2E7LA

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSHQGRYLTFGSGTKVIVLPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 27
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lA00
3MRMA 2BSSA 1RIUL 3IF1B 5ESAA 5IWLC 4G80A 4LCUA 2Q7YA 1JVKA 1R3KA 2YRZA 1QSEB 4ZTOL 3IFNH 3PHQA 5GRUH 5L8LB 5A16A 2MQ3A 3ZKNC 4DN3L 3UO1L 5JW4M 4Q2ZA 4NN6B 5IJVB 1HINL 4TSAL 3LPFA 4LPXA 3NMEA 5D96C 2V7NA 1G6RH 4TTGA 4S1RL 5KVFH 2I9LB 2YUWA 2J8OA 2CGRH 4YBHA 3GUTA 3BJ91 4JHZA 1CK0H 2F19H 4QRUB 3SQOH 2VLRA 4KRPB 3SDAA 1VSCA 4LIQH 5I75B 2C3WA 1QLEL 2AJZB 2IG2L 5HI3C 4TRPH 1XIWB 1WISA 1JJUA 4G3YL 2HP4A 4YAQA 3MRIB 5GJSL 1YN7A 2GT9A 3F7RA 1NCWL 2DL2A 3ZTJH 3F7YA 4WRLA 2HTKD 4NQEA 1D9KB 4GG8B 4DTGL 3L1OH 1KTKE 2V2WA 1REIA 1QBAA 1S7WB 4PLJC 5EU4A 2NY6D 2HYMA 4MAYB 2NTFB 4L3EE 8FABA 4LF3B 1MFNA 3F12A 4RMVA 4YQXL 3KPPA 1S7UB 3I6GB 5MEOB 2DQDL 4PRNB 3EDFA 3DX9B 2VLJD 5DA4A 1ZTXL 1DUZA 4KAQL 5F9AC 2XN9E 5E1AA 1I1YA 3DRQB 3BW9B 4G9FA 4I4WB 2BVPA 1AQKL 1QKZL 3L5JA 4RIRB 1ZA3A 3IFNL 3L3IA 2E3VA 4KHTH 2DQGL 3MZGB 1ZWIB 4CVZA 5IOPA 4YDJA 4KKCC 3U4EB 4TN9A 2OJEB 4X8XA 4HWZB 4H1LA 4RGNC 5CKGA 2KQNA 3VI4F 4QRPB 5F1IB 4WFEE 4UOW1 2I24N 4N8PA 4EDXA 5J3HC 3NCMA 2QQLL 2VJXA 1GAFL 3EZJB 4LMQE 3LKRB 1XGPB 4LRNH 1H3TA 4Y2OA 4YHKL 4LU5L 4ZO7A 4HS8H 2LU3A 1G7IA 4M1CC 1N2RB 4DGYH 5DHVA 1IJ9A 4X98A 1MFEL 4JM4H 1WCBA 1U3HD 1KC5L 3HZYA 2GSGA 5IR1B 3FT3B 3OB0H 3WDHA 1KCUH 4H20L 4Q6IB 4G6ML 3IDJA 3TNMB 1MCIA 43C9B 3QSKB 1MFCL 3VFSB 2DJUA 1PBYA 1HDMB 2OTUA 4TVPL 2WMPA 3TIDB 1U58A 3T0EC 3GMNB 2QL1A 4GUPB 1LEGA 5D93B 5BS0E 3D3VE 1I9RH 1PG7L 5HYJB 3W0WA 1A1NB 1HWGB 3SKUD 2EC9U 3S3JA 1BX2A 1A14L 5IHZB 3Q0HA 4EXPX 5BO1L 4FXKA 1V7ML 3DVGA 4IOFC 2AV7B 4QOKB 4G6AC 3C5SB 3C6LB 1DQLH 4PLKC 2XZCH 4PJAF 4NN6C 1CFTB 3SJVB 1H5BB 2FGWL 1TZIA 4FNLL 2BVEA 3W0WE 3WYRA 2DMCA 1UKSA 4OZ4B 3TP4A 1S9WB 2V7HA 1YDPB 1CZ8L 1I7UA 1TCRA 3UTSA 5IM7A 2FH6A 4KK9C 5GS2D 1H0DA 5HYJD 4L8CB 2J6EL 5I15H 4YX2L 4JFEB 1P84K 1A64A 3NCYS 1BQLL 5C0GB 3LN4A 2OR9L 2FR4A 3SKJL 4RISL 3EJZD 5C1MB 2HKHH 3MOBH 1FZKA 5EPMB 1NLBL 2VKWA 5F7WC 4QHLA 2EYTB 3IU4H 5KTEH 5I1EH 2P8MB 4P5MB 1KN4L 4WUUE 3GHBL 3IU3B 5B3NA 5IVZA 2ADIB 2DD8L 2G2RA 4HWEH 1A6WH 3EO9L 4NO2A 1FC1A 5LWYL 4MQTB 1XR9B 2E9IA 4J4PC 4JHAL 1PZ5B 5FYJD 5DJ2B 5JW3H 1FDLL 5SWZE 5C0AD 5DMIL 1CR9L 3LEXA 4FQLL 3RWFB 4TSCH 1U8QB 4MA3A 1KLGB 3TZVC 3VRLE 1G6RA 4O2FA 4XZUB 2ZZUT 1VACB 4NYLA 2Q86B 3PJSA 5IB5B 4G9FE 2W9DL 4NZJA 4YIQB 1OAXL 1TVBA 3ZTNL 1L7TH 1SYSA 4KK8C 1NCCH 2DI9A 5C0CB 3IU3A 5EBWA 4M6AA 3AXLB 4YXHL 3WSQL 3Q1SH 3RI5K 4ZUUA 3SO3B 1F13A 4YEEA 5K59F 3C2AL 4HEPG 3V0VA 2P42B 3IFLH 3HA0A 1B2WH 5LAXA 5F9JB 2R9HD 2FR4B 3MGTB 4WO4B 4OCRL 5HVGB 4O51A 4JFEA 3BHBB 1N6VA 3FZUD 1KCSH 3ULVC 2I07A 5LWYH 4FZ8H 1NDMB 5DC9B 4K3DL 2IAMC 3D39E 3O4OB 1TZIB 3GSNB 2O5XH 2AK4B 3L3HA 3SE3C 3W5NA 3QO1B 4OIIL 3QPXH 5I1IL 1JHTA 3M1BA 1HYSC 3LEYL 1SJHB 5DUBB 4P2RA 4WW1A 1Q72H 5F8RC 3QQ3B 2OMNA 4FA8A 2HLAA 5D93C 2DQJH 2Q76B 3WIHA 3VXUE 1A6PA 3QJFA 2IWGA 5T3ZE 3HFML 5EZJB 1QVOA 3H0TA 4HUUA 4LLWA 4C56A 1KG0A 2NY2D 3HAEG 4QRSA 4CJ1A 5SWZA 4G8GD 3BYYA 5IT2L 4F57H 3O0RL 3PP4L 4MX7B 1J0KA 4PR5A 2ICEB 5CGMA 4I77L 3GMRA 1U8OA 1EH9A 3DGGB 1FFOB 4XC3L 3UZQA 3RZWA 4MCYB 4Y89A 3L7FB 3TIEB 1JNNL 2VDKL 1JK8A 5EBLA 3OJDA 3ARQA 3EYQC 1YJDC 5I1DB 1SHMA 5BS0D 2DM4A 1R5VA 3RWGA 2BNUA 1CI5A 2I07B 1ADQL 1QACA 2GSIA 3PWJA 1UM4L 4YHOH 2F15A 5DD1H 3TH4T 1HSAA 5IOPB 3PWVB 3O6LH 4HCRL 5C9KA 4DKAA 1PAMA 3AXLA 4DN4H 3OKMA 4I4WA 4Z77B 3QWOB 1XF4A 4G9FD 5ICXB 1HI6B 4XNUL 2A6KB 3EO1B 4RGMC 4WI2A 1GC1H 4YWGL 1CDBA 4PUBL 2PYFB 5C0JA 4R6UA 2JELL 4U6VL 2R2EB 1RJYA 4KUZL 25C8H 5D2LF 5FCSH 4X9FA 5F96H 4LGSB 4QHKI 3NA4A 4MHHG 5DQJB 4BYHA 2XWTB 3D3VA 3VWKB 3TVMB 1MAMH 1U8IB 3W5MA 1N64H 1D9KA 3TGXA 3HRPA 3Q5YA 3T4YA 1S3KL 1XR9A 4O2CA 4PJHB 5EZOL 2VLKB 2XZQH 2P8LB 2Y7QB 5F96L 3I3DA 4J4PA 1V8HA 4IBLT 4PJDB 5D7IB 4QRTB 5C0AE 5ESQB 3BAEH 4J3WA 2CRIA 2VOTA 4ZUSA 1W72A 5D9SA 4WWKA 4MCZB 2E27H 4Y4HA 2G60H 1EZVY 5JMRA 3ZE1E 4QXUH 4NO5B 2MOVA 2GJ6E 3OGOE 4JR9L 1NCDH 2NY7H 2E9JA 5GZOC 4LCWE 1DEDA 4XPFH 3VXMD 2V2XA 1OLLA 1QSZA 2ZWLT 3MRGB 2VLKD 4KKAC 3GRWA 1TPXB 2HFGL 3MJ8B 3THML 1OT2A 3P4LA 4H5SB 4PG2A 4TNWF 3AY4A 4LCUB 3GBMH 4LASH 1NCWH 4KZEH 3BQUB 2H3NB 4XBPB 3RPKA 4Z7NF 1UKQA 1IC7L 2XKUA 3VU2A 2K1MA 1GZQB 3CK0H 2R4SL 4LKCB 3V79C 1I1FB 3L3OA 3MLRH 3KPRE 1J0IA 4PY8J 3JWDC 3UAJC 3EYOA 3GKZA 4ZXBC 4L8BB 2FZ3A 4CMHB 5T1LA 3ROOB 4Y4FA 5TFSL 1TCMA 3SGJA 3WNNA 4QYOB 5KVFL 1V3JA 1KJ3L 3HMWL 3IAQA 1XF2B 1KCRH 3TF7C 2VZTA 3QDAA 3TBVB 3P4MA 4Z7VE 1PZUB 1C5BL 4DGVL 5HD8D 3NH7L 1FFQA 3IDJB 3ZE0F 1IC4L 3BEVA 1MCHA 1XCQA 1YMMD 2DQIL 2WBKA 3IGAB 4P4RB 1T03L 4MWFA 5IG7B 2XACC 5BS0B 2XWTA 3D3VB 2ZNWA 2WWMC 2M2DA 3PGDB 2L7UA 4EN3B 1ZGLP 1PX4A 1RZJC 1LDPL 5M7QA 2NY6C 4X83A 1L6ZA 4EDXB 5F6HI 4HUKB 4NPYA 1AKJB 5E2UL 1X7QA 5DVOA 1XF5A 3PG2A 3H9SA 1DBML 3WUWG 3O6FD 2OJEA 4Y4KD 2EH8H 5DWUH 4K23L 1HYRC 5F1NB 4Y16B 3BO8A 4WHCA 2OJZH 4JRXE 4NKQB 4FQXD 4LVEA 4K7PY 2R4RL 1QQDA 5I1AA 1ZS8A 4OKVB 3IFLL 4LSTL 2IBZY 