2E7DA

Crystal structure of a neat domain from staphylococcus aureus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
DQLTDLQEAHFVVFESEENSESVMDGFVEHPFYTATLNGQKYVVMKTKDDSYWKDLIVEGKRVTTVSKDPKNNSRTLIFPYIPDKAVYNAIVKVVVANIGYEGQYHVRIINQDINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for multimeric heme complexation through a specific protein-heme interaction: the case of the third neat domain of IsdH from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
molecule keywords Hypothetical protein IsdH
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2e7dA00
4FC3E 3QZMA 3SZKC 4MYPA 4H8QA 3QZNA 2Z6FA 5D1ZI 2O1AA 3SZ6A 2O6PA 4YMPA 3RTLA 4NLAA 2E7DA 3S48A 3QUGA 2ITFA 2ITEA 3QZPA 2K78A 2H3KA 3QUHA 3OVUB 2MOQA 3VTMA 5D1QE 3QZOA 5D1XE 4H8PA 3RURA 3SIKA 2Q7AA 3VUAA 3QZLA 4WJG3
chains in the Genus database with same CATH superfamily
3WJLA 3C6EA 3H3PH 3O3DA 4NPYB 4OZGA 2X87A 3EF7A 3ZL2A 5E8DL 3OKEB 1KYDA 2W65B 1ZGLP 2YGPA 3OXSB 4N2LA 3L1FA 1T5XA 5KSUB 3MCG1 4OD1L 1BQLL 4IYKA 2H41A 1FL6B 2NSMA 2ZWNA 3FB7A 5DLMH 2APXA 1JGDB 1HAUA 5DJXB 3PHQA 5C92A 1QRKA 3ASWA 3M45A 2B16A 4FNQA 4FJYA 4L3EE 5E8OA 3RWFA 3M7FB 4G8FA 4NBYB 1YSOA 2Z31C 1PY0A 1D5BA 1EFQA 2KUTA 4QJ4B 2O5YH 4N2OA 4BZ1L 3TNNB 1NMAH 4KNQA 1M42A 3SDDA 5I28A 4P4RA 1ZLSL 3AM8A 3UP1A 3PDOA 1A4AA 2OL3H 1WWCA 5D72L 3IBOA 1MWAL 4LP4A 32C2A 5EN2A 4EN3D 1A64A 3INOA 5IBUB 1ZV2A 2FO8A 3OKOA 2ENQA 5DVOA 4XXWA 3BAJA 4CMMB 4HJGB 2VN6A 4UYQA 1BZOA 4Y4KC 2OSXA 3VXNA 3WIFA 4BWUA 5E95B 4BJLA 1U8QB 4KKQA 3G5WA 2HVJB 3ILQC 4DH2A 3THML 4Z0XB 1UT2A 1NM4A 4FKHA 4Z7OF 5DD1H 4JFSA 4IRSB 4MJ2A 1OCWL 4IOSD 2ZOKA 3G9VA 2N1KA 2WHVA 4KJWD 5H37G 1UVQA 2WWMC 3CV5A 4H8UA 4MA7H 3VXMD 1N2RB 1MG2C 1XR9A 4JDZA 2BERA 4KHTL 2EDXA 5TE7H 3ZE1B 4G2AA 2NUTA 3D1MC 1GHFH 2V9QA 3RY6C 3GJFK 3FT4B 2Y1AA 3MRGB 3Q0HA 3MCLH 4NHUA 4P23C 5AW5B 2O5YL 3PGCB 3SIKA 4IKKA 4CVWA 1X5YA 3UX9B 1GHFL 2VRQA 5TE6H 4YLCA 1ORSB 4KV5F 5J11B 2VLRD 4I7ZC 5K59F 3CC1A 3QXDB 4CAGA 4K3JL 3NACL 4B5EA 4I48A 5IM7B 3R7RA 1LXMA 5L7XL 1A3LL 3KPSB 4KJYB 5DHVH 2C9PA 5E7FA 1EZUA 1TU2B 3K1DA 2QDVA 5E00B 5BW7A 1RJZA 4UQ3A 4NM8H 4QXTB 1M6OB 1IE5A 3KPNA 4XCYB 1IJNA 3UTSA 2FJFB 4PJFB 1MLCB 5G55A 2C9QA 4YZFF 1KEMH 1WP6A 1RZFL 4P06A 1AH1A 1JV2B 1RJYB 2A9MH 4JMXA 2OJ1A 3AS1A 1L9TA 3BH4A 1SY6L 2XPYA 3E3QC 5IW1B 3SODB 3WO3B 1TZIA 1A21A 1PKQE 3K8MA 4IRZH 5AOIA 1AO7A 3HE7C 3AS3A 4PJ7B 5LQBH 4LCYB 4FJZA 3QUXB 3SN6N 5CD5C 3D39D 4YX2L 4ISVA 4PJAF 2FUQA 1J8HB 4OCNC 5DMKA 5DHDA 5I6KA 1XL6A 4LKXA 2AXFB 2JIXB 5L2JB 3GT6A 2CCWA 2VGLM 3WTWA 4AIOA 5SV4A 5B4MC 2HKAA 3OHXB 2FQFA 4WU5B 3BQUC 1ERNA 1HOEA 5CBAA 1HXYA 3NABL 5CEXB 5DWPA 4LRIA 1NLDH 3II2A 1YEEL 1FO0A 3FTVA 1I1AA 1E9QB 4ENED 4ETQB 5DVPA 3NJXA 1GZHC 2CXKA 4EF3A 2H7WA 3W9EA 1KBKA 3ZSSA 2FX9L 1NFDB 2VDQB 1JZDC 4RGMC 3W5MA 4P3DA 3QDMB 2X89D 1W72L 1H9DA 1KGJA 2FZ3A 2H0JA 3U1QA 4BXSV 1MWAH 2X4RB 1IGTA 1X5FA 4UNIA 2C9AA 1ETZB 2IFFL 4J3OF 1GH7A 2JE8A 1CT8B 4P2OB 3HG1A 3MLYH 3A4FA 4X6EA 4KNTA 3S34H 5DCCA 2AQPA 4PB0H 3X13B 4MJJA 4UM9D 5GS1B 3BEWA 4DO4A 4G80A 3PNWA 2AVFA 2J1WA 5DD0H 5GS2D 1YECL 1FCCA 4PRNA 4HU8A 4J1UB 1GYVA 1IGFH 4HKJA 3I6SA 5C97A 5AUMB 1N5YL 3BSZL 2R2BB 5D6CA 1F3JB 1F8TH 1FLRH 4BA0A 5EEXA 3Q8FA 2ZUQC 4G1EA 2W9DL 3G6JF 2WNGA 1U8IA 2BSED 3VXNB 3VXQB 3WIFB 3OLGA 3PXJA 1CG9B 4HJGA 4XMLH 1NDMB 5HGHA 3BJLA 3SDCA 2XWZA 3F85A 4ESKA 1BF8A 1GZHA 1TZIB 2F15A 5C07D 4DZBA 4M5SA 1TJGL 1P7BA 2BSSA 5B3JE 2DWYA 3JT0A 1K4DB 5HHXL 1I53A 4KDVA 3SKUD 1J0YA 1NCCH 4HC1H 3UAEA 4N24A 3ARGB 3WNPA 2JK5B 2MJWA 5DJYA 2AF2A 2FH8A 1QWNA 3SQRA 4PJXB 5L2KD 4Y5XA 3IVKB 3BSHA 2VM4A 4HMDA 2B2XL 1KTJA 1A9VA 3GWJA 4WWNA 1TITA 1FE8H 4OFKA 2LU3A 3TYFA 4E42A 5IB1A 2C3WA 2BHUA 4XVUD 1CGVA 4ONHA 3JUYA 2HWZL 2BHFA 1IAKB 4NPYA 3GDBA 4JZOA 1MG3C 3N0AA 1KZQA 1JNJA 1I1RA 4OH2A 1FZMA 4DKDC 4Z9KB 2XZQH 3FU6A 3PGCA 4ONFH 3OPZH 5IROC 1DLFH 1SNRA 4QHKI 4Y5XB 4ZDHA 3IS1X 5I16A 2ARJQ 5FLVA 2L7EA 3WFCL 1MEXH 2DLGA 4ODWB 2DWDB 1V8HA 3S88H 5DD1L 4LSPL 2CKNA 4GG6B 2KZBA 4TPRL 3P3RA 2OR9H 4BWWA 1F2XK 3CFJB 2EC9T 4FI6A 2AI0L 1I7TB 1NCHA 2XIIA 4MDIB 1WZ1L 4A39A 3AGWA 3JBG7 4MMYA 3VGHA 3GB7B 1OOWA 1SXSA 3EUDA 1U2HA 3LRSA 1GPOL 4I0KA 1G7IA 2FATL 5J13C 1HSAB 1FNSH 4X99B 5BV7B 1KB3A 5PCYA 4FADA 4GEJA 4UTBA 1MHHA 5T3ZL 4M48L 1FIGL 2X7LA 1JHKL 3WEOA 2QVMA 4E9XA 4MQXC 5HI3D 2DQJL 3LKQB 3MAWA 3ORJA 4W9FC 2YN5A 4UNUA 2TRYA 2K45A 3U46A 1H3GA 3HAEA 1IQWL 5IBLC 8FABB 3QDJA 4HP5A 1UWGL 2AKRA 2F19H 3MR9A 2I9TB 2YRLA 1B0GB 1UHVA 4WSJA 4ABUA 1WBZB 2VXTH 4JZNB 4A55A 2QLYA 4PAZA 1E5CA 3BVUA 4LHQB 1INQA 4GAYA 4KRPB 4QUOA 1A1MB 1L5GB 1R17A 2LU7A 1A6VL 2BIHA 3UPCA 2E7DA 3BVNB 1UACL 4D0BB 4WW2B 1E9QA 4A7SA 1FFRA 2B20A 3EYUH 3FH5A 1ZKAA 1UUSA 3HS9A 3X14B 3EBGA 3MJ8B 4G6FD 4HLZG 1AP2A 1NM9A 2PO6D 5AAMA 3VDBA 1A4CA 3QVAA 3UYPA 3HNVL 3VI4E 4KXZH 1F3JA 1NBCA 5EC2A 5HHQA 5IHLB 4XN2A 1G1OA 4NT6B 1GCYA 3ZDXB 4WDIA 3RWEB 3VXUA 3U30B 3RY4A 4A2LA 3SJVB 2WTOA 3S4SG 4EIGB 3P9LA 3GGWB 4JKLA 1FBIH 1T20B 3IAQA 1DSFH 4UT9A 3CFKB 4WKZB 5JPNC 5AG9A 3JT2A 4FXGB 3BE1H 3ZZSA 2D2OA 4NZFA 5ISZB 2HLAA 4U6XA 1UJ3A 4DN4L 3DO4A 