2E7LA

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSHQGRYLTFGSGTKVIVLPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 27
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e7lA00
2FRGP 1A22B 1CIDA 3PDDA 5L2KB 4GXUN 1H3GA 3LN4A 5F21B 3RFZC 5DJ0B 4YHPB 3B2VH 2KUTA 3OB8A 4P3CL 3RUGF 5E1HB 4HJJL 1XH3B 1YJDC 2HN7A 3ULUE 2BOCB 2X1WL 3CFCH 3O6FB 1HKLH 1UYWH 3PIQA 4G9FD 4NWTH 4BSVA 4X0KB 1WZMA 2XXCB 4WHDA 1NBVH 5HI4C 1JBJA 4HJGB 1RZ7L 1HI6A 2ZG3A 2BVQB 5EC2B 1PX3A 1NUDA 3BKJH 1G9EA 3D48R 3GGWA 3KAAA 3D25B 3ZYJA 4KK6D 3BD4A 5CKGA 1ETZB 3SGKA 2J7LA 1CN4A 5ADOH 2W9LA 3MOAH 4PGDB 3SEPA 2PO6B 3MV9E 3DO7B 4M7LL 3MRCA 1CVRA 2WIIB 3SKOB 1J0HA 3REVA 4EDXB 4FNLH 1MSPA 4JB9L 4KI5C 5T33H 3CU1A 5F7DB 4PRID 1QSEB 1NBVL 1OW0C 4X5WB 5KVEH 2HKHL 1NEZB 4RBPK 5IVXA 1MCDA 3H3PH 1N6UA 3P9MA 2AXFB 4QOKB 1KN4L 1ORSB 1I8KA 4HD9A 1KG0B 2D7TL 2DIJA 2R15A 2NY4B 1J05B 4MCZA 4N9GA 1MJJB 1GGTA 1ZT7B 4QEGA 3MOAL 4NN7C 4XP1L 4LEXH 2QQLL 1JF6A 4N0CD 4GQ9L 2BNUB 3M8OH 5AG8A 2HFGL 2Q7NA 1HILA 5IVZA 3D39B 3FO9A 3FRUA 4PJ8C 3SPVB 1NFDE 1UZ8B 1NLBL 4P3CH 3TO2B 4JR9H 5CWSB 3TA3D 3TPKA 3IFLH 5KJRH 4OCRH 2Z93B 4BJLA 3IU3A 1MWAA 2YZ1A 4PJAE 3HI1A 1CVSC 4Y0GA 1CFSB 2H2PD 5I17A 4RMVA 1JPSL 2F54E 5IVOA 3CLFH 1IAII 5IVNA 1SBSL 4MNQB 2J8UE 3UZEA 4Z7OE 1W0VA 4NO2B 3WNMA 1DLFL 3ARUA 4MA7L 4IRSB 3ZZ1A 2WBWB 1WLHA 4N5ED 3SDXB 5BMFL 4NZUH 1U6AH 5C71A 2BVQA 1FGNL 1S7RB 2ADFL 2FIKB 3MRCB 5DMIH 2VXTL 5I16A 5C8JB 3ILQD 4PJAA 1ZLUH 2BRRH 4I3SL 5DEFA 2W60B 3D85B 5AYUH 1NFDA 3U36B 2HYMA 1AGBA 5D72L 3GRWA 4MJIE 4BH8B 2ZSVA 5ERWA 4YHNB 2FGZA 2GSGB 3AFLA 4IDLA 3RWDB 5C08A 3NZHH 5FYLD 4NZTH 2V5MA 1MLCB 5GGQL 5E8PB 5JPMB 1I4FA 3VRJB 3BISA 3HRPA 1NEZA 4ODXA 1MCRA 1FJ1B 3RZCD 5JA8B 3DTXA 4O2FA 4HQQL 3S5LG 2AJVH 3RIFF 2FJGB 2HRPH 3IDYB 1UZ8A 3WNNA 4F15B 2AQ3A 2AXHA 1H5BB 2CSPA 3FQUB 5CEZL 1OB1A 4HIEA 3RTQA 2PW1B 1CTNA 2W9EL 5AUMA 4N0UB 1EVTC 1HCVA 2CGRH 4ELKB 3HE7C 2A0LD 4Z8FL 4U1LA 2HWZH 1QLRB 3BKYH 3IJSB 4GSDL 5F44A 4MAYB 5FA3B 1D5MA 3MZGB 4MD5A 2Z91B 4Z0BH 2VL4A 3IFNL 4Q0XH 1KXQE 5DURB 1SM3L 1F5WA 4HK0B 4JQVA 3GMOB 2YD5A 2QKIA 4E41A 5I17B 4MXWL 1B2WH 3D39E 4JHZA 5D9SA 3IXTB 3RVXD 3IDNA 3MACL 3QZWA 3MNZA 1MLBA 1MFDL 1KOAA 3VA2C 3CLEH 4LEOA 3HZMA 5D2NA 2O61A 3MCLH 2DQHH 4KK8D 3O9WA 4YK4B 1CGSL 4YWGH 2CLRB 3FQRA 5FM5M 5C07A 4OJFH 2YUZA 2GJ6E 3B3IA 3IFNH 4JFQB 4O4YL 