2E7DA

Crystal structure of a neat domain from staphylococcus aureus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
DQLTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein IsdH
publication title Structural basis for multimeric heme complexation through a specific protein-heme interaction: the case of the third neat domain of IsdH from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2e7dA00
3QZMA 2ITEA 4NLAA 3QZOA 2O6PA 2MOQA 4YMPA 3SZ6A 3S48A 3QZNA 3QUGA 2K78A 5D1QE 4MYPA 5D1XE 3SIKA 3QZLA 2ITFA 2Q7AA 4WJG3 3VTMA 2E7DA 3VUAA 3RTLA 3QZPA 3OVUB 4FC3E 3SZKC 2Z6FA 3QUHA 2O1AA 4H8PA 3RURA 2H3KA 5D1ZI 4H8QA
chains in the Genus database with same CATH superfamily
2W38A 5DC2A 2CO7A 4MXVF 1BG1A 2IV9A 1NBYA 1NEPA 3FT4B 4Q2ZA 3DUUA 3WS3B 1DVFB 1E42A 1PTZA 1UM6L 1T4KA 4EOWL 1X5KA 1IC5L 1JZ8A 5F88A 5KSAD 4B7LA 3AM8A 2IAMA 3RG1C 3UBGA 2GUYA 2Y24A 1BX2B 4ODSL 3V0WH 2K45A 3S5LA 5D7JB 5I19L 1VAHA 3QXAA 1MPAH 2ITFA 4ZMWA 5GS1C 2AJSH 2VT0A 3LXCA 2WLMA 1MOEA 5HTSA 2B20A 1U8JA 5BO0D 3N3EA 3TS8A 3OHXC 4JW3A 4LGRB 2ZCLH 5KAQF 2Z93A 1BIIB 5H94B 3TGXA 2AK4D 1CLZH 4Y1AB 4I89A 3RIAK 4ZSOA 5I1EL 1MFCH 4KO6A 1PX8A 1NCWH 3X3GL 5KUKA 3ZGIA 4WWKD 4W9ZA 2DQJH 1OEZW 4HDIA 3BN9D 4QUOA 1WWWX 3CTTA 2D9QB 2GK2A 3HUJF 1CR9L 1JPFB 3TU6A 4XXCC 3TX4A 4NQED 1E4JA 2CZNA 1I3GL 2BNQA 2ITDA 4TUJA 1S7SA 3CHQA 3QR2A 4IIZA 5IFJB 5CJQH 3DOSB 1FO0H 5HGGS 1KFAL 2BXYA 2G9HA 4PU2A 2X1OA 2XKNA 3LZPA 3L95A 3ZQWA 3APNA 3L7EB 2OMZB 4NO0D 2Q7YA 5IJDC 3W11C 2XVGA 4OZGF 5CLYA 4IBQA 1E5UI 4KV5F 3TBTB 1RZQA 4ZO7A 3CG8A 2CBTA 3JWNE 4UTCA 5I71B 1BQSA 4UM9D 3EYFB 1ADQL 4JRXE 5AOLA 2G60L 2V6HA 3ESOA 3LZRA 3OPZH 1J12A 2G9KA 5CSZA 2VZTA 1HEJC 2B4CC 2DLGA 1NLDH 5GZND 3VWJC 3FONA 5KBMA 4CILA 3O2WL 4LVHC 1KIRB 3K6DA 3C87A 3OWEA 4FXKB 2EKJA 3OKLA 5C0BB 5DVLA 1JWUB 4RMUA 4RMTA 4JCLA 5ADOL 4E9WA 2E9IA 3GSXA 3APMA 5JOEA 4LT7A 5E8DL 2ZXWB 1X7TA 5FR3A 3CFMA 1LO2H 5IK3B 5B7FA 2CBPA 5IVXA 3Q5TA 5GQBA 2WYZA 3S88L 8CGTA 4OV5A 2W0LA 2X2IA 4KXBA 4AVJA 2F19H 3QORA 4RDQG 1CICA 1H8LA 3CBKB 3AT0A 2J6EL 4NUJB 3NZUA 4JPQA 1ZT4A 1NBVL 2DIAA 2C1OB 3GSOB 3FB5A 5I1HH 4EVNA 3BIKA 1SJXA 4KZ0A 4OR1A 3L48A 3RWJA 3CN4A 3H3PL 5D1ZD 3C6SA 1FPTH 3T1FA 4Z7UF 1A6TB 3VI4E 5E9AA 5C0DB 2G3NA 4LFHG 4XPGL 3WFHB 4KXDA 1W72A 4IRJC 2J20A 2I9LA 3KW7A 3K46A 5EWIL 2ZWYA 3LQAH 5CZVL 3F05A 2PP8A 3LZOA 4P46A 1W0WA 4PJGE 4LPCA 3WKML 4PB9L 3ZE0E 3P4OA 2KDGA 5AW3B 5H37A 4ENEC 3PHQB 5MP6L 3VI3E 5JMRA 4A6YL 2Y36H 1G1KA 3U0TA 3E0GA 2G2NA 5CEXB 1MHEA 2VR6A 3QUZC 4N25A 3ME0A 3M8OL 4XVOA 2FSDA 3JYBA 4O58L 5EEXA 4QHMB 2EE9A 3P3UA 3UO1L 1QWUA 1ZT1A 3WAKA 2VO8A 4Y2DA 3VGDA 1F58L 4JQXC 4HXAH 4XMXA 5JIPA 2XQYG 4Z7AA 4OLUH 4EZKA 3DBSA 1JXGA 2XFXA 4MRCA 1TSHA 2ZSWA 4TSBH 3ABZA 5JR1L 1YEWA 2WXJA 4JK0D 4EBQH 2EZ0C 1CIDA 1Z0NA 4H1LB 4NM8L 4AVHA 2YD6A 4KJYB 1DBMH 1GGIL 3Q2LA 3GB7A 5EZLB 3W39A 3PWNA 5I17B 4BH8A 2Y6SD 3UZVA 1PEWA 4W9EC 2YD7A 4ZBJA 3UBHA 3H42L 3OJVC 5B38G 3JQOB 4G7SB 2A2QT 2B0SL 1JZ5A 3U2IA 1MNUL 2IWGA 2YUZA 2MCG1 4LCCC 3EG9B 4UOJA 1TG8A 1RK0B 2DOCA 4N0RA 4WU5A 5IREA 4RRPG 4OGXL 1RULH 2BNUA 5I8KL 4L8SB 4E9YA 1QAWA 5HHNA 4F3FA 5DJ2A 5DJ8B 5IF0B 4ZODA 3GMMB 2MQCA 5DJZA 5DSCA 2C9QA 4E41B 4MA7H 3K3QA 4JFXB 3VXME 1ZSHA 2A4EA 4OZFB 1FNHA 1KCUH 3QUMA 1ES0B 3P9MA 4WTXA 5I30L 4JO2H 4HQQL 2Y06H 3ULSA 4OLZH 1M9SA 3HBGA 4UDUA 3Q3GB 3S9DB 3ZHNA 5A6MA 1MVUA 1IKOP 5FXCH 4DPBX 3ZDZB 5AD0B 1IO4C 4BZ1H 1KBKA 3KGUA 3QJRB 5IVOA 4YMPA 1KEML 1BM3L 5I75B 3TXAA 4GQZA 5IJKA 4F8OA 2DWDA 2WBXA 3ARSA 3HNSH 1T22B 4EKXA 3ZTNL 1EBPA 3U36A 3NJKA 3QHFH 1GJWA 1YEFL 2IOOA 4FTVD 5F72S 4KDTA 4U1MB 3T0ED 1NICA 4A2MA 2WN3A 4G6AD 4DEPB 5JW3H 3IMUA 4QHLA 2I9TB 5D6DC 3IPBA 1N59B 3G6DH 3BDBA 5JHBA 1BZ9A 3UCQA 3D8MA 1UB5A 4K7FB 2QQKL 3EGXB 1SYSA 5H2BB 3BVUA 3GMQA 1TOXA 4PJ7F 4UV7H 1H6UA 3ZN6A 3HNVH 2CA3A 2XTJC 4PJFB 4QT5A 3FSAA 3L3GA 5E1HB 2BOCA 5F9DC 5LNEA 5I1IL 2JKSA 3T77A 3QJFB 2EYRB 5HI3D 4YFEA 2BIPA 2Y25A 3L2LA 4B97A 3VGAB 4X4KA 3UC0L 35C8L 2LVCA 5DT1L 4YSQA 1T2XA 2G0KA 2HUHA 2PW2A 4XC3L 3IMWA 4M1DL 4PYHA 3TLRA 2OSYA 3WJJA 3QS2A 1RQ5A 4JQIL 2APXA 3OHMB 5IBTL 5LGYA 3SY0A 3ISRA 1A7OL 3VH8B 4Z7WB 4X42A 1QP1A 5IMMA 1BD2D 2K1MA 3W5MA 1YECH 4HSCX 4ACPA 3FT4A 3WS3A 1WWBX 5MEPB 1W2KT 4WF7A 3GMLB 4KJQD 2VDLL 4PRNB 1FP5A 4L3EB 2EIZB 4TTDC 1ZPLA 3OLDA 5D7JA 4PWKA 1J9QA 3JT0A 5DMKA 2YC1B 1TUPA 1FGNH 4LE8A 3VYOA 3DV4B 4ELDA 4KK9D 4B3EA 2BHUA 3CBJB 4FNLH 3OLEA 5TD4A 2JJSA 3ZDXE 5I1GL 1BIIA 5H94A 2XY2A 5JHDE 1AMYA 4Y1AA 1EAOA 5JPMC 3RTQC 1JTTA 3GHEL 3KYMB 2BNRD 3KH4A 4M9PA 2VDQH 4KVNH 2CGRL 4TPRL 3VWKD 5DURD 4LDLB 5B1JC 2RMNA 4F7TB 2WCPA 5D93B 3OC5A 3L9YA 4CU6A 2NMSA 1JPFA 4FFYA 3WBDA 2WGNB 2E6PA 2EYSB 2F1AA 4PAZA 5FYJL 4WV1B 4AQ1B 1JXFA 3VD0A 1MJUH 5JUEH 2JCWA 5B8CC 3GRWL 5IFJA 1C1EH 4IMLA 3DOSA 1N6VA 3FSOA 1Z32X 3VQ2C 3PS6A 4PP1D 1A6ZB 5DD0L 4CDHA 3BD5A 5T5NF 3L7EA 5DC4B 2OULB 4QRPE 1HIMH 2PTTB 4W6WB 3MROB 1QO3B 2AK4B 1EHAA 4N5ED 5AZEL 3TBTA 4M5TA 4NQXB 2XIBA 4X83A 4OD3H 3VW3L 1J7VR 5FEBA 2QSQA 1JHLL 1IEBB 3ZE2F 1PZ5A 2P3YA 1NAML 3PV6B 1WGVA 3EYFA 2RFXB 2QSCH 5JOPD 5EZOH 