1S7XA 2HWZL 4KI5E 3DX9A 4Y2DB 5J6GB 1K8DB 4N0FA 2FSEA 4R96A 3WBDA 2XTJD 6FABL 2D03H 1DBMH 4X5WB 4KVCL 4EN3A 2EEBA 4DKEH 3H2WA 1AXSA 1J8HE 1JWMB 1M1SA 3QIUD 5JIHA 1BQHG 4XCCH 4DVBB 1A1OA 2WM0A 1N0XH 1JK8B 2BC4A 2JJWA 5GRVK 5JOPE 1YUHB 1XCQB 3WD5H 2D9CA 4EJ1C 1KXVC 3D9AL 4ZUVB 5ISZB 1FFOA 3DGGA 3P4OA 4YHIA 3LRGA 3VFMA 1N5YL 2H41A 1SMOA 5I9QB 2Y5TB 3BRGC 3HI5H 4XRCB 4YX2H 1JGUH 4NNXA 1MHCA 3N0PB 2AV1A 3JUYA 5T1LB 2DS4A 3ARED 3HE6A 3HFMH 5I73C 2R15A 5FECA 2VUOA 5GJSH 3T2QA 4K8RL 1I1FA 4OCWH 1JNLH 5J1TC 1AE6L 3MV8A 1J88A 4PRPA 4Q7DA 5JOPD 4JFHD 2DWDB 2PW1A 2IALA 3O11A 4E5XA 4JCLA 3WO4C 2LE9A 4WIQA 4PJIB 1DP0A 5HHMD 1T80A 1QSEA 1J1PH 1BFOB 5EU6B 3RAJL 4G6KL 3UJJL 5D2NE 5D5MB 2NLJB 1HHKB 5I76B 1XF5B 2FBOJ 4JR9H 2IFFH 3DMMB 4P2QA 2RIKA 4NQDE 7FABL 3MGTA 3FQRA 1H9VA 1VADA 4LFHG 1U8KA 5C0EA 4W4OA 1BECA 4JM2A 1HHHA 1PDKA 4WCYH 3U83A 4PJ5E 1V7MH 4NQCB 3NPSC 3NABL 1MAJA 4GRMA 1F42A 4JO4H 3RWCA 3ALPA 3E6HA 5JQHC 4YIQA 3LV3A 3MRLA 2LFGA 1HKLH 5AZ2L 1G0DA 4ONGH 3VFWB 5HGHB 4AM0B 4N0RA 1RZ7L 1LILA 3FN3A 3NFSH 1EJOH 4Q74A 4XNXH 2FJFA 4M6OH 2X7LB 3QIUA 5IEKA 5HVFB 3WEXA 4JM2F 4Z18A 2NY1B 4YPJA 1FNSH 4DUVA 4AL8H 3JV5A 3WE6A 3B2VH 1RIHL 2RGSA 3QXDA 3H7BB 2JELH 5C0JB 3LS4L 2ARJB 4H25A 4X7SL 4JFDD 2W38A 1HEZA 4X7EC 1IM3A 1NGZB 3GSQA 2BCKA 2V9TA 2DI8A 4YHMH 2J5LB 4WCYL 3DX6B 4R3SA 2OQJB 1DJSA 1JGDA 3KLAB 4U49A 3RX5A 5I1KH 2R39A 3FFCA 2NZ9D 5AG8A 4BUGA 1JF1A 2IAND 5CD5C 5IVXA 1QR1A 4RAUB 4NUJB 4CMMA 1A6TA 4PJBE 5DURD 4CN6A 5IROA 1HN1A 3O3UN 5CMAA 1N8ZB 3BGFB 3VXRA 4G8FA 4M5ZL 4K3EH 1HSBB 1TZGH 5DMKB 1LP9B 2V17L 3ULUH 5E8PB 2NTSP 1MVUB 3DUHA 1A7BA 4LIQL 5BOPA 4Y19E 1JPFB 2OLDA 4RISH 2KDGA 3FHQA 1YYLL 4Z7UA 1A7QH 4HKZA 1NLDH 3BI9X 4YC2C 3VA6A 3GMNA 4HFUL 4HUUB 3H0TB 5L0QC 2B4CC 3UJTL 3MREB 4H0HB 1A21A 1KIQA 4ZUTB 4XVSL 4LCIL 3QJHA 3MGOA 3TNMA 1S9XA 5BXFB 2M26A 1U8NA 2GAZB 1DVFB 4PGEB 1B0GA 4HIXH 4B53A 1NGQL 2DBLH 2IMNA 2Z9TA 2ZUWA 4WTXA 3SDYL 4OF3A 5CINH 1NCNA 2NX5A 4G42A 4D3CL 5HGDB 4PG9A 5I8KL 3WFCH 1R3JB 1ZT4A 4HK0A 3U0TA 1DBAH 4PGZA 1MJ8L 4XVTH 5F7LB 3GSXB 4HW6A 4PJ8A 5ALBH 5ANME 2DWEA 4OJFH 4XH2A 3MUGB 1LEIA 3RDTA 5K9KB 1I8KB 2NY4D 4DAGL 1G9MH 3OGCA 3LB6D 4OFIA 4AEEA 1NEZB 4L4TE 4U1HB 4NGHH 3RWJB 1K5NB 2HH0L 5D70H 3QNXB 5KJRH 4CL7A 3NFSL 1N64L 4RMQA 1LO2L 4GQ9L 3TA3D 1RK0A 2D4DA 5T33L 2OL3A 3FN0H 2WBJC 2FJGA 4P2OA 1HHIB 5BXFA 4JQIH 1EO5A 2MJWA 4XP9H 2DWDA 2DLHA 3K7UA 4LPCA 2GIYA 3GMQB 3VFUA 5IMMB 4ZDHA 3QXAB 4OLWH 5C0IB 3C6SA 2W9DH 5T3XH 3QEGH 4K94L 3MRNA 3VFPA 3PL6C 5E4EC 3AS1A 4NM8L 4EQ3A 1EHLH 3OR7B 5I8CB 3HZMB 1INQA 1K6QL 3NA9L 5KSVB 3TCXA 5FHBH 2BSRA 1UWEL 3M1BB 4Q0XL 3BEWB 4PJ8B 4NC2B 1IM9A 4NKIH 1Y18B 4HMDA 4F9PA 5D1XB 2FL5A 1BIIA 4NQVA 4ZODA 4XHQA 1EPFA 2HFFB 4FZEH 2YPVH 4OLXH 1NDMA 4K3GA 2CIKA 3F5WA 4HBCL 1CD8A 1M7IA 1JNLL 3ARYA 1ZK9A 3CXDL 3EHBC 3VGGA 5CZVL 1U8NB 5C6PB 5ADOL 1YEFL 4JFZH 1MREL 3QJHB 3TA3C 1HZHH 1LGVA 1CICD 1MNUL 3HNSH 4YDIL 1Z6JT 3V0WL 1UFUA 5DJ8A 3G6JF 4M00A 1IAKA 5BW7C 4PRID 1QSEE 1KFAH 4PGBB 3RWDA 3QEQB 4P5KA 4HIIB 3T4AB 3LMJL 4F7MA 3LDBB 5J7CC 3DVGB 3MV9E 2Q86A 1IEBB 1L9MA 5I17A 1NBYB 1R5WA 4XGZA 2XZZA 4FOMA 2GTZB 1J8HB 4S0SD 2V2TB 1F6FB 5MP6L 2I9TA 1OTSD 3U4BL 4YHZL 4HWUA 3LKQB 5D4QA 4LLVB 5IW3A 2HT4C 3MC0A 3QPQD 2C3GA 2CLVB 3HE7B 1EDQA 4BSJA 3VMOA 2PXYA 3BD4A 1XGQB 3JVGC 4OD3H 1RK1A 4Q6YA 3KHQA 3E6HB 3RU8H 2F53A 4ZFOL 1RUPL 1HH6A 2ADIA 1KC5H 4YDKH 1B0RB 3EYOB 4GMSH 3FFCB 2HMID 3JBG7 3NIGF 3P9MA 5IW1A 5LQBH 3ILQC 3SBWC 2ZCHL 4LCIH 3DJ9A 1F00I 2XV6B 2LTQB 1F4HA 1F4YH 3E6FB 4P23C 3PIQA 3MLPA 3VXSD 3QQ4A 1GPOL 4HUVB 2BFVL 1EEYB 3LSOA 5IM7B 2NW2A 2VLJA 4YGVB 1QBBA 3AB0B 2V7HB 4X6EA 4WEBL 2W9LA 3MJ7B 1BZQK 1AI1L 1NCBL 1FFPB 4F9LC 4YNYA 4R4FL 3MBEA 4IOIB 4I5BA 4MSWA 1F3JA 1L7IL 3WJLA 1SM3H 2WWKT 4ODUA 1OP3K 4NQDB 4JHAH 4PRNA 5DZNA 4P99A 4RFEA 2A6DB 3I6LE 3QXVA 4HEME 4MDJA 2DM7A 2DMBA 4Z7OF 1Z5LA 1NUGA 4WTZA 1NL0L 4GH7B 4MAYA 3K4ZA 2X4SA 3HMXL 1ADQA 3MNWB 3SGEI 3RPIB 5HDLA 3AMLA 1YEGL 1Q0YH 1A6ZB 1U9KA 2ITDB 1NGPL 5JW4R 2ESVE 4UB0L 3RA7H 5JQ6L 1JF5A 3WUWB 2Y36H 5KZCB 2GT9B 4PJAE 3BH9A 3GEWB 3KPSD 2GSGB 4YLQT 1CE1L 2VLLB 3ULVE 1U8IA 4QY8A 1BAFH 3OKLA 2NLJA 3VWKA 2F54B 4U1SA 1NCDL 1G7IB 4U7MA 4H1LG 1R3HA 1JIBA 4ZNCD 5HYFA 3WNOA 3BPNC 4FABL 5IQ9A 4DOHE 3PV6A 3KR3L 1FO0B 1HHJA 1FVCA 3NFNA 4K55A 4LCCA 1A8JH 3O11B 4TNVK 2I5YH 3VXTB 5I0ZA 1MQKL 3BOVA 4HF5H 4U6HB 1UYWH 3LEVH 2IANE 2ICES 4OJFL 2J4WH 4C54A 5HPOA 4RRPA 5FECB 3WS6C 2E9BA 2VLME 1W0YT 4LCWA 2ATKB 5KW9H 5I19H 3MUHL 4XMKH 5IGXL 2DBJA 4MAUL 4RBPH 1Q0XH 3DI2B 1G1CA 1S7UA 5DLMH 5MEOA 1F90L 1LHZA 2GTWB 5DJDB 5I1DA 4OFKA 2NR6D 4U6XA 5J06A 1QBLH 2X4UA 1LP9E 3U7YL 4IIQC 4MD5A 3X12B 5JR1L 4HIEA 3BEVB 3WJLC 4FQHA 4J3OC 5CS7A 1OY3B 1FSKC 4TTDC 4PR5B 1VGEL 1MCJA 3V5KA 4HX1A 3W2DL 3B9AA 5D2LA 3ET9F 5C3TA 4RRPG 1BM3H 2ILLA 3W9DA 3OZ9L 3ZZ1A 1P53A 3C09C 2W0FA 3W9EA 3L7EB 2QV2A 2VSCA 4BZ1L 5HGGS 4W68A 4MJIB 2C7UA 2CKBB 5FYJH 3K2UL 5ID1A 1MIEL 3PDGA 2V17H 1Z2KA 3DUUB 5DVMA 5IBTL 5K9OA 3H9SB 4X6BB 3I50L 3PWLB 3VRIA 5IJVA 3DECA 3MLVH 1V05A 3ZSSA 