3DMMC 1U8QA 5E9DE 3BP4A 4TPRL 1EHAA 5HHOE 1VFUA 4ESKA 4OQTA 4HEME 3LKOA 1ZLSL 2Z31A 2Z8RA 3H7LA 3QWOB 1U3HD 2UY7A 4N8CH 5JXEA 4Y5XB 3U4EB 5LG1A 1GIGH 4G6KH 2DDQL 2HAZA 4MMZC 5SX5H 4WO4D 1J1OL 1ZOXA 4Z76A 1CICC 4WTZG 3RNQA 4ODTL 2NW2B 4YBHA 4K3EL 2D0GA 1JWSB 1QHOA 3BQUD 1K3ZA 4FZEH 2EIZA 3TM6A 4P23B 1JGEB 1I1CA 3OHXB 2J2ZA 5D2LE 1G7IB 5C09E 1MFNA 4XPGH 3BUTA 4DN4H 2GJ6B 4X4ZA 2UWEA 3UTSA 4WW2B 5EFIA 4L8DA 1WCBA 4LSPL 3LN9A 1J1XH 1R5IB 3BIBX 3D9AL 1XFPA 4IIQC 3Q5OA 5CUSH 5I9QC 5MENE 4BQBA 5I19L 4YBLB 5I2IB 4JQIL 2JJTC 3LEVH 4M61A 1MRFL 2A6DA 4RDQG 2WUCL 1TQCB 4XNZB 4YXLL 2XQBL 5CGTA 3LKPA 4RWHA 5T1KB 5I8CA 4HH9B 1QFWM 3FZUC 5F88B 4PRHA 43C9B 3ET9F 4DK3A 1OGAD 1JWUA 2CIIB 1XF4B 1GPOL 2HFFA 2V2XB 3BE1H 4J7RA 3KXFE 1BPVA 2E7LC 2EECA 3MYZA 4Z7VA 5KSAA 5KSBF 4W6WB 4ZS7H 4JFZL 3ZDYF 1FZOB 3DUSA 4J3OC 5C0NC 3QUYB 1OTSD 1UCTA 2DDQH 2XWTB 1NUNB 3HG1E 5ANME 4P5TA 1EO5A 3WUWA 4LSVL 3RWJB 3HE6C 1OLLA 3AAZB 1IEBB 2ARWA 5CSZB 1V8HA 3L3HA 1BD2A 2GAZA 2DBLL 4Y4HB 1WTLA 2LV4A 1BQHB 4UT6H 2CDEA 3ZMRA 1U8QB 2YS4A 4XGZA 3NOIA 4OF8A 2H2SC 4NNYB 4J1UA 5GJTL 3TJHC 1BOGB 3S96A 2VH5L 3F7PC 3UJJL 2VR5A 2Y7QA 3QWOA 3V4PH 1P7QB 2WK2A 2IFFL 4WV1C 4WFFE 1XMWA 1ZHKA 5L6YH 1C5BL 1KCSL 2VYRE 3IDMB 2BDNH 1MVUA 4JFDB 2VKXA 1IAIL 2P8PA 5JMRA 1T83A 4WY7L 4X6BB 4CADA 3DRTA 2YMXH 1UH4A 3LN5A 1BX2A 2IH1A 3T3ME 1FVEA 2P43B 4P5MA 4Y1AB 4ISVB 4BSWA 4LP5A 3T04D 2A6DB 3EBAA 3O6MH 1MEXL 1CG9B 3UO1H 4UQ3B 1WIOA 4NWUL 4U1SA 2DJUA 5I1EH 1QFUL 4S1DD 3LKQA 5HD8D 1AFVH 1QSFD 4K7PH 5GSVB 4PJGE 3QIUD 4G42B 4QHUB 4D0CB 3WFBH 4IEFB 5DFWH 4IHOA 5JIIA 1IAIH 3T3PF 4Q58C 1T7XA 3CX5K 4NRXA 3FQXB 1RZKL 4L1HA 5TF0A 2HT2D 4JFFA 3DI3B 4WHTB 4PJBF 4GQPH 5I1KL 1HINH 4GRMA 2HFFB 3FO2B 1AXSA 4JKLA 4F7TB 2JCCB 4NIKB 1FO0A 5DT1H 4XPTL 3WXWH 1VKXA 1QSFA 3L3IB 3HE7D 1YEGH 2XN9E 5B38G 2YPLD 2EH7L 1OGAB 1QFWL 2DF3A 1FNSH 5E2UH 5MERB 1T0MA 2OR7A 5HHNB 3VXSE 3TN0D 5IT2H 5IV2A 1ES0B 3UTPD 2MCG1 2VMFA 1QBAA 1LWRA 3DIFB 4RIRA 1JGLL 2NCMA 5LQBL 2OL3H 1J0ZA 3REWA 2ITCB 5DZOA 4JFFD 5LKNA 3FRPG 4AZ8A 1DBJH 2XZAL 2DJ4A 4X5XB 3NFPB 3PHQB 2GEEA 2DM7A 3ZT5A 3STLA 2NLJA 3DUHA 3TIEA 1HSAA 1UM4L 3JVGA 4U7SA 2NY5C 1XIWC 1TJHH 4LPUA 4MGXA 4FQJH 1T3FA 3MOBH 3U0WH 2H8PA 3LN5B 2I27N 1OQXA 4HUNB 5JOEA 1MFDH 1AGEB 1N3NB 5IG7B 4L8BB 4ZUWA 3LS4H 2BY0A 1AR2A 4JFFE 5AAMA 1JGLH 4L8CB 3EYFA 4XNUH 5HDBE 2F9BT 2DKUA 