4A7GF 1MAMH 3BUBA 3MV7E 5B1KA 2K4AA 1UJTA 1XGUB 3AABA 1KIRA 2ZUXA 2DD8L 1AO7A 3NDYE 3U1SL 3DROB 3QQNA 1WFTA 4FXKA 5C0BA 3IGLA 3ULVC 1JWUA 4XXDA 3SE3A 4XCEA 5LG1A 1I3VA 1P5VB 1DUZB 2LT9A 4RFEB 3I6GB 1SUHA 1AAJA 4LLAA 5EBMB 4NO0B 4S1QH 3OQRA 4LLDB 5IK3A 3AREC 1IGFL 3SDXF 2CGYA 1PY9A 3GQFA 3QIWD 4X9HA 4O9HL 1IAKB 2H26B 1JPTH 1A7QH 4HXBL 3P0YL 4NUJA 4A55A 2C1OA 3GSOA 4LLQB 1BZDA 1XVSA 3ECBB 3V10A 1N3NB 1JI2A 2EXTA 1PLGH 3C5ZC 3E8VA 3PQYB 3C60D 4GQ9L 1GHFL 5I8OH 1N10A 4OIIH 4K3EH 4XCCH 5C0DA 3WDIA 4ZS7H 3WFHA 5E95B 3DMMD 3DWTA 4LBEB 2PYEE 4LARH 4AIZB 4B9IA 1GGBH 4BCZA 2VXQA 5INCB 3N5AA 2NY3D 3UG5A 3VJ6B 1O7DE 1S7UB 2MPVA 1JXKA 4XMUA 1PZ3A 3NOIA 3N1QC 1OHZA 4JUSA 5LQBH 1USZA 4NUGH 1C8PA 2JV6A 4PBWD 5AKRA 2KERA 1GXEA 3PHQA 2Y3NA 4UT6A 3SE4A 4XX1G 3DJZA 5CEXA 1IVTA 1CLCA 2JJTC 3AITA 3V0VB 4UU9A 4NM4L 4DVRH 3ZYIA 5IFHL 3ULVF 4Y9EA 5FUZH 4GW4B 5C07E 2GT9A 4QHMA 3TJEL 2GB2A 3QE5A 5I76B 4RWHA 4FABH 5F9WB 2XETA 4S0SD 1IC4L 4P4KD 2BVQB 5F7MC 3V6OA 2G0LA 1IQDB 2DWSA 4E9XA 2IDUA 1VZIA 3GI8L 4F1ZA 1EERB 2ETWA 4GS7B 5A3IC 4FGMA 3ZQXA 2B39A 2YA1A 5C1MB 3L4CA 3P11H 3W9EB 4XMKL 4TVPH 4FQQB 3L13A 2VZSA 1JPSH 4X99B 2IH9A 4KJYA 5I17A 3T0DA 5EZLA 3OF6D 4PW4A 4TYUA 2F7IA 3RZCC 2GVYA 3TCXA 1MFAH 4AH2B 4ENZA 3EGDB 3SSGA 4A67A 4FQCH 4KK6D 3QUXD 5CD5C 1D5IL 4JFDD 1FNAA 5ANHA 3QIUC 1DSYA 4JPKH 3EG9A 1RK0A 3FN0H 1P4IH 4P4RB 2ZICA 4ZMOA 4L8SA 1JZGA 32C2B 5DJ8A 5IF0A 3RWFB 4OKDA 3GMMA 5LNDA 4E41A 2BSTB 4JFXA 4GUOA 1DQDL 5JYLA 3D51A 3V5KB 5ICYB 4OZFA 2DV6A 3F6JA 1ES0A 4HMCA 1GMEA 4NN6B 4K3DH 2EYTB 4GSUA 5DWUH 3B9KC 4KOCA 2VSMB 2HJFB 3Q3GA 4V2CB 4TMPA 2R23B 5T1KB 3UAEA 3MODL 4IBVA 3WIIL 5AD0A 3HBQA 4WVRA 2KPWA 3ZTJG 4C56E 1HL5A 2XV0A 4FNQA 4RESB 3JWNC 2D8KA 1OP9A 3QJZA 4WY7L 1MCLA 5L88H 1XF5B 4AIEA 3EJZD 1WLHA 4KDVA 5FAAA 4YHLL 1A1OB 1QFUL 1JNHB 2R2BA 2ATPB 1UUSA 2NY2D 1DANU 3HMXA 3R8BB 3RGVC 1BP3B 4F7EB 3TPUB 4U1MA 3QQ3B 4ODTH 4R8WL 4WU7A 2OYLA 3QPKA 5I0DA 5EF1A 2BZ7A 1AOHA 4TQPA 4YUEL 2EVGA 1MIEH 4QWWD 5E1AB 4N0UB 2I9TA 1FORH 1S5IL 4WEBL 1N59A 4JHUA 4KC3B 4KTDH 3DVNB 3TNMB 3CVHL 2MMXA 2AEWA 4M7JH 1SDDB 2YSSB 3N6YA 4K7FA 1PIFA 3EGXA 4UBDD 5H2BA 1XMEB 4EN3C 3OAYH 1RZ8B 1DVXA 2R29L 5BZZA 4XNUL 3QJFA 4NSKB 4F37K 2EYRA 4L8CB 4GW1A 1I8LC 4KJPD 4DW2H 3L9EA 2XZZA 4ODWB 3VB8A 4GAYB 5A6IA 4LL4A 4E5XA 3CFCL 3U4EA 4QXUH 4TSAH 1CI5A 4FTVB 3UMNA 3OSVA 1Z3GH 1V5JA 4ZYKB 3O6MH 5F89B 4X7CC 2QZ5A 4WK0B 1H3WM 4Z7WA 3VH8A 1I8UA 2HH0H 5SX5H 3U30B 4Q9RL 1F11B 3GMLA 4FFZA 3QYNA 3C09B 4FLRA 4PRNA 2I85A 2OW6A 4L3EA 5C0CB 3PG2A 2CDGB 2V5TA 5IB5B 1MCIA 1NZRA 2XVLA 4S2SB 5EN2B 3VFPB 3RY6A 4ZRGA 4ZSOE 2YC1A 1GZQB 4P2CG 4RMSA 5HHMD 3WFBH 2GTWB 3GBMH 1BAWA 3S3PA 3L4TA 3RWEA 1BFTA 3DV4A 4LPVA 3ULUE 4ADGA 5I0ZA 1TQVA 4APQB 3STLA 1IKNA 3HS0C 2XRAH 4M93C 3S8GB 2ATAA 4HJ0C 4JVWA 5LAXB 3KYMA 2BNQE 1BD2B 1EGJA 3QDAA 5GPRA 5BMFH 3GSNH 3Q1EA 1SHSA 2XG4B 1RZIB 4R4FH 4MBRA 1WAPA 4F7TA 1RD6A 3A6CL 2G4GA 4JPIB 3IU4L 2ZOWA 2EYSA 4AQ1A 2YD0A 1ZCRA 4RISH 4TOYH 3KWVA 3P40A 4K3JL 2CJTA 1ESOA 3OWRA 4HLZH 3RJDA 2JLLA 3HE6D 5KVFE 1WV7T 1A6ZA 4JO3H 4MA3B 4MJJA 1UOWA 1AC6A 3NCJH 4PJGF 2PTTA 1M2VB 3MROA 1Z66A 1QO3A 2BIMA 3RQ3A 2AK4A 4N1EA 2R56H 3ZE0F 4KY1H 4PJXB 3VI3F 4JVUA 3L3IB 4NQXA 4UV4H 1PIGA 4LHJB 4NN7B 1W0YT 2Y72A 3IKKA 4F15B 3VWKB 3C5SB 2OPCA 1IEBA 3DOHA 4JG0L 4CSTA 1VGEL 1XH0A 2RFXA 1I4FA 5KYXB 3Q6FB 1HYSD 2AJYH 2WXPA 4FCAA 5FFLA 5E6IC 4KGLA 4F9LC 1XGUA 5IVXE 4M4PA 1DBBL 1NKGA 2OL3H 3IT8D 1N8ZA 4I5BB 3DROA 1U8KB 2DKUA 4MZ3A 3NEEA 4N9OB 1DUZA 1KNOB 5L9DH 4RFEA 2JJWA 3I6GA 5SWZD 4DKEL 1FFTB 5EBMA 5AOZA 4LLDA 3EO9L 2WQWA 4MB4A 2YBGA 1G0XA 3J07A 2VXTH 4ONGH 1B88A 2Y4SA 1JPGB 2HPTA 1IAKA 2H26A 4NKQB 1GIGL 2ENJA 4TUOB 1XR9B 4WI5A 4IIQA 4R26H 4JY5H 3BPLB 3H56A 1CXLA 3ECBA 1G9EA 1A0QL 1N3NA 3PQYA 3Q01A 3JTBA 5DO8A 2XQ0A 4XX1E 2VZ3A 2F6AA 4PLNC 3SDAC 3MLYH 4H26B 1U2HA 1ZHLB 3THML 4JPVH 5AKTA 3PL6B 1NAKH 1V3KA 5KVDL 4AIZA 2VNCA 1HXMB 1J9RA 3TVMC 1JVKA 1S7UA 2IMNA 1O6TA 1ZLSH 4S10A 3OR6B 3MCYA 4HCRA 5F7EH 4CVZB 3LH2H 2AQSA 5F6IC 1S7WB 3GI9L 5BZDB 3R0NA 3FQYA 4UNVA 1BEYL 3QIWB 4P5TB 5FYKL 3OZLA 4C55A 5AVTB 2OMYB 1MH5B 5J1SC 2KQMA 3UAFA 5FGCB 2FLRT 3MOAL 2GIMA 3JSSA 3MUHL 3N40F 4M3JA 5C2BL 3BWSA 1C08B 3V0VA 2XXCB 1I9IL 4KZCA 3JWOC 4GW4A 2BP5M 2OZ4H 4PJAF 1I1YB 4D0DB 1ZE3H 4G6MH 2VLLB 5EORL 5I76A 3RYMA 4ONFL 1BM7A 1OM3L 1CGYA 4IRZA 1G1CA 4R5XA 5T3ZE 4N8PA 4ZJ9A 1KYOJ 2BVQA 3DVIA 5IBLC 3GZQA 3JT2A 3TA3D 4PLKD 3SE9H 2NY3B 3HG4A 1NPNA 1V3MA 2HJLB 1XEDA 5D7EA 1XF4A 1QYGL 3P77B 4FQQA 3BLKA 2DQDL 3CXFA 2WWNA 2QELA 4X99A 4OGYH 3D9AH 2R4RH 3ZBMA 1J1XH 3E80A 1XFPA 3U9PL 3HZVB 4HUMB 4ZXBB 3DARA 4KZEH 4K8RD 4AEHH 3D85D 3E9UA 3CZUB 1KF9B 1YNKL 1RAMA 4AH2A 1K6QL 3EGDA 3VU1A 3SE6A 3V0GA 3Q5OA 1TLMA 1JVOA 4PJ9D 1J0ZA 5EZIH 4P4KB 4Y1TA 4MD4A 3SPHA 1BQLL 1E6OL 2DKMA 3WXVL 2YPLD 3W57A 32C2A 3NYKA 2WUBL 2HTLC 3MJ8B 2BSTA 1G9HA 1F8TH 3V5KA 3VCLB 1IZJA 1U8HB 2P24B 3HC0B 2HZHA 4NKOB 3ZRFC 5ICYA 2OMWB 1V54B 5JQ6L 4BUHA 1QABA 5CCKL 3LNEA 2KDYA 2EYTA 4AX3A 4OZFG 4G11A 4QHKI 2R23A 4XAWL 5T1KA 5ITBH 3QEQB 5HYJD 4LQFH 4NFCA 3QUXB 