLAA 5AW0B 4JR9L 2A77H 5IJCC 1S9VA 2XLLA 3TZVC 1FF5A 4L8BA 1ZIBA 3NCFB 3O6LL 4YHKH 4WO4C 3KE0A 4QDGA 3KWTA 4PJ5B 4GAFB 1I8MB 3O8XB 3T9WA 1PTZA 4KV5F 2DM4A 4OGXH 4C56D 2ED6A 3GHEL 2VXTL 4YWGL 4L8DB 3HIZA 1Z9SB 4LSUL 1S7UB 4J8QA 4EI0A 2GI7A 2YPKA 3QCVL 2X2YA 2UX6A 2VW6A 1QBLL 1OLLA 4F3FA 2LAGB 3EO9H 4N8UA 3SE4C 3O81A 2FSDA 2I07A 4FS0A 2FE0A 1IAOA 3LZOA 4GQZA 2AF2A 4NDMA 5TE7H 3GSWA 4GQRA 4FEIA 5AVZB 1PEWA 5DJXA 3U46B 4F27A 4MB5A 5ICZB 2ORBL 3SODB 1XH3A 1I7RA 4OF5A 1RZKL 3A22A 5BOZG 4E42B 5J8OA 5HYJB 3D3VB 3PDOA 5HD8D 3UPRA 5IM7A 2NY5L 4S1SL 1TQWA 4YDZA 3DRTA 3OKEB 1A0QL 3BIKA 4S0HA 3EGSA 3LQMA 1UVQA 5IQ9B 5TDPA 5T1LA 3RWFB 1ZANH 3G6AB 4BK4A 4H8UA 4X5WB 5I1HL 3KVQA 5KYNA 3IFNH 1KOAA 3PE9A 1A6WH 1UWGL 5DJDA 2NW3A 1TZIB 3M6DA 5E9NA 3BZEB 1BAGA 1EAPB 5IROC 3BD4A 4QJ5B 3TO4D 1A02N 2AQNA 1DL7L 4B41A 4XAWL 2VM4A 4U4IA 5ACZA 1P4IL 3O2WH 4MNGB 1UJ3B 3CN0A 2H3NA 3NACH 4AGMA 3VWJB 1DBAL 3MRIA 3MI6A 3EXJA 5J9PA 5IB3A 4BSWA 3GIVB 2QPEB 4YHPB 5LAPA 5BOPA 1TJIL 5JPMA 1RH8A 4OUUA 1MH5B 3N6YA 1HS6A 5C0EA 5I71C 1RY7B 2AABH 3IFOB 2DQJL 3NIFB 4NUGH 5I76B 5IMOB 3CSYB 2QPUA 3QJHB 4EXKA 5FM5M 4XVJH 1XF3A 2PYEE 4WUKL 5FGBA 3QNZA 1KB5L 3HC3L 1J8SA 4MNQA 1LO5A 2AK4A 5FFGA 2H26A 1O75A 3PU7A 3KGRA 2EEDA 3FQ1A 2YJLA 1TVHB 4AJWA 2YUXA 1O6TA 5F7UA 4XP4H 2QDWA 1OARH 4JFFD 4OFVA 4AQ1C 3RUGE 3SGJC 1N5AB 1EEUA 4W4OC 5I18H 3UTZB 2HT2D 5CBAB 2XSKA 3EGDB 3K2UH 4P05A 3ZSTA 2GUYA 3TCTA 4ODTH 1E4JA 1LDPL 5EN3A 4E9YA 4LSTH 4OLWH 2AFNA 5ANME 1G7LA 1OSZA 1B2WL 2VNCA 1KIQB 5HVGB 1H3PH 2WSKA 2OP4L 3PDDA 5BRZA 3ARWA 4TRPH 2ESVD 4DK3A 4JY6A 4M6ML 4U1SB 5JHBA 3D34A 4QD2E 4V1DA 4M48L 5C0RH 5HHQA 2Y6SD 2C1PA 2BOCA 2LLLA 1Q0XL 3BPOC 1IZJA 2WN3A 1WLHA 4QKTA 1E5BA 5I1GL 1SHMA 3A6BH 4L8BB 4E9TA 5AVVB 1O9ZA 2VLRD 3ZOAA 2JKRM 3E1ZA 2RFXB 4NWUL 1L9PA 1HL5A 2ZUTA 2G4GA 4OGQC 3VGGA 4LSPL 2X4RA 5DMKB 1T66C 2HRPH 1KTLB 2YPKB 3QWOA 4OZHE 4TSCH 2LT9A 1FL6A 3MVSA 4F3FB 5IBUB 2A73B 4LLMA 3F5WA 4FQ1H 4KKPA 5F21B 3O3DA 5CNHA 5E1GA 4X7FC 1IAOB 4PGBB 4CVWA 2UZYA 3ARDC 2N7SA 1J05A 1FFNB 1PKOA 1YNLH 4FQLH 1JTTA 3FOLB 5F9AC 1I7RB 1TR7A 2XFGB 3L5JA 4Q14A 4BZYA 3GSOB 3PDOB 4MWFA 3UPRB 1UFUA 4LCWD 4JFVA 3EGSB 3LCYA 3MV7B 5T1LB 1VZIA 3RWDA 1U93A 1WT5C 1XXFC 3CV5A 3BW9A 3MBWA 5LQBL 1GOGA 1Y6NR 2VISA 5DJDB 4LLAA 1KJMB 2N56A 2NW3B 3RX7A 3DX1A 2VKWA 4WI3A 4YL4A 3UYPA 4KQ3H 3EF4A 4PRNB 3D12B 4XP5L 2LLNA 4P2CG 5FYKL 5ACZB 4ZNEA 3GEFA 4LAQH 2ALWA 5JNYA 1AG0A 2AW2A 2DH3A 2XY1A 4WK2B 2GSIB 1NCOA 1TZHB 2R51A 3KBHE 4FXGC 3ZHLA 4PYHA 4JKNA 5CEZE 4QUOA 3QE5A 3GRWL 1SJMA 2GJZA 2ZKYA 1MFEH 1NC2A 3AREA 