4LLMA 4G3YH 4B5EA 3OKMA 5CD3B 2EC9T 4R7NB 1NMCB 1IL1B 1OF2A 3O81A 2AV7A 2GW5A 3TIDB 3VD3A 1AXTH 2X70B 4MA8L 1MFBL 1T2QL 4JPKH 1LO5A 2X41A 4Z7QF 5LGJB 2AJ3A 3MGTA 3EOBB 5TDNB 4PB0L 1ZTXL 1H15A 1F97A 3DMMD 3ESUF 5FYLL 1MCJA 2EZ0C 5I8KH 4JRYD 1AGDB 2Y36H 5EZLB 2Z35B 2D0FA 5C9KA 2C3VB 5HVHB 3TFKD 3I50H 5D7JD 4G9FB 1U58A 4U1NB 2ZPKL 5CMAA 5MEPB 1RUKL 3SDDA 2AK4E 5SWQA 4EUPA 3CVHH 1QG3A 4OCSL 4MNGA 4ZUSA 3GUTB 4G6FD 5D7LE 2IPTL 3MOBL 4L8SC 4NO0A 4JRYA 3U2SA 3LQZA 2W59A 4JG0H 3ELAT 1Y18A 3VE0B 1XEDA 1IT9H 3VFNA 4AIZA 5TDPA 1OAYL 1X7QB 3GSUB 3ARWA 3PGCB 5FHAL 1IGMH 3H0TB 5DA4A 1GOFA 1MHCB 3IXTA 1OPGH 3C6SA 1L0XA 2JCCF 2VZSA 1G0XA 1YA5A 2EDLA 3SOBH 3QJFB 3VGFA 3GMRA 2ZKHL 2KL6A 5D4QA 4YDJA 3RZCA 3EUUA 3V52L 4XNYL 1NCDL 2MJWA 5GZOD 1YMMA 4Z7VF 3KYNA 5DVMA 5FYJH 3KLAB 4OAWA 4U1JB 4JVWA 3QEGH 1J5OL 3EHBC 1S7WA 4XWOD 2EE6A 4D0CA 4ZAKB 3OX8B 4AH2B 1D3CA 3QQ4B 5TH2B 4MD0B 5A43C 1I7TB 1FSKB 1ZGLP 3W9EB 4X83A 3S37H 5TQ2H 4PV9A 5DK2B 3FFDB 4NUJB 1EGJL 4MB5A 5EU5A 2ARJQ 5DUML 3TBSA 3HLAB 2AJ3B 4J6RL 1P53A 2XG4A 3QNZB 3LRSB 3V52H 1LK2A 5I15L 1XGUB 4KAQL 5DRZA 1BLNB 1MJ7L 1MCOL 3C08L 1O0VA 3HZVB 4N9OB 5GJTH 2V2WA 2XG5A 4U1LB 5FCUL 1BVLB 4YLQT 4NSKA 2H9GA 3ALXA 7FABH 5H35A 4F33A 1IRAY 1L6ZA 3JV4A 2BCKA 3ES6A 3DPBA 5IHBA 2FLRT 5SWZD 4GKSA 1GAFH 1INDH 4PP1D 5C08D 3I6GA 5CMAB 4ZTOH 4K3JH 2YN3A 5FAAA 2NX5D 3KVQA 1HHKB 1DLHB 4XBGA 4TSBH 1N7ML 1X5JA 4ORGB 2VLLA 4LNRA 1E6OL 5T33L 4N0FB 3SE4A 1D6EA 5ESQB 1U0QA 2DS4A 3MO1A 4P2YA 3TZVD 2D2OA 1CXEA 4N1HB 5IEHB 5FYJE 3B9VA 3ARFC 4GBXD 1H3PL 3KPMB 4C56D 4M1CC 3QIWD 1YNKL 2R69H 4QCIA 2FX8L 2CUHA 2YMXL 2D7MA 1QOKA 1WAAF 2YUWA 4FFYH 2X4SA 2NY0C 1QLEL 1JGVH 3SGKC 1A6WL 3X3FL 4PGEA 1IL1A 4U3CA 3V5HA 2E9WA 4ZAKA 4HWUA 1Q9WA 4JFQA 3TIDA 4KDTC 4JQXA 1YNLL 1A6TB 4M8QB 3P9MB 4QOKA 3KLAA 3VRIA 2OR8A 4PJ8D 1WF5A 3QAZB 1PKOA 5EZOH 3U0TB 3G5ZB 5DQ9B 3RWCA 5KZCB 4RNRA 4CVXA 1CBVH 1WFOA 2NX5E 3VWJD 1N0XL 4P3DB 5SWZE 1X5KA 3G6DL 3HZVA 3HS0B 2GY5A 4G9DB 1F4XL 1F4YH 3DXAE 1FVCB 2EIDA 3FTGB 1HH9B 1KEMH 5MENB 5D7IF 4CGTA 3QNZA 1QTYT 2GJ6A 5CINL 1YY9C 3AS3A 4LMQI 3BN9C 1I7ZB 4PY7B 3D3VD 4HK3J 3KYOA 4PJ8A 3B2VL 1TJHL 3DVGB 2D31A 4HCRL 2F54D 4NO0B 2GTZB 4IJ3B 3SDXE 2PYFB 1OQOA 1LNUA 4RGMB 2GFBB 3V7AG 4QKXB 1N5YL 1HDMB 2P7TB 1VFAA 2B39A 4MJ6A 4YBLC 4NHCH 4MA8H 4EUPG 3PDOA 3GO1L 1MFCL 1CF8L 2NYYC 3OAUL 4NO3B 4Q9QL 