3AY4C 3FTSA 3ZKMD 2OP4H 1UD3A 1XF5A 3CMGA 4AC4A 1MCEA 1WITA 4I77L 2CHNA 4BWUA 1A1OA 1JNHA 1MCOH 2Y7SA 1JOIA 2ATPA 2N01B 5I1LA 1A6PA 1HHKB 4MWFA 1NC4D 2HKHH 3TZVD 4F7EA 5A2IH 4NT6B 4JM2D 4GW5B 3TPUA 3ZDXF 4ANVA 5F8RC 1SEQH 4C8XA 3QQ3A 4WWID 1HCFX 3EJCA 1T7YA 2ZONA 3F5WB 4X8JA 1Z9SA 3QNZB 5BV7B 1GMIA 3D39D 2GAZB 3KBPA 5E1AA 4N0UA 3IFOB 1IBDA 4PBDA 5HDQL 3WIHA 3TNMA 3DVNA 5IJCC 4BSVB 1BFOB 2YSSA 4GXVL 3GDCA 1BFVH 3PIQB 4OZIB 5E08H 1RZ8A 3KS0H 2E75C 2VE6B 2W59A 1USQA 4LP5A 4FG4A 2VC2B 1G7IB 1I75A 4NSKA 3GNML 4OM0H 2BFVL 3HHRB 2DM7A 4OQ1A 4P3DB 4GAYA 1T0OA 3V4VH 2HMID 5EV7A 2NY2B 4ZW3A 4YFLF 1MJ7L 2AMUA 1OARL 2KC0A 2VOTA 1GC1C 4HS8H 4P48A 1UWGL 4E5XG 4HOZA 4ZYKA 3R0MA 1U8PB 3B34A 5K69A 5F89A 4RA3A 1BGXH 1O7DC 1I8IB 3S6CA 3LHPH 3TT3L 3P3RA 4AUUA 1PY0A 1ECZA 1F3DJ 1MI5D 2R83A 1ITCA 1EJOH 2H9GB 3KPQB 4UTBH 3SD2A 3SGJA 3VH8G 1H15B 1CLOH 5C0CA 3GF8A 2CDGA 5IB5A 5PAZA 3CSPA 3ML8A 4S2SA 5AVXB 1PBYA 5EN2A 3VFPA 3K0WA 4Y1AE 4ZO9A 5IKCB 1PS3A 3EDFA 1GZQA 5J11C 1OCOB 3GLAA 1AMXA 2GTWA 4HP5A 1BXVA 3LIUA 3MLTB 2DQUH 1T2JA 4PWGA 2VR9A 4G3YH 5ILTL 1XT5A 2AJZB 4APQA 3QVAA 1R5VB 3T0BA 2H1PH 2CIIB 1EV2E 1FGVL 1SHXA 1KWKA 4IEFB 3DPDA 4F8LA 2P44B 5HGBB 3WY2A 3D3VD 3CFEB 4NC0B 2ZYHA 5E2WL 4ORGA 3EJQA 1RP9A 1RZIA 4FP8H 1RZJH 2L04A 2OI9C 1KFGA 4GMSL 3BJLA 1JIBA 1UT1A 3DECA 4JPIA 3GS4A 5B22A 3CVIH 2JCCB 5A1AA 1JCVA 4HG4J 1EXHA 1DZ0A 2YGVA 1A6UH 5ID1B 4LVNB 1GC1L 1QBMH 1TJXA 3CDFA 3LDBB 3S8FB 1C5BL 4J3OG 2YK1L 3WN5C 1X5HA 3QJTB 4MA3A 4FQIH 4WNQB 5JIQA 3CBRA 1XX9C 2WN2A 4FCHA 3I9PA 4ICWA 5C9JB 4Z7QB 1B9KA 2DQMA 1M2VA 4Y89A 4OLYH 2PXYD 1K8DB 2H3NB 1BW8A 3LAFA 4OQTA 4PJXA 3FRPB 2Q6WB 3UZQA 3L3IA 1KWGA 2NY4D 4KKLD 5F3HB 4KWUA 3VDCA 1AO7E 3C5SA 5F7WC 5C0BE 5F9OH 1SVZA 2KHAA 2EILB 3LKQA 2JJUA 5T3XH 4PBVC 4U6TA 4D9RD 3Q6FA 4GQQA 4MFHA 3U9WA 5G4MA 4YHZL 1KJ3H 3CZGA 4M56A 1RERA 5EU4B 3TF4A 5KJRH 1RJYB 3MOBL 3BVVA 3NIGB 3N85H 4PI2A 2XN9B 2YFNA 4I5BA 4JG9A 1U8KA 4M8QB 3B8SA 4MNQD 3VD2A 4AG4H 3TFKD 4K23L 3HJEA 1D5BB 2CM6A 3HN8A 1KNOA 1OE1A 1A7NH 3D05A 2GQHA 4UNIA 1WIOA 1I8MB 4XR8C 5D70H 1N18A 3HZ3A 1VFOA 3V5DB 4PWEA 1HHJB 1JPGA 1JF5A 2XV2A 3EH4B 2VYRE 1JFHA 5CP3H 1B0IA 4FZ8L 5HJDA 1TJIL 4TUOA 1OW0C 1XR9A 3ARYA 1YNLH 2EUXA 5AVYB 4PMEA 3X13A 3ZOAA 1YY9C 3O2DH 5CR1A 5DQ9B 2VMJA 3KR3H 3SJVB 2B14A 3RIFK 1FRGL 1JZDC 4NZTH 4F1SA 4N8CL 4MA1B 4R97C 2VAAB 3FTYA 4H26A 1ZHLA 5A7EA 3QG6B 2MQ3A 3PL6A 4UDTB 1ZMYA 1GKEA 1QG3A 3IN0A 1HXMA 5SWZB 4PV9B 2F5BL 1QR1B 3OR6A 5C0EB 4YLBA 2FQDA 4LEEA 1QBLH 4CVZA 1S7WA 1H6EA 5J8OA 1T7VA 1NGYB 3QIWA 4I3GA 4P5TA 3RVXC 3S2AA 3BP6B 3HG5A 1P9MA 1MH5A 2OMYA 4MSWB 2NY1C 1KUMA 4J7RA 3IMBA 3MRHB 3V6OE 2IAMC 4QLWA 2ZUYA 3DBXB 3UJIL 1C08A 2LTQC 2HT4C 3VXSB 2R69H 3EOTH 5GS2D 4D0DA 2VDNB 4Y8DC 3U6RB 4PGZA 15C8H 1QRKA 1QPPA 1MKFA 5K9OA 4GAGH 5JYMA 3UZEA 3N0AA 3QZBA 3MRJA 4K5OA 1QD0A 4EN2A 4JFOA 2DM2A 2C1PB 3MNDA 3MRGB 1A8JH 2Z64C 3V95A 1Q9WA 2HJLA 5EZJB 1H3TA 3P77A 4N26A 4FQHB 4HGKC 1BBDH 2ZKWA 1E5ZA 2NY7L 4JO5A 1JVLA 4ZXBA 1BIHA 3ULUC 1UT2A 2Q3AA 3KXFD 3OZ9L 4PLJD 4GRWB 3A47A 4OJFH 5GRJL 3WJMB 4U31A 3HN5A 5C86A 4E41E 2O1AA 3GJEB 2I24N 4W81A 4XO5A 3KCPB 4P4KA 3GMPB 4AGPA 5AOKA 1GTNA 4X6EB 3O6LH 3TA3B 2E9WA 1HTYA 4CVWA 4JM0A 1A5FH 2EDLA 2WQSA 1FF5A 2F8IA 4J8RA 3ROLB 3MJ8A 3ZDZE 4ODXB 1BPVA 3HC0A 2P24A 4H8VA 4NKOA 2IO5A 2OMWA 1QI3A 1XXFC 5C0RH 2EUWA 1ZLWK 4BGDA 2VH5H 2FEDC 3D2UB 2XPYA 1PGRB 3OLIA 5AYUL 1DZBA 1KPUB 2E47A 5GS0D 4Y9BA 3CCHB 3QEQA 3RUGB 2FGWL 2VDML 4OCWL 3QUXA 4RSVA 4W70A 1M7IB 3OMNB 4YHOH 1F4WH 1S9KC 2M26A 2KLRA 1UXWA 3V5HB 1VA9A 1MWAB 1I9JL 2IAND 4M5YH 6TAAA 1M6OB 4ZUTB 5JNYB 1E4XL 3D4YA 2YD4A 2YPLB 2ZG3A 5D1XD 4B6ZA 2N56A 1HHKA 2GUOA 3ULUF 2JI2A 2RA1A 4NT6A 4GW5A 3NIDB 1ZTXH 3E8UH 2CQVA 3F5WA 3UERA 3QNZA 1CICC 2GAZA 1TQBB 1OY3B 3MLPA 3IFOA 3J8F7 5HI4D 1L0XA 2FB4H 4MAUH 4P05A 1BFOA 4BSVA 5HYJB 3L4UA 2K3TA 3NCWA 5C0NC 1UCBL 3PIQA 4XWOC 3TJPA 4OZIA 1XTMA 3HBZA 2IDCA 2XWDA 4NQSB 2YR3A 2VE6A 3S98A 1G6RB 4WI0B 1G7IA 4WI2A 2N4IA 3VMPA 4CSSA 4NQTA 1KB5H 1MQ8A 2C26A 3ETSA 4FDWA 4P3DA 4Z7WE 2Z31C 5F96H 4CJ1A 3TEXA 1WA0X 9PCYA 4P46C 4PREB 3PP4L 1CGTA 2CM5A 2VXVH 4Z95H 5F7DB 5KWYC 1ZTMA 2F1EA 2Q5BA 4AEFA 3FQ4A 4L3EE 2EDJA 2WKGA 2GTQA 3HC3H 3C12A 3P4MB 1U8PA 1DUYB 5EULV 3TN0D 1J5CA 2EUVA 1Q0EA 1XD0A 2JVUA 1EJ6A 1I8IA 4C4KT 4L0YA 3I3DA 1AG6A 2CAKA 5DCCA 1ET8A 3QCTL 1J9SA 5F93C 5JHMA 1CFQB 1LNUB 2H9GA 2VR7A 3KPQA 2FEJA 1NFKA 1H15A 3US1A 2NY5C 3QFJD 4P9MH 4Y2DC 4L0ZA 4XHJD 4JEGB 4WSJA 5IROD 5HHPB 5LXGL 1NDGA 5CHNB 2X6AA 1Q1JL 5FYLL 1X5ZA 1KYOK 4W1TA 2X41A 4P3CH 4TVUA 3M1BB 3KPNB 1J8SA 2XVBA 4ALAC 1JNLH 3ARDC 1SN5A 1E5YA 3WFDL 3MLTA 1U36A 2BOBB 4C57C 3OB8A 4ZUUB 5FUCE 4LQ1A 2AJZA 4KKNA 1QW8A 1R5VA 5IQMA 2ZCKL 1PX4A 2CIIA 1BZOA 1LK3H 4O4YH 2JB6A 4IEFA 1BECA 3UAJA 1OB0A 5HGBA 2A99A 1N6UA 2R0KL 4YHKL 3CFEA 2NNAB 3CHSA 3ELQA 4EI5B 3QR0A 1RK7A 1SM3H 5KJ4A 1JD9A 2I5YL 4J27A 4G1EA 1SLVA 5KW9H 3QGVA 2Q87A 2ZNXA 4N8VB 1Q0YH 3D07A 4G8GD 2VM9A 2JCCA 4ERSH 3AG1B 1SF5A 2AK4E 1SXSA 5ID1A 3QBTB 2E8YA 4Z23A 2WLKA 3CZNA 3F62A 3FYEB 2FTAA 1M2OA 2MSPA 5EC1A 4LSVH 