2DD8H 1U8MA 4BK4A 2ZCKH 4UV7H 4JKPH 4G43B 3V5HA 2AK1H 1V3LA 4HZLB 2Q7YB 3FO9B 3HZVB 2HKHL 2X4QB 1T1XA 3CD4A 5C2UB 2P5WA 4F80A 3HRZB 4OV6F 1RHHB 3DSFL 3FB6B 1DQTA 1ES0B 5ANMB 1BOYA 1VKXA 4HIEB 4YHML 4E42A 1S9YB 1XGYL 2J8HA 2YSSB 1JL8A 1RUAL 2ATPB 1RZJH 3D39B 5C6TH 1NUDA 4LK4A 3G6AA 4UMGA 2IGFH 5D7IA 4MJ6B 5ACMA 3LB6C 5BRZE 2NY4C 4LSRL 1ZHLB 5DVNA 4LLUB 3DOSA 4LSTH 5FGCE 1PKOA 3DGCR 4X5LA 1XAUA 2K7PA 2VAAA 1GZQA 3D2UB 5ESVA 1KGCE 1KXTB 4FQCL 4C58B 5GSVA 1HINH 4OD3L 2ZG1A 4FFWC 5DK0A 3P4NA 4PYHA 3MRQA 4RAHA 4RFOH 3WNPA 3WS6A 4A2LA 4TVPH 1CF8H 1PZ5A 4GG6F 2V2XB 2Y07H 3QEGL 1U8LB 3BFOA 3ES6B 3R06A 4NSKA 4JE4B 4QOKD 3BRFA 3JZ7A 2JJUA 3OKLB 3V4VH 5LG1A 4FQ2L 1G9NH 2ZUSA 4MA7L 4U2YA 4LAQH 1L7TL 2D7OA 2YA1A 4M48H 3HAEB 1I3GH 5GRXG 4PGCB 4XX1E 4KXZI 2JJSC 5TE4L 4HS6A 3AS0A 1FVDB 1HYSD 5D7JC 4F7EB 1DBKH 3NFPA 5F6IC 3HI1A 2L0DA 1J87A 3QIBD 4JDTL 3GGWA 3IT8D 3WN5C 4E41D 5T1MB 2R1WB 5C0DB 1RJZA 1NC4D 2EDOA 1YNKH 5LGKA 2R0LH 3VXSA 1HQ4B 5AZEH 1A9BB 1CFTA 4XNZB 2IBGA 3FQXB 3BVNA 2LV4A 4U1NB 2XY2A 4P2QD 4WUUB 4WFGE 5DA0B 4ODHL 4QOKA 3CVHA 5GHWL 3S96B 1MWAH 4L3CB 4HUWA 4NOBA 1ZANH 5IHZA 3GHBH 1FYTB 1JZ6A 1TVHB 3QFDA 4QKXB 3QPQC 4NFDA 4PRIA 3DSFH 2Y36L 2ZUXA 5CFHA 1MCWM 1Z9OA 4JFOA 4PREB 3L3KB 4KK8D 5C7XL 3L3DA 2E6QA 1DFBL 4NZRL 5D7SL 3GSWA 3D2UD 3E6FA 4NC0B 4AT6A 1S7VB 1VGKA 5D1XC 4LMQI 3KPRD 3QEHB 1EZVX 3DRTA 5GGVY 4X6FA 4PRAB 6FABH 2H32A 1DL7L 1Y6MR 4OIBA 4R2GB 4UOW0 4PLNC 1M6OB 4KTEH 5ERWA 3MV7A 1MRCH 2F19L 4NQCD 3O2DA 5E0QA 1BBJB 3SN6N 4GG6A 1EEZA 1ONQA 3PXJA 4LSQL 1UM6L 4H1LB 1I9RL 1PG7H 4ZFOB 1HIML 4KROB 1U8OB 2A9ML 3MACL 4MA8H 3DTXA 3IDYC 1FL3A 3DARA 2ZG2A 4YDJB 4ZNEA 4ONHB 2QADB 3KAAA 1ETZB 2AK4E 1CIDA 4NRXB 2BVPB 5HI4D 4BUHA 3KS0J 1I9EA 1LD9A 2Z0BA 4Y8DC 2XQBL 4PPTA 1G7LA 3QULB 2ENSA 1BD2D 5DLML 4XZUA 4NJAH 2H9GA 1IC4H 5EU6E 1MJ7L 1F3RB 4J6RH 5DJ8B 1MHEA 5EN2A 5FK9B 3WDJA 2HLFD 3UTPD 3GMMB 1S9YA 3U7AA 1HHGA 3DNKA 4RMUA 5GRZA 3SCMB 5D6CA 4Z7VB 5F44A 5D2NC 3MLUH 4Y16C 3V6FB 2DICA 1KPRB 3N85L 4TNVF 4OF0A 4YAQB 5D96B 4DQOH 3V5HB 4O51B 1R6VA 1E4WL 2Y72A 4F7CB 5B8CA 4PJXE 4F8QA 1NAMA 2X4RA 4EI6B 4D9LH 4ZUUB 4MS8C 1INQB 1S7VA 5T5FL 2R0WH 1CL7I 1QLFB 4YHNA 2FH8A 1T3FA 1EVTC 3PP4H 5I1HL 1OT1A 2CKBA 3GKWH 5EBGA 1KPUB 4MNQD 1OAUH 2O5YL 1HZHL 4XCNB 3QIWB 3KPNA 5JQ6H 1T89A 4KK6D 4DTGH 4HLZH 3BZDA 4OZ4A 2YWYA 4IDJH 1CDHA 4OCMC 3GMQA 5B38G 3PL6A 3VGFA 2A0LC 3ARFC 3BP4B 3VI4E 1AD9B 3UTQB 1RZGA 3PHSA 4OB5L 2EIZA 2XPGA 4MZ3A 5HHMB 5HSFA 4BKLB 3T08A 5L2KE 1HQ4A 3QUKA 3RY4A 1UGNA 3GSUB 3U9PH 3VW3L 3VH8B 4UV4H 3NA9H 2GTWA 4NRYA 1MAKA 1T20B 1DN0B 5KBNC 1DBKL 1FP5A 3U1SL 5M95B 2GEEA 1KTDB 3WS3A 4I18C 3IXTA 3IJHA 2NY6B 4XVJH 1Y0LA 4NP4H 2VDOL 5I16A 4MNHB 3GKWL 5FO9B 1JGUL 2Q87A 3JUZA 2YUZA 1A1MA 4Z7NE 2G9HB 1IAIH 5B22A 2B4CL 4E41A 5LQBL 5DS8A 5JHDE 4NJAL 5JHDD 4L4TD 1G7HB 4GW1A 2UZYB 5T1KA 5ICZB 4MA7H 4NQUA 2VDRL 1SEBB 4ZOEA 3VFRB 4KTDL 5KVDH 1MEXL 3IDXL 4F33A 5HI3D 4V1DA 2XG5A 4ZXBD 4JAMA 3GRWH 4WU5A 4LVOB 4QHMA 4PLOB 3TT3H 2MTPA 1LO3L 4Y2DD 1OARL 1OP5K 1OB1B 1KJ2B 1AFVL 5TQ2L 1Q94A 3GGWB 5FUOL 5E4EB 2DQEL 1KJVA 1QSED 2PCPA 5AAMA 2R1YA 1RD6A 4OM0H 3UYRL 1LVEA 1F58L 3F12B 3ZT6A 4Y4KB 4JRWA 2G75B 1JYNA 1FE8H 3C8DA 1IAIL 4C83B 3IDUA 4RFNB 4A6YH 1QA9A 5GISH 5DD5L 3VWJB 2NXZB 3WLWC 1RQ5A 2CO6B 3PDOA 3BT2H 4TUKL 3KXFB 5DRXB 3WHXA 1YN7B 5D7SH 2ID5A 4QRPA 5F1IA 2JB5L 4LQ1A 3L3JA 5F3BA 2E9WA 3T0ED 1XF1A 1VPOL 2QLVB 3D85D 3VRIB 4MLSA 4HMCA 5FYLH 5KOMC 2H26A 2VLRB 1MFDL 3N9GH 1NFKA 3M07A 5C07A 4ZS6C 1SBBA 3QNZB 2Z8SA 3O3AB 2FYYB 3V6BR 2DAVA 3PWNA 4PJ9D 4URTB 4R4FH 1S78C 1GOFA 3BYTA 1NCUA 3OAYH 2W92A 1HH6B 4IRSB 4WNQA 1XGUA 4LCYA 5J12B 4NO0B 1MSPA 2JTDA 4X0KA 4JEGB 4L4TA 3RKDD 4QGYA 3BDYL 1HWHB 3MOAL 5D72H 1BM3L 2R2BA 4X6DF 5KSBB 5C9JB 5EC1A 4JG0H 3MRPB 3MA7A 4D0DA 5TE4H 3HE7C 2AABL 4XPFL 5CWSA 4NQCA 2F74B 3SDDC 4KTDH 5KVDL 5C71A 3JV6B 3T04D 1G9NL 3AREC 3M8OL 4X7FC 3OKOB 4WI7A 1T0NA 5ETUA 3CLFL 3LAFA 1CFNB 5AZEL 3HNVL 3CXHJ 3B5GA 1KV3A 1FNSL 1MF2H 2BVQB 2BRRH 3I6KB 1XGTA 3AY4C 3TBSB 4NWUL 1NC2B 4YEFA 1RSFA 3O6MH 3A6BH 1DLHA 2CR3A 2X70A 4GAGH 5DEGA 1BZ9B 3PE9A 2AXFA 1F6AB 3GB7B 4UTBH 4D3CH 3NFNB 3GMPB 3CLEL 3V7MA 1UZ6F 5F88A 3SKOB 4PTUB 1F4XH 1OPGL 4G80B 2H26B 4Y19A 4U1LA 1DBBL 1LDSA 2APTA 3CUPA 3U30C 4GBXB 3BSZH 1DQJA 3E2HC 2D31A 4NNXB 2VXUH 1UZ8B 3WHXB 3WLBA 1GIGL 2HFTA 5IEHA 5T3ZL 3VFMB 5JOFB 4JG1L 2C1PA 1R24A 1A6VH 1YEFH 2O5ZL 1A6ZA 2ITDA 5F9WB 5CEZD 1LE9B 4AEHH 1CXHA 3BP7A 4I48B 4ZSOA 3EYUH 4HT1H 3FFCE 1AXIB 1NDGA 3H9SD 3HC0B 2V5TA 4NO0A 5MEQA 4M43H 3ILQD 2GCYB 1IKNC 5LCVL 2BOBA 3LHPH 4Q9QH 3GDBA 2MHAA 3OF6D 5GGRA 3CFKB 4QRRE 4HQQH 4JY4B 4PS4H 2VABB 5KAQF 4XC1L 3BPNB 3FQUA 4NKOB 5E8NB 5C0CD 2C3HA 15C8L 1BREA 2ZJSL 3QDJB 4MYWB 1BVLA 2NMSA 1VA9A 4GAJL 4H88L 5LKNA 1FZJA 4PJCA 3W0WD 5SWSA 2ZOKB 3ROLA 5HGAA 4X6EB 4OLVH 3F58H 2NW2B 1CTOA 4QHUA 3CZFA 1QBMH 4WI4A 1I9JL 1KCUL 3BH9B 1UM5H 4WW2F 4WJ5A 5IMLA 5FAAA 3O41A 2JK5B 2ADJB 3QEQD 4L4VD 3RKDC 1JTTA 1SJEB 2Q6WB 3VXOA 1TTUA 4UUJB 4YHLL 3P9MB 5IW1B 3VWJA 2E7BA 4OZGF 1TFHA 3CZJA 