4XPHL 4PB0H 1J05A 4N8VA 3TT3H 2VXSH 1B4JH 3TH4T 2OP4L 3QI9B 1OTTD 5C0DA 4YFLI 3WIHA 2FSEA 1CD1A 4M9OA 3OG6B 3TBYB 2BSSA 1HH6B 1MH5B 1NDGA 1EJ6A 4H20L 5DEFB 5AYQA 2YHGA 4KROD 1NGPH 4HZAA 4H5SA 3FO0H 5MHSD 5ID1A 3OQ3B 3UBXG 1I85A 1RUKH 2E7HA 1ZHBB 1J0YA 4L4TB 1TZHA 5C0IB 4JJHA 4X4ME 1FORH 3SE3A 1G6RL 4YFEA 2PR4H 3BXNA 3INUH 3L7FB 1T5WB 3QG7L 4LEXL 1RMFL 2OBGA 3ZO0A 5EU5B 4F15C 4JG0L 1M71B 4Q6IB 5ISZB 4HDIA 5E8EB 4I77L 3DRTB 4K7FB 5ECJE 2ATKB 3T0EA 1ONQA 1ZT4B 4HW6A 5TFSL 3CXHK 5FOBA 1OWWA 1FFPA 4Z7WF 2R1XB 1TXKA 3IXAB 3HPLA 2AK4D 1YN7A 4OCNC 2NY1D 1I1AA 2ED9A 5I0DA 4PY8J 3IFPB 4JHAL 3VWKC 2PTTB 1IBGL 5T1MA 3MRLA 4OLWL 3WFCH 1CFNA 1C8PA 3MRHA 2VZTA 3W82A 3U48A 4GMTL 1TVHB 1HQRA 4DZBA 3OPZH 1FRGH 2QLVB 3WDJA 1JUFA 1RJYB 1HSBA 1XCQB 2EEDA 4ZPVA 3QAZC 3TBVB 1SJHA 4OGAC 1XGTA 4Z7UB 3MO1B 3BW9A 4JFDE 3UYPA 2MQ0A 5FO8B 4F7TA 4HS6A 3C09C 1P7KA 3IRZA 5DVOA 3RX7A 2Q8AH 4ETQB 3FAWA 1IBGH 3CZJA 4P46D 5CP7A 5IKCB 4NO3A 5CZKA 5E08L 4UU9B 2VLJB 1K6QL 5ALCH 1FAKT 4AEIH 4QRRE 4R96B 1K4DB 4LVEA 1VESA 2JB5L 1KLGA 1ZGLA 4LU5H 1HHIB 4JJ5B 1FL5B 2J12B 4EXKA 4KRLB 4LCWD 4OZHA 4NZTL 3OR7A 5HHNA 3MA7B 4TVPL 4I3RL 2VITB 1N5AB 1YEIL 4NZJA 1FVDA 2Z31C 4WJ5A 4C59B 3RVTD 2R9HC 5DD6B 8FABB 1YY8A 3AXLB 5BZDA 3GI8L 3KWWA 3NFPA 1YPZE 5JLZB 3V4VH 4I3GA 1A1OB 3WIIH 4S1RL 1R3IH 3UTTA 2XN9B 5SX4H 3DRQA 2R2BB 4LCWA 1CLZL 3WIHH 4NJAH 1VENA 4L8SA 2XFXA 4QYOB 3MV9A 3CSBA 5DJZB 1AKJA 1V5JA 2BNRE 2Q86A 4G8GA 4MQXC 1MCHA 4XCYA 2AEQL 1JUFB 5T3XH 2H6PB 5F9AC 3MYJA 4M8VA 4LSTH 43C9A 1NCTA 4QNPF 4FXGA 2G5RA 3GJFK 2C4FT 2E9JA 3T1WA 3P0YH 2C1PA 3D2UA 2OZ4H 1I9EA 3L5XL 4UAOB 3O6KH 2RB8A 5HGBA 1PX4A 3V5KB 5GS2D 1ZA3A 5JHDE 1I3UA 3D87B 2HVKB 4UU9A 5C6TL 3V4PL 1MIML 4BM7A 2F58H 5L8JB 1ITCA 1QYGL 3QUZD 1RULH 1S9YB 3BYYA 1G7MB 4OZHF 4WW2A 5EFIB 3DROA 1OAKL 1JRHL 4ETQA 4DUVA 4JKPL 5KW9H 4IRZL 4AYFA 1W72L 3JV6B 1TCRB 4PUBL 2WNGA 3GI8H 1CBVL 5J7CC 4Y4FD 1C12B 3X11B 5DDHA 4TRPH 5D71L 5I1AB 1MWAL 5DLML 3CD4A 3MCLL 3Q3GB 5J06A 3I3DA 12E8L 3LN4B 5C0JB 5I1EL 3ZDXE 2FYYB 4N90E 3WFHA 1A1OA 2QQQA 3DSFL 4QXTA 4YIQB 2ZWLT 4YHIB 3IETB 1WC7A 3N1GC 2BVTA 4HEPG 3B5GA 4LKCA 5DO2C 5AZEH 1DL7L 1AKJB 5KSAB 3KPMA 1RSFA 2XIDA 4F9LA 3VGAC 4N0YH 2D03L 1LO4L 4LIQE 3HZKB 2VDPL 2RIKA 1E4JA 2N7AA 2WUBL 4A2LA 3L5XH 3T0AA 3R0MA 2A73B 4LK4A 3PDGA 3JZ7A 3RWEA 1DR9A 3BO8B 3LMJH 2ADIA 1NFDB 1NCNA 5HHPB 