3FQTB 2JH2A 3IDGA 4XI5D 2XQYK 3M17B 2JJSC 5EN3A 4F93B 1NCBL 2FIKB 2XJLA 4WENB 4OGQC 5C0BA 1G9MC 3SGKC 3BE1L 3ESUF 4R9HA 5IFJB 4OW6A 5FCUH 1MKFA 2YRPA 1LMKA 1X9LA 2R2BA 1DVYA 3OHMB 5T5NF 1GSMA 2ATPA 2BPBA 3C5JB 4FULA 4KKBD 2F53A 5DC9B 5TDOB 1CI5A 3FSOA 4XMPH 3T0XA 1E65A 5AVSB 1KCRH 3EO0B 1RJLB 2G3ZA 5FUZL 3D18A 4HWBL 1UUNA 5JIMA 4XGZA 2D3JA 4QCIA 1GYUA 4XPHL 3BUDA 3M8OL 4XN1A 4AEIH 2A9DA 2OXHA 4DO5A 4PJIA 5EOQH 1S7QA 4PJEE 1TTBA 5GGRA 3EYVB 4ES8A 1HNFA 3UJJH 4FQPA 2OMZA 2VKXA 1OB1B 2XETA 3BGAA 5EBWA 2NY1D 3KGUA 4TRPL 2OJZL 2QTVA 1B4TA 1K5NB 1DZ0A 3RDTD 3B2VH 5IESL 1G7JB 2IXQB 4BFEA 1WC7A 5DD5H 4U0RC 3RFRA 3DJSA 1YUKB 4TQEL 5F1IA 5K59E 1AY1H 3ULAB 4EDWH 1MFAH 5E1AB 1N0XH 5ISZE 2OW6A 3MV8D 2JQZA 4UM8B 2NZIA 2XV3A 3VH8A 1XB8A 4MD5B 1JN6B 4LRIC 3X2QB 3VFSA 4R97C 4KKAD 2WINA 1KCUH 1XGZA 1J1OL 3GB7A 3KPMA 4ZMTA 2EUXA 1G7MA 3GLEA 3SYPA 3UBHA 3WAKA 1T1WB 2BSDA 4RAVA 3QFJA 5D7KD 3VGDA 3O41B 3AG3B 1A65A 1JGUL 5TK2A 4M5YH 2ZXDA 5F8QC 3DTXB 2YUZA 3GMMA 4GXVL 5B1BB 4TQ8A 4HEPG 4W68A 1UD3A 1N5AA 1WAAE 2NTFB 4WUKH 1EEYB 1RJZB 5C0EA 3QCTL 4QXUH 5B22A 4KNSA 5DURD 4GG6E 3EJZD 4BH8A 1FZMB 2NY0B 4KOBA 3BWUC 1GAFH 1NPUA 2VLJA 3BT2L 1LQBC 3B2VL 3AC0A 4XCFL 3WD5L 3EG9A 1IC7L 4WEBH 5AAWC 4J27A 2HJLB 2Z8SA 3V55A 1DLHA 1PLGH 3EOBB 3D85A 3DX2A 3MYJA 1H3WM 3TO2B 3V4VH 2VXSH 3WEBA 2ESVE 3QA3A 1XCXA 4K8RD 4PV1C 3F01A 4ENEC 3MRKA 4A68A 4HD5A 3T6ZA 2Y1YA 3TPUB 1NDGA 1P5UB 3CC5A 2D0HA 2BNQA 3BRGC 5HYQA 4N4YB 4KI1A 4Z23A 3GBNH 5GGSY 1KIRA 4PGDB 1VGEH 3F7YA 5CCJA 1EJOH 3MCKA 4W9IC 3V6BR 4P9HH 3MUHL 4I77H 2XTJD 4UWQB 4HIEA 4KGJA 3UBXG 1W80A 3QWNA 5HYEA 4UAHA 3OKYA 3B8YA 2JKLA 3PAYA 4FG2A 2XT1B 3MLZL 4TVPH 5E2WH 3U7YL 4ZMYA 1T80A 3LZRA 1CFSA 4PBXA 3D08A 4UIKH 5F1IB 2OAAA 4KDTC 2W38A 2ZNXA 4MNQA 4YSCA 2MSPA 4NZRL 5BVPL 1RMFL 4HLZH 2W88A 5I66A 4M8QB 2A0LD 3A3YB 2ZUWA 3BW9A 2Y3NA 5L8KB 2EZ0D 1KFAL 1QI5A 3FO0H 1EDYA 2EIEA 3GBMH 3JTBA 1T89C 4IDLA 4E36A 2CGRL 3ZYZA 4GAGL 2XWJB 4AK2A 3AT0A 2E0PA 2D4FA 3L2MA 3QNXB 2A6KB 3W57A 2GJJA 3J27A 3TFKC 5FYJH 1JERA 3FYEB 5GRZA 3SJVE 4MJIE 3WLWD 3CSYA 4M1CD 3RVUC 2G3MA 3IDIA 1M57B 3MA7A 5DO8A 1RIVH 1VZIA 2KBGA 4CVUA 4OM0H 1SY6H 3T2QA 3UL4A 3QWRA 1X5MA 4A38A 1A5FL 4PJCB 3GNMH 1JNLL 3CD4A 4HHAA 2VN4A 3ABZA 3NJIA 4UQDA 43CAA 5TF1L 3U48A 4OJFL 1BFTA 1NC2B 1PLGL 1T3FB 1NDGB 4F7PA 4L9LA 2EZ0C 2CLZA 2XPGA 4PS4H 4IDJL 4XRCA 4DUXA 4DVBA 1JRHI 3WLWC 3V7MA 5LKNA 3LSOB 3B9KC 3GRWA 4JQIH 3C6LA 2O6PA 4TLKA 3CFDB 4LGPB 3A47A 4MZIA 4PWGA 3T3PB 1RIUH 2WWNA 3B7SA 4P2RB 3VXTB 3DK2A 4FNRA 3RFZC 1UENA 3QNZB 4KK9C 4U1IB 2BP8B 1F0LA 2OKMA 4P07A 5ICUA 3UTTB 5IMOA 5TDNB 2AQ2A 3QJXA 4Z7NE 2P5WB 1FO0H 1CICA 1DEDA 4DP0X 4FQ1H 4W4NA 5D1XE 2FTAA 2P8PB 1P6FA 3LNEA 4MAYC 4DTGL 4PRID 5FYKU 2Y5TB 3WO4B 2XY2A 2IDFA 4K9EC 4W4OA 3QZNA 3MLPA 3VXRD 3CIAA 2GIXA 2NRDA 2ZOLA 1WFNA 2X4OB 5BOPA 2FL5A 4F9PC 1BJ1H 1RK7A 1PZSA 2EEBA 4PJCE 1XGRA 3PAVA 1YYCA 2A73A 1GOGA 1FNFA 3V0FA 1JGLH 3ZIMA 1ZV5A 5CZXD 4NBXB 3RWCA 2Z8RA 4CN6A 3NSCA 5DVNA 1THAA 3CNKA 1YEDB 4YHIB 5GGVH 4EIZC 4GKLA 3MNZA 4JFHD 5LB1A 3L9YA 4AENB 1U3YA 4AJYV 3ECVA 4UAOB 4EOWH 1OP4A 1A8JH 1Q9OA 3S48A 5FYJD 5FKPB 1DQLH 1FZOB 1F42A 4XO9A 1F5WA 4O9HH 5KG9B 3D25B 2OMVB 1V54B 4G8GB 2HA1A 2YARA 4QY8B 3G04A 4HC1A 3K6SA 4NZRH 5BVPH 5BS0D 1CFVL 1SQMA 4X7DC 3VO0A 4AGNA 5LG6A 4YDMA 1JZFA 3GHBL 3QEHB 4N6RA 2VLJE 4M1DH 2D7OA 3CFCL 3AM8C 2VUOA 5IVNA 5DHXB 2HMIC 2H5UA 3PDOB 2PW1A 4JFPA 1F1DA 2IPUG 5DI8A 3MLUH 3MGOB 4GG6A 2DZEA 2AQRA 4D0CB 2WQAA 3GMPA 4L3EB 4HF5H 3O6MH 3MHZA 5JOPE 4EUPH 1FZKA 5ESVB 5KBPA 3ARYA 4H7VA 5FGBC 2ZYSA 1RIVL 2L8AA 4J3XA 1S5HB 4NYLB 1J0KA 1WUZA 1WAEA 4H8PA 3MVSA 1AQDB 2WXJA 3BUIA 2G75A 4GG6F 2IVFC 1YPZA 3IJHA 2AZUA 3DJTA 2XCMC 1L6PA 3PNRB 5DZJA 4M7LT 3Q5YA 2OP4H 3FCSA 4P59L 1MFNA 2DF3A 1R0AH 4OZGB 2GIMA 5GRJH 4MA3A 1MHEB 4PP2B 1MUJA 1QSZA 4Y2DA 4LLYA 5EZPA 2P4AB 3T1FB 2P1YA 1T20A 1KTLA 4LSRH 3SO3B 4DEPB 1G9ML 4RRPA 1QLFB 1KPRB 4M6OH 3O4OC 1ZTXL 5CINL 2FYYB 4XH2A 3WENA 3RDTC 3DOHA 1EXUA 3NIGE 2YUVA 5HY9B 3JTSA 2IEPA 2CLRA 5I2IB 4H8HA 4DP9X 1H8LA 5L88H 4PJHB 4U1GB 5KBNC 3EO9L 1YC7A 1BZ7B 1CXEA 1XD0A 4LSPH 1CYXA 2G5UA 4PPTA 3U4KA 4CN4A 1EV2E 1S78C 4EZJA 3DIFB 3P2BA 3PV6A 3TWCH 4AEFA 5BZWA 1ODAA 5KVGE 4WWID 4KO6A 1JK8B 4TMPA 1HHJB 5EIIA 3L4ZA 2NY2B 1RUKL 1NKRA 2BVPA 4F9LC 3FF7A 1BREA 3Q48A 3T0VA 4QO1A 1NTDA 5E94B 4YHLL 3C5ZA 5IFHL 5D9SA 3GS4A 3HEIB 4L9DA 1NAKL 2NXZB 2JB5H 1PNCA 4I1NB 2DL2A 5EHFA 4GMSL 1QRNB 4N6RB 1SM3H 1YEGL 4DERA 1L9SA 1FDLL 3C9NB 1N0XL 4XNMA 1JHLH 1VFMA 3LIUA 4O2FB 1GYAA 4PJFE 2SEBB 3CVIL 4JFQA 4PRPB 1YDPA 2MOQA 5I6OA 3QZOA 5AW0B 4OI9A 5L88L 3KLKA 3BH8B 2EUVA 1S9XB 3LV3A 1PZCA 4FS0A 2Y3AA 4IBLT 1VESA 2H0FA 1HXYB 4I8DA 4AQ1A 2VZOA 1IO4C 1RP8A 1XAUA 4OI7A 3DX9B 1J10A 1DCLA 1VF5C 3DX7B 4UMSA 3I85A 2UYLA 5CWSA 5DEGA 1DFBH 1I7ZA 2IWGA 4AYID 1J87A 4M61A 4DTGH 4R4FL 4ZMLA 3EUUA 5AOKA 1QMUA 5MENE 3RU8H 1AFVH 3DX8B 3B6SB 3EH5B 2APBA 3TBVA 3ZPDA 3CFBB 1ZVSA 3ZY7A 3KJ4B 3V0AC 3D39B 3BPOB 3Q2LA 1I8KA 4RMVA 2CRYA 3TF4A 5A2IH 2EEFA 2EIJB 3QZWA 3L1OH 3R4DA 1Q0XL 2R27A 2FBJL 3KPNB 4XCYA 3VA2C 2N56A 4F8LA 3KGSA 