4FQPA 4WNQA 5C9JA 2AGJL 4MQXC 2QPSA 1K8DA 2H3NA 4G7VL 4PG9B 2QV2A 3FRPA 4N0YL 4U6XA 5F3HA 3D3VB 5LWYL 4PH8A 4RRPM 3UH8A 2CK2A 3EJUA 4IGBD 3BW9B 1XCQA 4C59B 4G8AC 1EXUB 4MDIB 5EU4A 2R0WL 1S78D 4V2BA 1RJYA 4N3UA 4HFWA 4LNRB 5IJKC 3R4DA 1U2YA 4U1NB 2XN9A 3BUPA 4M8QA 1AZCA 2L4OA 7CGTA 2HPOA 3HNTH 4KDTC 3L54A 4NWUH 1HNFA 3GKWL 4XN4A 1J86A 4Y9FA 2WUCL 5TK2A 1KN4H 1T03L 1I8MA 2Q20A 4XP4L 2V9RA 3V5DA 2G75B 3PQYE 4S1RL 2VB5A 1HHJA 2AQRA 2FT6A 2HB0A 1U8OB 3B9DA 5EU5B 5I6LA 4RFNC 2PO6B 3PWLB 2FHFA 2GC7C 3QCUL 4AW4A 1VJSA 1NCIA 5TFSL 3T08A 5DQ9A 3SJVA 2HTKC 2E3VA 1EVTC 1KYDA 2OTUB 3FU7B 3VXRB 4XCFL 4H0GA 1SY6A 4WEMB 3QRGH 3QUML 2VAAA 3SDDB 3CJJA 3QG6A 1DBKH 4UDTA 2N7SA 2NUPB 3A0OA 3WJJC 3C75A 3LEXB 3DRQA 1E8YA 1M7DB 5SWZA 3MJ9H 4PV9A 4DP9X 1QR1A 5C0EA 4B27A 1TKWB 4LPYA 4XP1L 4G8EB 3CU7A 1FCGA 1NGYA 3D4GA 3QXVA 1VRSA 4LSSL 4EUPH 3TL5A 4KX9A 1A4AA 3BP6A 3OXSA 3FK3A 4MSWA 3UJJH 3GMRB 4YDJB 3WEOA 4WFGD 1RIVH 1NTDA 5HI5D 4A63A 3EYOB 2O72A 3DBXA 5AW6B 3U46B 1WSST 3VXSA 5D7JC 3CC5B 4PFEA 2WKLA 1KYFA 5C7XL 4XVSH 5DLLA 2ZUWA 5KVEH 3U6RA 1IBGH 4PUBL 3WFEH 1TVDA 4PJ5D 3L4XA 1C5CH 3FCBA 1NGWB 2D03L 2R8SH 1CZ8H 2JJSC 4J3SA 2C1PA 2CDFB 1UKSA 3MRGA 5K5YA 4HIIB 3EGSB 4BHUA 5EZJA 2DH2A 4FQHA 3IVKA 2LVEA 3B83A 3F04A 4I3SH 4BFIB 4LU5H 4QJ5B 3NABH 4UI2A 4L9LA 3CFQA 3T09A 3WJMA 1EO5A 4DZBB 1PZUB 1UFUA 4ABWA 5E1QA 1FN4B 3GJEA 4Q7DA 4HG4K 2EUZA 3KCPA 3PGFH 3ZTEA 3GMPA 1HQRB 2D31B 2ESVA 4X6EA 1D9KD 3TA3A 5IR1B 3VMOA 1SN2A 4ZS6C 2FO4B 5HVFB 1UM6H 1N64L 2DWEA 3MACL 3ROLA 4EOWH 5B21A 1IC5H 2MTPA 3CFTA 4ODXA 5TQ0L 2CO2A 4ODSH 3QQDB 2E7MA 4OLEA 5I71C 1I1FB 3VRJB 4WUKL 4AEIL 5I19H 4IDLA 1HJCA 4FG2A 3D2UA 1HL9A 2XY1A 3IAQA 1KPUA 1WFIA 5BUPA 1PG7W 3KXFB 1OAUL 5IW1B 1O9VA 4A7VA 5DYOB 5IEKB 4QOKB 2IG2L 2F54A 3GT6A 3K72B 1M7IA 1ITBB 2GBTA 4FXKC 1J88A 3TOPA 1L6XA 2P28B 3QDMD 3DYMA 4NERA 3SE3C 3V5HA 1DQTA 4DGVL 5I1EH 1M6OA 3JV6B 1LEIA 4NRXB 3X3GH 4WZ9A 5C6TL 5JNYA 4N0UE 3EBGA 1MW1A 3FFDB 4S0TD 1AIZA 2V5SA 1TEFA 4I85A 2RJMA 1G4MA 1P2CB 3D4ZA 3KWTA 2OMUB 1FE8L 1CR9H 4MZ2A 2I7OA 2V7NB 5JTWA 1I3GH 1ZJAA 2BIHA 1NCAL 1Z5LB 2MEJB 4KNQA 1CYXA 2EDNA 3ARXA 2Q3ZA 4NC2B 4NQDB 1HEHC 5HYJA 1KFAH 3T4YB 5DLML 4DUWA 7FABL 5AB1A 4AV5A 5IVNA 1RVFL 2P49B 3COOA 5KANG 4X7SL 4NQSA 4RMBA 4A7UA 5T3ZH 2NY6B 3W0WB 1G6RA 1QA9B 1FAIL 4WI0A 3D6GA 1P7KB 3ALWA 5D1XB 4U1IB 4K5NA 2EDEA 4PREA 1ADQH 3APFA 3KPTA 4NAQA 1HI6B 3SE4C 3P4MA 5C0CE 4WWOA 1DUYA 3FSVA 3RPIB 4FLQA 3O2WH 1JV2B 3AU0A 4WFED 2BC4B 2VUOA 4LCUB 4U49A 3JBG7 1IQWL 1CFQA 1LNUA 5ADOH 3FBKA 2BY2A 4NHUB 2H6PB 1DO5A 4NZ8A 2DQFA 3NCCB 4KK8C 1JHKL 4OF0A 4D9QE 1E4KA 3IB4A 4AKOA 5EIQA 4P2QD 4NPKA 5CLWA 1LO4L 5HHPA 4WWNA 5CHNA 2L7UA 3S88H 1BJMA 5C0JB 3VWJD 3M1BA 3ARZA 2UY7B 3ZTJH 3LKPB 5EEWA 5IQNA 1MLCB 3BVWA 4KRNA 2BFGA 4P5KB 1W8OA 1FH5H 3FFCB 1DVYA 1WEJL 2BOBA 2J6EH 4U3XA 1NBVH 4MS8C 3IKCB 4BA8A 4G6FD 1INDH 5BQDA 1RFDL 1BBJB 1TETL 2WLNA 3MN8A 3HR5B 1I1AD 3H3PH 2P26A 5DMJB 3ILDA 2QVFB 4XPGH 4ZAKD 2NNAA 1KSRA 5DZOA 4PWIA 4EI5A 5EWIH 3U6XS 5CZVH 2QT6A 1ZRUA 3LIZL 4N8VA 5GGVY 5GS3A 1SMOA 1AZBA 1U95A 2F53D 5F2FA 5GGTA 3WKMH 1FWXA 2YD9A 4L8SC 4PB9H 2M1KA 4N6RB 2LQRA 5LCVA 5FUOL 3WV0A 2NSMA 5MP6H 1WFOA 4PJXE 3GBNL 4CN6A 3BJ91 2A6KB 2FLBT 2AXJA 4A6YH 2AV7B 2VMDA 4TSCL 5ICZB 4DWHA 4IRJD 1EAJA 1EJFA 3DHPA 4E36A 5H4ZA 1JL8A 3M8OH 4OM1L 1ZIBA 1BWWA 3DI3B 4O58H 3TYFB 5JIIA 2PP9A 3UO1H 1TVBB 1NKRA 4PG9A 4TQ8A 2DRUA 4ZFZB 1F58H 1ACXA 3D08A 3D3VA 3WFZA 1FO0B 5L4MA 4ENED 1FYTB 5CIPA 3FO0L 2V9QA 5J6HB 3MNWB 3G08B 4J5VA 2X9ZA 4NO2B 3BW9A 3AZUA 3ECQA 5TGBB 1H5BB 1EXUA 3QHZL 1JMZA 4MDIA 5JR1H 4G8GB 5I75C 1QSED 4D9LL 2NDFA 4HJGA 4NM8H 4OJEH 3HI6L 3NIFB 4U1NA 1TQSA 1VZHA 1KJ2A 3S96B 1GGIH 3O6KL 3V0DA 2B9AA 4K9EL 3VQLA 4LSRL 3TCTA 3QO1B 4DEPC 2YUVA 3W3BA 4JY4A 3H42H 3FCTB 4UB0L 3MLXL 2B0SH 2UWEB 3BH9A 1VIWA 1YEIH 5F3FA 3L1GA 2G75A 5EG6C 3AS3A 4U4BA 2IEPA 1YNTB 1UGNA 9CGTA 2EZ0D 3MLVL 1U0QA 4ZZFA 2FYYB 1U8OA 5EU5A 1OCWL 2PO6A 2W5PA 3LKOA 3PWLA 4OGXH 5BRZD 5I8KH 5KVGE 2DQHL 3ESMA 2Y69B 2HG0A 3S37L 1EHLL 4HIEB 1PD1A 3VFVB 1N0LB 2OTUA 3VGAC 2GITB 3FU7A 3L16A 3VXRA 1B2YA 1WA2X 3E1ZA 2HWZL 4BQBA 5I30H 1PLCA 3ZE1B 3SDDA 4F8TA 4HQQH 3ZZSA 2NUPA 1HHIA 2YGOA 3PFUA 5FGCE 1M7DA 4Z5RB 1RIHL 3ZDZF 4ZUSB 2WJ7A 4PRHB 1BVKB 4G8EA 2EP6A 2OCCB 3H4HA 1JWMB 4AE1A 5HPMB 1KEMH 2HKAA 3C9NB 2A9ML 4MDJB 1BM3H 3FUFA 3GMRA 4YDJA 4CRPA 2D3JA 2B77A 5JIHA 1PG7L 2EICA 3OLGA 1Z2KA 4UZSA 1WWCA 3AVEA 1UD6A 3EYOA 3AQDA 3U46A 2EEAA 4QGTA 2EAEA 5K33A 3CC5A 3ZTNH 4E9RA 3RY6C 1D5XB 4TVPD 1YEFH 3GRGA 2DI9A 3Q2CA 3ZXAC 4Z3FA 5FFOA 1QNZL 2TSAA 3G5WA 3MBWB 1XHHA 2YQBA 4M8UA 1DJIA 3VXNB 4OCRL 2GABA 4DOHB 2VDPH 1NGWA 4M62L 3U48A 3AROA 1IKNC 2CDFA 4DHLA 4HIIA 2QQKH 4WO4B 4C4KO 4DCQB 3VYPA 2GSIB 4WHDA 3QDJD 2XN1A 3WG7B 4B9PA 3BVDB 1RSYA 4PJFF 2P5ED 3U25A 1AS6A 1K2DB 3AWGA 5I1IH 4Z78B 2ZE0A 5D93C 5CZRA 5FM5O 3UC0H 1ZA3B 35C8H 1YZZA 3KPMB 5DT1H 2ID5A 4UF7C 4OF8A 4DZ8B 5ADPL 4XC3H 4WV1C 4AQ1C 4I9WD 4M1DH 3GUTB 4DZBA 2ZWNA 2PCFB 2AQNA 2XXFA 1FN4A 5IWLA 4NZRL 4JQIH 2C3WA 1HQRA 1G9MC 3GPSA 1A7OH 2D31A 2XTJD 4Z7WF 