4Y4HD 3LZFH 4OZIF 2C9VA 1UM5L 4IDJH 4RFOH 4M02A 4AEEA 4OUUB 1Z3GH 3DXAD 3QFJE 4TNEA 3NBNA 1J5OL 3P3YA 2IANB 3VFVB 1U8OA 2B9BA 2QQNL 2FECI 2X6MA 2OMUB 4UMSA 1AQMA 2F8OA 3UJJH 4L4VA 5I15L 3G5WA 2NNAA 1T1XB 5AKSA 1ETZB 3Q05A 1O7SA 2IOMA 3ESNA 2VXUL 3GMNA 4HJ1A 1G9NC 3G04B 4LHUG 1DBKL 3DMMD 4X7EC 1KDIA 1QBMH 2P5PA 2KLSA 3D39B 5KVEE 4LZKA 3EGXA 3MX0A 4FQHB 4NJAH 4J27A 1QFWI 5DK0A 3BRFA 5H35A 2N7BA 1QRNE 3Q2CA 3BDXA 2FX7H 2IGFL 4JFDD 4KKQA 3RGVD 1U92A 3SY6A 2VMFA 4GIPD 1G7LB 2NNRA 2F1AA 4NBYB 5TK2A 4J23A 1CBVL 4YOKA 5IR1A 1GW0A 5LUMA 4W9EC 4P4RA 3BDBA 4KZEL 2ZXDA 1EGJH 4V1DB 1FJ1A 3W39B 4BUHA 1DVFC 2EE2A 3DTUB 2CIIA 4QRUB 4UCFA 5DZNA 4P9HH 5KEZA 3D5OF 4G9FD 4LHJB 5F6HI 2QBWA 2X6BA 2JCWA 4NQED 4W9KC 2YBRA 4F8QA 1GAFL 3MV8D 3L48A 3LQAL 4X6CF 1U4EA 2B1HL 1OM3L 2BSBA 4PV1C 3AMKA 2XKNA 3CH1B 5C8JA 3UABA 1UXLA 4L3EA 4JFEA 2ZWKA 1PIGA 5DHEA 1GOHA 5EF0A 1AY1H 4OZGA 1FL6B 1H6FA 1QEXA 2K6ZA 4LLMB 1AQKH 2A0LD 2VAAA 4XNQB 3PWVB 2FCBA 2ZF9A 5C97A 1VACA 3TF4A 3LZNA 2WNKA 5B1CA 4PUBL 1DVQA 1J1PH 3NP4A 3QXVA 4JPKH 4OFYD 3WIHL 3BPLC 2CIKA 4YHML 25C8H 2WHVA 4MWFB 2HFFA 2YRBA 4NC2B 3O6FB 2WVVA 5I6OA 3S6CA 5KVDL 3B9AA 3DC0A 3GZOA 4OZGF 2GAZA 4KMLB 3OXRB 3TJEH 2HAZA 4LEEA 4OGAD 3I3EA 3EYOA 3RWDB 5LGYA 1U93B 3RY6A 1E3XA 2QKIA 4OZIB 5IB1A 1CLYL 5DA4A 3MBWB 5AEAA 4WNJA 2JJSC 2BS8A 4IYKA 3OLEA 2R7EA 2VXSH 3UYPB 3H7BB 4HK0A 4MB3A 4OM0H 4ZZKA 2LOEA 1X4XA 3TT1H 1FGNH 4HSAC 4DP4X 3H53A 2CM5A 3QUYD 4HFWA 4DHLA 2PTVA 4L1SA 4P57B 1VFAA 4EQ3A 1U3JA 2P7TA 3H9ZA 4U1LA 3BFWA 4PI0A 2HRHA 2YN3A 3CZNA 4XMKH 3W11D 3ZUCA 4R7XA 1HL4A 3AREB 5FLVA 3FSAA 4OGZA 3PP4L 5KOMC 1A1NA 4CRPA 1AACA 4F1ZA 5H37G 2X6VA 2WD0A 3T09A 3FQRA 5AYTA 3N9GL 5ESAA 3CDGA 3NZHL 1I8KB 1RZ8A 4K23H 1LEIA 1U8OB 3RVWC 4DSYA 2NNAB 3G6JE 5J1AA 2BXZA 5F89B 2XWTB 1WDAA 1PZ5A 3KPRB 1WCBA 2HVBA 4BJLA 3W9EB 4RGNE 4WFEE 1M4KA 3AXHA 5IBTL 3S0PA 2AEWA 2P47B 1HKLH 1BVKA 3Q9QA 2I9TB 1QG3A 2W81C 3NN8A 1R5WA 3SJVD 1R3LA 1F42A 1EJ6A 1LO4L 4KKAD 5DMIL 1CGXA 1U36A 3L3IA 4G1MA 1OGSA 1JV2A 3MX0B 2VITA 2WLHA 3SE8H 1EGJA 4LPVA 5DK0B 5H35B 1RZJL 1JNJA 2VZTA 5KJ4A 3MRPA 4M1CD 3ARQA 4ZQKB 3LXUX 4X6CB 5KW9L 4K3EH 3SDCC 2XVBA 5GRVK 4FI8A 3EJZC 1R19A 1U8CA 5KG9A 3L4VA 4LCIH 2D31B 2X4QB 3MV9E 2VQ1B 3RPBA 2R69A 5DT1H 2EABA 2ZYRA 4LLDB 4PTTA 3U1PA 3CFBB 2HFEA 3C08L 4LXFA 4ELME 1DDHB 4NZRL 4QTHA 3KLSA 2FO1A 4JKKA 1I9EA 5F3HB 1XR8A 2IXQA 2DTSA 1A1MA 4OD1L 1BHGA 5ICXA 1I9JH 4GRLC 2TRYA 4ZO8A 3VD4A 4LCYA 3Q7JA 1ASOA 4ODHL 1MLBB 4TSBH 4MMZC 1IM9A 1VF5C 4P3CH 4PYGA 5DHYA 2NW2A 1CF8H 1IEBA 5LGKA 3P4MA 5J11B 2VL4A 2EH8H 2XWJA 