2J1KA 5E00A 3T4YA 4F37F 4M1GH 3RVVD 3IMWA 1UWYA 3HTLX 1TYJA 3CVHL 1T5WA 3QUGA 3BDXA 2ITFA 2HLFC 1TZGL 3S5LB 1P9MC 2QADB 1UD8A 5FV1L 1HXMB 3HKZA 4P8QA 1NCOA 4HJJH 2Z92A 4D0CA 3BQUB 2VLLA 5DUPL 3D3VD 2YMTA 5DJ0B 4JCLA 5JW5A 3ALXA 3MRPA 1CB4A 3QDJD 4TSAL 2LV4A 1A1OA 5C08E 2FJSA 4XODA 3RIAF 4Z3JA 4FYTA 5SWSE 4HAKA 1A4JA 2J5WA 5C9JB 4WI9A 4UV7H 4WI0A 4JFVA 5D1ZI 4XCNB 3SDAD 3MN8A 1XF5A 1G4MA 1U8IB 1PW3A 1U8CA 2YBRB 3APMA 3FT0A 3LZOA 3VXQA 5JPNA 5DFWH 2FWOB 2XWBA 1EFXD 4PN6A 4RIRB 2XTJE 4UT9H 1N2RA 1OSPH 4GXFA 1T03L 1LO5B 3O6FD 4R96B 2DQTH 5C0AA 1AZRA 1KJ3H 4HQQL 1NBVL 4L4TA 3WE1A 3DXAA 3SSGA 2DWTA 2WGXA 2Y4SA 2DQUH 4NQXB 3JYCA 5CJQL 3BH9B 2LHAA 1MW3A 4GUOA 4KTEH 2WBWB 1HL8A 4NRZA 1ZRUA 3WHE0 1NGYA 2WMPB 2ATAA 2DDQH 1ACZA 3MRBB 4JO5A 3NEEA 2BVOA 4CNIA 4CUCA 5IIEA 4ZTEA 5FS5A 3WKPA 1KXTA 3O0LA 1T5KA 3ISYA 5DRZA 3SO3C 5J11C 1KB5L 5AVYB 4S0HA 2EYSB 3S4SA 1KMGA 1HH6A 4OFIA 2AV7A 1V55B 2AJUH 1HWHB 1AI1H 2OP4L 3D3VA 5H37H 4KY1L 2BS71 1UZ6F 3KAAA 1JPGB 2X41A 2PYEB 3EGDB 4QOKE 4Y4FD 1DBMH 1SLXA 3QIWA 1MZYA 1PD0A 1U3HA 5CHNB 5JHBA 2PXYA 3APNA 2F7QA 5HHMB 4C83B 5DJXA 4XX1G 3WEMA 1OAYH 4FQLL 1DP0A 1E7UA 4W9DC 4Z3HA 4U1MA 2PO6A 2OW7A 4PJBB 2XUWA 2DIAA 1R5IA 1NEPA 1IIKA 2R39A 1T66D 2OMUA 4U6TA 4Y2NA 2BZDA 4ERSH 2WOYA 1EHLH 4K2UH 4LP8A 2AJXH 4IRJD 1T1YA 5E1QA 4D9RD 4DOHE 3PP3H 1EZLA 4MXWH 5EO9A 2WXNA 4X4YA 1DYZA 3SDCD 2VC2H 3B3IA 3O6FA 4KXAA 5I9QB 1O9VA 1KPRA 2EE6A 2X1QA 4YFLI 3MNWA 1GRWA 5HPMB 1EMTL 2Z64C 5T5NG 5KS9F 4IW4C 4DAGH 4ZUVB 3TBSA 3DX0A 3CH8A 3L3OA 1IE4A 1XCQA 3W3BA 5ISZD 4IU3B 2C34A 1XGUB 1BXVA 1JTOA 3FONA 4X80L 4Y1AD 4BE6A 5ICZB 1NA8A 5F7AA 1NOLA 1UH2A 2WXMA 1YMMD 4KO9A 4PR5B 2B9AA 2ZOOA 2X12A 2EC9U 3OJDB 3PV7A 1L5GA 1OF0A 3CQPA 3NCYS 3R06B 3QISA 4HIHA 4Z76B 5HVFB 2B1HL 2F5BH 3FPYA 1HAWA 1DE4B 4JZJB 4DK6A 4YVNA 3D2UD 1NWOA 3NZHH 3VB9A 4Z7OB 1A22B 3ULUC 4A2HA 3S3CB 1OP9A 4HALA 4PS8A 5EH1A 1BPLB 1NWPA 3H0TB 5TFSL 3L81A 4BM7A 1ASPA 2CHWA 2O5XL 3ZKXC 3IJSB 1KYFA 3SDXF 5DYOA 5EZJA 3V4VB 1NLBH 4NZDA 1DBML 1N10A 1IC4H 2HVKA 1DQIA 4N8CL 2K8QA 2X9WA 3L4TA 3WY1A 1J1PL 2L7QA 3MBWB 2ZG3A 1ZLSH 1FZOA 1EHKB 5AW3B 5HGAA 3MV8A 2MQGA 1WHOA 5T5FL 4PJAE 3TO4B 5MEOB 5BS0E 1GOFA 1ETJA 1LO5A 1RPKA 4HWZA 4IMLB 4QRRB 5IVXF 4OZIF 4DKFH 1ZE3H 3BI9X 1JYVA 2MPVA 3AADB 4TNGA 1BFVH 1NFAA 3Q5TA 4JFDA 4ZX3A 2ZXEB 2XBTA 4JCWA 3CBKB 3NGBC 2NY3D 3V6OE 1JZEA 1DN2A 1P7KA 1Q9LB 1R3LB 2VDRB 3GSRA 3RX9A 2ICEB 4ZTPH 4DGIH 1A9EB 3HHSA 4P9HL 3QPQC 3VYNA 3Q3GA 4ZAKC 3QB7C 4MA3B 4NC0B 5IBTH 1KFGA 3S8WA 3WBDA 3UTZB 3IFPB 2X53A 4V1DA 3NIGF 5DHVB 5HJDA 4JM4L 3OZ9H 3EZJB 5K93A 3CSBA 5H2BB 1ZT7A 4BQ8A 3PQYD 5DC4B 1HQ4B 5K5YA 4JPIA 4OIIL 4XNUH 5I8KL 3CDFA 5DMGD 7FABL 3IJ9A 3AG1B 4OGYH 2QPUA 4XNZC 2JKRM 4BEIA 4QTIH 3O3UN 1CLVA 4MHHG 4FE9A 2ZF9A 5E2JA 3QWRD 1FLTX 5I76B 4HJJL 1ZHNA 1MIEH 1WLHA 3QFJB 1ZGLM 2GITA 1YY9D 1XBRA 5HGHB 3GGWA 5ECJE 3MRDB 4TUOA 4PJDF 1DVUA 5DJAB 1GS7A 1DQML 2R2HB 2OCJA 1BZ9A 3QBTB 3HBZA 1FYTE 1MCCA 3SE6A 1DBBH 3K0WA 3VNZA 1Z9SB 1YLBB 2HRPH 4KTDL 1E8WA 4H4NA 5TQ0L 3WHXB 5B8CC 4I0PC 4X8JA 25C8H 3RWGB 4N8UA 2GSIA 4PJEA 5ALBL 4QRTA 1JD9A 4X0NA 1WC7B 4NN6B 2DYPB 4QYOA 3STZB 3HC3L 2IQAB 2R8SH 4X6CA 4EZKA 5I1IL 4G43B 3BFOA 2JVUA 4HFWB 3ATFA 4HHWA 4FC3E 4QRPD 3LS4H 1BVNT 1HZHH 3KGTA 5H94B 4LCCB 4J6RL 2GIYA 1RAMA 2R15A 5IB5A 1IFHL 2X4NA 1QFHA 5FGBA 4AJWA 1NCCL 4IOFC 3WFDH 1ZJAA 5EDSA 4O4YH 3I9GH 3LKQA 4NI6A 5E5MA 1QR1B 4LEOB 4HUVA 3WE6B 1DSWA 2AFNA 1IFHH 4F9PA 3T2PA 4ECNA 3MRIB 4NN7B 3QAZB 4NRXB 3LZFL 4X5RA 2X4TA 4X8XA 4M02A 1QSFB 1BM3H 4N2GA 3R8QA 4EN2A 4HIIA 2UUDH 4MXQD 3MZTA 1HSBA 5IZ7A 4NNXA 3M17A 5HSFA 4BQBA 1YN6A 4MLIA 4K9JA 3LEYH 2BNRE 2XQYA 3V2AR 1CD1A 1JVKA 4CVXB 2XYCA 4U7MA 1VEOA 3ATEA 4BFNA 4XPFL 2UY6B 5I17B 5LNDA 4IHOB 1CGYA 1AJ7L 3T8MA 4N20A 1RURL 3S5ZA 2BS8A 2PTTB 1I3GL 2DIEA 3LN9A 4HZAA 3PQYB 3ARDD 5EF1A 5BXFB 1PZ3A 3IMVA 1ECYA 3QEUB 4GG8A 2P7TB 2EXWC 2OMTB 1KXQA 2BY1A 2PCFB 3P4LA 4G9FE 1OTSD 5L4FA 2P47B 3WS6A 4NO5A 1I75A 1NCUA 2EXSA 2G0KA 1T6VN 1UWXK 3IGFA 4U1SA 4YXHH 5IWLC 3ROLB 4JHUA 4F20A 1ML0A 2VDPH 5SX4I 3HJ0A 4D94A 4BFBD 2NY3B 2GHWB 4IBZA 5EG6C 1RZJH 3VXRA 3O3EA 1AO7D 5AVTB 2DKMA 2JKIS 1RK0B 3LVTA 1MZZA 3APDA 4IGBB 4GUCA 2X3BA 1JZ8A 1AGFB 1GVIA 5ITFA 2CK0H 4YHKH 3HZKA 3FBQA 3DPBA 4GAGH 3VD9A 1IL1A 4KWUA 1U8MA 4P9HC 3L3HB 4OZ4B 4G6JL 4M8QA 1YNLL 3DETC 4D8OA 3ETTA 4RISH 3L3JB 4RFEB 1AIZA 1VACA 4KTEL 4Y16B 4MNHA 3T65B 3UJIH 2ENYA 3HMXA 1FF5A 3OAUL 3S5YA 4NKMA 3QEGH 3IKCB 3GBDA 4LVOC 4AI7A 2YD9A 2IAMA 3AREC 1IAOB 2F6AA 4R90H 5KVDE 3JQOB 2OR9L 3TT1H 2YGQA 1CGSH 5HDLA 1W16A 4IU2B 4OFYD 4PRNB 3CX5J 5F88A 3SKNB 3TA3D 1WBXB 4GMTH 2VLMD 2YFOA 4MGXA 2ZYRA 4ZFOL 2AQSA 1QTPA 1FGNL 4HHGA 5EN2B 1BBDL 1G7JA 4O51A 4OCRL 3SQOL 4L0PB 5T5FH 2F74A 1XCWA 3CSGA 2FNBA 3B2PA 2VERN 3TJEH 5F8RC 3U30C 1QPPA 1A7OL 1ZHLB 1PX4A 2FZ3B 3LZQA 1T6BX 2VABB 4K9EL 5FYLE 4Y1AB 4ZMQA 1RUAH 1XGRB 1MLBB 1PMYA 5GZOA 4C4UA 5EBMB 3MRCB 3BFWA 2X2JA 2H8PA 1N67A 3OX8B 1TTUA 1BIIA 1DJSA 3EJSA 4OJCA 3TONA 1BM7A 2IPTH 5AWNH 2OZ4A 3OR7B 3PDDA 2WIIA 3RA7L 4JB9L 3VXSE 4QXGH 1BM3L 3RIFF 2FGWH 1QKZH 2WM0A 5KSVA 