5T33H 3BIKA 5HXMA 3NCBB 3DVNA 1D7FA 4FQIH 3BX7C 3FRPG 2ICCA 2QHRH 3IFPA 4PJXB 2X05A 3TV3H 1QP1A 4LSSL 3QXUA 3MGOB 1R0AL 2FIRT 4Y5YA 3KG5A 1WFTA 4I48A 1GZPA 2R1YB 1RUPH 3WJJA 4HCRA 3TFKC 5KSUA 4I5BB 2XIDA 5F7UA 1VEMA 5KW9L 3WDIA 1CDCA 1CU4H 2F54E 1EFXD 5D71H 5IW6A 2VLRD 1UM4H 2P45B 1XR8B 1GGYA 4P2OC 1WGOA 1P7QD 1VFUA 2GJJA 3CUPB 1XZ0A 5I2IA 5EIIB 1HILA 3FONA 4MQSB 1J1OH 4YH6A 2CKBH 1CXKA 4DJMA 3TBWB 4HDIB 5CJXA 3P0YH 2Y5EA 2CJUH 2AI0L 5HHME 1IAMA 3ARPA 3QUMA 5BQ7B 2WSKA 4BFBD 1DEEB 2ICWB 1FCGA 3S4SB 2EXYC 4XMKL 4WWID 1RUAH 4DGVH 2CH8A 1DQML 5J6HB 1B6UA 3O2WL 2OR7A 3EOAB 4F57L 3X3GL 2FGZA 4EUPA 1PLGL 1FZOA 1QLEH 3VDCA 4F15C 3IS1X 4ZAKA 4DZ8A 1MQKH 3MUZ1 4ODSL 3SDCC 3B5HA 1XF3B 1BIIB 4OTXL 3UBXA 5IHUH 2DDQL 4KI5F 4NRYB 4XC1H 1HEZB 4WWKC 2P8LA 2B1HL 1J8HA 3OR6A 4IRJA 4NC1C 1A7RL 1SY6L 2EE9A 4WUKH 4YDLB 1WBZA 1KIPB 3AAZA 4JCMA 3STZB 3MA7B 3L5XL 2GJZB 3MRPA 5HDQH 1N3NA 3UTQA 3CMOL 1PQZB 2X2YA 1CD9B 5C07D 5AD0B 4UT7L 1E28B 5F97E 4LEXH 2ZCKL 1MIML 3VJ6A 2FX7L 2YC1A 3H9SE 3BAEL 3ILPA 5A2IH 1PX3A 4LRIA 4QRRA 3U36A 4F3FA 1U8JA 4ENEC 1XF4B 5I18H 1A47A 1KIPA 4Z7UF 1A7PL 4YFEA 1NBZA 2A83B 3LZFH 1PEWA 4WHTA 1HHHB 3SDCA 2HFFA 5JNYB 1NSNL 1MCRA 3CSGA 5C0BE 1RUMH 5E94B 3BRDA 2NY0D 1A14H 1RZIB 1T5XA 3DMMA 2YD3A 5KSAC 5DHYA 3I84A 4XVTL 4NN5C 2FO4A 1ZT4B 5E95B 1MAML 5F7EL 5DD6B 3MV11 5GRWA 3QFJE 5CIPH 4YUEH 1M4KA 2XT1B 3NABH 3B9KB 3KLSA 1Z3GH 3C6SB 3JTSB 2FIKA 1A6UL 1T66D 4MNGA 3T77B 3UZEA 4QEGA 3D87B 4LSRH 4RX4A 1GOGA 4JM4L 5CP3A 4PGDB 4DOHB 4B50A 3F62A 4XB7A 1RMFH 1JGLL 2V6HA 2X4NA 3ULVD 1FBIL 2V5RA 4YHPA 1AGEB 4FRWA 5IGXH 1MHHB 1X4ZA 2APBA 4P2OB 3O6FA 4NNPH 5FKPB 3NIFF 1Y6KR 4AIZB 3T0EA 4GRLB 2UZIH 1DUYB 3QJFB 5C08D 1A7QL 1A02N 3CX5K 4N8CH 1BBDL 1FSKB 4S1SH 4U1MA 1CGSL 1F8TH 5C8JB 4EOWL 3QEQE 3LQAC 4K7FB 1G7PB 2DM2A 1F3DJ 1C8PA 1KCVH 4Z95L 2Z91A 3RDTB 5K9KA 3MQIA 1JFQH 5FO7B 2Z8VC 3PWUA 4GO6B 3BPOC 4W4OC 5EG6C 2B39A 2AJ3B 3VFTA 1BOGB 1IZJA 3H9HB 4GW1B 3VWJC 5K33A 3V6ZA 4ODWA 1MCDA 1JI1A 4HIHB 1MI5A 1F6LL 2FEDC 5C09B 4JGMA 3SPVA 3ULUC 4HKBB 2RQ8A 4WTWA 4LL9A 1CE1H 1KPVA 4LAJH 4YDVB 1I85A 3AMKA 2Q6WA 4DFIA 4YXLL 1ZS8B 2FECI 3RZCA 3HB3C 4P2OD 2IEPA 4J3VA 3MXWH 5IMLB 4Y16A 1ODAA 5DRNA 3L5XH 1UT9A 4BH7A 5HDQL 5T1DH 5GRYA 3GJEA 4K8RD 1TVBB 4I0PA 1X4XA 2MKWA 1T2QL 2A9NL 1BF2A 3HB3D 3RJQB 3ARDD 5LXGL 3ZT5A 4LRIC 3CX2A 3L9RB 1YECL 4UNTA 5CEXA 4MA3B 3SO5A 2IH1B 4K7PX 3B3IA 3ULUD 3F7VB 1KXQE 4MAUH 1N7ML 3C8HA 2JJTC 3SKMB 5K9QG 5T3XL 4ONGL 1HXMB 2A1WL 3HI1B 3KPMB 5A2JH 4P4KA 4GMTL 1KELH 4NWUH 5D7LA 4XP6H 1AQKH 4H26B 1D5BA 5DF0A 4TULH 4EI5C 5FV2A 2DF3A 3O9WA 4JO4L 5DUPH 4GKZA 3QDHA 5GGTL 2R1XB 1EUTA 4JFQA 5ISZD 2XN9B 2B4CH 1HCVA 4AQOA 3PQYD 1G84A 1U8LA 2C1OA 4LSVH 1AHWC 5J56B 1QEWA 2BY2A 5DMIH 4PTUA 5IK3A 3S4SG 5DYOA 1FNLA 4Q9RL 1I4FA 3DVIA 5D72L 1S7RB 4YHZH 3QP3A 4C56E 3G5ZB 1P1ZA 2ZUQB 1C12B 1OWWA 4LEOB 4YBQD 2PYEB 5GIRA 2ERJB 4NO5A 1GGTA 1MJUL 2CK0H 4TOYH 1ZA6A 4C4KT 3DUUA 2XICA 4PRPB 4NFBA 4AM0A 3IXAB 2YD4A 4HPYH 2W9EL 4XXCC 4HG4J 4JFDA 2EXWD 1CFNA 4Y8AA 5ELIA 2K3TA 2IANB 4FQXC 5CCKL 2WUBL 1AKJD 5CIPA 4Z0BL 4OAWB 1RZJL 5FA3A 4EIGB 1K6QH 3FOMB 3ZTJG 4KJWC 3DIFB 4O02L 4N90D 4QT5B 1MY5A 4RSVA 1ZKAA 3EDDA 1VESA 1ZLVK 1ORQB 3HRZA 4FFWD 3U2SA 4CN1A 2F8OA 3FO9A 3HZVA 3ZDYE 1OGTB 2YPVL 3MV7B 5HGBA 5IBLD 4LBEA 3PNWA 4JANA 1KTRL 2AJSH 3MXVH 3KYMA 3ZDXF 1KB5B 1MCCA 1RIVH 4JRYD 5CD3B 2E7MA 3LH2H 4TYUA 1UWEH 5KANG 4FQ1H 1S7XB 2C26A 5INDB 4HHAA 2CMRH 4R8WL 4U2ZA 4DQOL 1WFNA 1J11A 4IS6A 4OI9A 2OJZL 1QFOA 1KLFA 5F3HA 5FF6A 4JZNA 1A6VL 1JGEB 1BWMA 5C0FA 2XWJA 1XT5A 5E1AB 2VDNH 3OB8A 2EC9T 3UTPE 1CLOH 4YK4C 4LSPH 4HGMA 2XA8L 2V5SA 3D5OF 3QEUA 1FVEB 4X7CC 1GCFA 1TVHA 1KB5A 5IB4A 5H37H 3DSNA 2VXVL 3G6JE 3V4PH 5E56A 2C4XA 4M48L 3L6FA 3S96A 3GJFK 4YWGH 1BVZA 1SEQH 4BM7A 1KYOK 5CINL 4S0TD 3TN0A 4NUGH 5FKAB 4F7TA 4MGXA 2LQRA 4YBQC 2ZG3A 1JHLH 4WUUA 3B2VL 2AK4D 2CLZA 5CJ5A 1OF2B 3OL2A 2OI9B 1AIFB 1UG9A 3EDJA 1LO5B 2HFEB 4JJ5A 2QR0A 1TITA 2X4OA 5CIPB 4ZOBA 2VZVA 1U3HA 1WBXA 5E00B 4HH8A 1XIWA 1KG0B 5F7EH 2AJZA 2XWJB 2A9MH 1GHFH 3MACH 2QSQA 3TWCL 1MCFA 3UTSE 2E6JA 4X99A 3BH8A 2ICWJ 2WWKO 1MLCA 4L3EB 2AEPH 3QUYC 1M71B 5F1NA 3CDGA 5FYJE 4EI5D 5GGQL 1NGQH 2DBLL 3W39A 1EHAA 1UWGH 4MJ5B 2YZ8A 4F33B 1YECH 1N0LA 4LCCB 2H3NA 5I8EA 5GS0L 1JF6A 3U0WH 4KGLA 4GW4B 4XVSH 1BZ7B 1ZLUH 3RVWC 2HLFC 5DC4B 2B1AL 2AK4A 2UWEE 1WEJL 5E6IC 2EH7L 1Q9KA 5AUMB 5L2KD 5JIIA 4EVNA 5JZ7C 4C4KO 3IF1A 5SV3A 4XCYB 3C5ZA 1EEYA 2VLLA 4J3TA 1AGFA 5SX5H 5E99H 1LP9F 5FO9A 2EKSB 5E2WL 4D0CB 3ARDC 2N1KA 5CEYA 1Q72L 4WWKB 1I8MB 1Q8MA 5EZIH 1YMHB 4TPRL 5I6XC 1MVFA 2BNQE 4PJEF 5A43C 3Q6GH 4QYOA 4P46D 1L7IH 1UEMA 2VISB 3O9WD 1HXMA 2IPTL 5EZOH 3ARFA 1FRGH 3NPSB 3CVIH 5J13C 1U95B 5ENWB 5EUKA 3CFCH 4ZFFB 4OSUL 4XBPA 3HI5L 3S6CA 3B3IB 5IHLB 2NYYC 1P6FA 4N0YH 1CLZL 4OLWL 3GFUA 5DQJA 5I1KL 1C1EH 5CBAB 3HS0A 1FPTL 2AP2A 3UCRA 1IAOB 1RJYB 4PLJD 3BN3B 3VXNA 2XN9A 5DDHA 5F7HA 5I8EB 4QOKE 4PJHF 4FP8H 4LHUA 2Q3AA 3TJHC 5B8CC 1EHXA 5DFTA 2EDFA 1GAFH 1RY7B 1G0YR 5CP7A 3NZHH 4P5MA 1FJ1A 5DRNB 