5IR1A 3C6LB 4OJCA 1ODAA 1T83A 2FO4A 3KG5A 2ARJB 3QEQE 4N9GB 2QQLL 2C34A 4OZHB 4IMKA 3ZJAA 3PDDA 3QQDA 3BN9C 3VRJA 1JD7A 2VR3A 5F7LB 3P30L 4JY6B 1JZ7A 1FQ9C 3DIFB 2C9UA 3KXFA 5IW1A 1XCTB 1EIBA 5DYOA 2HKFL 5IEKA 4QOKA 1Z0MA 4HIJB 2Y7MA 4FEMA 1FVDA 3EO0B 5I1GH 1NM9A 2GIXA 4N68A 4TTDD 4MB3A 3C8HA 1D9KB 4FQXB 1BYPA 3GHEH 5AW7B 3JV6A 3CXHJ 3K71B 1Q72L 5JDSB 1O5PA 4N2OA 1RZPA 2CGRH 4TPRH 2J1KA 3DX7B 3FFDA 3IAPA 1QACA 1O7VA 1WO2A 2XZCL 4YS4A 3RHWK 2AJXL 5ITFB 1S7XA 1N5AB 2ROYA 5C6WH 1P2CA 4OZIE 2OMUA 4UZGA 3T0WA 4OLWH 4Y7OC 1L9NA 4GO6B 5FYJH 4IKLA 2P5WD 2IH8A 3RTQD 3S2CA 3GRWH 1OAXL 1PCXA 2OZNA 3BKML 4NQDA 4NXSA 3T4YA 2DBLH 3PWPD 5DD0H 3L3JA 3UCRA 2NX5D 3DXAD 5BPPA 2E56A 3B1TA 3MA7B 1KC5L 3W0WA 1QA9A 2QGEA 1PW3A 1ZDQA 2VN6A 1KGJA 3BPNB 5DS2A 5AZEH 4AYFB 5E6YA 1TJHL 1P7KA 5GRZA 1RCYA 5D1XA 3CFBB 3VW3H 5CNHA 4U1IA 1JHLH 1NAMH 4NZUL 3GJFH 1DJSA 1UEMA 3KM2A 3WEAA 5M95B 3OHXB 1SYVB 2HXAA 1GY2A 4L5FL 2KLTA 4LIQE 4XBMA 1U8NB 3RPIA 3RVUD 1JV2A 1EEZB 2DD8H 1KPVB 2XI9A 3U1SH 2BC4A 3VX1A 5EIVA 4LCUA 2UY6B 5BOPA 5GRXG 3FUDA 3DVGB 4NHUA 5EHFA 1LP9B 2B5IB 2H6PA 2X4QB 2UX7A 2YAMA 2VISB 3MTRA 5F9WC 4I0KA 3QRBA 1X5IA 4QY8B 1IGFH 4TLSA 4RLDA 4WHYG 4GS7C 1KLUA 3CN0A 4UQBA 5C0JA 5K59E 3PXLA 2UY7A 1UM4L 2DEWX 3DJTA 3LKPA 1MLCA 3ARGB 3KW8A 4JCWA 4BQ6A 4HXBH 4P5KA 3FFCA 3NRFA 3ULVD 1B4JL 3P0YH 4X6CA 4H44C 1K3IA 1D6EB 3IKCA 2D7MA 2ZXEB 4FMFA 2ITCB 1BBJA 3NCEB 3HR5A 4GQ9H 3U83A 1QRND 4M7ZB 1GHFH 2JCCE 3ARED 1QTYT 3BAKA 3GIZL 3NSJA 3TASA 4JFFD 1CFVL 3IMVA 2P1YA 2E9JA 1A22B 1IM9B 2O5NA 3DX0A 4P2QB 5FLVA 1KCVL 5IROA 4Z7QE 2W60B 2DMHA 3NFSL 1VERA 5C2UB 4N6RA 3C5ZD 1EVUA 4LVHB 3H8NA 2VDQB 4N8VG 2A6KA 4R0LB 5K39B 2WXIA 2AV7A 2QPFA 3FKUS 2YJQA 3ABGA 2H7WA 1RUAL 4QKXB 3NN8B 3JVGA 3V0EA 4P9HL 4G6FB 1SHMA 5IFHH 1IBBA 4NN6C 5E7BA 1RH8A 3TYFA 1I1AB 2Y6SC 1TVBA 2EIEA 2WNGA 4ZFZA 4M7KL 2R15A 1WZMA 2CJSA 4QKTA 1IC4H 3NIGE 4I0PB 2XN9E 1FO0A 4ZAKB 1FYTA 5JOFB 1DVSA 5J6HA 5BS0A 3G08A 4OT1L 3GI8H 2EXSA 4OUOA 4HLJA 5TGBA 1H5BA 2WBJB 3ALXA 4G8GA 2F53B 4XPFH 1VFMA 4XMKH 5DEJA 3AGVA 3QA3B 4G42B 2YGNA 3O9WD 5EUOB 1O6SB 5ALBL 1I7TA 3S96A 3ZIYA 5L8LB 4XPAL 3MGAA 4L3FA 4DP4X 1R17A 4BUQA 4DQOL 3QO1A 3NPZB 2Z0BA 2J44A 5MERA 2BY1A 3FCTA 4H8UA 4ZX4A 3HS9A 3ZKSD 2AITA 3QNYA 5A3ID 2UWEA 3SJVE 1AHMA 1D5IH 5CCGE 1YNTA 5EEYA 3QWRA 5DRXA 3WFCL 2HAZA 4DO4A 2FYYA 1SXCA 3I9IA 1EEQA 2EEDA 1I53A 2EACA 1SDYA 5JW4M 2XWTB 5BZXA 3JV4B 1IFHL 1MJJB 3RZCD 5SWZE 3VFVA 2C3VB 1N0LA 1U30A 2DY2A 5E5RB 1TF4A 3TJHC 2DYRB 1MY7A 4ZPVB 1DQDH 4XOEA 2GITA 2SODB 1JF6A 4W68A 4RZCB 3SYCA 5CEZL 5F8QC 3CFUA 3TH3T 1ZGLP 4R7XA 4GRLD 2AZUA 3FQ1A 3QIBB 1MVFA 4ZFQA 4Z5RA 1EDHA 3MODH 3VXSE 4G43B 3WIIH 1XH2A 4ZUSA 1MAKA 4PRHA 1BVKA 2AXFA 3KLHC 2DQ6A 3U30C 1IBYA 1JWMA 4J3OH 4FNTA 2C9AA 4WY7H 5HPMA 4X5QA 3C9NA 3SGJC 4MDJA 2WO3B 3C09C 5FM8A 3IFNL 3NSCA 1NINA 4PSRA 2WWKT 2EDOA 1QFUH 3B9KD 2JB5L 3WHE1 5A7BA 5TE6L 4D94A 3LQMA 3MV9D 1A66A 3ABLB 3GXPA 5HI3C 5JIKA 1D5XA 2OMBA 4HMDA 4BKTC 4QPEA 3WXWL 1Z7JA 5JW5B 4ZFOL 3LRLA 1VESA 3BIBX 4R8WH 4WJG3 2CSPA 4HK3N 1KXHA 2AJ3B 5KBLA 4YUEH 4TVSa 5F9JB 3VXNA 2NQDA 4JRXD 5I6XB 1WZKA 4AENB 1S5IH 4WEBH 4APQC 2WYTA 2MWCA 3EZJB 1TJMA 5D1QB 5A2BA 1BQHB 4WO4A 2F2HA 3WEXA 5FA3B 4GRWE 4DCQA 2YD3A 4N22A 3QZOA 3HG0A 2XBTA 2GSIA 4Z77B 2DQGL 2C5DC 2MCAA 2R29H 3K8KA 4TULL 1TSRA 4KRPD 4PP2B 4XNUH 4Z78A 4NUQA 1A6WL 4TNWK 4AY0A 2ESVE 2XNAB 3SDCB 1ZA3A 1UWYA 3KPMA 4DZ8A 2FQGA 3QEHB 5E4OA 4K94C 4A7QA 1YCSA 4LCVA 3TIEA 4BWWA 1ORQB 3S4SB 2PCFA 1IGMH 4EN3D 1OANA 2C3XA 3AADB 2X10A 3QULB 2WOBA 1ML0A 3JVFC 3GSUB 3MU3A 2J88L 3FN9A 3C6LA 4L1SA 4YIQB 1OGTB 5C70A 4Q9RH 2ZIDA 4KKCC 4N2DA 1F4XL 3CV5A 2ARJA 2OS7A 4N9GA 5FCUH 4OZHA 5HHXL 3QDJB 4CBZA 2F54E 4NN7C 1JZFA 4F15C 2P5EB 3VWKC 5BOZG 4QTHB 5MENA 4JDEB 1IC7L 1AYRA 4JY6A 1G9NL 1I3UA 3DIFA 3EOBB 1Y1DA 3B2DC 4NP4L 1PKQB 1IM3D 3NZHL 1ZGLM 2BM3A 1XCTA 3JWDC 1CGUA 1ACCA 4Z7OB 4HIJA 1JXDA 1TIUA 4NB7A 5CFHA 3EO0A 2GJ6B 4PP1C 4JPWL 1NCHA 4GT0A 4FQXA 5AYQA 4QYAA 4UOW1 3EO1B 5DQJB 2W07B 3K71A 1PYWB 5JDSA 2YAOA 3Q8FA 2IOMA 3DX7A 4P2RB 3G5XB 1LQSR 1SJEB 3PHSA 4WTQA 4N1HB 4BZ1A 5HYJE 5L6YL 1LJMA 5ITFA 3A6CH 1N5AA 2QEJA 2EVJA 3FSZA 5GRUL 4YSAA 3MUGB 4ONOA 3IU4H 3IXAB 1UTDA 4IRZH 4H88L 1JGEB 1KV7A 5EO1B 2R1WB 4QNPE 4HJ0D 5B1CA 2PPDA 2CHZA 2R0LL 4K3JH 4EZMA 3BPLC 3KYAA 2HRHA 2JKJA 2C7FA 3HVNA 5FYJU 1KJMB 1SPDA 3MZTA 1Z9OA 3HG1B 3B1UA 3O81A 3R7RA 3MA7A 3C2SA 3CC1A 3PL6C 4GIAA 4PJXF 4O02L 3PHOA 4AYFA 3VFMB 4B5EA 2RR3A 3BZ5A 3X17A 3CFBA 2EVFA 4OFVA 1J18A 1WQVT 4JG0H 3K6FA 1VGEH 3QIWC 4P5TC 1LM8V 4QD2E 3GC3A 4ZOBA 3RNQB 43C9B 1SYVA 1P9MC 4HH9B 1DJXA 1HHGB 3FPXA 1C7SA 2FZ3B 4JFTA 4ZDHB 2BP8B 3VFOB 4KKZA 1U8NA 2ZYRA 1EHXA 3LH9A 1DBBH 5IVZB 4KI5D 2OCFD 5KBKA 2X4NB 1QW9A 2JKWA 4JDZB 4RGOL 1RJLA 1RSFA 1XZ0B 3JTSB 1FHNA 2EADA 3DVGA 1LP9A 3VXMD 2X4QA 4KO5A 4PV8B 2NX5B 2VISA 4DKEH 4HFUL 3VD4A 2DWXA 4Z9KB 5HDBF 3UZEC 3D48R 1KZQA 4QY8A 4WW2B 3EO9H 5CS7A 5D8JL 1ZLWH 5EEZA 5E6ID 3RKPA 1IJ9A 5T1LB 1LVEA 2VDOH 3MV01 4PTTA 4TV3A 1K4DA 5LJYH 1GIGH 3BEWB 1KT2B 3ARGA 4AMXA 3K74B 5DVOA 1OQOA 1P4BL 