2FE0A 3CU1A 5C09D 3CZJA 3QUHA 4DT2A 1LDSA 4Q9RH 1E50A 3NEOA 3N2JA 3NQKA 5EU7E 1CICB 5E4EB 1KYOJ 4GRMA 5L9DH 4OJDH 3U9WA 5K9JL 3PHSA 5EO9B 2X05A 4X4YB 1HHKA 4P2RA 4UT6H 1IKNC 3GSQA 1Q1JL 1E4WH 1DLFL 2XZAH 4JJ5A 1UM4H 2UY6A 5FGRA 4BFRA 4K3JH 3V0JA 5BRPA 3TP4A 1A4BA 1YQVH 4UB0H 4S2SB 4TRPH 4CMHC 3SE3A 3VFUB 3IWVA 4F7MA 3GLDA 4ZXBA 4HUWB 2XN9D 4ELMB 3K6NA 3DIVA 3TU6A 4GRMB 4FEMA 1UXLA 2KS0A 1JNNH 3I75A 4N3UA 5I74C 3NZUA 2FBOJ 2CWRA 5ID0A 1Q38A 1OP3K 4ZI8A 3Q1EA 2IH9A 1AXIB 1AY1L 5FFOA 1BYPA 4EDWL 3WS6C 5MENB 2FEEI 2AEOA 3ZE0B 4I48B 3FN0H 1PQZA 3O4LB 1FG2B 3A6CH 5C0GB 5AZ2H 5TTRA 3CFEA 1K4CA 4UF7C 5J6HB 4S11A 3KCPB 3GXNA 1A2YB 2WVVB 1P9MA 4YDVA 3T0EE 3OGCA 3O11A 5F3BA 3NIFE 5B21A 3ME0B 1C1EL 1N6QL 4DK5A 4F8QA 3FT4A 4XNMB 2CHZA 1EHXA 2Y7LA 3WYRA 3DC0A 3QJZA 4I9WD 2VR3A 5DMIH 1XR8B 3T0BA 5IHHA 2EIDA 1X5IA 2VWEE 4ZXBC 3T08A 1JWMA 3GSUA 4RH4A 1LO2H 4UTAL 5CUSL 3U2SA 5CEXA 3LXBA 1HYSD 2FO4A 3QYCA 4YN3A 5BZZA 3SDAA 3ZYIA 2ARJA 4MJ5A 1EWHA 1HWWA 4ODVH 2R2CA 1F6AB 1PY9A 5KZCD 1MHHB 4LPVA 1K6QL 2AABH 1RZ7L 4BFIB 1FFNB 4AT6A 1MH5B 1YYML 2B7DT 5CSBA 3APFA 2IAMC 1OGAD 4YDLB 2CNZA 3K6IA 2RMNA 3VXRE 3BKCL 3C6SB 1JV5A 4TNVK 4X2UA 1U3HD 4KMLB 4ZTPL 4AUYA 1LWRA 2Y06L 4LHJB 1XO8A 4S2SA 3LIZH 2YXFA 4IJ3B 5HJ3B 1RUML 2WXLA 5CINH 5E8DH 4TULH 4KKZA 4DFIA 1G5GA 1PLBA 4G6KH 4WW1A 1HHKB 5CP3A 2GHZA 3PL6A 3TPUA 3WGVB 3UG5A 1E6OH 1TZHB 2WLYA 4UT9L 5F9OL 2P44B 3AUVA 2QQQA 2WSDA 4C4BA 1QLFA 3QJOA 5A2JH 3MBWA 2G3XA 1T5WB 3VGAB 1CGTA 5KYUA 3HOGA 1R5VB 4P48A 5H2BA 3C87A 1UQSA 4S1RH 5T3ZE 4ODHL 1IILE 1PG7L 5DURB 5IHUL 4EKXA 2ZCKL 5A6IA 1QRNE 3UBXI 1YEKH 3EYUL 2QFRA 4P2OC 5JPMB 1BA9A 2I85A 1LHZA 1AAJA 4LEEA 2FECI 3W39A 3WEXB 1HI6A 2G2RA 4KY2A 4OLZH 5F70A 3MRCA 3MLSH 5H35B 1P7KB 4NHUB 1CF1A 1FNAA 4WFEE 4YFEA 2XY1A 1DEEA 2AJYL 3F64A 4EBQH 4GAFB 2D2CC 5AVRB 5B4MD 3TH3T 4IIQB 4JANA 2L4OA 1RZKC 1BEYH 2NDFA 2WYIA 4OQ1A 5HHME 2R69A 3RKDC 4D9QD 2VOTA 2YD6A 3MOBH 1TKWA 1SUHA 2OR8A 5CAYB 1K4DA 3L2LA 5KW9H 3NACH 3RWJB 4ZYKA 5CFHA 1FPTL 4WJ5B 1MFUA 1P53A 3I3DA 2N1TE 3GMRA 5E9DB 3L13A 4HIJB 1KTBA 2BZ7A 1GZPB 4GW1B 5DFVC 3SE4A 5BVJA 2ITCA 1JN6A 1T0NA 3HZYB 3LOWA 4XI5C 2V9RA 4R8WL 1BMGA 3QUMB 5C0JB 4LNRA 5DZAA 1BZDA 2IMNA 5BRZD 3RFZA 1GS6X 3SBQA 1K72A 2VISA 3GBEA 3DLQR 2Z1PA 1T7YA 4PLKC 2YC1A 3O6FB 3PL6C 4Z7NF 3PNWB 1P6WA 2WLIB 4XMKH 1QRNA 1KIPB 3SGJC 5DUJA 1UB5B 4BUHA 2ZKMX 2A6IA 4HCRA 2BSRB 1KCRL 2K7PA 3JXAA 1AHKA 3N85L 5D2LA 4V1DE 4XOAA 2WP3T 1A6ZB 2V33A 1OK0A 1N3NB 3PWVA 4TUJB 2DWDA 4UQAA 1KENH 4PJFF 2GY7B 3R1GL 3LNFA 5KSBE 4NDMA 5C0CB 2G5BB 4G8FB 1ZHBB 3H7LA 5D5MB 5DFTA 1TPXC 3Q05A 3BP7B 1P7QA 3IPBA 3HFMH 3E9UA 4JY5H 4PR5A 4FXLA 4PJ5B 2WUBH 2GJPA 2R1YA 3WMSA 4HX1B 1XF4B 3GLAA 4WUKL 1WEJH 4K7PY 3JVGC 5I5JA 5IESH 4NAJA 5GZOD 4XVTL 1L0PA 1YMME 3QYNA 4B9KC 4OI8A 5JNYB 1F02I 4TNWK 1CFNA 3GRWH 4QR7A 3EFDH 4NJ9L 1MPAH 1SN5A 1TVBB 2C26A 3V4LA 3W81A 2X0WA 5IEHB 2FJGB 2P7TA 4PG2C 2IH3B 1O6SB 2FECL 1P7QB 1IGCL 1OALA 2IAAC 3MSPA 4HEME 4PREB 3O8XB 1AZCA 3WJMA 1B9KA 4PRAB 1GR7A 2J12B 2YUWA 3BKML 3EJTA 1NZRA 3QPQD 4N8VG 5LUMA 2F7PA 5KYXB 1R5WB 4AYFA 2IADA 2B9BA 4NX0A 1QD0A 4H2CA 5CM1A 1DQVA 4G6KL 3LH9A 5LXVA 4Z7UE 1J0HA 3A67L 4Q89A 4WFHE 1E28A 1MNUL 2TRHA 4JJ5B 3FCSB 4M6NH 1UEYA 2VDPL 4L4TE 4TLUA 1M7DB 5FO9A 2HT3C 4E9YA 4N0CC 2BVQB 3QULB 1E4KA 1ZGLA 2Z7ZA 3H9ZA 2FR4A 1M3IA 4WI8A 3IDJA 2Y5QA 1FBIL 3KPSA 3UEQA 1UD5A 2J2ZB 5I8CA 2YLKA 3BGFB 3OMAB 5IJKC 3PABB 3L1GA 2VDOH 4XWOC 1VPOL 3OM3B 3B9EA 4H5SB 1FGVH 4I5BB 2YZ1A 1EZVY 2DWEA 3DHUA 2K70A 3RU8L 4RMTA 2NSQA 2ZKHH 3ESVF 3QK0A 3GINA 2WZAA 4M7KH 1I8AA 2EINB 2HRLA 3LKRB 5IROD 4J8RA 4UDUB 2WBKA 1B90A 2W1NA 4ZD3L 5EUKA 1J1PH 4GAYB 2KLTA 2YBGA 2BCKB 2LTQC 3NIFF 3HNVH 3S37L 4F8OA 4PW4A 2YEVB 4HIPA 4PYGA 3T6WA 2Z7WA 5I73B 1NAMA 2B0SL 4JY4A 1N3NA 4AGQA 1N0LA 5FW7A 5C86A 5HVWA 1K8IA 2F1AA 3EYQC 3HAEB 3VWKB 4UT7H 4YGAB 1MW0A 2JJSA 2NY4D 4NP4L 4ZFGH 5JQ6L 2BFVL 2YPVL 3CFMA 4LCWA 4LOUC 2GVYA 5DRXA 2YQBA 1UJ3C 5J6GB 2PWDA 2E27H 5K33A 2DMCA 2B8OT 5EUOF 5EU7C 3PJNA 5F0LB 4ZJ9A 4LNRB 2YPVA 4FCAA 3GMNA 4KMQA 5TD4A 1YY8A 4GP8B 1TVHA 4YHZL 1UKSA 3DV6A 4JRXE 5HHOB 4LIQE 3F6JA 3WKQA 2W95A 4FYSA 1VFBA 2GBTA 3SDXA 3CK0L 4PRDA 3N85H 4HIJA 5EEWA 1IGCH 4HDIA 1ZIAA 4FFTA 3BKMH 3ZKMD 5LBSH 3I6LE 4Z8FH 3EGSA 4PJ9A 3EOYG 4DKAA 3OQ3B 4WJG3 2Z92B 4LVHC 4JRYE 3OL2A 5JIIA 4JZJA 1U42A 1X6LA 4RSYA 1CYWA 3ULUH 4U2ZA 4I87A 3FRPB 2XN0A 4X7TB 2DWSA 4L8SB 3BC9A 4L2YA 5IVZB 3FSVA 5C2UB 1MVFA 1FPTH 4RBPH 3T2NL 3LAFA 3ZZ1A 5DYOB 2CM6A 3QFGA 5EZJB 3DOSA 1UM6H 1H3TA 3BVDB 5IK3B 3IJSA 2AQQA 3JV0A 1VCAA 1LVEA 3VD7A 5D2LB 2QGBA 3RYMA 2ZWZA 4V33A 3IEAA 3I6KA 1OTTD 3WIHL 3HN5A 2J8HA 4PLOB 5SV3A 1OGTB 1JZ5A 3ATBA 4LL9A 3UO1H 4CVZB 1EO8H 3K71B 4XMKL 4YAQA 3IPFA 3OLEA 5HHOE 3RL2A 4KUZL 1NEUA 2EO7A 1JHTA 3KWUA 4FLQA 5CXPA 2R8SL 2V5TA 1PKOA 4WK2B 3TS8A 1NMCB 2VR7A 2QVFB 1VADA 1ID2A 4PWKA 3FUMA 5E51A 5ENWA 4ZUVA 2UXVA 3IFLH 3NAAH 1OM9A 3BQVA 3D0VB 4IHBA 4WW2F 4UM8A 1D9KC 3TT3H 1FP5A 1A7PH 1B2WL 1CICD 3DBSA 4FZ8H 1TJMA 4JRYB 4UV4H 4H8WC 5GS0C 3TN0A 4MD0A 4XMTA 3KDPB 4WSKA 3CBRA 5D7LB 2AJSH 1T2QH 1KGUA 4X4ME 