3GJFH 5D9SB 4GKOA 2AERT 4FXLA 4L3EA 2WANA 2K7QA 4X6CE 4P5TA 3S35L 3ORJA 1IGJA 1D5BB 2DQIH 5C09E 5MI0C 1OAKL 1YNTB 5E9DE 1QRNE 3HR5B 2EXWC 3DHMA 1FHGA 4HAFA 3V5KB 3GMOA 3GSOB 4ZMAT 3U4BH 4L4VE 4PJHA 3U6RA 1P69B 1OW0C 1WWWX 1P9MA 3WFEH 4Q9BA 3ARVA 3BPLC 2YK1L 2HJFA 5FV1L 5IB2B 4JFHE 3GJFA 5C6WH 1IZKA 2FCBA 3DYPA 2I5YL 5E7FA 5B21A 2P8PB 4D9RD 2Y6SD 1IGFH 4XT1C 4NCDA 3C9NB 1MRFH 1A5FH 1IILE 1FQ9C 2GK2A 3V7AE 1CLCA 4MX7A 1OOAA 1O0VA 5ADPH 2BOCB 3BZ4B 3MRNB 5ID0A 5KSAD 5HY9A 3BIAX 5FKPA 2CUHA 3OKMB 4U6YA 1ND0B 4U0RB 4IRJC 5BRZD 2R0ZL 4PGJA 4CW1B 2C3XA 3QQ3A 2WIIB 3F6LA 4U6HA 5FFLA 1MREH 1WTLA 4KMQA 1FLRH 1ZEAL 4XP4H 4F37K 1EEZB 1WCBB 4JKPL 1RK0B 3V7AG 2VR5A 4PJDE 1N2RA 5D7IE 3GIVA 5C0AB 5DJAA 4WFFE 4HQQL 4ODWB 4P23A 3T1WA 3MLSL 2R56L 2PO6C 4OF8A 1TENA 2Z91B 3IYLW 4G7YL 3T3PE 3L3GB 4AT6B 2NX5B 4G42B 2PXYC 3L3IB 1QHOA 1EAJA 3HLAA 5CJQL 3T3MF 5F89A 5J89A 4D2NA 3QUZB 4F3FB 2PYEE 2DQTL 2JCCB 4FXGB 4YPGA 3SDCD 4ZDHB 3SDAD 2GITB 4XBGB 3D1MC 2WQ8A 5FUZL 1OHQA 4OLZH 5B38B 3C9NA 2J8UE 1A6AA 2R0KL 4RBPK 1EHNA 4M62L 3BWAB 2F54D 4KK9D 1S9KC 1UB6B 4UQ2A 2FEDD 4Y7MA 3QNXA 2Q3ZA 2GJZA 1DDHA 3N06B 3JSSA 5DD3L 4OZGE 3CVIL 3BUTA 4KVNL 1FL5B 1QKZH 3RVTD 4AENB 4MXWH 2HVKA 4HWEL 2DJ4A 3TH2T 1PD6A 2VR4A 3UROR 1T5XB 1LP9A 4ZS7H 1P84J 2P8MA 5ACLA 4KWUA 3WFHB 1PGRB 4Y2DC 3QBTB 1KEML 3FT4B 3S88L 4XPAH 5EZLA 3ARBA 4NUJA 3C60C 1LO0H 4LHUB 2A77L 5HYSG 3ILPB 2F53B 1J9CT 3PGCB 4P4KB 2WNGA 2W65B 2VITA 3EOYG 2W60B 4YDLC 5JLZA 1VACA 3RRQA 2ADGA 4IMKA 5DFVD 1JGDB 1SJVA 3KLAA 5ICYA 1H5BA 2H8PA 2R29L 3SJVA 1W8OA 4OQ1A 2BCKB 3T0EE 5KG9B 4K3HA 1EXUB 5ID0B 1FGVL 3RFZC 2UUDH 3U9UB 1F97A 1OGAE 2CXKA 1U95A 4LLMA 4GAJH 1CVSC 5C9JA 3ULUL 3P0VH 1JPFA 4X6DB 4CUCA 2NY4B 2DIBA 4I1NB 5JPNA 1WT5C 4IRJB 4IMLB 4PD4K 3IDGB 3FFCD 4WY7H 2CDEB 2FJHA 2XKSA 5E8PA 1JHKH 3RWEA 3ARWA 1NANI 3UBXB 5DJ6A 3DUSB 3SCMD 4ZYKB 3ZL4H 4PGBA 2X1XR 1HK6A 5JA9A 2P46B 5CMAB 1D5ZB 4E9LA 2ESVA 3AREB 3ARGD 2VC2H 4D0CA 5J0BA 2VLKE 1H8OA 1AH1A 1HNGA 1HH9A 1JF1B 2AXJA 1N5AA 2FLBT 5EU3B 4YXKH 3ARBB 5IR1A 2E27L 1II4E 2A0LD 3ARFD 3V6OE 3MLTB 1KEMH 4IOSD 3EJYC 4P3DB 5DVLA 4UTAH 2K9UA 1CXIA 3OKEA 4HIHA 1SEQL 4HBQA 1QSFA 4JM2B 4PV9A 2WBWB 5BVPL 4N9GA 4AK1A 3IJSA 2JIXA 4OZFH 4OKDA 4P48A 4LU5H 5MENA 3DV4A 4FZ8L 2E5EA 3UDWC 2P24B 1BX2B 1F4XL 1YY8A 3V5DB 5CILH 3S34L 4OGAD 3QDJA 4LHUD 4PJIA 3GI9H 1GH7A 1QFWI 4S10A 5GS1A 2E8YA 3QI9C 4GBXC 5E2UH 1JNHA 5TDOA 1OAQH 5E00A 5GGRB 5F7DA 4Y16D 3WSQH 4YQXH 3DO7A 5DJ0A 1DE4A 1K3IA 2X10A 4HS3A 5EUOF 4HUNB 1IGCH 2VKXA 3LV3B 4M61A 3KJ6L 5EO9B 5F9WC 3HC0A 5MEQB 1YPZE 3FT3A 3DV6A 5EU4B 3SDXE 2DIJA 2OL3B 4ZSOB 4DUXA 2OXHA 5E5RB 1MHCB 4CNIA 5FUCC 1OWRM 3RWJA 3O6LL 2QQNH 2C1PB 1CFSA 5BV7L 3OKKA 4LASL 2P48B 1BQLH 3FQRB 4PJEA 4I9WE 3C8KB 1U3ZA 1KYOJ 1FYTD 4L9LC 1KULA 1DQJB 1N4XL 3VE0A 3RVUC 3N50A 4RFNC 4MJ2A 4EVNB 1HCFX 1A7RH 3HC4H 5KN5A 5L2JB 2WW8A 2RCSH 2J2ZA 3QUZD 4X4YA 3FQUB 1V7NH 4NKOA 2VABA 5FYKD 2GAZA 3O4LE 4C56D 1IC7H 3QUXB 3CFDB 1NLBH 4OZFB 4XBEH 4UT9L 1YMMA 2WIIA 3V52L 5DTFA 3PHQB 1T1ZA 2Z31A 1G7JB 1SM3L 3WXVL 1ZT1A 4X7TB 4JJHA 5T5NF 4X99B 5H35B 3MREA 4V2CB 1AR1D 3TBSA 3KLHD 3FCTB 4L1HA 3BQUD 4M6ML 1BP3B 1PVHA 1TQBB 4G8GE 1T1YB 3TZVB 2HTLD 2ZUTA 2DKMA 4ZTPL 4OCLC 1IQWH 3UC0L 2YR3A 3P9WB 2D0GA 4L8DA 4NRZB 1T04A 2PW2B 3OKKB 3P4OB 3ARTA 4ZUVA 3D9AH 4OLZL 1MVUA 4P4RA 2ITCA 3MYJA 1JHLL 5FDWB 4Z78A 4LPVA 4U1LB 1TJIH 3WFEL 2EO9A 5EU6D 3S8WA 4PJ7B 1JPTL 1JMZA 1CFQA 2OP4H 4ZAKB 4EUPH 5DT1L 5HI5D 3HAEH 4FQJL 5F9OH 2HKFH 4JM2C 3WLWD 4BSVA 1GGCH 5BZWB 1QR1B 5FUOH 4G8GA 1T0MB 4DUWA 3W81A 5DWUL 4YNYB 4ALAL 6CGTA 2AXFB 4M4PA 5KSAB 4FQ1L 4M6OL 4XCFL 3ZDZF 4M8QA 3BKMH 1KOAA 3TT1L 4KKBC 2P24A 3K1DA 3MFGB 3O2DL 1MJ8H 1I1RA 3SBWA 4O5LL 1MCSA 4MVBC 3EO0B 1A6WL 2CPCA 1T22A 1OP3H 5D7JD 1MWAA 1FZMB 2FECL 1TJGH 3QXDB 4N9GB 3T3PF 3PP3H 2XTJC 3P30L 2R2HB 2DQFB 1IQWL 3MV9D 5FM4A 4CU8A 1HOCB 5BZWA 3QXWA 4GBXD 2ZNXA 3T2NH 3QI9D 2BSED 3V0WH 5HHPA 1RI8A 3NTCL 4BZ2H 3LKSA 2VXSH 1C5BH 4ODXA 3E2HB 3V95A 1CZ8H 4XI5D 5EC2B 2NX5E 4I2XA 5HHQB 3HN3A 5E08L 1WC7B 2VDLH 5IF0A 5I1CL 4K71B 1IEAA 4ZD3H 5DRWA 3TPKA 4JFDB 4KTEL 4OLEA 4R0LC 2R23A 4X6DA 5DJXB 5IFHH 4L8DB 1CXFA 3NIDE 3IKKA 2BZDA 2W1NA 4F7MB 5FOBB 3O45B 5IT2H 1U91A 1D3CA 1RU9L 3HG1A 3DROA 5E6ZA 4YE4H 3RWDB 2BDNL 1I4FB 2VWEC 4L29B 2QQNL 5HYJE 2MNUA 4RMRA 3TO4A 4Z76B 3FJTA 5IK3B 1Q9LA 1FAIL 1FZJB 3ARGC 3ZKMC 2LAGB 1MCQA 2VDML 2CJUL 3RTQB 3F7PC 4ZUWB 5L8KB 1FO0L 1IARB 1QTYT 1MFBL 2G60L 3NZHL 3NZ8B 3SE9H 2R0WL 1MFEH 4J2XA 1RURH 2DLEA 2CIKB 3F5WB 4I3SL 2AQ2A 5KN5B 1MLCB 1NGYB 4X7SH 5A40E 4P3WA 3LKPA 4K94C 3VFTB 3V6OA 4KK6C 4QRQB 4JZOB 4LNRA 1WWAX 1S3KH 1T1WA 4HGWA 4U1KB 5TDNB 3RY5A 3S34H 4GQPH 5A2KH 3KPSA 1FYHB 4PJ9C 4RZCA 5TGBA 4M02A 4ERSL 4JJ5B 3OPZH 2Q1EA 1ZV5A 3WV0A 4XNXL 2MFNA 3MGAA 2JJVA 2YPLE 2HKFL 5TE7H 3S35X 3FB8B 1E6OH 5F1KC 3S37L 1DBAL 3T0EB 3QUMH 4PV8B 4KUZH 4MB4A 2UY7A 1NCCL 4H1LH 1AGEA 1IFHL 1QNZH 4Y19B 1CQYA 2V5YA 4HS3B 4MJID 4PYGA 1J7VR 2MWCA 2QSVA 4N0FB 1MFBH 4PUBH 5TDOB 5SWZB 2BX5A 1QBML 1HHIA 3GJEB 2CLRB 3QIWA 