1JAEA 1HXKA 3O2VL 3DV6B 1D6EA 3INOA 2ITCA 4HKXB 4ODHL 4ZXBC 4MMYB 3QZNA 4QR7A 1WHPA 1A0QH 1U8IB 1P7HL 3ES6B 1T1ZB 3L5IA 5KBPA 3KJ6L 3THMH 1U41A 2E7CA 2XTLA 3A4FA 2GJZB 5KVDH 3MLSL 3IJEB 4OCNC 3KYOA 2A9AA 3M07A 2CKNA 3LZQA 4ACTA 1DN2A 3WEBA 2GTZB 4P4KC 2FECL 1IM9A 5A2LH 3SO5A 1WYJA 2W60A 3GI9H 2FWOB 3QNXB 4IJ3B 5FYKH 5F44A 3GSNB 1NCNA 5K39A 4U1SB 4NNPL 3D3VE 3MOAH 3SDAD 1QVOB 4RGMB 5DDHB 5DD6B 4DP8X 5MEOA 4DQAA 5C6PB 3O3EB 5C2BH 5CR8A 5LDSA 2D0HA 3CXDL 3NN8A 1I9IH 3QQ9D 4BRVA 3NA4A 3LD8B 1NFDB 2X2JA 1MHHB 1I1AA 5EORH 1PEZA 1QRNB 2V2WB 1G7LB 3SQOL 5FOBB 4ONFH 7TAAA 5I1JL 1OM3H 1W0VA 5DC9B 2IMMA 1VZGA 4I0PA 4ZAKA 5I6KA 2X28A 5JOFA 4M6ML 4G1MA 2A6JB 3QUXC 4G8FB 1OT1A 3GO1L 4BZ2L 4M6AA 2WBJA 1YQVL 4NJ9L 4N90D 1QYGH 3CH1B 4NBZB 3QA3A 2DQDH 4G42A 4FX5A 3CXHK 5EUOA 1O6SA 4E0RA 4XP5L 1JFQL 5SX4H 3FQTB 3VVVA 5IBLD 1EPFA 2LU5A 1YNKH 2ZX9A 3AU1B 3T3ME 4D9RE 1Y0LB 1K6QH 2KKQA 3I9GL 5BV7C 1PJ9A 3O45B 4XVTL 2OL3B 2FAUA 2P42B 2NY0D 2J55A 2IALB 3BSZL 3VXRE 3CDYA 4B9GA 1E6OH 3WXVH 5FPIA 4NX0A 2XWTA 3JV4A 1MJJA 2WUBH 5JHDD 2COVD 2H6OA 5BCAA 3LXUX 3EJZC 2I60L 4M4RB 5JQ6H 3O9WB 1U3YA 1G87A 1KOAA 2NY2C 4RZCA 5F21B 5CCKH 2AQQA 2ROXA 3HJ0A 1BAFH 5EC2B 4KQ3L 2VZVA 2D2OA 4XAWH 3QIBA 2OKMA 4C4BA 4G43A 4QWWC 5IQOA 3H54A 2HTLD 4M43L 2FT8A 2YLHA 4DKDC 3LN9A 5DD5H 5D7LB 1BEXA 4I4WA 1TZGL 1A9VA 1NA8A 4I77H 3WTVA 1CBJA 4QRPD 4PVBA 3KDMB 3BFWA 3RWDB 4HWBL 1CBVL 4QMEA 2QTEA 3T2PA 5JW5A 3Q7JA 1OD7A 3MRCB 1WIUA 4U05A 4KMTL 3ARFB 4XCNB 2AJ3A 1PVHA 2DLFL 2J4WL 5F9JA 5BV7L 4XN7A 1KYAA 3B3BA 5L2KD 2EDQA 4AENA 5HDQH 4GRLB 3TNNB 1TENA 4PJ8A 3MV7D 2ZUVA 4GXVH 5D1QA 1IEAA 1Q94B 1BQHA 4OZIF 4YSRA 4DN4H 2FDBP 4JKNA 5FA3A 1SXBA 3UAJC 3AW5A 1MCDA 4Z77A 5KYYB 2W81C 1RK1B 1WG3A 5KANI 2FHBA 4PWJA 3GNMH 2VC2L 1AXIB 2BFVH 4GO8A 2XNAA 3VXQB 2WYHA 3SDCA 3UX9B 2NT1A 3CK0L 3SEPA 3V4PL 4AJ0A 2D3VA 2H32H 1MJ7H 3MV9B 1GYCA 4LFHD 1OARH 1ORQA 4PJHB 5EU3B 3S4SA 2KI6A 2X70B 3RWCB 4DNLA 4LVNC 1UWGH 4Y0GA 5K9KB 3LDBC 4MLSA 5ES4B 3OAUL 3QULA 2QR0B 3SPJA 1WAEA 3GSUA 3TT3H 4YIQA 1OGTA 3GKZA 1R19A 5T1JA 3PDGA 3BSHA 4OCSL 5HGAB 3KXFE 1HCVA 4ZTPL 2WZ0A 1ZANL 3LJ3A 4QOKE 1PY4A 4RX4A 3NK3A 2HSIA 2P5EA 3MCKB 4KRPB 4QTHA 2PYED 4YE4L 4JDEA 5J1AB 4XPTL 1NDMB 1RV6X 3BYYA 2P8MB 1QUNB 5CUSL 2ZF8A 5AZUA 4BCXA 4DIXA 1IE4A 1PKQA 1EZVX 4Z0XB 2I32A 4GFTB 4P59H 5ILTH 3G5VB 2DYPB 4GXUM 2BINA 4XNBA 1X4YA 2GJ6A 2VRKA 5DVNA 1FGVH 4FXLA 2ZPKL 1F3DH 3EO1A 2W07A 1URLA 2P80D 4WUUB 1PYWA 5BQ7B 2BS71 5E2WH 3RZWA 4P2RA 1GGCH 3MRDB 2R39A 4NQDE 4POZC 1SJEA 3HTLX 1OGAD 5LDUA 5ABAA 1R5WB 2ARWA 3VI4B 4RSYA 4MAYB 1JNNL 5AG9A 2LV4A 1XGZA 2XWCA 2W80C 3ARQA 3IXAA 3MUGA 2JCCF 4PVMA 4OF6A 4PPTA 1J0KA 2B8OT 4YK4B 5EO1A 3W0WE 4F57L 2R1WA 1OE2A 1HYSC 3S37X 4JJOA 2A9NL 3BP5B 2WXMA 2VSDA 4BH7B 4P5RA 3IMRA 5D1XE 1C5BH 3JZ7A 5EA0L 2YK1H 5BW7A 4QRRA 5J89A 1XH1A 4MA1C 5TJWK 1KJMA 1XF2A 4Z7QF 1MCSA 3H0TA 3HG1A 3FT9A 4P23D 2E27L 2Z3FA 5EOCL 4NHCL 3V6FB 4Q89A 3VFMA 1E4XI 4H8QA 2DQEL 3OMIB 4F7MB 3HG3A 2Y07L 4FQ1L 5GIRB 5FDWA 3RNQA 43C9A 4YHZH 4HH9A 1HHGA 2X2YA 1NCDL 2FZ3A 5CEYB 4M9OA 3WJLA 1PG7X 3JV5A 4WK4B 3HVDA 2G5BB 3BE1L 2R51A 5CZKA 3MOBH 5AW5B 3T8VA 3NIGF 1TTGA 5IVZA 5IV2B 1YUHA 3ZHKA 3V4VB 2X4NA 4JDZA 1XZ0A 3QJUB 3JTSA 3RAJH 5EIIA 2YN3A 5DD1L 1NWOA 3JXAA 3FFCE 1N0XL 5AL0A 4PV8A 1J5IA 5AG8A 4X6CE 4BJLA 4QJ4B 2IQAB 1YSOA 2LFGA 4WW2A 2C4FU 5JIMA 4LP8A 5DO2C 5T1LA 3QARA 4E9QA 4TQEH 1TCRB 2MOQA 3SCMB 1TJIH 3UOAB 1HE8A 2RH0A 4M1CC 4C56D 3DV6A 4ZQKB 2BZCA 4L2LA 2VSCA 4MMYA 2WWKO 1U8IA 1FRGH 4GG8B 3B7SA 4B60A 3ES6A 1JGUL 2DJ4A 4N8CH 1B2WL 1T1ZA 2PWEA 5HVGB 1IE5A 3UACA 2GJZA 1ZHNB 1O75A 5CXPA 2F15A 2PPEA 2PR4L 4FNUA 3WDJA 3SODB 4N2GA 1D7CA 1TT6A 2GTZA 3IAGC 2F5BH 4EDWH 5JO5B 3HE7D 3A21A 4NBYB 1YY9D 3TA3C 1M6UA 4HALA 3QNXA 1V8HA 4PLKC 2FWOA 3NAAL 2FWUA 4CMHB 1PFCA 1H3PL 2A4ZA 5I1CL 3IGAB 4G5AA 3GSNA 3KJ4B 3Q9PA 4WFHD 5LN4A 1QVOA 5DDHA 5DD6A 1FYTE 4DGWC 1NOLA 5BS0E 3O3EA 1F6AA 2Z1KA 3UJIH 2X89D 5TF1L 4YBLB 3TBBA 1UB6B 1F4YL 3NESA 2ZWKA 5FYKU 1UUNA 1B4LA 1NFDA 1MHHA 1QATA 2J71A 5FA4B 4G8GE 1XAKA 2MNWA 1QRNA 4MAZA 1G7LA 5EN3A 5FOBA 1RZGB 4JRWA 4ZW7A 2ZYIA 2Z92B 5DEGB 3NIFE 3RVXD 2WBKA 3N2JA 3S35X 1AI1L 2GCYB 1WS7A 2A6JA 4G8FA 4HIHB 3P69A 2NY1D 4ZW8A 1Q38A 4HT1L 2IAMD 4LRNL 2K6YA 2VJ8A 3GK8L 1H3XA 4PS8A 2Y1VA 2VMCA 3FTZA 4MX7B 3CH1A 3DYOA 2UWEE 1CDCA 3QAQA 5J6GA 4XTRC 2H8PB 4AW7A 5D4HA 4LMQI 1QPXA 2NY7H 3WD5L 1F0LA 4D3CL 1J8HA 3SDAB 3FQTA 4NFBA 4NQUA 5DMIL 1A7BA 4AT6B 4ZFGL 1YYLL 1EEYA 3AU1A 2XWZA 3OZ9H 4LIQH 3U9UB 4WQOA 5GRJH 1TQBC 1WICA 3O45A 2OL3A 5TDPB 4XE0A 1XL4A 2IALA 4LPXA 3ZPDA 3INUL 4DPCX 1ZLUH 2EXYC 3I84A 3QR1A 3ZE1E 1SMAA 1ICTA 3AMLA 4HUXB 3ULUD 1PZBA 4D7PA 4R2GB 2O30A 2VKXA 1OE3A 4W6XB 1E5CA 4IKKA 2OSLB 3OSKA 1KG0B 1T04B 2BNQD 1DEDA 2N7BA 4M4RA 4PRHE 1VFUA 4XI5C 3VTTA 3O9WA 5I66B 2AS5M 2DI8A 4LHUB 4F27A 2F7OA 2APVA 4A39A 1F00I 3P3TA 3SPVB 1G84A 3ESUF 4K8RL 2V4LA 3DDGA 5EC2A 3WNIA 3NFPB 2OK0L 2ADFL 3H9HB 2HP4A 3RUGF 3FHAA 3R06B 2UVFA 3GXTA 2FGWH 2VDMH 3MJWA 4OCWH 1XCWA 3CSYB 3SGKA 3KS0J 5DHVA 3BKJL 3VFGL 4D8OA 1XIWB 2B15A 2NY0B 4HAKA 