1PAZA 5LAXA 1CT8A 2QHLA 4L8CB 1CXFA 1VZGA 5KVEL 4PRHD 1HINH 1NIEA 3ZGHA 4QNPF 3FHAA 3K5RA 4NI3A 1TDQA 3IXAB 3QDGB 1R9FA 4PB0L 1HCZA 3U0TB 4X6CF 4XMPL 3RG1C 4Y2OB 3SDDC 1L4IA 1J5CA 1R33A 2CRZA 4AL8H 4F8PA 1FZKB 3AQDA 4LBAA 2F8OA 1IKFL 2A83A 4F7CA 4B95C 2O5ZL 3QUZC 5DZNA 5I15L 3DYMA 2J6EH 4WHDA 3EGDA 2WD0A 1K8DB 2BOLA 5AB2A 5A2AA 2DQFA 4JFEE 3QEHA 2DQIL 4PJGF 3ET9F 4PRDB 1TCRA 2J5LB 3ZZQA 4RQQB 5IEKB 5LDUA 5FO9B 5AOLA 5FKAB 5CEYA 1ONQA 4OB5H 1YNLH 2V2WB 3VU2A 3CLEH 1A4JB 4HH8A 3FU5A 2CA3A 1QFOA 3NCYP 3NIDE 3WKML 1F6AA 2R1WA 1NIBA 1I31A 3DARA 4KI5F 1YECH 4KH9A 3Q8AA 4JHAL 1YYLH 1TF4A 4GH7B 3HZ3A 4JM2D 4OKVA 2B1AL 4EQ3A 4J23A 4B7IA 3BRFA 4ODTL 3LXUX 1AZNA 1J05A 4WEMB 5DJCA 1SY6A 5SWQA 3CTTA 3FRPA 4X9BA 2FX7L 3GXIA 4CC1A 2E7LA 3WNLA 3FTWA 4I89A 4PH8A 2LFEA 4Y4FC 3ZQXA 4U2YA 4WFGD 1ECZA 3BD5A 2AV1A 1M4KA 4DF9A 3KZ8A 3CPUA 5EUKB 1DJWA 4JFEA 2APVA 4NQSA 3S3JA 1ETB1 4XBEL 1O7SA 2AEPH 3P3SA 4JFHE 1M3JA 3NJGA 3MUZ1 2I27N 4Y9FA 3BFQG 2AEPL 3ETSA 4ZX4A 5BQ7A 3ZMRA 1G7PB 1JCKA 1KBPA 2XI9A 2AKRB 3SHSA 2YO3A 3UYOD 2P8PA 1LJMA 3OPUA 4KKNA 4QTHB 2O4EA 2QVTA 2L7JA 4I18A 1YPZF 5IMLB 2BP8A 2V7HA 3L6FA 1JD7A 5D71L 1FNLA 4JFFE 5CZKA 2VLJD 3L4CA 4WEUD 4FX5A 2WANA 5IHWA 2X44D 1AHWA 5JHAA 2BJML 4AJVA 4EDXB 5E2UH 1X5LA 4UTCA 4AX3A 4RDQG 3QQ9D 2H32B 3PFUA 4E2OA 1BEXA 5FUZH 4XRCB 1G1KA 3LRSB 1Z9LA 3NJNA 4U4BA 4WEEA 2OXHB 3QRFM 5E9DA 2DQFB 5DEGB 4ZW8A 4WJ5A 3C08H 1I7TA 4HHAB 5EB9A 3V6FB 1CFNB 4Y4HB 2XTSA 3BKJL 3PWNA 1C12B 2WVTA 2QLVB 2AITA 4PJ6A 4AW7A 2IBBA 1M05A 3KYNA 3RVVC 3MLZH 4HA1A 5AL8A 3U7YH 1QSEB 1AHMA 5ITFB 4Y16C 5KOVC 1BVOA 2QMJA 1ZLVK 3BIAX 4YIQB 3EZ8A 1EAOA 1O75A 1XZ0B 2P48B 3DX4A 1ZGLB 1LK2A 5BRZB 2XVLA 4AUJA 1RHHB 2Z6FA 1F4YH 4NFDA 2V5SA 4IU3A 3SGDI 3RZCA 4N86A 3TO4D 4AQ8C 1QBLL 2J88L 5GRUL 2DMHA 1G0DA 4JG9A 5E2TL 4XB8A 1QABA 3T3PF 1OZTG 5KYUB 5KAQF 4XNXL 4GAJL 3T77A 5C3TA 2EP6A 2OMTA 4R26H 1BXAA 4DQAA 1I82A 4ZW7A 5BZDA 1EEZB 2X1PA 2D7NA 3CLEL 4AK1A 3RTQC 1QW9A 3L3DB 3K72A 2WQWA 3IJYA 1NKGA 3V0IA 1I9IH 5GZOC 2A6JA 1INDL 3DVFA 2YOAA 4UZUA 3HCVB 3DIDA 3QQ9C 4G9DA 3RWHA 1GGUA 2A9NL 4YNYB 4PV8A 1AGDA 3UTQB 2BY2A 1TEYA 1TTCA 4FXKA 4HX1A 1H5BA 3UYRL 1RSFA 4ZYKB 2IH8A 2H47C 4GI8A 1F11B 4WTZA 3HN3A 3RWJA 3BVNA 3S2CA 3N41B 3FQRA 1NC4B 4LFHG 3K72B 4R4ND 1A0QH 3E0GA 3OZ9L 1I8LA 5FYJL 3SDXE 5I1GH 3MODH 3B34A 3QNXA 2KQNA 5BRQA 4G80B 4LLDA 4RDQF 2JB6B 2E4FA 5D1XA 3VGAC 3VXSB 4AGPA 5LBVA 1C5BH 1I1YA 3N40F 4G5ZL 4U3SB 5DUPH 2X4QB 2DLFL 4LO9A 1ETZA 3MYJB 5FO2A 3V5HB 1IGTB 1RPUA 5FHBL 2AV7B 1Z9NA 2P28B 4JFEB 2N0KA 3QAZC 2F5BL 4JN1L 2FUTA 4IJ3C 2VW4A 4L8DA 3G6DL 3Q2NA 5FYJE 5AENA 1P4IL 2F61A 5DJ8A 1EEYA 3ARVA 3DIFA 2XXFA 2J8UB 1B4RA 1DQDH 5K9QG 3WELA 2IH1A 1HESA 3K4ZA 1WWAX 3I02B 3WHXA 2P5WE 2UZYB 1XGPB 2JKTM 2WXRA 3ECUA 5ID0B 4HDIB 4Z7UF 1KLUB 1JS4A 4QRPB 3HI5H 4LLUB 5HHMD 4FYQA 1E4HA 1G9NC 4RMRA 5IQ9B 4R7NB 1EANA 3KPSE 5A16B 4MJIA 2GITB 3NPZB 4HCRH 4I0PB 4LPYA 4XN9A 5DUBB 2HT2C 4B97A 4JDTH 1R3IH 5AKRA 4QXWA 4B27A 3MRHA 2J3SA 4K5PA 4E42B 4MCZB 1EVUA 1SVZA 2WWOA 3EYFB 1A6AB 1GY1A 4PCSA 4WI3A 4G7RB 1O9WA 2LW3A 3JUZA 1GGYA 3P0VH 4YLQT 1EXHA 4N0FB 4UTBL 5MEND 2BXYA 2ZCHL 3IVKA 5FO8A 3F65A 3V5DA 4LIQL 2Q7AA 3T0DA 4YR6B 1N5AB 4JHWH 5C07B 1J8HE 1JGEB 2R7EA 2XRAH 5I1EL 3IFPA 3VJ6B 4L3CB 2PXYC 4M6OL 1KGCE 5JHDB 4ZOAA 1IC0A 3V5HA 4G43A 5I74B 1RH8A 3IDUA 4JLRA 4GRWB 4W9CC 1HQRB 3SQBA 2CGZA 2EO9A 3GJFH 3NK4A 1NDMA 1ADQL 2ZOTA 2XZCH 3A22A 5JW4N 3SCMD 4XNQA 3OJMB 1QG3A 3C6SA 1QATA 4XPTL 2Q8BL 3FO2B 2OLDA 3VFSB 4CMHB 1NIFA 5I1LA 3J2PA 2B14A 3L7FB 3PREA 3KXFA 1IBGH 5CKGA 4DEUA 3I74A 2BNQE 3NMEA 2W9EH 5AB9A 1AQHA 5DRNB 1BBJA 1QFPA 2V17L 2ITDB 3ZTJH 3D0VA 1PX3A 2CO6B 4ZXBD 4YK4C 1D5XB 3HVNA 4XAWH 5ICZA 2HKHH 2E7MA 5E1HB 2AS5M 4TUOB 1CICC 4PY8J 2R29A 2A83B 2P49B 2QADD 3MUJA 2PTVA 3P4MB 4BZ2L 3RVXC 3FQNA 3AVEA 2RFXA 5JQIB 1H5BC 2A6JB 4A2MA 1JPFA 3K71A 4Y2DD 1CU4L 1OGTA 2JB5L 1IGIH 1WHPA 4RMUA 1S9VB 3CHOA 2E6PA 2VDRH 2H6UA 2FL5B 3G5VB 1QFWI 1NIAA 3HE6A 5IJBC 2VDOB 2DH3A 3VG0L 1MDAA 5CJ8A 5KS9A 2EE2A 4GRLB 4F57H 1OT2A 2W60A 4FFVC 4IBWA 4QIRA 5JXED 5E2TH 1AGBA 4XC1L 2LFGA 3BPNB 4GS7B 2OA9A 2AEIT 3B37A 3HUJE 4NUPA 3CLFH 4AYDC 5HVHC 5KANI 3TEYA 1MELA 4M62L 5E9AA 1S7XB 2OYLA 5E4IA 1I9RL 3V6ZB 4MD0B 4BK5C 3OHXA 1T7ZA 4S1RL 4P3WA 2JCCE 4JM2C 5D2LF 2LAGB 2QR0A 2QQKL 3U0PB 2AJVL 4YIQA 3ESOA 1MLBA 5I1JH 1OAXH 4X6DB 5T33L 1ILSA 1BQKA 4HSAC 2PR4L 1T1ZB 4OM1H 3VFGL 2XTJB 3AREB 4M6NL 1F4XL 4RGNC 4WIQA 4TNWF 1KWGA 1GXEA 1WAPA 1A1NB 1OIOA 4PJHA 1A3LH 3JWDH 2CKBA 2FT7A 4WRLA 4FTVA 1Q9WA 5D4IA 3OPZL 3S4SB 3DK0A 1CFTB 5FF6A 2QV4A 3PQYA 4HBCH 5DC2A 3FH8A 3HG5A 1A8ZA 1VB9A 3JV6A 4B9ZA 5JIDA 3MLXL 3HB3D 4FNTA 4IBQA 4JRXB 3O3BB 1VEPA 4AIZA 1KF9B 4N2MA 3VG0H 2AJZB 2VXQA 1FO0L 2W94A 2GCYA 3R19A 4B96A 2KERA 3DRQB 3MRNA 3H53A 2OMUB 4FQIH 1MFBL 2GKIA 2VXUH 2V8LA 4PBWD 4PJBA 5FOBA 4Z18A 2R69H 1G6VK 3DUUB 1LMIA 1JDDA 2PYFA 3ZE1F 5KWYC 1BIIB 3ZX1A 2PYEE 2FEDD 2YZ8A 2DYRB 3CSYB 1J1XL 5D1ZB 4LAJH 4HLEA 4JHWL 5EUOB 2Q3XA 3VACA 2NUPA 3MV9B 1GJIA 2HN7A 3AZUA 2YXMA 5H4YA 2CJUH 2Q2LA 2ZKYA 2KZKA 4PJDB 5CIPB 5T1MA 1QR1A 