2C3WA 1P4IL 1BFTA 3L3JA 1CZ8L 1A1NB 1BHGA 1EEUA 4J1UB 4OFIA 3QQNA 5GPRA 3B8SA 1CXFA 1FORL 5DHVB 4QLRA 1QRNA 3ZE2F 4HS6B 4DFIA 3CFJA 1IC7L 4MD4A 4DKAA 4JRXE 4YHML 2V2WB 5IKCA 2H3NA 2GCYA 1BFSA 2OTUB 1YPZF 4MA3B 4HUVA 1Z5LB 3KYMB 1TVBB 2KPNA 4JN2A 4JFDA 1IE5A 2LAGB 5HGHA 2BCKB 3ES6B 1KCKA 2C1OB 5TDOB 3QP3A 3UTTE 5DF0A 5GS1C 2E8YA 3FTGA 4XZUB 4DVBA 2NY4D 3UBXA 1YPZA 1FC2D 1GGUA 1A7PL 2YPLE 4NP4H 5DJXA 2OL3B 3E6FA 3F7YA 5TE4L 1AR1D 4UDTB 4I18B 4H8WC 4KY1H 5DD1H 3KJ4C 1X4ZA 5E7FA 5MEQB 1HOCA 1HKLL 1NKOA 2WZPD 4PGBB 2NY5H 3T08A 2P44B 4ZNCD 4MZ2A 4D9RE 5ALBL 3KWWB 4YGVA 5IP4A 4J3SA 3N1FC 3Q3GA 4PJGF 3EYOA 2XNAB 1JIBA 4KDVA 4G8EA 4K71B 1KTKE 3FT3B 3DRQB 2N56A 2APXA 2GJZB 5E2VH 3MV01 1FH5L 5T5NF 1RI8A 3QPXH 2AJZB 2P5EB 4ZXBD 5EBWA 2VDOL 2CKBB 5FFLA 1A6UH 1B6DA 2DQDL 3EZJB 3TA3B 4PJ9B 4PJ7E 3CJJA 1HXYA 4NN6C 3OBAA 5DC4B 4NQDB 1A02N 3NMEA 3EJZC 4R3SB 1YMHA 1BQUA 2AKRA 4U7MA 5L8KB 3QNXA 3RWIA 2R9HD 4M6NL 4OQ1A 3ARXA 1VA9A 1U8JA 4EN3D 4WHCA 1ZMYA 5HGGS 1RZ8A 2WAHA 4IMKC 4JVUA 3WHXA 4FNLL 4WFHE 1RV6X 2GK2A 2G2RA 1CIUA 3HC3H 5FUOH 2H3NB 4GG8A 3O6ML 4YXHH 3G04B 3GSOA 1HXMA 4NZDA 4R97C 2FL5A 2XI9A 3RTQB 4X80H 1JGUH 1I4FB 3FB6A 1I85C 4OCRL 3IAGC 4C56B 4NJ9H 3MJ9H 3IFOB 2JELL 4OT1H 4ZAKD 1FAIH 4HZLA 5K59F 4NKMA 3X12B 4JPIB 2R1XA 3NN8B 1CI5A 1DSFL 3G9AB 4ZXBB 4GAGH 4GRWE 5EA0H 1KYOK 1MOEA 3RVUD 4LRIA 4NQSA 1ZGLM 4UMGA 1GGIH 2HMID 4IRJC 1ND0A 3LQAH 4NQDD 5JXAL 1QUNA 4X4MA 5IQ9A 3LRGA 2W65A 2KQMA 3KDMA 4XCEB 1T4KB 3KXFD 1UWEH 1LNUB 3OAZK 3I85A 3FN9A 5IHZA 3SDAC 1IEHA 1HQ4A 4C56E 4DVRL 2MKWA 1RZIB 4NNPL 5DGQA 2VERN 1JNNL 3NA4A 5D6CB 3WO3B 3QDJE 5D93B 3MLSH 4NQVA 3GBMH 4GG6A 1MPAL 4K3HA 1HXYB 1MCCA 2NY6B 3QHZL 4QRUB 4CU8A 5I6XB 3VFVB 5FGBA 2PTUA 4WW2F 3QFJD 5MEND 5HI3C 3DURA 2VLJA 5IFHL 1N26A 3MZTA 5F89B 4XPBH 5D96B 4E41D 2DN7A 5JUEL 5DURD 1Q8MA 4FG6C 4UT9L 1INQB 3BPNC 2A83B 3CK0L 5FM8A 2DBJA 1LD9A 5ADPL 4N5UA 1Q72L 4ONHA 1UT9A 4RMRA 4ZFZB 4QRPD 5D71H 3UAJC 5EC2A 2XY2A 1INDL 5BOZG 2EDHA 4NUJA 4JY6A 1A3RL 5AYUL 3M1BA 1A2YA 3OKYA 4U3XA 3G9VA 3I6LE 3SO3C 4WWKD 5DWUL 1FV1A 3OJMB 4NQDE 3JUYA 3RBGA 4XC1L 4JPIA 3GSOB 4LGRB 5FKAA 2F15A 4DEPC 1H3PH 1WZLA 5EU3B 3KJ6L 3MRPA 1I3RB 2XZQH 1OTUD 1LP9E 4AEEA 1EX0A 3MPCA 5I2IA 1OM3H 1DLHA 1MRDL 2GHWB 3MRRA 1YMME 5A3ID 1CT8B 2NNAA 3MLSL 4N9GB 5BVJA 4K3GA 4N0YL 3V2AR 4Y5XC 4U1KA 1KULA 2VUOA 2ZPKH 3SGDI 