4N0FB 1Z3RA 1B4JH 5C70A 1JV5A 1OZTG 3I6SA 4MD0A 2IWGA 1HXMA 3JUYA 5EUOF 3UX9B 3MGTA 7TAAA 4WUUE 2VAAB 1XMWA 3NSDA 5AAWA 1JHLH 3EHBB 3OX8A 2W88A 4HWZB 4JFTA 3V5KA 3PAUA 3LIZL 3CFIC 4TOYH 4HSCX 1BIHA 2WBXA 4I2XE 4FKHA 4UOJA 5FYKD 3COOA 3QYMA 5C07E 1B88A 2WBWB 5TH2B 2GAZB 1J8KA 3L1OH 2D8KA 3U25A 4IRZH 1JZ8A 4G6ML 4XHJD 1ADQL 2DIAA 2F7IA 5E9DD 5CHNA 2QKIB 3CX5K 2RALA 4D8PA 5IB1B 2WBJA 2WXHA 3AAZB 1EQWA 4KK6D 4IM8A 4ZFZB 1YECH 3KLHC 2QSVA 3L5XL 2WO3B 4MXVE 4WTZG 5HP5A 4NBXB 1T5KA 4HGWB 3I9GH 3RFZA 5DC4B 5JYMA 4G7YL 4F57L 4XPFL 5EO1B 4HFWB 1VFAB 4ANXA 1IJ9A 2QPSA 3VI3A 3CSFA 3H4HA 1SOXA 2JB6B 1IGJA 3VQLA 3CZLA 3TCLB 3CSPA 4P4KD 5I5MA 4Z7NE 1LE9A 3A21A 3TEWA 1A1NB 1I3RA 1NBYB 3VJ6B 5DD1H 4BK8A 4XCEA 3RNKA 1UGKA 1NMCC 4URKA 1RZ8B 1LEIB 1WVZA 3SZ6A 2W94A 2K6WA 3SYPA 2G2NA 3V52H 2F68X 4AM0A 1PSKL 1XZWA 2VDKL 1AO7B 2BINA 4MCYB 4ZFOB 3VI3F 1WCBB 4Z7OB 4UTCA 2DIBA 3L13A 5EN2B 5EH1A 4HIHB 1AMXA 1G5GA 4Q89A 1JGEA 2JK5B 5GGUB 3NN8B 1R5WB 3QUZC 2VLJB 5MENE 2ENSA 4BYHA 2P42B 5D2NB 1HJBC 3QS3A 4KO5A 5EMYA 3PDGA 4Z3FA 1V55B 1MCPH 4LKCA 3PHAA 3WUWA 5IIEB 2IPTH 3WXWH 4M03A 5BV7C 4WZ9A 1NEZB 2NX5D 3MBXH 3O4OB 2OMTB 2Q10A 1LO3L 4KXZH 1K4CB 3B1TA 3NSXA 3UG5A 3OAUL 2OTUB 3VXTB 2KKQA 2X05A 5AW7B 1RU9L 1U8CB 3GZKA 2JXMA 2CO1A 4Y2OA 1N6UA 1V05A 4K71B 4XNYL 3RGHA 1OALA 3BSZL 4AG4L 2KQMA 2VR5A 5EUOB 2HKHH 4HD9A 3TTYA 2NZ1A 3T8XA 1IFHL 2DEXX 1XR8B 2IXQB 2K3HA 5CIPH 3UAEA 1QTPA 3UBHA 1V3LA 2DYRB 5ICXB 1GHFL 3D48R 4P9MH 5JUEH 2ZX8A 3F6IA 1BD2E 1DJSA 1IM9B 1RUAL 4K0OA 1KEML 4LLQB 2W0LA 3MLWL 2F2HA 4V2BA 5HDBB 1ZHLB 3IGAB 1NIFA 4G71B 3MUUA 5JXAH 3CNKA 1JV5B 1RJZB 4R3SA 4AY0A 1L9SA 3E0GA 1FUNA 1C12A 1JZIA 2C3VB 2LTQB 3IDGA 1UXSA 3OX8B 5ACMA 3S96B 1XGZA 3UZQA 3MNZB 3V5KB 3B2UC 4XBMA 5I0VA 5IHHA 1C5BH 5CZRA 7FABH 1R5VA 2DD8L 4AEIL 4I1PA 3CX2A 3E3QC 3TIDB 2H9GB 1BZ9A 4I48A 3RHWF 3B2DC 4R4FH 3BPCA 1AZBA 3LS5L 4ODSL 1DFXA 4PJ8A 3CSTA 4BA8A 5D7LE 5AAMC 3IDYC 1SBBA 3BHBB 2PYEA 4KTDH 1JXKA 3RFZB 1HQ4B 12E8H 4HPYH 4PBWD 1W2KT 4I87A 1DLHA 3RURA 2Y9RT 4KH2A 1ZJAA 1D6EB 4K7PX 3RUGA 1IGJB 3L4UA 1OPOA 3DX4A 2BRRL 4UB0H 2MOVA 3A23A 3TNMB 3HJ0A 2P24B 4DVRH 1U3ZA 3MKKA 4ENEC 2HVKA 3WHXB 4ODVH 3MRKA 3RY4A 3KYKH 4HDIA 5I6XB 4PW9A 4DIXA 4PV9A 3OWEA 2DQUH 2ZYIA 5ANMA 1MHPH 1KYFA 1TJGH 3FUMA 5FKPA 1RP8A 4AM0B 1HZKA 1ILUA 1G1CA 3I6LE 3BISA 1RIHH 3FU3A 5CKAA 4IRJA 4N2BA 1ZV9A 1CR9H 4XC1L 3RUGF 1A3LH 2OCCB 3WTYA 1N59B 2OJEA 4M1DL 3F7LA 5FF6A 1PD1A 2J6EL 3NIGB 5I1JL 5F8QC 4D2NA 2WOYA 1PG7L 1PZCA 2XN9D 4PLKC 5I2IB 4LKCB 3WUWB 4LAJH 2JH2A 1T1YA 1AOHA 3GJEB 3KLDA 3ETBF 