4BK8A 1SBBA 4TV3A 3ARPA 4DGVH 4N0YL 4G1MB 3B2UD 3SCMB 3QUMH 1NEZG 3OTTA 2X42A 1D9KD 1ZT1A 4YLBA 2CDFB 1MXDA 4WVRA 3SPVA 3K6FA 1JK9B 2NT1A 5T5FA 5MHSE 4GI6A 4OFDA 4PJIE 3AQZA 3BSGA 4G8IB 1AQKL 3CFNA 3D25A 4P5KB 5DJZB 5HI5C 4N28A 2FR4B 5ABZA 5IOKA 2AGJH 3EHBD 3FOLB 5AKSA 2CIKB 3GM0A 4NZ8A 4QHPA 4QYOB 4FA7B 2N7SA 2HRPL 5AVVB 1G9NL 4AGMA 3OAWA 1S7TA 3A6BH 5HDRA 4AC4A 2VLRE 5LGYA 5CD3A 1GGIH 3L9EA 1HILA 3GMOB 4OF6A 4I9XA 3O41A 2B77A 2X6BA 1XF2B 1Q1JH 1FFPA 5EIVA 1TCMA 2X2HA 1RPQA 4LT7A 5E8EB 2NY1B 2GJ6A 2A73B 2FEJA 5HHOD 4QRUA 2VC2B 1RK0A 2W9DH 4MD5A 2GEEA 4H8WL 3ASOB 4LLMA 2B1OA 4PJ9D 4PD4K 5D6CB 3MV9D 5IVXB 1NOAA 4OZIB 5ILTL 4PHZA 4LCCC 1PS3A 1WWWX 4I5BA 2BOCB 4L1HA 3RBSA 5HTSA 3VUAA 2K9UA 4B9IA 2R1XA 3I50H 4H0LC 1A6WL 1TFHA 3TZVD 3RTQD 4FQHB 1L7TH 4WHTA 3ABMB 2O1AA 4LSQL 4K5OA 1NUGA 3QJUB 2GEQA 3MBED 4JPVL 4OCWL 3PUCA 1GA2A 1NAMB 4JY4B 7TAAA 3GXMA 2BP3A 3QUZA 2XDHA 1NCGA 4WTWA 1M1XA 4POZD 2EYRA 3VDCA 3C09B 3FT2A 4OZFG 1ZHKB 1LM8V 4P5TD 5A1AA 5KVEH 2NZ9D 4ELDA 5CJXC 2NX5B 1VKXA 1Y6KR 3DVIA 5FR3A 5JTWA 2GTZA 3U82B 3KS0J 2X4QA 2V2XA 3EFFA 5I8OH 1R5WA 2DQUL 1UKQA 5CJQH 3RBGA 4AYFB 2WLIA 4W6YB 3IDXH 3ZMNA 1M56B 1C08A 1T0MA 1WE5A 2C3VA 3IJ8A 2NY6D 2IDSA 1J0IA 4K0OA 3O2DH 3EBIA 3WFBH 2W81C 2WKLA 1IKFH 2NXYC 3BPOC 5JUEL 1HH9A 2XKSA 3L7FA 4XCCL 4NRXA 4J1UA 5KSBB 1BLNB 3HG0A 2A6DA 5IQNA 3SGDH 4J7RA 4JE0A 1IM3B 4QRSA 5D5ME 2VJ8A 3KXFD 3GBNL 1KJ2A 4WV1C 4HS8H 5E6UB 1BQSA 1P84K 1HXKA 3BH8A 1W15A 1Z7JA 1QEWB 5F7NC 5GXBB 3H4HA 4JJHA 1S78D 1AQ8A 4G7VH 4RA0C 1B4JH 2BNUA 3IXAA 1WGVA 1MJUL 4JFUA 2YEZB 2FATH 4L1LA 2XZZA 1DL7L 3HBQA 3NJHA 3KPOB 1CF8L 4L3ED 5JMOC 2ILLA 3BZ4A 2PCXA 3CN4A 4Y2DB 2EDEA 5DJ2A 2Z3FA 5E6SB 4P4KD 3MRHB 3UTZA 4X7EC 1FN4B 4TXVB 1I7UA 2RQ8A 4OUUB 3N1PC 3OG6B 5F7BA 3MRMB 5TDPB 4D3CH 1I4FA 4I9WE 3U25A 2DICA 2IDCA 5A16A 2JELH 1V3MA 2XPZA 1XB6A 3ABKB 4LLAA 3WEAA 2W0FA 1VGKB 1VADB 1G7LA 6PCYA 2JLPA 3AGVA 1FSKB 1ZHNB 1MF2H 3A24A 3RNKB 1MRDL 2XN1A 2WSPA 3CHRA 5I76A 3SE9H 3N1QC 2DI7A 4YGVA 4U3XA 5EEZA 5MI0C 5ETUA 4NB7A 3EJPA 1JV5B 4N5EC 5DJ8B 4ODSL 1K2DA 1WFOA 2APTA 2Z35B 4AGLA 2UZXA 3PP4L 4R5TA 5GISH 3Q7JA 4KI5D 1YJDC 1U3HC 4TSCH 4L9LC 1B6DA 3WN6A 2BVYA 4WHYH 2XQBH 1U4EA 4C47A 4KKLC 3H7BB 1NJ9A 3VFWB 4A2GA 5F3HA 3HPJA 1E3FA 2WN2A 4HYTB 3QJHA 4DETA 3MBEC 4GKSA 2YAPA 5K1JA 2ZX6A 5A6LA 2XX0A 3RDTB 1S7SA 1ITCA 3O4OB 4XN7A 4YHPA 2FGWL 3NSXA 4JG1H 3N41F 3VWKA 3VM7A 4A1RA 3HE7A 5D1XC 2VZTA 3FSZA 1RZKL 4G6AD 4H0GA 1I9JH 5D7JA 2FGZA 4YEEA 5CEZE 1JIBA 3BN9D 3K8LA 1DEEB 4L3EA 2BZCA 5AD0A 2KH2B 2UXFA 1OB0A 4FFYH 4EMZA 1CZ8H 2KMWA 2Z93A 4JRYD 3JWNE 1E4WL 1ZSHA 3A0OA 1J9QA 4W4OC 5AZEL 5I9QC 3EHBC 2AQTA 5CILL 4M9PA 1E9OB 1ZV9A 3GMLA 1X9QA 3GZOA 3ROLA 3FU7B 3NFNB 3OKEA 1W0WA 5ALBH 3WI9A 3TBSB 5FC9A 2DEWX 5FGCE 3HAEH 2ZD0A 4K94L 5K69A 4L1SA 1IGMH 5FA4A 5GGTL 2ZWYA 3D0LB 2HJKB 5FYLD 2LE9A 3GKZA 4AG4H 4AM0A 2X4UA 3VRLE 1YEFH 4HJTA 3ARFC 3GRGA 1C08B 3FRUB 4UOZA 1CLOH 2OMWA 5BZDB 4K94H 3QI9C 1BGXL 5A2KH 4YHMH 4N9OB 3ULUD 3GO1H 4MDIA 4UM9B 1CGWA 4EUPB 2NQ3A 4LAQH 5EZOH 1LGVA 1SXBA 5C0FA 4MCYB 5B39B 1A66A 1W9XA 1WIUA 1R5IB 3EDDA 3GTNA 2L3BA 4MZ3A 1OGAB 3QUKA 3WTVA 3QHZH 2AEQH 3LKRA 5C6TL 4NQDB 4AY0A 4MMZA 3RUGB 1PG7X 5FM4A 3RP1A 1NQBA 1BECA 3LRKA 1KLGB 3HB3C 3FFCD 4YBQC 4KNUA 4XHJC 3NJMA 3DROB 4RGOH 3LEVL 2P26A 2BNRD 1JBJA 4WTZG 1F41A 2ZAHA 2EDJA 3IGAA 4NUGH 2NSXA 1MRFL 3OAZH 4TQPA 2E9IA 3QYMA 4W6XB 2EABA 5FGCB 2ZXQA 2BNUB 2H26B 1Q0YL 5T1KA 3VE0B 1J9CT 2CMRL 5MI0B 1BFVL 3CZNA 1K85A 1JZ6A 3LHPH 3IDNA 5TGBA 3QJVB 2I60H 4NC2B 3MJ9L 1LWHA 4WKZA 2MKWA 2VIRB 4GJTB 2JJTC 1CIUA 4IBYA 4GIPD 1X5KA 2FJHB 4ZPVB 3BT0A 4XXDB 2ZOUA 4KJWC 4NT6A 2NR6C 4P5SA 1FIEA 2YPLD 3OF6D 3WLBA 5CN3A 2XVKA 4QRPE 4G8IA 5BQ7B 1YNKH 1O7DC 4FQJL 3P9MB 1T0NB 4GSDH 3FO2A 3OLIA 4JPWH 4NCDA 4HIEB 3VMOA 4JG1L 3ZQ9A 4DKTA 1WT5C 1L6ZA 1QVOB 2H1PL 3ISWA 4HT1L 4Y5VA 2MTAA 3OXRA 4WUUE 3BIKA 3STBA 4PRPA 5BS0A 3WNOA 4Y2DC 4DUVA 1CD8A 2NY0D 4EKJA 1I7RB 2O61A 1A6TB 3WXVH 3CZGA 4YUEH 3APCA 3MV8E 5ESAB 4HCRL 2VABA 3F7LA 4S1SH 2D9QB 2XXCB 5AZEH 1SDYA 2H2SC 3WNIA 5I0WA 5D55A 2Y7SA 1JL8A 4LE8A 3T4YB 3QNFA 2P5EA 2X9YA 3A4DA 3U46B 3F3HA 3NSDA 5TDNA 5IMOB 5JMRA 3VTAA 2PYFB 1JNHB 1TO4A 2I60L 3DOSB 4AVKA 5JIHA 5F3HB 3F62A 4GB9A 4TLTA 3CXHK 1Y07A 3HI5L 2VLJB 1DVTA 3CVCA 3QPKA 1TQUA 3WU1A 3GIVB 4WK4B 2NY5L 1JDAA 4HVBA 4U1HA 2NXYB 1LILA 2WTPA 4OJYA 3MNMA 1ROWA 3OAYH 3ZO9A 3GJEB 1QFWM 3IXTA 3UFIA 3LQMA 5ETUB 5MERB 1I7ZB 1MRFH 4J3OH 5ITBL 5HHXH 43CAB 5C0FB 1A1NA 1ND0A 5GGSA 3O0RL 3T71A 3B9DA 3TEWA 4HJEA 2W07B 3X13A 4RAVB 3VI3E 4J6RH 2XJKA 3FQ4A 4CC0A 3BIBX 3Q6FB 2VITB 4BFGA 1J5IA 3SDXB 4NEHB 2NXZC 1KYAA 3KEDA 4XBGA 3T0EB 5IREA 4XPGH 3ETBJ 4F33A 2NY5C 1AZUA 1MH5A 1KGWA 3BVXA 1SEQH 4H1LA 2OTUA 5JLZA 2HPOA 1WA1X 4O2FA 4OAWA 4L37B 1T5XB 5KSUA 2DJ4A 3KNBB 4PGBA 3U9PL 2MWCA 1UXMA 4WO4D 4E41D 4F2EA 2E9BA 3MREB 3MLRH 5E5MB 5EIIG 2K3HA 5DDHB 4AQAB 5KYYA 5JW3H 2Q86B 5LWYH 3UPAA 1UQSB 5JDJA 5IB3A 5EO1B 3GXTA 1E6OL 1IEBA 3IFOA 1IL1B 4P4RB 5I66B 4N0UA 5LN4A 2BINA 3M6DA 5C0EB 2ZXCA 3U4AA 1AYOA 2VERA 1YC8A 1WZLA 1ZOXA 1QFWH 2NNAA 3NCJH 5IJVB 