1C7SA 3RWGB 2MCPH 3ARYA 3DXAD 4TNVF 3DGGB 1UYWL 3RX8A 2VLJE 3MACH 4Y4KC 4PP2A 5ICZB 3QIWC 1HHIA 3CFKA 1TTGA 4YDKL 3FRUB 4MMXC 1WICA 5LXGH 3NCYP 4JM2B 4W70A 4CL7A 2I9TA 1BIIA 1BZ9A 2UZIL 2C3HA 5FDWA 4MNQA 2BHZA 2UV3A 4WHYG 4MJIB 1FZKA 4Y7MA 3BYTA 3VD5A 5GHWL 4HXAL 1G9NH 5IB4A 2C7UA 2GAZB 1ZEAH 1UB6A 3U9PH 5D1QC 2FLBT 3ARGA 4WI6A 4QT5A 5GS0D 1K9TA 1RIHL 1P84J 4GW4A 1IAKB 1AJ7H 1U3YA 3DYOA 1Q9KB 3MBED 1AR1C 3C2AH 2AJYL 1FVCA 5F97E 1IGJA 5I1LB 4L9LB 4R4FL 2H8PB 2DL2A 4JHWH 5HYSB 1L7TH 4YAQA 1BGXL 4P4RB 4GQ9H 4OV6F 4O2CB 1IFHH 4OCWH 5HGAB 1IC5H 4NRZA 4RDQF 5FYKU 5C0AB 2VDLH 1A3LH 4Z78A 4R7DA 5INCB 3S5LB 1KJVB 4EOWH 3HC4H 1K8DA 2E6PA 4PJBB 3QPXL 5C0RH 3SDAB 2A73A 2EC9U 3GSVA 3B2UD 1WBZA 2XKUA 4P2OB 5IOPB 2VNCA 4OIBA 4G43B 2HA1A 1C08A 2KQNA 4IRJB 4ORZC 1OGTA 4P2RB 4Y16A 4ZNEE 1W0YT 3Q6FA 2BX5A 3VXUE 3DROB 5HGBB 1QSFB 3JWOC 3WO4B 1UXWA 5EOCH 2YRLA 3IF1B 1RJZA 4TUJA 1QLFA 1L9NA 2X4OA 1YEEH 4LFHD 4MA7H 2R0LL 2P5WD 3HMWH 4LLVA 5BMFH 1SEBB 3OXSA 2QADC 2IBZX 3QIWB 5CLTA 2HMIC 2HLAA 1NL0H 5GS0H 2KZ1B 4MHHI 3BT2L 3L5HA 1D5MB 3ROLA 3WFHB 5ITBH 3ORJA 3TNNA 1CFQB 5GZNC 2P7TA 3VWKD 1Y18B 5GS1A 4LKCB 4GBXC 4OF0A 2GUOB 5FUOL 3HCVA 3TBTB 3L6FA 4W68A 4NWUH 2FYYA 1ZT4A 3OF6A 5C0BA 2JB6B 1I1FB 1WBYA 2R0LH 4LPVA 3CPLA 1WQVT 3TN0A 3QEUA 2IPKA 5DJ2B 3T0EE 4ODSH 4M48H 4PJBE 2HJKB 5DK0B 4QRRA 4PLOB 1MUJB 5E8NB 5C0GA 5IEKB 3D69A 1QFUH 3QYCA 4ZUWB 4GG6F 2NY3D 4NQXB 1KCLA 1NLDL 3OKOA 1IC4L 3WFBL 4M4RA 3C8DA 4AEIL 4LSSH 5DQJB 5FIEA 3PL6B 3M8OL 5IOPA 1W72A 3VXUA 1DDHB 3LQAC 2FB4L 5EOQH 1SJXA 4PGCB 1S5IH 3OHXA 3UX9B 5KVFH 3KGRA 3QB7C 4NCDA 3TT1L 3WV0A 5B3JE 3UMTA 3MCKA 4L8DB 1IGYA 1CXHA 1OP3K 5C0BE 4GXVH 5IM7B 1GVIA 5C3TA 3BIKA 5F93C 3PGFH 2R1YA 3UBXB 1SEBA 1NAMB 2GTWB 4HIJB 2VZVA 1AHWC 2OTWA 1T04A 4HS3B 4PJGA 2EO9A 3QO0A 3QEQB 4GLRI 1T5XB 1QLFB 3VMOA 3EJJX 1IGFL 3G6AA 4PRHB 1A7RH 2RCSH 1JWUB 2VXSL 1S7QB 5HY9B 3P4MA 5EU4B 2AJUL 3HG1A 5F9OL 1YY8B 3NA9L 3GSUA 3OAYK 5KTEH 4RFEB 4YDLB 5J1TC 1FHGA 1DE4B 2VB5A 4ORGA 1G7PA 3O11B 4L3EB 1U8LA 7CGTA 4TULH 3CPLB 2FX9H 4KZEH 3UXFA 4ZNEA 4G6FB 5TPWH 4S1DC 5ESQA 4WI2A 5HVHC 2HJKA 4K2UL 4PYHA 3FT3A 4WU5A 3K2UL 5B38B 1JN6A 2HFEA 1FBIL 4QHNA 5IBTH 2NX5A 5JDSA 1CS6A 1WBYB 5BV7H 3INUL 4G8GB 5E7BA 4HIIB 4UB0H 1P4LA 2NQCA 4TOYH 1S7RA 1U2HA 3FQNB 1GGCL 2OXGA 1OARH 1NUFA 1FNGA 4WVRA 3DURB 2ZUSA 3WUWB 4YHOL 4FFZL 4M03A 