2LTQC 4F9LA 5FF6B 4G7YH 1B6DA 1RZKH 4CDHA 3KYOB 3RL1B 1DLHB 4J3UA 3GO1H 4P57A 4G6FB 1G7MB 1P4LB 4EXKA 4CBPA 4HFUH 3O8XD 3G04A 5DUBA 4KFZC 1FN4A 1TTGA 2Q8BL 1HQRA 3HI6H 3PL6D 3DHJA 3GM0A 4AJ0A 1T7VA 1T0NB 5A2FA 3KYMB 5EO0B 1JGVL 3C60B 4OUUB 5DSCA 1J12A 1R5IA 3MJ9L 4ODVL 4XNYL 1BF8A 1FGVH 4GKNB 4WHTB 4M6NL 5CZKA 5EORH 4ZXBB 1ITBB 2D7QA 5EBLB 2JB6A 1YYMH 4P2QE 1I8LA 3G5VA 3TYFB 3GMRB 3ZT7A 4PP1C 4C57C 3V0VB 2FNBA 1N4XH 3P4MB 4JFZL 4BJLA 3LPWA 1E28A 2EECA 3D0VA 4JFED 4JVPA 3DUSA 1AGCB 4C56B 4OCXL 3ROOA 1UEYA 4JRYB 4V1DE 5LBSH 4FQQA 2C3VA 4OF7A 1D9KC 3BUYB 1F4AA 5J1AB 2YWZA 3NN8B 1MCPH 5GQBA 2N4IA 1M7XA 5CJ8A 4PRPE 1FIEA 1LMKA 2Q8AH 4P2RB 4WW1B 1CD1A 2OZ4H 3VMNA 4FFZL 3ARGB 1A6UH 3WNMA 2OXGA 3GK8H 3EBAA 1ZOXA 3EYQD 3MODH 3VA2C 2YHGA 3QPXL 1CL7L 5C09D 1MFAH 5F7MC 1H8NA 3Q48A 4JRXD 1TETL 4M7LT 4LIQE 1N8ZA 2DYPA 4PJEE 5DRXA 2ADGB 1PSKH 1IL1A 1J8HD 4EZMA 5D6CB 4WTZG 5SX5K 1X5GA 4LLQB 5E8EB 1RZIA 1W8NA 3MLXH 5IVZB 2CRYA 1QPPA 2EDQA 3MRFA 4RA3A 4GKZB 3SEPA 4L9LA 1MHEB 2IPUK 5EN2B 3EFFA 3EGSB 1MELA 4ZQKA 4TULL 5CP7B 3IDMB 1E6JL 1P4BH 2ZUQC 5TE7L 3TBWA 1L6XA 4APQA 2X44D 2UVEA 1B88A 1LD9B 1ZLWK 5E1HB 4P23D 2EDEA 1F90H 3QIUC 4PJ5D 2HRLA 4HC1H 5DFWH 1KJ2A 1KJ2H 1G6RB 4JRXA 3K2MC 5D7KD 5DVKA 4RFOL 1DLFL 1G6VK 4YXLH 4WVRA 3K81A 4OLXL 4NNYA 2RB8A 3G5VB 3ZE2F 2YN5A 4N8VA 1QFPA 1RURL 3T2PA 3L95A 5IJKA 3ARFB 4X9IA 4X4ZA 4HD9A 5ERWB 4Z7WE 4WFFD 4KDWA 4X6CB 3CFJA 3X3FL 1T5WB 4HPOH 3QQ9C 4PRHE 5C0ND 3GIZH 3CDYA 1UXWB 4QHLB 4TSAH 4MAYD 12E8H 4PJHE 4UILH 4JQVA 2VH5L 1T7XA 2WUBH 2H2PC 2Y9RT 1QRNA 3FB7B 1D9KD 1KF9B 3O3DB 3BDXA 3REVB 3L3KA 4JGUA 4PREA 3FQNA 3SPVB 5MEPA 1I7UB 1TCRB 1QSVA 3UTSB 4X6CA 2XWBB 3LKRA 4YGAB 3H9HA 2PTTB 3G6DH 3TA3B 3S36X 1K8IA 3L95B 3LVEA 3E8UL 5IMKA 3NGBC 3RUGF 1FNHA 1RZGB 4JHWL 2GW5A 4JO2L 2UZXB 3ZYIA 4DAGH 2UWEB 5CEZE 1LO3H 2AVGA 3A6BL 3TT3L 1UACL 2Z35A 3WIFA 3VXMA 3K3QA 3BZFA 5EZJA 5D7IF 3BP7B 5GJTL 1N7MH 2WAHA 2BOCA 3BZ4A 3N1QC 3EFDH 3H6JA 3D69B 5L6YH 1UCBL 2A73B 4XPBH 3MCKA 4A6YA 1RUQH 5D1XD 1N6QL 1SQ2N 2BFVH 3KNBA 5IV2A 1NAMB 4HS8L 3S5LB 1MCOL 2CLZB 4OD2A 2DI7A 5BRZB 4BFEA 1E6OL 5CHNA 4ELKA 2A6IA 5F72S 5FGCB 2Z31C 2BERA 1QO3B 5LGJA 2HJLB 4GRLD 3HNTL 1K8DA 1UCBH 5J6GA 3UPRA 4PJAB 2J88L 4JFFA 4UIMB 5IIEB 2WBJD 5LAXB 2GUOA 2EDDA 2JCCE 3PWLA 5KANI 1UXSA 1UACH 5HHOE 3SDAB 3SHSA 3BGFC 3SDCB 1F4WL 3OG4B 4WV1A 4JKMA 3I02B 1RUKH 3WN5B 3NN8A 3RP1A 3MZTA 1DUZB 1IGYB 3QG6B 4Q2ZB 1R3IL 3OQ3B 4R90H 3NCJL 1ZLSH 1IBGL 3M17B 4OTXH 5GS2H 5IF0B 4M1CD 5DO2D 5EU7E 2BK8A 4CAGA 3F8UB 5J3HD 2V2WB 4IEFB 3RWFA 1GOHA 5SWSD 3AM8C 5E9DB 2I60H 5FYKL 5I66B 4QO1A 5TDPA 1VENA 4L4VB 3V52H 4OAWA 5J13B 3ZKMD 4NO2B 4XXCA 4HZLA 3A6OA 2FGWH 1JV5A 1D5MA 4OUUA 5KVMC 3OMZA 3TPUA 1O5DT 4L8BA 4TOYL 3MV01 2NY1D 3UJIL 4MD0A 3EAKA 2LU4A 1CBVH 1ZAGA 3SOBH 3D48R 4R97C 2WINA 3GB7A 3DURB 1YEDA 3L3DB 4UBDD 1P1ZB 1E27A 5AZ2H 4Z5RA 3TYGH 4UOJA 4ODBD 3T09A 3IDXH 1GC1C 1AI1H 3VXUA 4KJWD 5KVEL 5TPWH 5ABDE 2HJLA 4NHUA 3EDEA 1BHGA 2DLFL 1MUJB 4NBZB 1H3UA 1J1OL 2OS7A 4JFFD 3JV4A 5T3XE 4JFXA 3MMEB 4KRLB 2VQ1B 2NZ9C 2GFBA 1A3QA 5DURB 5I74B 2H6PB 2G75A 3RL2A 2F74A 2R1WA 5C0DA 2ENYA 5CSZB 2A74B 1HKFA 4HH9A 1N6UA 2XYCA 1KJVB 4RZCB 3DLQR 4FQCH 4HIJA 5EO1A 1VFBA 1HDMA 2OTUB 4MMZC 4LNRB 4U1KA 4BQ6A 1OAZL 3SKMA 4QTIH 2DOCA 1JPTH 4QNPF 5IHBA 5ALCL 4J3XA 4MDJB 3MFFA 5C2BH 5BV7B 5JW3L 1T1ZB 2HMIC 1ADQH 3VFNB 3M17A 3OSKA 3HZYB 1FRGL 3QCVH 1INEL 3V6OC 4F7TB 2ICWI 1DBJH 1H5BC 1QOKA 2VDPL 2A2QT 4IOIA 1S7QB 4NM4H 2N56A 4G8EB 4OZIE 3HZKB 4M43L 2HT4D 5BCAA 1F2XK 1V3MA 4Z5RB 2FX8L 1AJ7H 4PJFB 4UDUA 4RAVB 3L3JB 4PP2A 3U4EA 1YEDB 1FAIH 2BVOA 2WP3O 4F37F 4OZGB 4R7DB 5LGJB 1EGJA 2ZJSH 1IGIL 1W0VB 12E8L 1D6VH 1GIGH 5HYSA 1S7QA 4R26H 1TPXC 3QO0B 2FX9H 5DD5H 4FNLH 3TZVD 3LDBC 4KK5D 2EDXA 4O58H 3KPPB 3UBXI 2AJVH 2ZCLL 5EFIB 1AR1C 4OLUL 1MJUH 4NN7B 5DJYA 5IB1A 5KS9E 2PXYB 3VD7A 5DJ0B 2AJ3A 4JFPB 3VFVA 1S7WA 2W07A 3MUY1 4KUCD 2EIZB 2XPGB 1T7YA 1S7SA 4HIJB 3E0GA 4QRPD 3U0PA 3GRWL 4PJBB 1DQDH 1P2CA 3MRBB 2DQFA 1CFBA 4QGTA 4NFCA 2H6PA 3WLBB 2VXUL 1X5JA 4I18B 5DJZB 1ED3A 4Y4FC 3W11C 1UWXH 4DK3A 2DTML 5I1JL 4R97B 3S36L 1W72L 2CKBL 3D3VD 1ZLVH 1DVFC 5IMKB 5KZCD 4I3RH 1XH3A 3I02A 4GXUM 4YR6B 1B4RA 4NJ9H 3VWJD 4QF1B 1ZVHA 2AABH 2IBBA 1BZ9A 2IAMB 3O4OC 4HUMB 4PJAA 1RK1B 4FTVE 1Y0LB 1M7IB 1XGTB 3I6KA 2KZ1B 2AQ1A 3JWNC 2BY3A 4TQEH 3UTOA 1QLRA 4LVOC 1LE5A 5AYUH 3T3ME 4NQVB 1U8PA 1EIBA 2XTLA 3SCMA 1EJOL 1KB9K 3MRHA 5DK2B 2NCMA 4MD5B 3X12A 5E94A 1HHGB 1D5MB 3O3EA 2RR3A 4PY7A 4UIKH 3GSUA 3ARUA 5EBMB 2Q8AL 3FFDB 1P7QA 2W59A 2NW3A 1X5AA 5I66A 5E5MA 1T2QH 2A9NH 3MRCB 4Z0XB 1UJ3B 1IQDB 1MI5D 4FQXB 4XHJD 3VJ6B 4AEIL 1AD9A 1I7ZA 1QRKA 4HJGA 3WUZA 4L4TB 3G08A 2ZSWB 3DYOA 4JPWL 4PBVC 4LHJB 2W60A 4JO1H 5JLZB 1Q38A 2EYSB 3MA9H 1LK2A 3R8QA 4OZHE 2NXYC 1TIUA 3FZUC 3MLSH 4OZFA 3TYFA 1EBPA 4U7SA 1AC0A 4TRPL 1H3PH 1WBZB 4NKMA 4LFHD 5I73B 5IQ9B 1OAYL 3PGFL 5IB3A 3K4DA 2YA0A 1J8KA 4JFYA 3K2UH 4D9RE 1KN2L 2VXQL 4LHQB 4HUXB 2FL5B 3LN5A 4XVUC 4QY8B 5JW4Q 1OTSC 4HXBL 2FD6H 3RX7A 4P5TC 3MNVA 3QUXC 