2NY1C 4HFWA 4XMLL 5D1ZA 1BG1A 4FQCH 2DQDL 3NZ8B 1ET8A 4N90D 3BKCH 3KCPA 4GFXA 3LEXB 5CKAA 4M6MH 4HMEA 4UZGA 2FB4L 4PJ9C 4P46C 4G5AA 4FFYL 4OV5A 5EU6A 4ZS7H 3HC4L 1JHKH 2F58H 5KVFH 5L4MA 5J89A 1XCTA 4X4ZA 2WSKA 1NIDA 1KT2B 4NN5C 4YAQB 3VI3B 2NZ1A 3H9SE 1X7QA 1WD9A 4Q9QH 4W6WB 4TVUA 2Y9RT 1UM5H 1B88A 1RZPA 4XVSH 2QZ5A 4HKJB 5FWQA 3NZSA 3RUGE 2VH5L 2WTRA 3MRIA 1SEQL 4JN2A 1KBBA 1N64L 3IMUA 2R2HA 2OZ4H 3KCWA 2MOGA 3NK3A 1MW1A 2FO4B 3WUWB 1VIWA 4DEWA 4X6DF 1HCFX 1W0YT 4LASH 3LQAH 4BHUA 5I19L 2D7PA 2G0LA 4E0RB 3L4UA 1CQYA 4JGJA 1A25A 2Z31D 1FVDB 4HF5L 4NQVB 4ZO9A 2FX9H 3HLAB 1AYRA 3TNNA 3WG7B 3JWDC 4CVXA 3CX2A 5EBWB 4EAEA 1D5BB 2DPKA 4B0MM 1R34A 3ALPA 1QNZH 5C07A 3AAZA 3FTYA 1GTFA 4GQ9H 3ECQA 4LOFA 4U0RB 3EGXA 3Q8EA 1JGDA 4P46D 2QR0B 1QPKA 4GKNB 4BCZA 2ENPA 3DUHA 1TEFA 1GL4B 2X2YA 4WQOA 3QSKB 4UOW0 4J3WA 2E7CA 3O3AB 4XNYH 2I9LB 3ENEA 4JFZL 3MJWA 4MB4A 3WXWL 1S9YB 4TLSA 4CJ0A 4NOBA 3QRGH 3QIWB 3IE4A 4RMBA 2XKNA 1WF5A 2ED8A 3FU8A 3L5HA 4Y9GA 3BYTA 1XF4A 1GYWA 3SD2A 3N43B 3VWJD 1T21A 1Z9SA 3X11B 3GMQB 3GI9L 1QSED 4WHCA 1LE9A 4LKXB 3KPMB 1ZHBA 5D5MA 2RR3A 4LPWA 4I88A 4XVSL 1MRCL 5DK2A 5FOJA 2DMBA 4NDMB 4PRIE 1X5XA 3QCVL 3MFGB 4BH7A 3VH8B 1RIUL 5B3JF 3MRBA 4XCEB 1R24B 4UUJB 4PWFA 4Y8AA 5J6SA 3OQRA 1TZAA 2GY5A 4F7TA 4O51B 3FPXA 2UWEF 3TWCL 4NQXA 3BZFB 1GZQB 1OQOA 4PTTB 3UCRA 5C3IA 1O7VA 4XVJL 2YD4A 2BIIA 2WBJC 3RJDA 4KJQC 4BSWA 4MMZC 1AS7A 2WBJB 1MCFA 2ZYIA 3PGDB 2GJ6E 2HT4D 1MI5A 1NC2A 1T3FA 4OJFH 1MJUH 3IFNL 4L8BA 1HEZA 4G6MH 1ZWIA 4PRHB 4E5XA 4KKPA 3L95A 3N9GH 3QS3A 2V3EA 1CF8H 1VRSA 2NNFA 3TGXA 4CL7A 1HE8A 2HWZH 3LZNA 1OWWA 3KHOA 4TTGA 4LDLB 4N2HA 3P2TA 3RZWA 1WZAA 3I9AA 5IMMA 1MWAB 1O6TA 2FT8A 2P5WD 3ARZA 3HZVA 4YE4L 5D7LD 1E9OA 2OTPA 3GMLB 4AL8L 4XPHH 1EZSA 4WK0B 4AEIL 5EZLA 2B1AH 2VRKA 5F7FA 1JXKA 5GHWH 4OIBA 2BHZA 4K71C 3NJVA 4OF3A 1AGCA 2BO0A 4GSXA 1QUNA 2F53B 3H9HB 4H25A 2B08A 2ESVD 3G04B 3B3BA 1B0GA 3REVA 4PRPD 1QBMH 1DQMH 2A77H 3F2LA 1SBSH 3F83A 4I0PD 4WI6A 4YHPB 2CALA 3BW9B 1FG9C 2G60L 4CGTA 4MB1A 4YHML 1B0RB 2HB0A 2SODB 3RDTA 4XN5A 1YJDH 2RCSH 1SZNA 2EADA 1QBBA 4KRPC 1YEDA 3D4CA 1AMXA 1AE6L 4WUUA 2I07A 4YHIA 2VYRE 1U8HB 3BLKA 1TQCC 3BKYH 4NC1C 4YK4B 2DYPD 2PN5A 3GDCA 1U8NB 2VQ1B 4FG6D 3HC2A 5FFGA 1S8DB 4MRBA 1NBYB 3FH7A 5I15H 3QGVA 4V1DD 2EDQA 1IQDA 1RL1A 3Q6FA 4OFYA 4UNVA 3CE1A 3KWWA 2NLJB 4NO0A 4AMXA 4BKLB 2GFBB 1AD0A 4WJKB 3DX9A 4Q8BA 4R4BA 2HUEA 4XAKD 4XP5H 4XO3A 3DTUB 3HG2A 4PWIA 2VMDA 3RGVC 1KLFB 3VI4B 5BV7C 3FB6B 4EOWL 2NCMA 2GUOB 4U33A 3ZL4H 5EF3A 5TQ2H 3O9WB 2WP3O 4IRJC 1AGFA 4CU7A 3KH3A 1S3RA 2BVEA 1MCPH 1BAGA 5ICYA 2D4DA 4DPBX 3AXIA 4DOHB 3QQDA 5DJZA 3STZA 4A2EA 3SOBH 2VXSL 5B7EA 2AJ3A 1Z5YD 2CK2A 2WKOF 1PSKH 2X09A 1IAKA 4QMEA 2XG5B 3KYNB 4CKVX 2P8MA 2UWEB 5LJYH 1NCDH 2J6WA 3HG1B 3R1GH 1NGQH 3HNSL 4Y5XC 2DBLH 3ARBB 3BZ4B 5KBLA 2XV0A 2LABA 4OCSH 1I1FB 5CBEA 3CXHJ 3ZTNL 2R2EA 1HH6B 4JQXC 3F7VA 2XIDA 2APWA 5ALCL 3ZTCC 4WFHD 2R83A 2CRMA 4XHJD 3SBRA 1RURH 1KXVA 3RNQA 2YAEA 2QPFA 1RVFH 3E6FB 2XC8A 5DHYA 3KYOB 1G7IB 2HT2D 4HZLA 5DD6B 3U6XA 3DUUA 2DMGA 3KPQA 5INCB 4ORZC 5TFSH 2YXVA 4ZPTA 2YA2A 5FUOL 5TH2B 1K3ZA 3HLKA 1F97A 2GSIB 1TNMA 2AJZA 3L5IA 4PJEB 3V6OA 1WZKA 3CFUA 1IC5L 3IDIB 2X9XA 4BSVA 4YDIH 3W0WD 2BIOA 3FK3A 1I1CA 2AXGA 1YMMA 3HUJB 3RNQB 1J12A 4KGLA 1ASQA 1OEZW 4HCFA 1T1XA 3RIKA 2ADGA 4XP1L 5HHVH 1IC5H 3WTXA 4ELKB 3UABA 3UZEA 4FHBD 3ML9A 4KVCH 2BVTA 3L5XH 1VEMA 4EXKA 2GPZA 2JLLA 2AJYH 4GKZA 4X5QA 3EO1B 3GSXB 1HHIB 4YSDA 5IB5B 3IU3B 2UZIL 1V27A 2FX8H 3GI9H 4HK3J 2XZQL 2EC8A 2EYSA 1JGUH 4OVVA 1X5ZA 5E9NA 2X9ZA 4PY7A 5F97E 1MREH 1T83A 5GGRB 2XU9A 1RHHA 4Z7IA 3FXIC 4FQIL 1RI8A 4PJ7F 3QUYB 1F4WH 1CXLA 5GS1C 2IANA 4MMXB 5F7YC 2BDNL 5LXGL 2JQAA 4WSGA 5A43C 1RVFL 4EI6A 1FGVL 1RHFA 2MEJB 4PJGE 4RAHA 4X5XB 5D2NA 4MZRA 3ALWA 1CLZH 2XWTB 2ZAIA 4HKZA 2FD6L 4NPKA 3VI4F 4RNRA 5TE4H 1AGBB 2P80D 4HMCA 1NL0H 1E9PA 1X3DA 2CJUL 4TYUA 5CEZD 5DQDH 2EE9A 2X1WL 2C1PA 4DO6A 1E2VA 3A4EA 3GHEL 3KJ6H 4BV1A 4DGYL 1JHLL 1G7HA 4Z7QE 4HS6B 3G6DH 1RERA 2PPCA 1OSZA 5AAPA 5IQ9A 1EBPA 1JZ7A 2JKJA 3IDGB 4XCNA 1RU9L 4YDKL 4FGMA 1UKTA 3BAEH 4BFIA 1PYWA 4LNVA 3QI9A 1JPST 3FNKA 1KOAA 1OCOB 3ZL4L 1MFCH 4F1SA 4PJ5D 4XX1E 4W9HC 4X5WA 3EJZC 3SE8H 2DLFH 5CGYC 1RZ7H 3AU1A 4QOKA 2FJFA 2OMWB 2V2TB 3SKNA 2E6QA 3DMMB 4X98A 2VSMB 3UADA 1I9EA 1Z9OA 5T3XL 1XSJA 3V7AG 4Y2OA 1J9SA 3CK0H 2BK8A 2BP0B 2CDGA 2IQ9H 2BWDA 3RGHA 4ANUA 2WZ6A 4NHCH 4KKLD 1MFVA 4Y9BA 4P3DB 4MS8C 2CDFA 5EMYA 1O0VA 2PCPA 4BZ2H 1CU4H 5FPIA 3QXWA 3BO8B 3VQ2C 1HHIA 4XP9L 4Y5YC 1QOKA 3WIAA 4YXHL 1U8MB 1Q8MA 3DPDA 3MRPB 1R3KA 1OM3H 4NQSB 2J6EL 5EORL 3N5AA 4MLSA 2NQDA 5GGTH 4A7GF 4JDVA 1AS8A 4ZTOH 2GTQA 4EI6B 5DO2C 5EBGA 2BOBA 1U3JA 4B9PA 2WUCL 3FFCE 1DQLL 2BVQA 5L6YL 4E9LA 5C0BB 3BX7C 5I8EA 2W0KA 3PV6B 2VMCA 2H3NB 4HUWA 4JPVH 4OCWH 5IG7B 1KGIA 1MSPA 3L45A 4TSAH 1AO7B 5E8PA 5SX4H 3VFVA 4QHNB 3EDJA 4YPGB 2XN9A 4OLUH 4S1QH 5EF0A 4UQBA 4QKTA 5DLLA 1Q0EA 3R18A 1AD9A 5DHYB 1RJYA 3UYRH 4ES9A 4JFQB 2UZXB 1RZFH 2OMZB 3ERXA 4GG8B 4RQQA 4NJAH 2KYIA 3RTLA 5IEKA 4GI9A 3GUTB 2F54D 2GQHA 1RUQH 4QRBA 4DN3L 1DJHA 1XL4A 4ZSOE 