4IOFC 5D7LA 3MDJA 2WLJA 1I9JH 2XLLA 1MWAL 3QCVH 4OW6A 4Q0XH 1E4XH 3WELA 1E4KC 3NCYP 4DOHE 2SEBB 2FEDD 3U7WL 4KPHL 1FUNA 3KDMA 5HYFA 4BFFA 3RWDA 4UTAL 3HG2A 3RHWF 1MCQA 2ALAA 3NIDF 3TV3L 5E6UB 2OAAA 3MRCA 4L48A 1TO4A 2ZP8A 2YKLL 3ARFA 4UT7L 2YEZB 4LEOB 3T4AB 3W56A 1JGDB 1NCCH 1R24B 4GRLA 3TNNA 5ICXB 4N8UA 3UBXI 1NIFA 3UTOA 4PGJA 2OZ4A 1Q94A 4AGMA 3AACA 4MTMA 3CH8A 3DX9A 1AY1L 5KYYA 3QQ4B 4XVUD 2P7TA 2NYYC 4HX1B 5CGBA 1H3VA 4EI5C 2DAVA 4QNPF 3QORD 2CO6B 3VXQA 2GSMB 4PJ6A 4QRPB 1NSNL 5DRNB 1ZS8B 4J6IA 3IMSA 3MV9A 4JVPA 5EU3A 4PJHA 2MHAB 2X70A 3RWCA 4U1JB 3BD4A 5K9KA 4XWOD 1ZAGA 4OZHE 4OLXL 2IPKA 4XPBL 3ZT6A 1FIGL 3HRZB 2AEPL 1BG9A 1L7IL 2QR0A 5MENE 5L2KB 1GPOH 2O5YL 3K80A 3MV7B 4FI8A 5HGAA 3VYNA 4P46D 3Q06A 1RZ7L 2CLZB 1GOFA 5KYNA 3DX6A 4PIRF 2Q9OA 3MCKA 1IGYB 2KT6A 3IPFA 5LXGH 1Q1JH 5J1AA 2VL4A 1NDMA 4HS3B 4JN2B 4OGQC 5HP5A 3Q05A 2OR9L 2P8MA 1QUNA 3UPCA 1E8WA 1T20B 3WFDH 1L3WA 2K4WA 3T6VA 4Z0XA 3O4OB 4XMVA 5IESL 3G5VA 2DYPA 4Y2DD 5ABDE 2ZCKH 1UA3A 3MPCA 2WXLA 3GLZA 3MNVB 4ZNCD 1GR7A 4H8PA 3FB8B 1DO6A 4JR9L 2FJUB 4WUUA 4D0BB 2R0KH 4YHKH 4NQCD 3U4BL 5BQ7A 3V6ZA 2W0KA 3KL3A 5IMOB 1MCKA 3MRDA 4NPJA 1ULVA 4ZD3L 2GBVA 1WE5A 2A83B 1YQ2A 2I5YH 4XN5A 1R5WA 4MAYA 1KIUB 4BA0A 5J3HD 5T3ZD 2J8UB 3N42B 1G7QB 2PO6C 4CKQA 2PWHA 1F1GA 2HFTA 3KPRD 3RPKA 4DH2A 2FEEL 2XUWA 2KMWA 4BH7A 2HFFB 4JX0A 4OUUB 4UQ3B 1L6PA 5FV1L 3H7BA 2ZXCA 5L8KB 5F70A 1FZJB 1U2CA 2EDKA 3CQQA 2PCPB 4M5ZL 2AGJH 5C0FB 5DJDB 3SDDC 2EVHA 3NQIA 3QI9B 2HFEB 4MQSB 4C54A 4W9JC 4HUUB 4JFYB 4G7VH 1KYUA 4N0YH 3KGTA 3IFLL 2NXZB 3QEUB 3MUY1 5LWYH 1GZHA 4F7MA 1BVLB 4D8PB 2YGPA 5GIRA 1OGAB 2DPKA 4GH7B 4EIZC 1JRHL 4GOSA 4UIMB 1LP9E 3CPUA 3OAYK 5C3LD 5CEYA 1A3LL 1P0SE 3ZDWA 2R0WH 2G5BA 5B38B 3CX2A 4MQXD 3FU6A 2CRYA 2BIQA 1KB5B 5ACZB 3WE6B 5IV2A 4Y4FB 2G3MA 3V4VA 1XSKA 3ZT7A 1IJNA 4BKSC 1DSFL 2JK5B 2ENSA 3V6BR 1A3QA 3CGTA 4UT9L 2RAMA 2WTPA 4JFSA 4FFVC 1T6WA 3GKWH 1MY5A 1QSFD 5KS9B 3UFIA 4Z3IA 4AYBA 2CXGA 3GGWB 2VWEE 1FLRL 1U4FA 2IQAA 2WUCH 5DRWB 5EIIG 4AQAB 1T03H 2O6DA 4XP4H 4XNQB 4DUVA 1D5ZB 4P23B 4S1RH 3U4KA 2ED6A 1N68A 2Q7NA 1TCRA 4W4OA 3PUUA 3SCMA 2AABL 2XHNA 1F5WA 1IV8A 3IS0X 4UTBA 1CI3M 2E86A 1EH9A 1DQVA 3FJTA 1GS6X 4ZQKA 4H25A 2BW5A 4ESKA 2EE0A 1DFBL 3RBSA 1B6UA 3TBCA 3MUUA 3FUHA 4GG8A 1SXAA 4XCFH 4WJ5B 1T89A 3UYRL 2WO4A 2YPKB 1ZHNA 3FOLB 5IEHB 1BDYA 5IWLC 1PPIA 3MFFB 3RU8L 2BP0B 1PMYA 5JO5A 4HISA 1MZYA 1LWRA 2WJ5A 2K7QA 4IBTA 5H4YA 4WNJA 1NMBH 1SQMA 4LSSH 1T83C 2ZWLT 1AR1B 1A7RL 1JZ3A 5J56B 1UWXH 5IQ9B 1T1YB 4XB7A 4BCYA 4PRDB 2WOYA 1UB6A 1IZKA 1ZHKB 2PMZA 3LPWA 1MRDH 5C7XH 1CYWA 2UXGA 5FA4A 4JKPL 2PTVA 1URIA 2YPVL 1ZK5A 3OKDB 3TEZA 1RZGA 4YNYB 3IYLW 2Z92A 5DEGA 5EUOE 2GCYA 4HIHA 2IDFA 3VVWA 1A14L 1UH3A 2AQ2A 2D03H 2O93L 3HE7B 3CWGA 3CSTA 4HLZG 1OTSD 1X44A 3HAEG 4MX7A 1HZKA 1G4RA 2Y1AA 3K1KC 2H8PA 2XVKA 2EEFA 5FM5M 4TNWF 1JNJA 2WTOA 4X9FA 4BINA 3MA9L 4Y5YB 4AT6A 1YMMD 1JZHA 2VLJD 3U9UA 1S8DB 3B2MA 4NYLB 1NBZA 1GGTA 5EOQL 5EU7E 3CAFA 1YMHB 3ZRSA 5TDPA 5GS0C 2CO7B 4BELD 4JFED 5KZCB 1OSZB 3DUUB 1C16B 2FK9A 4HUXA 3E3QC 5FFGA 2NY6C 4E9LA 1N64H 1ZLEA 3VSTA 3MACH 1JDAA 3MJGX 2OSLA 1KG0A 1W6WA 1T04A 3IJ8A 4H8WL 1L7TH 25C8L 5TQ0H 4BD4A 5HGHB 5D1XC 5I66A 5CP3A 1CWVA 4LHUA 4AEIH 4WUKH 3PU7A 4GI8A 3SPVA 2WTRB 3ESPA 2QZQA 1SQ2N 3SY6A 3O2DA 1OAUH 3IDJB 2X0WA 3R06A 3VD5A 3EJYC 2XWEA 2IG2H 5I9QB 4ZSOB 3CSYA 2AMGA 1UOKA 2EDWA 1F3RB 1XIWA 2EINB 1EX0A 3KYNB 4H5SA 5CKGA 4DGVH 3LKSA 1JHTB 3KLQA 2SEBA 4HIPA 5E23A 4YSTA 2YOCA 3IBEA 1GYWA 2VJXA 4XOCA 4F8PA 4WTZA 1JN6B 1OAQL 5D1QE 3VFNB 4CVUA 2ITDB 4JAMB 1AHWB 2BNQB 3MXWL 2NNFA 1FE8H 2QQNL 3MRFB 1AO7D 4R96B 2YLKA 3OZKA 4LGPB 5I26A 5C0BD 2A9CA 2YEZA 3T71A 4LEOA 4PMFA 5CIPH 1NCAH 3T4AA 2HVBA 1JGDA 5HJ3B 1R24A 5KTEL 3FBQA 2FL5B 2R69A 2KZ1B 5ICXA 1YEKL 2RBLA 4K3GA 3V4UL 4DP5X 1WTLA 3BLBA 1ZVSB 5DLMH 1RVFH 3A4AA 4TVPE 3SKJH 3QQ4A 4M61A 4NXKA 4X7SH 5CJOL 4HX1A 1DQLL 3U79A 5LG6A 1KJ2H 2CO6A 1L9QA 1R34A 5F1IB 2D0GA 3LNFA 5DRNA 4HGMA 1B0GB 5IROC 3KPLB 5IHUL 4G71B 2PR9A 2MHAA 4DGUA 5IB4B 2DMGA 3N91A 5J12B 4PJCB 4GEJA 1XGRA 2P5EE 3G9VA 3HRZA 4ABVA 4ELMF 5HHVL 3MLRL 1MREL 2HLFC 3B7UX 3JVGC 4P2OA 43CAB 5L2KA 3MRBB 4JO8A 3KWUA 3UBFA 5C0GA 1IQWH 3FT3B 5IZ7A 1U21A 1PKQE 3FUIA 5IUSA 1N12A 3KM1A 2CLZA 3FTXA 4XN9A 1JHKH 4Z7OE 2AC0A 3K8LA 3QG7L 3EBIA 3AG3B 1IGYA 1LO4H 4XT1C 3K6SA 2GJ6E 3QORB 1BFSA 1KN2L 3GSRB 4HS3A 1OPGL 4JN2A 1J0HA 1KELL 5DUML 1H5BC 2K9FB 4KDWA 3D25B 2ZAGA 4AYSA 3BAWA 4Y16B 2GFBB 4H7VA 4JFQB 3ISWA 1T20A 1WEJH 4P2RE 1A4JB 3BOVA 2BJMH 1NLBL 4KK8D 2EH7L 4L8BA 2M83A 3ZVVA 3BGMB 3MNVA 2XV6B 4JZJB 3NGBB 4BZYA 1B6DA 1SOXA 4D0BA 1AS7A 2JF1A 5IMOA 3WTXA 4Y88A 2A83A 1ZXKA 4P46B 3BXNB 5ESVB 3KNBB 3U6XA 1EFXB 4QRRE 4QRUA 3HZKB 1EQWA 3LIZH 1KIUA 3GPEA 2J8UA 3HG1E 4HYTB 4B3VA 3RB7A 1OOWA 3HB3D 1XB3A 4KVCL 4NEHB 4NKMB 4UWQB 2EIMB 1F18A 4ZOCA 1E9QB 5FUOH 3L3OB 4MJIA 3V2AR 5SV3A 3ZTDC 4TSCH 2D7TL 2HFFA 1R3LB 1S78C 3BD3A 3CSBA 3Q8CA 4OUUA 1G94A 1P7QB 1H9DA 4YDIL 1FZJA 3T65A 2PCPA 4OM1H 5DJDA 3KHQA 3QI9A 2IGTA 1JZ6A 4QYOB 5CKAA 4HUUA 4PB0L 4JFYA 3KPOB 1RIUL 3FCSB 