2D0FA 8CGTA 2XTJE 4U1JA 3G04B 1G9EA 3BT2L 1NANH 3PABB 1I7TA 1OARH 2A6IB 3DBXB 4MD4B 1FG2A 4AIOA 3NPZB 3BSZL 4LSVL 1C5CL 1KB5H 3S88H 1DVFA 1A5FL 2CLRA 1CT8A 4CDGC 1E4KA 4M7LL 4JFDE 3N1FC 2OK0H 1OCWL 3JWOH 1HE7A 2VLRE 5DFVC 1DE4B 3IDYB 2F8VA 5GZOD 5TPWL 1M7DB 1KIQB 2EICA 3O4LB 2ZUUA 2QKIA 1KBGH 2WBJB 2NZIA 5GS0D 5FO7A 5CD5D 4YPGB 5EIIA 2AV7A 1WZLA 2XG4A 3ETBF 4EUPG 4K3DH 3BZFB 1S7TB 1G0XA 1G9NC 2AXGB 5E24E 5H2BB 1OAQL 3D0VB 1UVQB 4WGVB 4PTTA 3OAUL 1HXYA 5F7KC 3EDKA 2XZAL 3L3GA 2OL3L 3CH1B 5B3JE 2HN7B 1NKRA 4MQ7B 3DV4B 1U58B 3EYVA 4BSWA 3CFCL 1MCLA 3TV3L 4HLJA 5GGUA 4GRWF 4LLYA 4JFPA 4Y5YB 3UDWA 2CR6A 1NAKL 3VG0L 5GS3A 3OKNA 4ZQKB 2EXYD 4KAQH 3KPTA 4PLKD 3MRFB 3DXAB 1FFNB 2YZ1A 1B0RA 4NQDD 5KOVC 4IOFD 3SDXF 2FX7H 3UTZB 2VZ3A 1AJ7L 4X80H 1CGTA 3EYSL 3WFZA 5TF0A 4X4MA 4I0KA 1NCAH 4JY6B 4UT7H 1ORSB 4IM8A 4UAOB 4PB9L 5I1LA 5ITBH 4Z8FH 1FNEB 2EYRA 3B8SA 2HRPH 2LVCA 5CZXC 1IVLA 3FMGL 1INEH 5I6XB 4XTRD 5ESVB 1YEJH 2ADFH 3H7BA 3LRSB 4G9FB 4K7PH 1IKNA 4G7VL 1MIEH 1YNKL 2P8PA 4TVSa 5EZIL 2J3SA 1CK0L 2GY5A 3EYUL 3WFBH 5F8QC 4NZTH 4TVPE 2ZP0T 3N85H 3MR9A 1IAKB 5E99L 3HNTH 4OQTA 2YXMA 5CJBA 1X44A 1CGSH 2DIAA 2P43B 1EX0A 1N3NB 5IVXB 3KS0H 4I0PC 4EN3C 4D94A 1E6JH 1P4BL 2FRGP 1GXEA 1ITCA 1MI5E 4ELMF 4NNPL 3NCCB 1EFXA 2AKRB 3RKPA 2X4RB 4IRJD 1FH5H 4XPHH 1CYGA 3QDME 3O3EB 4JQXA 4BELD 5GGTH 4PJGF 2ORBH 4OM0L 5KVEH 5E5UB 4HWBH 4CADB 2WUCL 3KJ6H 3EO0A 4H25B 3S36H 3FT2B 3TCLA 5CAYB 4QRUA 1AQDA 1FL5A 3HZMA 4OZIB 2VN7A 1CLYH 4NC1E 3WFDL 4EBQL 3OJMB 4M5YH 4ELMA 2C7UB 5AAWA 2SEBA 1AC6A 4HJ0D 5TF1H 5IWLA 3QHFH 3PHOA 1P5UA 2CKNA 2Z93B 2ZKHL 3RWIB 4MNQB 1C16A 1DANT 5FOBA 4LSSH 1A6AB 5C70A 5C86A 4Z7UE 2B0SL 4DKFH 1DSFL 4K07A 2YOCA 5J9PB 1IC5L 3TO4D 3VRLF 1R0AH 4NBXB 1OVZA 1KN2H 2VISA 3BUYA 1GGIH 4MNGE 3MTRA 3LZFL 5DJCB 3MYJB 1C08A 3BMVA 3QFJA 3G6AB 5EC2A 4F8TA 4FMKA 2XRAL 1I8MA 5FGSA 3SGJC 5BMFL 4JPWH 1BJ1J 1E4JA 2X89A 1TTFA 3MXWL 1E4KC 2DWEB 5KSUB 1Q9WA 5K93A 4LSQH 2AK1L 2DQGH 1YUHA 1RHHA 4MXQD 3F65A 1T1WB 4HGWB 1IBGH 5C0BA 3ZKND 1T1XB 4AEIH 1IC1A 2X1QA 3FRPA 1T0PB 5BZDB 4XNYH 2AJYL 3MLWH 3P73A 5E8OA 5IBTH 1VFAA 1G7JA 3TEUA 3HMWH 1OAYH 1U42A 2BY1A 4H8WH 3DVNB 3U82B 3M45A 1JHKL 3EYFB 1P5VA 3RVVD 4O4YH 3QUXA 5FCUL 4JO3H 3QO0A 2QBWA 1CGYA 5SX4I 5C07B 1YQ2A 1IAIM 1DLFH 1VGKB 4TUJB 3P2TA 1PY4A 2BJMH 1MLBA 2VQTA 4MJIA 4OGXH 4Z76A 4L29A 1CVRA 3MLUL 4OD1H 1KIRB 5HY9B 2I27N 5T3ZH 3MRRB 2IPKB 1OSZB 4GOSA 2ARJQ 2Y23A 3KYKL 1JE6A 1JN6B 3HTLX 1BMGA 2KL6A 4ETQB 4PJ7A 1T6VN 3R1GH 4N68A 4R4NC 1U0QA 4QXUL 4QLRA 4S2SB 3KYNB 2C5DC 2X4UB 3UYRH 3QDGE 5FGRA 4PRHB 5FKAA 3X11B 1A9BA 2RFXB 2YS4A 4WDIB 5HDBE 1PYWA 2A6DA 2GYSA 3TBVA 4NQDA 4Y1AE 3OAUH 4L8SA 2OTPA 2LVEA 4K9EL 4MXWL 1OW0A 4Y4FB 3QRFM 1YNTA 1KIRA 1Q94B 3ZYZA 2A6JB 1RZKC 1C7SA 2OZ4L 4KDTC 2MCPL 1UZ8A 4ZAKC 4TUJA 4WU5B 1X6NA 2DQDH 1UB5B 3QDGD 4JRYE 1NGZA 4YO0A 3JV4B 3VXTA 1A4KB 1WSST 1GJIA 3A6CH 3BQUA 3CC5A 3GI8L 3EYFA 4U3XA 1AKJA 5LXGH 3QUYB 5T3XD 1VERA 3RZCC 2LABA 4Q6IC 3TNNA 1R3HB 2BHYA 3E3QC 2F54A 4U1SB 3ULVL 3FO2B 3ZSTA 1IGTB 4UB0H 1ZT7B 3RA7L 5DGRA 5E70A 5DHXB 4GT7A 2Q20A 3CCHB 1AXTH 1HH9B 2D4FA 4QRPE 4GKSA 4QWWC 4Y1AA 5EUKB 4Z7QF 2BXZA 4PJEB 1YEIL 1FLTX 1FFRA 2BVYA 3BDYH 4MD0B 3HUJE 4M7JH 4E0RB 2HG5A 3BJLA 4JZJA 4RGND 2H32H 5E2JA 1FG9C 1Q1JH 1KEGL 2AJVL 2D7MA 1EJ6A 5ETUB 3DV6B 1P6AB 4K3EL 4LDEB 1JV5B 1CFVL 2VAJA 1B90A 3C6LC 4AMKH 5SV4A 3FOLA 3IXAA 4BKLA 1IGIH 3LKSB 5CEYB 5CWSB 4CRPA 3T4YB 4OF5A 5L0QB 9CGTA 2X1PA 4PBWD 3RWHA 3O6FC 1NC2D 2EKSA 2G5BA 1G7QA 1JFQL 1MCNA 4OCSH 4TPRH 5EC1B 5FB8A 1A7OH 4WEBH 3PWPA 2WK2A 3LPGA 1ZT7A 3C5ZB 1BIHA 3DVFA 1TJHL 3FCTA 1YC8A 5SWSE 3VD3A 5B4MC 3MJ8A 4R0LB 3RIFF 1XGUB 2EC8A 2WWMD 1IAII 2VLJB 1X5YA 3MSPA 4UDTA 4OFYA 5HHNB 3FT2A 1YY9D 1KCLA 4NQSB 4XNQB 3CC5B 3SE3A 3PWNB 2BY0A 1T22B 2HJKB 4R4ND 5FHAH 3FN0L 2IALB 4HPYL 1OQXA 3BP5B 3IDMA 4Y4HB 2QQQA 2UV3A 2YPKB 1FYTE 4DW2L 5ECJE 5IFAH 4ACPA 2MSPA 2R0LL 5ID1B 3WFHA 1MRDL 1H15A 1U8HB 3D39D 2NY5C 4QTIL 4F7CA 5B8CB 3DXAE 4H26A 2IQ9H 1AFVH 4KKLD 3CU1A 5I74C 2OBGA 1RZ7H 2UZIL 1GHFL 5AEAA 2HFEA 2W0PA 3S97C 4Z7VA 2QADC 1CE6B 1FGNL 1CLYL 1QA9B 4KZDL 4OBRA 4LLDB 5K9QI 2ITCB 5HDOA 4Z78B 3V4VL 2ARWA 5CEXB 5FK9A 2AXHA 3CSBA 4Y5VA 3CX5J 1EMTL 3QXAA 1ZHKA 4MS8D 4HKXA 4N0UA 1L4IA 1SJXA 1K3ZA 3ALWA 5FHAL 1SY6A 1YEKH 4GMTH 3D69A 2DQTH 4QCIB 5INCB 4HIIA 4LRNL 5C6TL 3EOTL 1G9MC 4QXWA 3HCVA 2R9HC 4AH2B 4NRXA 3Q3GA 4XP5L 1CLZH 2PR4L 5EOCH 3HNSL 1CLOL 2UYLA 4RCAA 4P9HL 4UINL 3L5IA 3SGKA 1A2YB 1WBYA 3UTZA 3OGCB 4ODVH 1FORL 4U1IA 5IFAL 3GIZL 1WK0A 3C09B 3CFIC 4MB3A 4OFPA 3UPCA 4QNPE 3U0TB 4FABH 4JANB 2J12B 1WAAF 3P73B 2XWBA 4JO3L 1ZTXH 4ZFGH 1M6OA 1CXLA 4XP1H 4KQ4L 5C0AA 1U93B 4D0BB 2F5AH 4NQCE 2DDQH 5D1XA 3MLTA 4XWGH 3MA9L 2YMXH 4J3SA 2G9HA 5D1QD 1MFDH 2P5EE 4W6YB 1NEUA 5FYKH 1N5AB 3IU4L 5EU3A 5FHBL 4BSWB 3EYVB 5J12C 1BLNB 4AENA 1A2YA 1WBYB 5HPMB 5DMGD 3SY0A 1MQ8A 2YD6A 1HXYB 3L1OL 4U3HA 4FTVA 5EU5B 1D5ZA 2BNRD 3NGBB 4Z7QE 5JHLL 2B5IC 2Z4QB 2MPAH 1GGUA 3I3BA 1MCEA 5C0CA 3BXNB 2O5YH 3BWAA 3O6FB 4MNQE 1WTGT 1JZ8A 5ITFA 