3RVXC 3SDAA 4IRSC 4FXKA 1UGNA 3IB4A 1XZ0B 2R1WA 4JQIH 3RTQC 1C16B 4BUGA 4LIQL 3QO1A 4BZYA 1CWVA 4JCLA 4ZYKA 1EBPA 3OSKA 5A2JH 2IGFH 2XACC 5IJVB 1HYSC 3O41B 3NGBC 3S96B 3MRDB 1LK2B 1VFBB 3T2OA 3RWDA 3KXFA 3V5DB 4F7CB 1M7DB 4UV4H 2XWJA 3CX5J 3EJYD 1FV1B 4R8WH 2E3VA 2NY1C 2V6HA 2JTDA 4S2SB 1I1YA 1V3MA 2A9ML 4P5MB 4Y1AA 1RJLA 3FQTB 4EN3A 5E8DH 4B7LA 4KUCF 3FL7A 4J8RB 1CL7H 2NXZC 3SY0B 1DVFC 4HXAH 4JDZB 3RVVC 5I8EA 5BQ7B 4YWGL 2WP3T 3DMMA 5DR5H 1EUTA 1I7RB 2IPTH 1VPOH 3UTZB 4XXCA 5C09A 5HYSG 5DSCA 4Y1AD 2IF7A 3QQ9C 3CVHL 5IHZB 2JIXA 4HS8H 5DJ8B 3S97C 1RZIA 4D2NA 5MERA 5I16B 4PG2C 1OPGL 1CXKA 2I60L 2I9LA 5JR1L 1O7VA 5C86A 3MFFA 3RWFA 2AXGB 2LABA 1KN2H 2NX5B 2APTA 1GJIA 1RFDH 5HHMB 1MCWM 2P8MB 2R4RH 4FN0A 2OZ4L 3C08H 2PYEE 2CK2A 3DGCR 1PAMA 1A7BA 5ETUA 4TVPE 3DUUA 2JJTA 1EBAA 1X5LA 2XWBA 6FABL 1T1YB 3HMWL 1ZLWK 4YPGA 5LAXA 1U3JA 3LKNA 3M1BB 4HG4K 5MENA 3G6JA 1G6RB 4JO3H 3MA9L 4UINH 5D7LB 1KELL 2V7HA 2DI7A 5CD3A 5ITBL 2UWEE 3UTSE 4CJ0A 3P4OB 3PHSA 5FM4A 1A6ZA 5A2IH 3DLQR 4X7DC 4OGYL 5JW5B 1HH9A 2XA8H 5I0ZA 4WFEE 3VU2A 1G7QA 1RUMH 2VAJA 4HK0A 3EOTH 4NRZB 1GZPB 4G5ZH 2ICWI 4FQXD 5CS7A 4WDIB 4WWKA 4ELMF 3QZWB 4ONFL 5GRZA 4ZUTB 3RA7H 5EU7C 3O8XB 3LB6C 4Y5VB 5GGRA 1F6FB 4N0RA 5C0EA 2HH0H 3MV8D 4PREB 1OD7A 3AUVA 1QFOA 1YDPA 4OCYH 4W6XB 3LEYL 5EZJB 1L4IA 3SDDB 3QCVH 5MEPA 2VDNL 1HH6A 1Z9LA 1M7IA 1E27B 5D7IE 3ARRA 4JO2H 4KK8C 5DJ6A 3U7AA 3VWKB 4DGIH 1S9KC 1AY1H 1A4KA 4M6MH 1NGYB 4S1SL 1DQML 3R8QA 4HKZB 5HD8C 4KTDL 1YNLH 3TT1H 3CX2A 3RUGA 4MJIA 4PJEE 2VR9A 4ODUB 4OZIA 4GH7B 3TYFB 3EDEA 1JHKH 1KPVB 1W0WB 1ZA6B 3GHBL 2Y9RT 2I9LB 4UDTA 4ZYKB 5FB8B 4X0KA 3TVMD 1NEUA 3S88L 1M71A 3ZE0E 3ARDB 5BOPA 4I0CC 4P4KB 4YHPA 1TJIL 3QUML 3QA3A 2EDEA 3O45B 2EDQA 3P3YA 3RGVB 2Y07L 4DW2H 1N6VA 1DEEB 1MCWW 4GO6B 1NFIA 1FIEA 4XNMB 3SE9L 3GMRB 3MUY1 5IVXE 4PTUA 4KPHH 1AP2A 5I1HL 3STBA 2OQJA 5KVDH 5JOFB 3R1GH 3T77B 5K93A 1HQRB 3D69B 4LCYB 3FCTA 3V8OA 5HHQA 1JHLL 3WS6C 4OGXL 5A2FA 1OARL 3FFDA 4QRTB 3ZDYE 3QCVL 3CC5A 3QH3A 4YDIL 5HDQH 3ZKMC 4IRJA 4JO2L 4IOFD 1IKNA 5BV7L 3T0ED 1I7TA 1U95B 2JK5B 1FLRL 3O3BA 5IVZB 4LDLB 3CLEL 1H3TA 1N5YH 3U82B 3G04A 4TYUA 5D1ZB 5LBSL 3H3BC 4Q9RL 2YKLL 3ZL4H 4H20H 3D3VA 1MWAB 4PREA 3JVGC 4PBVC 5LJYH 4EI5B 5EZJA 4ZFOA 5TE6H 2OSLA 3AGVA 4LSDA 1YEKH 4YUEL 2CUIA 3SPVA 2FCBA 1CLOH 2UWEF 4Y4HA 1GGCH 1JZ7A 3MJ9A 4AENA 3QO0B 