5ADOL 5AALA 5C0IA 5F1KC 3AS1A 5CIPA 4IGBC 5FLUA 4RNRA 2ZYSA 3RI5K 1KB9J 2NUPB 4AIZB 3RNQA 5B4MC 2DDQL 2EIDA 4TKWA 4OZHA 3MLPA 1HNGA 3GXIA 5TDOA 2K9UA 1DJWA 3T4AB 3SQBA 5CO1A 1QW9A 2GIYA 2J72A 2ZG3A 3B83A 4RFNC 4M5ZL 4OZFH 5F88A 3T8XB 1EJFA 4WFHD 2F54E 3P3UA 3PL6C 3ALWA 4L29A 2BHUA 4M4RA 3KHQA 3WMSA 3L2NA 2H3XC 5IESL 1G1YA 1TPXB 2FHBA 4KKBC 4OBSA 1T4KB 3ESUF 5CSZA 5FDYA 3RA7H 1ZPLA 1B0WA 3QJFB 4K7FB 4TQIA 2X6UA 3MODL 2OQJB 5AOLA 5FO8A 1QR4A 5EU4A 3CDFA 4G8GB 3UPAA 3U2IA 4OZHF 2GCYB 5GZOC 3O3BA 3QUMH 3VXME 2EIZA 3OM3B 4NUJA 2ATKB 4P2QE 4H13C 1YMMD 5CCHE 4G6KL 1UWEH 2OTWA 2X42A 4OCYL 5I1IH 4L4TB 1C12B 1A9BA 4UDTB 1UUSA 2Y7QA 4IHOA 1E4KC 5E6ID 1KG0A 5ECGA 1YNTB 4RMSA 4AMKL 3IDGB 1XCWA 4R84A 2PW2B 1QAWA 3HR5A 2ZCLL 2GBUA 3GPEA 4O2CB 1CXLA 5IMLB 1MCRA 32C2A 4AUYA 5CFHA 4U1KA 5BOJA 1R5VB 4PRAB 4MS6A 3BFQG 2R9HD 4DGIL 2XCMC 3PXHA 4L37B 1HXKA 3SQOL 3PV6A 1NA8A 2EXSA 3QW9A 4XMPH 2D7OA 4FFTA 3UAFA 3IT8D 2VR4A 3LOWA 1WFTA 4PJ8B 3QFJA 3JVFC 2WIIB 4FFWD 4G7VH 4NRYA 2BHFA 5D7HA 4BFRA 1A7PL 3FTYA 3C2AL 1RZ7H 3S36X 1CUOA 1KCSH 4PJDF 2PYEB 4JNXA 3IXTB 3QIWD 3GS7A 1V7MH 2YD3A 1S5HA 3PAZA 2VDNL 3WKPA 2YA0A 1FORH 4JQXC 3DX7B 3VFNA 4ZFGL 3OLDA 4DP2X 3QEQB 2L4OA 5F0LB 4M5TA 4WFFE 1QLEH 3WI9A 4FTDA 3FKUS 4XMLH 3IMSA 4K9EH 5F7NC 5TF1H 1MW1A 1OB1A 2HVKB 5TDNB 2CUMA 1NGZB 2P46B 1QRNA 2HJLA 3BLBA 4HDIB 4YVNA 5EZJA 3T2PA 3AU1A 2PTUA 4U6YB 4I0KA 3P4NB 1IIKA 2R4RH 3CZSA 5A16A 3SDAA 2EACA 1NGQH 1AG6A 1M57B 4WV1B 1OT1A 2CRIA 4IBZA 1JZ7A 4HEME 1D6VL 3TPKA 2Y4SA 4UWQB 2VL5A 3Q06A 1X9UA 4ZAKA 3RZCA 2C9AA 2DWTA 1CXIA 2FZ3A 4M43L 3HE7A 1XGTB 1A47A 4GW4B 4HUUA 2MNWA 2SEBB 1BJ1J 1YQVL 4LLWA 1KLFA 3S5LA 3TASA 3GBNH 1UZ8A 4OT1L 5BS0E 1MFAH 4OZFA 3LKPB 4F5CE 5JDJA 3HG1D 1KGXA 5CIPB 5KBDA 1C16B 1PZUB 5EIIG 4CU7A 1RK0B 3SCMA 2ADIA 5DVKA 2XWDA 4A2MA 4JKWA 1P4UA 2XTJC 1BMZA 5FW7A 3P0VL 3QUMA 4MVBC 1A64A 4GW1A 3WAJA 2MTAA 4AIEA 5D6DC 3LKOA 4C54A 1NL0L 3CFUA 4C4KO 3T6XA 3P54A 3HI1A 5DRXB 3HPJB 4YQXL 5I30L 2F7RA 3UO8B 2O72A 4HJ0C 1A7OH 3QAZC 5AVXB 2C9XA 1MFMA 4NQSA 2IH3B 5GHWH 2NTSP 4HQQL 5E2WH 1CLOL 3O3BB 4KX9A 4WWID 3W9DA 4LSVH 5FECA 1ROCA 1OP9A 2BSTB 5IHUH 3LRSA 4W9ZA 4HHAA 1QWNA 1AP2A 2ZXAA 4XPHL 2XHNA 4A6YA 3P2DA 1HI6A 5JMOC 1U3HC 3HR5B 1TQUA 4NC1C 4RVBA 5KBKA 4PJDB 2QQKH 2J2ZA 4L0YA 3GSNL 5TFSH 5PAZA 5JHDB 3SDDD 2C3HA 5KVGE 1PLBA 1JFQH 4XPGL 3QQDA 5HDWA 2CDGB 4UQ3A 4GKLA 1WFUA 2ODIA 3S35X 4GAYA 4WTZA 1YY8B 1RMFL 5LNGA 4BQBA 3U6XA 4IU2A 1J5IA 2WCSA 2IFGA 1L6ZA 2DRUA 4WK0B 5EHFA 3MRHB 1SEBA 5F3BA 2DQDH 4GQQA 4UM8A 1BQLL 1GYCA 2YKLL 3G6JA 5MP6L 5IFHL 4JN1H 