4NQCB 4URKA 2PPCA 3QEUA 4UQCA 4WKXA 3FO0H 1BVLA 4CC1A 1BMZA 1OGAA 3T8MA 3ZSSA 3X3FL 4DN3L 4WW1B 3QHZH 1DP0A 5CD3A 1HSAB 1YJDL 3QWQB 5B38A 5K1NA 4D9LH 1D6VL 3LQAC 1KB5A 3KPRB 3NIFF 5ACZA 3HI6H 3WE6A 4Y4FA 5T33L 1T1WA 3O6KH 2OA9A 4K9EH 4AQEB 4LSRH 3ZU8A 2BWQA 4HKZB 3SPIA 5KS9A 1ACYL 2CNYA 3GGWA 4AQAA 4UB0H 2UWEF 3MLXH 5ACLA 5FOJA 4XNQA 1D5ZA 2DTML 2NR6D 4P23A 1YNTF 3MXVL 4KROB 3MLVH 3PGCB 2N3JA 5AOJA 2NOYA 4WO4C 4OSUL 5C08B 1IGCL 1OCWH 3WMSA 1FNFA 1I9RH 1EEUA 2DJSA 4HMEA 2DQHH 3DO4A 5B1AB 1JK9B 5DMGD 2EE3A 1NCTA 2K8QA 3TO4A 3PWJB 1DN0A 4UDUB 1O9WA 1RJCA 2HWZH 3ZE1F 3OL2A 1V7NL 5IEHA 4OZ4A 1F1DA 3MFFA 1QSFB 2BP0A 4HEPA 4FXGB 4ZOEA 3LV3B 1RIHH 3CE1A 4FI7A 1NFDE 3CDGA 1S2EA 1U8CB 2D3LA 2OMNA 3C6LC 1QRNE 2DWDB 2GKIA 4Z3JA 3B2VL 1Z3RA 4FTDA 3PHAA 2A9MH 3M1OA 4CC4A 5IQ9A 4JHAL 1T1YA 1PG7H 3U2SB 2C9SA 3WENA 4YPGA 4CADB 2XJLA 4PRDA 3ZYOA 2FJSA 3FT0A 1ZHKA 2YZ8A 3MRNB 1BLNB 3H85A 4JG5A 2ARJQ 2NXYB 1QFWL 3OKDA 4A6YB 1QNZH 4YNYA 1A4KA 3VRLE 3UJTL 4OCRH 4M62H 1J8HE 1A02N 2YD1A 1YN7B 1NGXB 4L3ED 3V9FA 3HE7A 5ALCH 5AQ0A 1D9KC 4FQXC 4GO9A 5B39A 1F56A 1P4LB 1BQKA 4IHBA 1QSZA 4PGDB 1RZKL 1R3KB 5JQIB 4JHWL 5EU6A 4YO0B 5LGKA 3DO7B 4Y5YA 1P4UA 4I8DA 3MV11 1LHZA 5ADPH 4UIKH 5FW7A 4IU3A 1S8DA 4MHHG 4NYLA 4Y5XB 3ROOB 3GRBA 2XCMC 3DYPA 4R83A 2YQGA 1YEJL 1YMHA 3KBHE 4JNXA 1VDGA 1BLIA 5D1ZI 5AWNH 5IMMB 3TV8A 2UXTA 3FB7B 5C3IA 1QI4A 2VDKH 5TDNB 3WTTA 1Y7VA 3QQXA 2V9TA 1CL7L 1OSZA 2UV3A 3CN1A 1C16A 1BSIA 4RH4A 4C47A 5ID0B 2H0JA 4X6FA 1B90A 2BHZA 2YMXL 2Z34A 3NTCL 3BPNC 2QQLH 4OZHF 4QJ3B 4YXKL 4J3OD 4PRPA 5HGHA 4ILDA 2H5UA 3ETTA 4MB5A 2QJDA 3O3UN 3SE8L 5DMKB 5DJ0B 2HX7A 5D7LE 2GW5A 2YAQA 1EAPA 3P30H 5L8JB 8FABB 5C71A 4ELKA 2WTRA 2PPFA 2F7QA 1NCJA 4TN9A 1YMMB 2W0FB 1PQZB 2D3NA 3F7RA 2ZXQA 1X5YA 2VLJB 4LHUG 5EO0B 3IDJA 5I74B 2NCMA 5CZXD 2WLZA 1GJUA 3IPEA 4NC1E 1KCUL 2X3AA 4QRFA 5AVQB 2X05A 4G7RB 1XH3B 4JFEB 3KYNA 2W88A 2B5IC 4XGZA 2X1XR 2R4SL 4N20A 1YEHL 1JHTA 2KLSA 4HJIA 1Q72H 1P6AB 3MJ9A 3H1ZA 1NMCB 2WD0A 3MLZL 4ZUVB 2XZCH 1JN6A 3VGFA 3VFNA 4MJ2A 4JAMA 1AHWA 4YL4A 3IJ7A 4EUPA 2ICES 1XR8B 3MRFA 3ARGC 4JHVA 4R96A 3SBQA 4FJYA 3PAUA 4WTZG 4IMLB 5L7XL 3AGWA 2W92A 4JFWA 2VWEC 5HJ3A 4LSQL 1BVOA 2R27A 2A6DB 1UZGA 3BKMH 2FL5A 3U1QA 2IPUK 2JMRA 4KXAA 4M7ZC 1ZVSA 3SKMB 3MV9E 4PJHE 5KSVB 2IPUG 2Q8AL 1IEHA 1KC5H 4OCYL 4QAMB 4B0MM 2CA4A 2VDPB 3GFUA 1PZ5B 3QDGB 4ZI8A 3VFWB 5F1IA 1PLBA 1TJHH 5E5MB 1B0GA 3FHEA 3KPLA 3FU5A 1JMXA 4JANA 5TDOB 2HRPL 3PQYD 1KCBA 4UV7L 4DAGL 5E4AA 5IB4A 2CE6A 4R0LC 1AO7B 4L5FH 4PJCA 4F33A 4Q52A 2ZOTA 4XXDB 4S0HA 4ORZC 4XCEB 3D18B 3MRIB 43CAA 5IBUB 3MRBA 2DQCL 5CM1A 3FT3A 2NZIA 1I1AC 1LP9F 2Z65C 1WFUA 3T0AA 1JG9A 4K55A 3CFIC 3NBNA 4HZ1A 1GOHA 4I0PC 4ZAKC 2APWA 2EDDA 1WISA 5DUBB 3GSRA 1HE7A 1TYEB 2P48B 3KDPB 4AV4A 3Q1SL 4HZLB 1UM4H 1OK0A 2WBJC 3D25A 4QXTB 4WUUE 4Y16A 2GFBA 2PTUA 4JFQA 4NQQA 4A37A 2VLRB 1B4JH 5CSBA 2Q2EB 1HN1A 4LOUC 1A4JA 1AE6H 4TRPL 2F7PA 2Q3XA 4CL7A 5I8CB 3BGMA 1TTCA 3EJPA 4JZJA 1KENL 3O4LB 4PWHA 2WLIB 4YWGL 2PPAA 1Q90A 3GIZH 2Z8VC 1KGIA 1HL4A 3TURA 3WNNA 3SKNB 1CFVH 4UOQA 2ZJSL 5GGRY 3BXNA 5ESVA 3KNBA 4OVVA 1EFXA 3AB0B 3HZKA 4L4JA 4YGVB 3ZO0A 3EUUA 1KCVH 3O0LA 4G82A 2BSSB 2X4OB 2WGXA 4NKMA 3NFSH 2XTSA 1E9QA 2B4CL 3L3OA 3L3HB 1I9EA 1G5AA 5EU7C 5FIEA 4UU9B 1F13A 2BSCA 1R3LA 1RUAH 2GT9B 2IVFC 3DX1A 1XGTB 4GAAA 2MOVA 1P7QA 5AW0B 3QFGA 5GGSA 4DF9A 4F93B 3MAWA 4P9HH 2ZX7A 5CF3A 1VGKB 4ICXA 1ADWA 3IDMA 3LEYL 1CCZA 5C92A 4QYOA 2K6ZA 3SN6N 2Z4TA 4MQTB 3UMTA 2J5WA 3KPOA 1MFNA 1FZMB 2AQPA 3OKYA 4M7KH 1FFNB 1MJUL 3FCSA 3QIBC 4NQCA 1C1EL 1CYGA 1J48A 3I02A 5FM4A 2E6QA 3O6FB 5AAMA 4I0CC 2H2PD 1XZWA 2IGLA 4QHPA 5L4IA 4K5PA 4CJ0A 2BZDA 4WW1A 3FQXB 1HSAA 2KPNA 2MCMA 4N4YB 3HB3B 4JO1L 4X80L 3NACL 3KPRA 4LLWB 1KJVA 3D1MC 5EUOF 3SYQA 2J5LB 5ALBH 4O2EB 3MCLL 5T1KD 1IMHC 1NAMB 4XPAH 3WI9A 1ADQA 2OXHB 2ENYA 3GJFB 3NCFB 4N86A 4AQEA 4DQOH 4TNVK 1WBYB 2YRPA 4HKZA 4JBSA 1N8OE 3I6LE 4XC1L 3MJ7B 5I6XC 4L3AA 1AGBB 2EO7A 3HFML 2XZQL 4PJ8C 4GT7A 3WFCH 2WWOA 3VXPB 3PGCA 4KI5E 5D1QC 2DLIA 5C08A 2WINB 3DGDA 4JGMA 1JK9A 4XAKE 1B4TA 1XGQB 4UQEA 1IFHH 1GSKA 1MRFL 3PWJA 3V52L 5I0WA 5A2AA 2E6JA 5FYKD 3SDCC 3SYOA 4N5UA 1QLEL 2BXZA 3FQWB 4X6DB 2BWIA 3ARBB 4JRYB 5CBAB 5CEZH 4FLHA 2ZAHA 4HK0B 1QFWM 1KGXA 4PTUB 5BUGA 2J6EA 2WIIB 3BAIA 2NZ9D 1QSFA 1M05B 4FXGA 3RDTB 3LV3A 3ZYJA 1FL5B 4L1BA 3IFPB 2WWMD 3QJSB 1NIAA 4AZ8B 1U8CA 3TJHD 4HEPG 3D52A 5HGDB 4AVKA 2R2BB 4ZS7L 3EHBB 3UYPA 3IFNH 1TTUA 3N1PC 1GGBL 4U3CA 1MFEL 3U2SA 1UZ8B 2JB5H 3KLKA 4AC2A 4CADA 2FH8A 1JYWA 1JV5A 4WU7B 2CD0A 3HI5L 3MRNA 1BLNA 4X7DC 2H3KA 2X6BA 4U2ZA 5CU5A 3WXWH 3R7QA 4YR6A 1NCGA 4POUB 3RY5A 4A6YA 3T2OA 1LMIA 3BUDA 3KLHD 1S3KH 8PAZA 2NRDA 4RNRB 5F7BA 1I7UB 1SHWA 1BREA 2ATKB 5T3XE 1YN7A 1NGXA 2ZP0T 3BFQG 5I73B 5C0CD 5DJCA 1UOVA 5LUMA 2FECI 7PCYA 1VACB 3UPRB 4PQXA 1P4LA 4N85A 2DQGH 4GW1B 4TULH 4UM8B 3G6AB 4BXVA 3HS8A 4PGDA 2E7DA 1R3KA 3T3PE 4E5XB 5B39G 4U3SB 4YO0A 1A6WH 4PGCA 3DO7A 3U4EB 4D9QD 1CQKA 2EC9T 1SFHA 1IC0A 3A6BL 1CLYH 4APQD 4Y5XA 3ROOA 2JSFA 3VGEA 4N90E 2BY0A 5E70A 3OAZK 4YE0A 5E5LA