5IOPB 4IRSC 3ARFB 1KPVA 4LEXL 2ZSWB 3CPLA 1EFXB 1K8DA 2B4CH 4M5ZL 5DHEA 3N04A 2H2PC 4LQ1A 1XH3A 4I2XA 4HH9A 2YUXA 3HR5A 1AMYA 4ONFL 1G7QA 5EU5B 3OR7A 1C16A 4ETYA 5KBDA 1DE4A 1BZ8A 4MQTB 1WAAA 3LS5H 4L2LA 3NA9H 4J6IA 5MP6H 2BX5A 5F7DA 5E08L 2EH7L 2YPKB 3N06B 4JPWL 1MRCH 1KWKA 4AV5A 2YKLL 4OCYH 2HAZA 1D6VL 2CLVB 2WZ0A 1AQKH 1N59B 1TMQA 2B2XH 2WPGA 4F80A 3GMPB 1WAAF 2XWEA 2YGVA 4I2XB 1A9BB 1VERA 5D1QE 4G8EB 5DO2D 2EDLA 5J13B 3CHQA 3DGGB 3NP4A 2VSCA 4BQ9A 4KJQD 4JGUA 5D1XB 3O81A 1VJSA 3FCBA 4N0YH 2NY2D 4ZAKA 3O6KH 1D7FA 3MUGA 4JQIL 3MBEB 5A3ID 3PWJB 1JPSH 4GBXD 3VFNB 1L9RA 4X99A 3VI3F 2ZX9A 4LDEB 4BSVB 3WFCH 5CJOH 5EEUA 3KW8A 2GYSA 1NUFA 1H6EA 3KYKH 4DZBB 1I8MA 4Q6IA 3NCJL 5FX3A 2K6ZA 1JTPA 4BFFA 2FQEA 2ZUSA 4IIZA 3BAKA 5DJDB 5B3SB 4C8XA 1NMBH 3L6FB 3UBFA 5HD8D 4OCXL 4OTXL 1DJYA 3HCVA 3JV4B 4UINH 3U36B 4KXZI 5IHZA 3GD1C 3CFJA 2BIMA 4MBOA 3P30L 5AD0B 5GIRA 3PWJA 3VFNA 2Y7MA 3REVB 1P4LB 3ZUCA 1XGQB 1UGKA 4L4VA 4PD4J 3AB0C 4OGXH 1FNEB 1ZSDB 2VRAA 1JZIA 5IJCC 3KL3A 3QA3B 5ERWA 5ANHA 1BIHA 1E8XA 2VW7A 3T77B 1IZJA 2CXGA 1EIBA 3KMDA 1MFDL 4Q14A 1BFOB 3DV4A 3FT3A 1JXGA 2Q6WA 5HI5D 2F8IA 3O8XD 4XO5A 1ID5I 2PWHA 2QELA 3QZWG 1HL5A 3MA9H 1ADQA 4NWTL 3H3PL 4P49A 5CSZB 4EVNB 3CDGA 4YSQA 2WCSA 2XQ0A 2Y25A 3ZE1E 5GZNA 1UWXH 2ODIA 2VL5B 2HSIA 1D9KB 2JCWA 4AEEA 2MMXA 4IMKC 4NWTH 4D2NA 1OW0A 3DGDA 4MAYD 3LTVA 1KCKA 1SF5A 3ABGA 4R96A 1ND0B 2Y5EA 5GGSB 1AG0A 3SE4C 1CLZL 4TOYH 3DNKA 2IGLA 4NIKB 4A7QA 4UILH 3SYQA 3ES6A 1BD2B 2V9UA 4LU5H 5M95B 4ODVL 1NLBL 2WLLA 1E67A 1CZ8L 3GUTA 2H0PA 4GIOA 3LKNA 1I8LC 4WTQA 4WV1B 1G7HB 2DJUA 2LQRA 4HWEH 3HPLA 3Q8CA 1KDIA 2J44A 3X11A 1LE9B 1F00I 5CZVH 2VAJA 2VAAA 4R7XA 4YSRA 3D50A 4ONHB 5AW9B 2WXGA 2TAAA 3A6OA 5DRXB 4AG4L 3X1FA 4DGVL 4M1GL 3SEPA 2JI1A 2Y6TE 2VDQH 2PNDA 3T04D 4Q52A 4HGMA 1MHCA 2BP5M 2YQ3A 1E3ZA 1WA2X 1PNDA 1NC4D 2R0KH 3K6OA 4TSBH 4UQ2A 5EC1A 1UWFA 3RLSA 1LK3L 2BW4A 5E6IB 4Q0XL 3ULUE 3L4YA 1DQQA 3TH4T 4JFXA 2R0LH 1Z9MA 1OPOA 2ZUYA 3OHXC 3QCUL 1R3IL 3B9KA 3QS2A 3ELQA 4OJEH 4YO0B 2X4OA 2VDKB 1KV7A 3QUXD 1A14H 1BFOA 4LVHB 2JKSA 5JDSB 3E1ZA 3D51A 5FYKH 1ZVSB 2IQAA 5D9SB 4G6FB 5MEQB 3IGLA 3V5KA 5JHLH 1T7VA 3X1EA 4U3CA 1P4BH 1KEGH 1F1AA 2ZCLH 4Y4KA 5KS9E 2X6VA 2DM3A 2BIQA 2QPSA 4HBCL 3UZQB 4LOVA 2ED6A 3Q1SL 3DUSB 3PGFH 3WGUB 1U93B 1W0VB 2FJHA 4ZPVA 1XFPA 1JF1B 5FO7B 1OAKL 4OGAC 4TSCL 5FXCH 1WFIA 3L5XL 4K55A 2YAHA 1UJ3B 1X7TA 4YSPA 1QSEE 4HJ1A 1M71A 1QP1A 4RWYH 5GSVB 4AV4A 2DQHH 4NQVA 1BVNP 4PJHF 3ZHDA 3EH3B 4TPRH 2YD5A 3E6FA 1T7XA 2EVHA 5I75B 4P2QA 3C60D 2OX5A 2DKSA 1UXWA 3BUTA 3UJIL 4PJFA 3FF8A 5E2VH 3V52L 3RVWC 4P3CH 4HS6A 2A6KA 5I73C 1OLLA 1MF2L 2G9KA 2TSBA 4BDVB 3M7OA 3W56A 3WMPA 3QC6X 4LHUB 5K9OA 3S37H 5C70A 2HH0L 1T1YB 3TIDB 3D85D 3QEQB 4RNRB 2RACA 1T4WA 5T1DH 3SGJA 3QQXA 3KWTA 1UADC 1A7RH 1E4JA 3DTDA 4KJPC 5FYJU 3JTTA 3P73B 4TM9A 1A0QL 4X6CE 4NUJB 1WUNT 1DQDL 1OP3H 3OX8A 3SCMC 5K9JH 2AXFA 2JIXA 5L2JA 5C0ND 1QO3A 2DM4A 2VR6A 3ULVE 4O5LL 4ZMPA 3QUKB 3MACH 4ODBD 3UMNA 4KFMA 1KN2H 5AYUH 2V7NB 4O00A 3ZDYF 1M2OA 2DQIH 1UOWA 3OMZA 4MD4A 2QJDA 4QXGL 4E5XG 1F4AA 4K4KA 3VQMA 4DVRL 5D1ZC 3U1SH 4ODXA 3TO4A 5MEOA 1FUNA 1KIPA 3K91A 2F8XC 3IAPA 4N8VB 4XXCC 4UT6A 4WF7A 3UTSB 2PYED 4JN2B 3U83A 3MRKB 1XVSA 3I84A 1H15B 2IOMA 3JWOH 4Y88A 2WXPA 1ACCA 4KKRA 4JFOB 4CU6A 4CRPA 5L2KB 4CC4C 1Z2KA 3MODL 2OMXB 5HYJA 3KLHD 3BHBA 4QAWA 1T0PB 4OLYL 2F58L 1W0WB 1HZKA 2EDNA 4ZPTB 3FO0L 3FQWA 1SOQA 3H56A 3MCKB 1F90L 2BVUA 4R2GC 2R51A 4NQCB 1RY7B 2JJVA 3GS7A 2Q76B 4L0ZA 3FQUB 5FM5O 2PP9A 1AQDA 4H20L 3AS2A 2BMKA 3PCYA 1BBJB 1K8IB 5ACLA 3MV7D 1BCIA 2YK1H 4O2CB 4OTXH 5E0QA 2Y69B 1GC1C 2H0EA 1BGXH 1SJEA 3TTSA 4AZ8B 3JZ7A 2MQCA 3RWFB 1XR9B 4JDZB 4N0UB 3D2UA 3HHMA 4N2CA 2ICWB 1A47A 4ORGB 4U1HB 1AZVA 4YHOH 1TSRA 4IBVA 4JUTA 4DP6X 4H88L 4A66A 3EOBA 1OP5K 2VDNB 3JTTB 2OI9B 5T1JA 5DQ9B 4EI5D 2V17H 4ZMWA 3L3OB 2N01B 2XG5A 3AQYA 4F7KA 1DQQB 1DUZA 1ETA1 2VLKD 3QNYB 4ZUTA 2LOEA 3HG1E 5T1DL 2YSTA 1R5VA 4FP8H 2OXGA 4PG9A 3T09A 3NCEB 3EW3B 4GW4A 3KWVA 2QKSA 1PG7W 2I24N 4F9LA 4GRLC 4TS6A 3QDAA 2VR8A 3T4AA 3CHPA 3QIBB 1BJ1J 2C4FU 2ZXWB 3ARED 4PHXA 3ZTNH 2ZF8A 3FSAA 3VXSD 2KDYA 5D7JD 4C4KT 2FCBA 4M93B 5E2VL 4JG0L 3VNYA 1YA5A 1MY7A 2WXOA 4JL2A 4OZFH 2B3RA 1KTRL 4Y19E 3CU7A 5E70A 3S9DB 3PJLA 1SN0A 3LNHA 4NNXB 3RB5A 4M43L 2WLLB 3QWOA 5IB4A 4AT6B 5EUOE 4DQOH 2C1PB 1JP5A 2WY3B 4C56B 1J8HD 4WI4A 3L2NA 2CA4A 2CG9X 5IFHH 3KPTA 3CQFA 4Q4EA 1NCTA 4GRLD 2LT9A 2XKNB 1TJXA 4AQ1B 1OTSC 3DDFA 2GC4C 1NAKH 3PHOB 2Y7OA 1MI5D 1FIGH 4KVNH 4AXWA 1MNNA 5JORA 4OF7A 4GRWH 1S9XA 3TIDA 2XN9E 3BXNA 3OJ2C 5TF0A 2QGDA 3HE6B 1MCNA 4XO4A 3HC3H 4QRRD 1IAMA 4RAUA 3P69A 1CVRA 1BP3B 4N1HB 1WBYA 3X1GA 2VE6A 4P05A 4H26B 2X5PA 5FDYA 4RDBA 3TX4A 4UOW1 3CFEB 5J6HA 2KDGA 4OZHA 1RJLA 4QRTB 3V0WH 2AANA 2VLRB 2BRRH 1W8EA 2NXZD 3EYSH 4L29B 5C08B 1XGQA 4G3YL 2ICCA 1N9PA 1CFSB 3GBLA 2QTEA 5D6DA 3OKKB 1Q94B 4OM0L 2N59A 1HIMH 1SRDA 1WS8A 2YOCA 5HJGA 3HNTH 3PU7A 2ZCLL 1X4YA 2WBJA 3GNML 3QHZL 4L5FH 4RLDA 3CZFB 5C0DB 4M8UA 4LLVB 1GZPA 3GTVA 3MRDA 4G9FD 3FO1B 3MMEA 3M88A 2NW3B 3QORA 1FE8L 5C9JA 1G0YR 1P5VA 3ROOB </