1NQBA 3Q1SL 1JYXA 2H5UA 1WIUA 4UYPA 1S5HB 4JHVA 3DO7B 2FBRA 3DROA 4HWBH 3VFNB 1SBSH 1FZJB 1ZTXL 2W92A 4V11A 4TQEL 1CGUA 1T21A 1KB3A 4DKEL 5DJ2A 1NC4D 4JLRA 3FH7A 4RMBA 3BRGC 1OSYA 1AHWA 2OMXA 5L2KD 1J0ZA 5KANI 1J5DA 4DZBA 3LJ3A 3GZQA 2CLZB 3G6JF 4JL1A 4CKVX 4FL4B 1TNMA 3RWGA 4OIIL 2APVA 1IQWL 5JOFA 4YPGA 2EADA 2IPKA 5A16B 5JW4Q 2FJHA 3PNWB 2EVJA 1BQSA 4ZMLA 3MV9A 1C08B 4LF3A 5CLTA 2P49B 2VH5L 3A5VA 3FQ2A 3TO2B 2DMGA 2VL5B 5HDRA 4LSQL 3U7WH 2TSBA 1MDTA 2V8LA 4ELMA 3HE7B 3TZVA 3E80A 3NFSL 1S9KC 3NJFA 1KLFB 3BC9A 4WO4A 3ALXA 1UZ8B 4TUOA 4JRXA 4LVOB 5DRWB 3AS2A 2IALA 3WTWA 2HP4A 4JFDE 1DN0A 3RILA 4KNUA 4TQPA 2VIRB 1CD0A 4U1JB 2ATPA 3X17A 3GHPA 2RQ8A 3AMLA 1A4JB 3SCMB 4QRBA 1OCOB 3W57A 5J12C 1C5DA 3T77B 1H8OA 1RIVL 3SE4A 4DAGH 4ELMF 1TEGA 4BDVA 4WUUA 5DD0H 3TM6A 4PJ7A 1TIUA 1HQRA 2QHRH 3V6ZA 4GW1B 3UROR 1AGEB 1MJ8L 3K2KA 4K7PY 3FCSA 1HHIB 4CC0A 3LKOB 5H2BA 5IFJB 2LU3A 1F8TL 3HI1B 2CJTA 1KB9K 1FNSL 2VMCA 4I2XA 3V9EA 1NOFA 2GQHA 1G0DA 2YGNA 4JFHE 2KYIA 2KZKA 4MA7H 5C07A 5SWSB 4Q9RH 3ZDWA 1IVTA 4ODWB 4O4YL 2NQCA 2APWA 1CYWA 2NPLX 2X44D 2W60B 3FOMB 4KRNA 5FECB 3S5ZA 3P0YL 4PJ7F 2C1OB 3N2JA 5IROA 4YHNA 4Y16C 3GJFK 4ETQB 2JQMA 4L8CB 4YFLI 2QFRA 2ZUYA 5H8DA 3B7SA 3H9HA 5GRUH 1ZHKB 3DJSA 2AJZA 3E3QE 5E6YA 2MHAA 3K71B 3O6KL 4QYOA 1CBJA 1NLBL 1QFWH 5JMRA 2V3EA 2VLKB 3DYMA 4R7DA 5HHVH 3QEGL 5EZOL 4HKZA 1J9RA 2WQVA 4KK5D 4FAAB 1EO7A 4FHJA 4Z0BL 2R1WA 3HMXA 3IU3B 1FRGH 3QCTL 3MMEA 3KVDD 4X80L 4TNVF 4YL9A 5C3LD 4UV7H 4CMMA 3QK0A 4HWBA 1NIBA 3D50A 4TVPL 1BA9A 5KAQG 4IU2B 3FSZA 5IEHB 3KPMB 1WO2A 4NZUL 1NLDH 1QLEB 1A1OA 3FAWA 4MXVF 3FU7B 3P77A 4UM8B 3KGTA 4P3DA 2GTQA 3KXFD 2FO8A 1JF5A 4HZAA 4PS8A 3VD5A 3V5HB 1CFTA 2OSLA 4AQ1A 4FG6C 3DROB 3SGJA 2ENJA 3M45A 3FUEA 5AB0A 1ZLEA 1EERB 2OYLA 1I9IL 4W4OA 4Z7NF 5HYQA 1HE7A 4HCRL 4HX1A 3KAAA 5JYLA 1AJ7L 5JLZB 5E23A 3S37H 4ZPVA 1AHWB 3EYQC 4EI5B 5TJWK 4F24A 2OMXB 4D7PA 5C6TH 5FYKU 2PP8A 1JXGA 1G9NH 2XX0A 2OKMA 1SLXA 2DLGA 3CFEB 2WXFA 4JL2A 2HRLA 4K5MA 3HAEH 3T6QC 3A3YB 2HKFH 2DW5A 2BVPA 4YPGB 4JMNA 3WBDA 1MRDH 3DOHA 1MFDL 1YN6A 5G2NA 4UOW0 1BQHA 3NAAH 1P7KA 3MV9B 4A7UA 2VO5A 3VQ2C 2AJVH 3V0AC 1HT6A 3WY1A 1NIDA 2XV6B 4LB8A 3OHXC 4PRPB 3TZVB 3S35H 1Q94A 1E0OB 1F45A 5FYJH 4KZDH 4HWUA 3H3PL 4JRXB 1QLRA 2IALB 4AYFA 3C09B 3I50L 3K81A 3BH8B 1DN0B 3RWCB 4DEUA 1BD2A 2AXFB 4E0RA 2ZCKH 2X4TB 4WWOA 4HWEL 5HHNB 4LRNH 3TBVA 3MV01 2YQGA 2D3VA 4M1GH 1KIPA 4M6OL 1BPLB 5GGSA 4AQZA 2I26N 1UADC 1F3RB 3N85H 3IF1B 4PJ7B 4A55A 3ARDA 4JO1L 4RGOL 3ZR6A 1NIAA 3IPBA 5EZLA 2A9AA 2NRDA 1V3MA 2VN7A 3KS0J 4FOMA 5EFIB 5KSUA 