3P9LB 1YZZA 3HKFA 4XP1L 3VH8A 4BFGA 5EO9A 4PRIB 3RNQB 2EH7H 5HHOB 3VG0H 1WQVT 5DRZB 1RUKL 5DZLA 1D5IH 5CSGA 1RIHH 2NQCA 1MRFL 5F7DB 1Z9LA 2VL4A 2QSCL 2J6EA 1A4JA 1FL6A 2FIKB 4I0PD 3WJJC 3MBEB 1KT2B 5K9JL 4KMTL 1IC5H 1E4WH 1GVIA 4LLDA 4ERSH 2OMBA 3FQXA 2D2OA 3KHOA 1FFPA 4AIXA 1NAML 4WFGD 4EDWL 3KPOA 3UBXG 3U6RB 1NBVL 4M93C 1DQMH 3LSOB 4XCNA 3TCLB 5TGBB 3NFPB 4HUVA 5DZOA 3O6ML 3RGVB 1NCTA 4G6AD 4JFQB 3B5TA 4ESKA 1RMFL 3LN5B 4JZOA 3QISA 4N5ED 4BFIA 3MV7E 5KS9A 4ZUSB 5JW4N 4WGWB 5CZXD 2X09A 1N6QH 2NY2C 5D1ZC 5EBWB 3NZ8A 1QFHA 1WWBX 3T0BA 5HDBF 1EO8L 4NSKB 2OZ4A 2VXVH 4UDTB 1IAOA 5C0BD 3ZHKA 1Q9LB 2C4FU 4M7KL 4ORGA 3LKQA 4ZOAA 2EDJA 4N0YL 4P4KC 3QIBC 3U46A 2AJUH 3QAZB 3MRQB 3ZKXB 2XN9D 5GSRA 2N7BA 2WQRA 1KB9J 2JJTA 3U1SH 2QSCH 3GBNH 4GRWE 3O8XC 2DKSA 4KHTL 2IAMD 1X5LA 5K9JH 4AMKL 4M5ZH 3J8F7 1A1NA 3MRLB 2ZPKH 3LKOB 3GJFB 3STBA 2NY0C 3BXNA 3QUZA 1NQBA 1FNEA 2EYRB 2E7LA 3NCYP 3IDNA 5IMOB 2NXZC 4FTVB 4PD4J 5EU5A 3D39A 1NFIB 2EE6A 3FQTA 2DLTA 1NGPH 4YDVA 1HOCA 4XWOD 5EZLB 5DQDL 4O02H 4N0CD 2D7NA 1INDH 4QHNB 2OR8A 3VXQB 1N59A 4DKEL 3RY6A 1I85C 1WEJH 3QYCA 5CLWA 5DHVH 4EIZC 1DTUA 2CRZA 3BKML 4Q9QL 5A2LH 3VD5A 1I3UA 5I2IB 4NKDA 1FN4B 1B9ZA 4OZHA 3W39B 1CICB 5DEFB 5C8JA 3CFEB 5CILL 4CVZB 3BKYL 4HFWA 3BH8B 3BGMA 4NO3A 2ZKHH 3L7EA 4JREC 1G1YA 3HG1D 3VH8G 1QPXA 2MCG1 5FGBA 4YHYC 1TVDA 4U7KA 3I6GA 2Y5TA 3Q6FA 3PF2A 5B39G 1T83A 4IIQB 1LO5A 2NTFA 4R4BB 1W72H 3KPRB 3IFPB 4FQHB 4PJXA 2FJGB 4GMSL 5F89B 1RUQL 4K2UL 4FQ2H 4ZTPH 2QTEA 3UC0H 4NUGL 4CGTA 3RHWK 3VXRD 3L6FB 4EKXA 4OM1H 4X5WA 4DVRL 1XGPA 5DJDA 3QZWB 1I7TB 3VDBA 1LK3H 4FQLH 1OD9A 2VTFA 3RBGA 4XHJC 1ACYL 5I8OL 2VDOH 3P11H 2YUXA 3MRRA 4HWZA 1YPZF 4PJFA 4UDUB 1MFAL 1U3JA 2CUIA 4WO4A 5TFSH 5BVJA 2HT3D 3RUGE 4WY7L 1R3JA 3ROLB 1I1AB 4PJCB 4UT6L 4KGJA 2Z31B 4XI5C 4HXBH 4DFHA 2RCSL 3BP6A 5E8NA 3DRQA 2F5BH 2H1PL 4NZUL 2WIMA 4KZEL 3MV9B 2YKLH 2ZCLH 4X4YB 4LVNB 5A16B 4S1QL 1YNLL 2EIEA 3MXVL 5GPRA 4KTYA 4KROD 1NBQA 4RMSA 3UJTH 1J0YA 5BS0A 5AG9A 3HG1B 4KY1H 1FNGA 4HXAH 2UVFA 2OSLA 3O45A 1DFBH 4NZRH 4ONOA 4HH9B 2G5BB 3RWHB 5JOFA 4ISVB 4RMTA 1ZHNB 1M05B 2E7CA 2Z92A 2YRPA 1S5HB 3ARRA 1ZHBB 1IMHC 4CVWA 5DRWB 2BC4B 2VDQL 1SBSH 1X5FA 2DQHH 3DWTA 3W11D 1QHPA 4D9LL 4JZJB 3VG9B 1I8LC 4IRZL 4XNMB 3WL9B 3LS4H 1FZKB 1SMAA 2BXYA 1OTUC 3Q6FB 1CXEA 4ODXB 4XX1G 1PG7W 3GMOB 3GSOA 4ZPVA 4ODUB 3A67L 4RGOH 5ALCH 3I6LD 5C08A 3KPLB 1PY9A 3V2AR 1C12A 3LRHA 4GAYB 4LEOA 5GS1B 5GZND 4ALAH 1H15B 1YEIH 1IKFL 4ELMB 1S9WA 3S4SA 3V5DA 3CFEA 5GISL 1NFDA 1FJ1B 1J0JA 2EKJA 1LDPH 3JV0A 3MRMB 3MNZB 1JPGA 4KK5C 3T8XB 1OAXH 1FBIH 3WKMH 4PRDA 4RGMB 3VXSE 3IRZA 2MCPH 2AKRA 4KDVA 4P49A 5EIQA 3HPLB 5I19L 1EERB 3MRBA 1EEUA 4X9BA 1ORQA 1F3DH 1VFMA 4PJFE 5J11B 2X7LA 1Q0XL 2Y7QA 3QIUB 1AY1H 1KELL 1S7SB 4NQEE 4KRPD 2GY7B 1CBVL 2QR0B 3H42L 4JO2H 3REWB 4LSUH 1NFIA 3BN9C 3MR9B 3RAJH 3K8KA 3AFLA 4LDLB 3SJVD 3BPCB 3CK0L 4PRHA 4Y5XC 4HSQA 3MLZH 4X98B 4WHYH 3VGBA 2GTZA 3HPLA 5B3JF 4K7PL 1WUNT 3PGFH 4M8VA 4I77H 3GBML 1ZHNA 5FIEA 2IBZX 4P3CL 2H45A 4OCWL 4JVWA 2NXYB 4K8RH 1YJDL 4S1DD 2W0KA 4XMPH 4JN1L 2ED7A 1JPGB 1HI6A 4KI1A 4Z6AT 5T1DL 5DQDH 5D5MA 4JZNB 1Q9KB 4IDJL 1NCAL 4FMFA 3VD4A 1YYLH 2AEQH 4KUCF 1K2DB 1DQLL 4YBLC 3MBED 5GRJH 4ELKB 1YQVL 4GSDH 2YRLA 2XXCB 1JYXA 4F9PC 4I9WD 5I1IH 5BRZA 4ZPVB 4H8WL 1UB5A 4WI5A 2XXMB 5FCUH 3X13B 3WCYA 1BQHA 3IVKA 1CD0A 4B7LA 3SGDI 4PJXF 1E4XH 5E03A 3PWUB 5J8OA 1F5WA 1T2JA 2J88H 3GSRA 2F53E 5CEZL 3QWQB 3TJEH 3F6IA 4MB5A 4HULB 2HN7A 2NPLX 3S35H 4P2CG 3PUCA 1OB1A 3EIFA 2PR4H 5EOCL 3TBTB 1NMCB 4A6YL 2IH1A 1A3LH 4N9OB 5DJCA 3B83A 1YN6A 3ULVH 1A4JB 1FL6B 1CDIA 4MQXD 1AXSB 1JWMA 2R8SL 1GC1L 5E8DH 4YHPB 1C5DB 4XAWL 1MUJA 4KH2A 4N8VG 1NAKH 1NPUA 25C8L 5DRZA 4UNUA 2FSEB 2NXZD 3RVXC 3BKCL 1CGWA 4LGRB 3GMPA 4FXGA 2JCCA 2A6KA 3EO1A 2BP3A 3CPLB 5HVHB 1WIPA 2VDNL 1QG3A 4CU7A 4ONFL 4X7DC 2Z4QA 3B2UC 1QQDB 5I1AB 3QT2A 4JFFE 4YHOL 2WINB 5D6DA 1S8DB 5JDSB 2FO4B 2KUTA 5BOZG 3PWPD 3MODL 1T6WA 1HKLL 4NKDB 1WITA 2VWEE 3MROB 1MJ7H 1MEXH 1UQSA 3SDYH 1SBSL 2DQHL 1L0YA 1QUNA 1MI5B 2Y06L 1JZ5A 4P59L 2PKDA 4PG9B 3VD9A 1FH5L 3LMJH 3V8OA 1BOGA 4RMWA 3P0VL 1P4IL 2CUMA 4OCXH 1H3PL 3QIWC 5LGHH 3AS3A 4NT6A 1Q9WB 3FQWB 1T21A 2F53D 4M1GH 4X5XA 5IKCB 2MQCA 5KSBA 4J8RA 2EEDA 5ILTH 2YD7A 1G7PA 4UILL 5B39A 1RVFL 2UYLB 3PL6B 1OGAD 3HE7A 4Y88A 4S11A 5ADPL 1H3GA 4O2FB 2HFGH 1UM5L 1AP2A 4MXVF 1F02I 2I26N 5CZVH 3AM8A 4AH2A 5C7XH 3GHEH 5IFHL 2GQHA 5CGYD 5INCA 2CDEA 2FJHB 3KGRA 2EZ0D 3IDGA 4APQD 2YD1A 5I30H 2X4NB 4OLUH 1OTTD 4FG6D 3WNLA 5I17B 3WN5A 4OIIH 1CDJA 4K3JH 5EBMA 1P9MC 3NAAH 3FMGH 2J8UB 2JLLA 3ULSA 3JTSA 4I0PB 4MNQA 3SDXB 5C0RH 5KG9A 5CP3H 3RGHA 3L3HB 4KV5E 1HSBA 1BJ8A 1ORSA 4IDLA 1IGMH 2EDWA 3RVXD 1KPRA 5ICYB 2FLRT 1PW3A 1OAZH 5EOQL 2B7DT 5HHOD 2H2SD 3W2DH 4IRSD 1JWSB 3OJVC 4GFTB 1IGJB 5D8JL 5F9JA 4WHYG 3C2AH 4BA8A 3ARGA 4Z7WA 4NJ9L 4ODTL 1DEEA 2ICWA 5IMOA 1JYWA 4O5LH 3OKNB 4P46B 2HVKB 2OI9C 2VXTH 4XNQA 1NMCC 5DDHB 4RNRA 4FN0A 3LY6A 4FXKB 5J1SC 3IJYB 3TO2A 4OV5A 4R0LA 4X4XA 3VFGH 1NGXA 3STLB 2QSTA 4BQ9A 2VLJE 3F7VA