5JTWA 4UT9A 3CFKA 1DR9A 4LARL 4TSAL 5C2BL 1MFBL 2YD4A 4OCSH 2ILLA 1W8OA 2YKKA 1YA5A 1UOVA 3KCPB 4JPVH 3SO5A 1DVSA 4UM9B 3IDXH 3V8CA 1WT5A 4ZTOH 1A9EA 2GJPA 4P2RB 1K8DB 3H9YA 3CFCL 4OKVA 4ONFL 2X70A 3P11H 4K94L 3VNZA 4GXVL 1H0DA 1ZLDA 3ZE2E 1TOXA 5D7LA 1GGCL 2IADA 3VFMB 3CHXA 4YHNB 5HBBA 2Y7MA 1RQ5A 2FWOA 3MREB 5T3XL 5BZDB 3T0DA 3VRLE 1KCUH 1SDDA 2EDOA 3DX6B 4B9KC 5DHXB 3H9HB 5KBPA 2MHAB 2J1WA 3MRCB 4AM0Q 4FXGA 2VZOA 4Q2ZB 1F13A 4OLZL 4U7SA 2NY4B 3LEXA 4YK4B 1E6JL 3OTTA 2R1WB 5F7LB 3WV0A 5I1KL 1MIEH 3DIVA 3MMEB 3E6FA 3FPXA 3GS0A 3X1BA 3HUJA 5I71B 1NKRA 3BEWA 4Z7NB 3K8LA 3BAEL 3B7RL 1EFQA 3RB7A 3RPKA 3WG7B 4CNIA 3ULSA 4RWYH 1DUYB 1WBYA 3UTTE 5E9DE 1PQZA 1ZEAL 3P77B 1JZ4A 4WW1A 1X9LA 1SJHB 2C7UB 3O4LD 2PNDA 3MJ7B 2Z31B 4A67A 1SEQL 4JO2L 5AOJA 3ARFC 2BJMH 2CHDA 1KN2L 5HYSG 5ID0B 3MHZA 4E9SA 2NYZA 3QXTA 1FG2B 4MXWL 4F33B 4OSUL 1PFCA 2V9TA 3H6AA 1FPTL 3HUJF 5HYQB 3OG4B 4LNRB 1OLZA 2OI9B 4HX1B 2AV7A 5HHME 4QF1B 2K6YA 5A2BA 4JJ5B 2XUWA 3IU4L 4N0UB 2D03H 3VCLA 4JDEB 3NGBC 4WO0A 3V6BR 3H42H 4YHOH 3MLVH 3CZJA 5LKNA 2ZOWA 2E27H 1JHTB 3T3ME 5E5MB 3ZGIA 2QADB 1KGWA 3KDPB 4DKDC 4F8OA 2R0ZL 1KY7A 1BQHB 1OTTD 1UH4A 2JCCE 1MUJB 1JNLL 1S7WB 2P45B 1UT1A 3S88H 3AABA 1BQ5A 1DVFA 1QSED 3T8MA 4FFZL 1CCZA 5CS7A 5CXPA 1Q8MA 1NCJA 1YY9D 4NFCA 5ITFB 5GRXG 1V7NH 3FSWA 3RL2A 2P5WE 1JZ3A 2Z93A 2DQMA 1R24A 4JG5A 2IBZX 4I1RA 4K3JL 4N9OB 3G08B 4NM4H 3VXRE 3GMPA 3ARGD 5E7BA 2W9DH 2IH9A 3GMRB 3MXWH 4ORZC 1LEGB 2NYKA 3B8YA 3VXMA 1JGUL 4PR5A 3C5ZB 4IOFC 4P2QA 2B5IC 1Q0YH 4JM2F 1HOCA 1LWJA 1CU4L 1JSYA 4MNHB 1ZHBA 3X11B 3T3PB 1E2WA 4OQ1A 4URTB 1HH6A 2WLLB 3E6HA 5CBEB 3WIIL 1Z9MA 2V2WB 1F4WL 3AG3B 4L5FH 3RVTC 4HUXA 2ZTBA 1HHJA 2EXYC 1NSNL 5J3HC 4DGYL 2CNZA 5KSUB 1WZ1H 4ZX5A 1TCMA 4IIQC 3CFKB 2XA8L 5KSBE 4L05A 1C8PA 1MY5A 4JMXA 2PCFA 4WHYH 2XZAL 5GGTA 1AD0B 4MLSA 2CO2A 1N5YH 5B39A 1MKFA 2JJSA 3QO0B 4HKBA 1UM4L 4R4ND 4TVPD 3V55A 5D7LB 1UOKA 3LH2L 2V9UA 4NC1E 3HB3C 1W9XA 4YGAB 3OPUA 4E41A 3QWNA 5IB4B 1AHKA 2Z64C 4UOW1 4FFVC 1QHQA 1NPUA 3I75A 4YBQD 4ZS7L 2DI7A 1N0XH 2P8PA 2X5PA 1A22B 1YSOA 2Z1KA 4NSKB 4LSRH 4WHCA 2K9FB 3ULVL 2VZUA 3IJSA 4B6ZA 4ZW7A 5GS3A 3WE6A 3D2TA 4QHUB 4UDUA 8FABA 5IHZB 3HUJB 3BEWB 4EE2A 3OMZA 3QB7C 3FUDA 3NCWA 3RJDA 4OM1H 5HI3D 4H7VA 1ACYH 2HLAA 1WBYB 3T5WA 4WDIA 5B38A 2G60H 4G80A 3RIKA 3DWTA 1MREL 3HKZA 3IBOA 4MQSB 4Z76A 3FRUA 3S2AA 3ZKMD 3QG6A 4W68A 2DQIH 3R1GH 5KSAD 1QYGH 5DZPA 3HAEB 1IEAA 4HEMA 5BZZA 1JYVA 3BP6A 2DM2A 2OK0L 1HWHB 1OAZH 1IB5A 3H56A 2HPTA 1CIUA 4Y4KB 3WNPA 2BP3A 4UAHA 4HPOH 3WFBH 1REIA 2QV4A 3UBXG 4DETA 3GSRA 4HS8L 2YZ8A 5BS0A 4U1NB 3SDCA 1ZS8B 4F5CA 3VB8A 4PP2B 1UWFA 2B15A 4FMVA 2V2TB 2O5XH 1FH5H 5E1QA 2A6JB 4PV8B 4E9VA 4GKSA 1J8HA 2LVCA 4D0CA 2DAVA 3QIBD 2FJUB 1KC5H 3KHOA 4MD4A 4OTXL 4W9GC 4XNZC 4NHUA 4NAQA 3QNYB 5CUSL 3RWHA 2OXHB 3TX4A 1DVFB 2WSPA 3VX0A 4GP4B 1J5HA 2K1MA 2X4SB 4JB9L 4MHHI 3C5SB 4UIMA 4JM2B 5ILTH 2ROXA 4AW7A 2K8QA 2WLKA 4GRLA 3MO1A 2YPVH 4E2OA 5CAYB 1OT2A 2OCFD 2Z93B 1M1SA 4MMZA 5D1ZD 3MLUH 2XN9E 2VTFA 2K4WA 1FVDA 3B6SB 1U3NA 4NCC2 5HHOE 3O41B 5JZ7C 4NNXA 4TTDD 4QRPA 1IE5A 3H9SE 1ZXKA 4RAVA 1ECYA 2VLLB 1CL7L 3OZKA 4X5QA 3UJIL 3E8UH 3A6OA 5KSVA 4WEMB 4ANWA 3LN4A 4PR5B 1Q9WA 4X9IA 4D9LL 2P44B 1KT2A 4QHKJ 1HOCB 1WTLA 1ZHBB 4UNUA 4WJ5B 1CQYA 5L88L 1EZVX 3QJRB 4HF5H 4JY5L 3FJTA 3P30L 2B3IA 5IW3A 3E6HB 1DQJA 3BPLB 4LCUA 1A3QA 5T3XD 1EBAA 4CKQA 1E9PA 3D52A 4HUXB 2YO3A 1JPGB 1U8PA 2N1KA 4JM4L 2QLYA 2AEIT 4IMLA 5FV2A 3GXDA 1DJXA 4HG4K 5GS2H 3U2JA 2A7BA 2EYTA 2VOTA 2YQ3A 2FQDA 3ZE0E 1OGAD 3KH4A 2VUKA 1G6RH 2HT3C 4JFWA 4M5YH 4M7KL 2AEPH 3PWPE 5BUAA 1HEZB 2MKLC 3CC1A 4HUVA 3KBPA 1UYWH 2MCPH 1NCDH 3DTXA 2FNWA 3CVHA 2NY0D 4E41B 3A4AA 1T83C 3A24A 1FFTB 1UH3A 1EZUA 4N9GB 3I75B 3WKQA 1TU2A 3P73B 5HJDA 4CDHA 4YO0A 5E8DL 2F8VA 2P8PB 5LCVH 3W0WD 5AVTB 1QRKA 3MA7A 3CC5B 1OT4A 3ILPA 4UANA 1TO4A 4WQOA 5F8RC 3WE6B 3V6OE 8FABB 3B56A 5F9WC 4EN2A 3F6JA 3IAQA 4LDEB 2CPCA 4GSUA 4YXKH 1KCWA 4Z8FL 4PCKA 3SBQA 5MHSE 4N87A 5B38B 2F5AL 4KTGA 4F8PA 4Z76B 1SXAA 2PR9A 4XX5A 5EPMA 4A66A 4JVPA 2EEBA 3QDJB 5J7CC 4QWWC 5D9SA 3RKDD 15C8H 5ANHA 5JQ6H 3QUZA 3D08A 4ZYKA 3V79C 1JWMA 2Z8SA 1BEYH 1P5UC 3BUQA 2BW4A 4NZFA 2Y1VA 2Q3ZA 1CGTA 4PIRF 1VRSA 2DTML 3MAWA 3V4PA 3S4SA 1K5WA 4B27A 3B2VH 4XPBH 1OF2B 3B1UA 4MASA 4QYAA 4Z5RB 2EC9U 2N3JA 4OF0A 5AZ2L 2DQ6A 5DJZA 5DUML 4Q6IB 3SOTA 4ORGB 4APQC 1KCRL 3AADB 3F12B 4YSPA 4XXDA 1HINH 1HSAA 1J8HB 5BJTB 4D0CB 3KJ6H 3EDEA 4QTIH 3I2CH 5AVSB 3UTSD 3RWHB 1XSOA 4GPVA 4DVBB 4LBEB 4H8WL 1MHHB 4HXBL 1LE5A 2G2PA 2A9CA 1IKFH 4PGCA 4TUKH 2HSIA 1YEGH 3WELA 3N40F 1OQXA 1FVDB 3FQTA 1DQIA 3JTBA 1M56B 3KNBA 4LLYA 4NNXB 3WFHB 4QRPB 2LU5A 43C9A 4KRLB 4BHUI 4EN3B 3HG1E 3NH7H 2Y23A 3GI9L 1OSEA 3BVNB 2AGJL 2UVFA 3CIQA 5KSVB 2D4FA 3QJSB 3L5WB 4KU1A 3KPLA 4IKKA 1A6ZB 1Q9WB 1Z5YD 4MJ6B 4FA7B 1G6RA 1WCQA 1VEMA 4YDNA 3QUKA 1S7VB 3AACA 5H94A 1MAMH 2CO4A 3M8OH 3NCYP 5DR5H 1DQJB 3APDA 4LCUB 1KPVA 4PHXA 3QNXA 4R2GC 4PJGA 1CI5A 1U8PB 3HI5L 5CJQL 4H0GA 3WU1A 3CVIH 1WS8A 2E9GA 2D7TH 3QO1A 5T1KA 2X3AA 1M9WA 3CPLA 5EUKA 5IK3B 1CE6B 2NXYC 1NPNA 3PHOB 3ZX1A 1Q0EA 3HE6B 4BQ6A 4KTYA 3ULVD 4NERA 4G9DA 3KW7A 4XCFH 2FT8A 4I0PD 3O0RH 3TLRA 5AAMA 4F2FA 5K9KA 1PZBA 4AJVA 1OEZW 4FD0A 2WIMA 3SBPA 4P5TC 2G3NA 4KXCA 4PJGF 1BX2B 1JDDA 4G6JL 3EYVA 4HK3N 5EWIH 2D9CA 5LAXA 2B0SL 3TA3D 1FI8C 3IJYB 2OMYA 3MLXH 2UZIH 2EZ0C 5SWZD 2AVFA 5FHBH 1HEJC 4YO0B 3SKNA 5C08D 5D70H 1IC5L 5LXGH 4WFGD 5D7EA 4PJXE 3T0ED 1F4XH 2E46A 4P23B 4WEBL 1UA6L 1OZUA 2BS9A 4MA8H 5TQ2H 5D1XD 2XKSA 3SBWC 4X83A 3UTQA 3TFKD 5CJOH 4GMSL 1DDTA 1Y07A 2R4SH 1EZSA 4KVNH 1AD9B 1RZIB 1Z5HA 5A6MA 5JHLA 4YGVB 2B20A 2B4CL 1E5ZA 2WLIB 3AQZA 2EIBA 4GMTH 4HIEA 4FYSA 4W9LC 5ETUA 5GJSL 1IT9H 3PV7A 4L9LB 4TTGA 5DFVC 2APFA 1M6OA 3TPUB 3DVNB 2A38A 4UQBA 3EKCA 2VR3A 4ZYKB 1WV7T 3DSNA 4JFOA 3WEXB 4F7EA 1IAMA 5CMAA 4E9XA 1EBPA 3GBML 3S4SB 2RR3A 3CXDH 4XH2A 4IGBA 2YARA 2WWMD 2FQEA 4RIRB 4XPAL 1TTRA 3NCMA 1AZZC 4ZMWA 2PO6C 3FFCA 1XAKA 1HSAB 1T7WA 3CZKA 4JK0D 4U6VH 2NTFA 2IDUA 2YD6A 4JFXB 2VERA 3ZR5A 3OF6D 4ZOCA 3V0IA 2WXKA 3JWDL 3LB6D 3PL6A 3BQUB 2X10A 4Z7WE 3TN0B 1LE5B 4WTXA 3F6LA 2NYYD 2BIMA 3M1BA 4PBDA 1BWMA 4NM8H 5EV7A 1MF2L 4LIQH 3J07A 4N8VA 2E4FA 3V4UL 3ZGHA 3FQTB 1H9VA 3D6GA 4PWJA 3OC8A 5T3ZL 5GZOA 2ICWJ 5I0XA 3FRPG 2IMMA 5JW4N 1H3UA 2NY1C 2BVEA 5FCUH 2G0LA 5CEXB 3ZY7A 2YEVB 1UASA 2BSDA 1E4KA 2GG1A 3KPLB 4HMDA 5C09A 2L7UA 1G6RB 3T65B 3BE1H 4JE4B 3ZRFC 3LD8B 2BP0A 4PP1D 3D7PA 4GEJA 2Y07H 4KXDA 3ILDA 5H94B 3BXNA 4XAKE 1IAIM 2E74C 3WAKA 1JTPA 2FVNA 4FZEL 5F7YC 1KPVB 3PQYE 5C0ND 5JO5B 4MJID 1LD9A 4ZMOA 1KN4L 3PCYA 5I1EL 2C5DC 4PJGB 3QO1B 4NS0A 1NBZA 2ZOKB 1FYHB 1JN6A 1RV6X 1Q72L 2JB5L 3CHQA 4Y19E 1IIIA 1VADA 2YN5A 1ZA3A 5E03A 2Z35A 4BSVB 3GS4A 4KVCH 5C0FA 3FF7A 3VRLF 2CLRA 2FL5B 3UTTA 3MZTA 3F2LA 4MA1C 1ECZA 3MTXA 2XWZA 1DQLL 2BSRA 2PXYB 4P07A 3VWKC 4OKDA 5K9QG 1R47A 4JQXA 1AQ8A 2OZ4H 5T5FA 1IILE 1ZVYA 1INQB 2J4WL 4AVKA 1UXWA 2OMYB 3NFNA 4MBOA 5CCKH 4TV3A 4QRRD 3EXLA 1D5ZB 2OYMA 5C86A 4MAUL 4XMUA 1I1AC 3SKNB 1TUPA 2AQTA 3AGWA 3MRBB 4NP4H 4NZ8A 2NNFA 1SJEB 2EQDA 2G5BA 3D4CA 3GUFA 1ORSA 2Y7NA 2ZOLB 4OBRA 3U9WA 2Z7ZA 4MAYD 1NANH 2OA9A 3AZUA 3DX0A 4DK5A 1X4YA 1CE1H 3O2DH 4ZOAA 4DP0X 1HL8A 1RK1A 1DJIA 4TL5A 1WWWX 5DZAA 4PS3A 5G4OA 3QJQB 2CRZA 4RGMB 5HPMA 5IW6B 1EZVY 5GS1B 1SUHA 2P5EB 1QFUL 4HIEB 2Y0SA 1MW3A 1TVBB 5DD3H 2JCCA 4A2FA 5FM8A 3KPNA 1K8IB 3RL1B 4N22A 3QRBA 1FDLL 4O02H 4DP6X 3B9KD 1GXEA 3VO0A 3IVKA 4JFOB 1JNNL 4F7EB 4P8QA 4FMKA 1IBZA 4MXQD 3VXPA 2BSEA 4QRTB 3ZUNC 1NGYB 3GMOA 2P5WA 2XZQL 1CURA 2DWXA 4FEMA 4N5ED 3T3MF 3UC0L 3MACL 4DGVH 4Z3HA 3BVTA 1NDMB 3VXRA 2DQTH 1OP3H 5L9DL 4Y2DC 3FFCB 1GSKA 2JCCF 4NGHH 4AI7A 2X09A 4OVVA 4F7KA 2VZ3A 1OTUD 2KZBA 1W0WA 5DUPH 2V2XB 3BIBX 3OB8A 3D33A 5K1VA 5D6DA 3PL6B 1MG3C 1JJUA