2ZNXA 5EIQA 3VWJC 2FBOJ 4UNVA 1T20B 4LVNB 3X13A 5KVMC 5C2BL 4DW2L 3KJ6H 1CF8H 5T3ZL 4WI3A 2DQCH 1ZWIB 3X11A 2HLAB 4PJXB 2DLIA 4JRXA 4XWGH 2Z31D 5B8CB 3LS4L 4XBGB 1FGVL 3HE7B 4XH2A 3N1PC 4RMWA 2VITA 3DYPA 1TJGL 4IOIB 2YKLH 3PWNB 4KKBC 3ZL4L 3H3KA 2NR6C 1DE4A 1H5BC 1AO7A 5TE6L 1QO3A 3ARDC 5FO7A 2V7HB 4FQPA 2Q3ZA 1IGTA 5T5FL 5GGRY 2DWEA 3RDTC 3RGVA 4GG6B 2M1KA 1KT2B 4FQ2H 2ICWJ 1G1YA 4HWEL 3QQ3B 5FECB 3ZKQD 4PPTA 2X4SB 3FMGH 3LKRB 2BJML 3RDTB 5FA4B 3GSQB 1EEZB 1MRFH 2GIYA 3PL6A 2IPUK 5E6IA 1XGYH 3V7AE 1UXSA 5GZND 3V5HB 1P6FA 4U1MA 3EW3B 3HNSL 3DVIA 1I3GH 3CMOL 2IBGA 4E0RB 5DMGC 4YC2B 4PLJD 3JWDH 5E8PA 5JPMA 1AGBB 3SDDC 1QR4A 3GJEA 3JV0A 1JCKA 1X6LA 5E4EB 1DQLH 4W81A 5IFJA 3MODH 4WI7A 3PP3H 3ZYIA 4A6YB 1T22B 2Y5TB 5IJVA 2DQGH 1SEQL 3R8BB 2Y25A 4GRMB 5DUBA 4BSJA 5TQ0H 3OL2A 1TZIA 4K9EC 5SWSB 2YD7A 1KCUH 1MRCH 4PJDE 2NW3B 5DD5L 3F58H 5CD5D 3OJDB 1IM3A 4NOFA 4Y4KA 4XMKL 2BNRA 3BGFC 4OKVB 4OZFH 1BJ1J 4OM0L 3QUXB 4FABL 5FKPA 3MRIA 4HGMA 1U8PB 2FWOB 4JO1H 1PBYA 3JV6A 4HSQA 5IESL 3CFDA 1KB9J 1Q0XL 3HMXL 3GNMH 2ZSWB 4ODHL 3FT4A 1U8LB 2QQNH 5C1MB 3STZA 3W2DL 5KSUB 4LCUB 2EIBA 4RFEA 2H32A 3ARGC 1PG7W 4NFDA 2CD0A 1JN6B 1BD2E 2DMKA 5JHDD 2XNAA 3FT2A 3E8UH 5I76A 1UACL 1ZV5A 5ESAA 4ZD3H 4Y4FA 2BY3A 1S9WA 4JY4B 4M6OH 3ZSTA 4LARH 3LSOB 4CW1A 5ELIA 1CLCA 4CJ1A 5T1KD 1AO7E 2JF1A 3QEQD 1RUML 4NRYB 5ISZD 3B4NA 4KKCD 4PLKD 4LDOB 2P8MA 3QEHB 3KLHD 5ICXB 1QD0A 2JJSA 1I9IL 4A6YA 1A4JB 4MB3A 3ARFD 5HYIA 5F1IB 4U1MB 3WN5B 2JK5A 3VI3E 3PQYD 3HUJA 3UPCA 1TZIB 1BECA 2YC1B 5CSBA 1RK1A 1FFPB 1T21A 3B9KD 5CGYD 4CMHC 3MMEB 1RJZB 3VA6A 2HT4C 1F90L 5GRVL 4EBQL 4PJAF 1AKJD 1IEAA 4NM4L 3CUPA 4LKXA 4XCFL 1CFNB 3O2DA 1DBAL 2GCYB 3MLXL 2EDNA 2IBZY 4JM2F 1G1CA 3ZE1E 2H26B 5C6TH 3ARFA 3PWLA 1PKQB 1J8HA 4I3SH 3SDCB 3T65A 3TO4D 1QHPA 4JDZA 2FEEL 4GAYA 4HGWA 3QSKB 5EO9A 1I1RA 1HK6A 2VLKA 2XYCA 3CXDH 1JNLL 3ULUD 2O5XL 3SE8H 5FKPB 1S7TB 3DNKA 3K7UA 4RFNC 4Y2DB 5CJBA 4KJWD 3HB3D 2VDPH 3HCVB 1GC1L 1R5WA 2KBGA 2Z4QB 3NCJL 1WVZA 3S3PA 1AO7B 1FNFA 4JQXC 2OJZL 4X6CA 1NCWL 2FH8A 2NY6C 3NIDE 3AC0A 1Y0LA 3T1FA 3KPQA 1MFEL 1NMBL 2FR4B 4WUUB 5E9DA 2ZOKA 3S98A 5GHWH 1WUNT 5F7YC 1N59B 3VXQB 1C5DB 5EU6E 4NQDA 1FYHB 4LP4A 3TBWA 5EOCJ 4Q9RH 3G5XA 4QCIB 5CWSA 3NFNB 1JGDA 1T03H 5ESAB 1N6QL 4G3YL 1NGYA 1FIGH 2EKSA 4LLVB 2QSQA 1UADC 3VXSB 2XPGB 1SJEB 4EIGB 5IMMA 5E6YA 8FABA 1CZ8H 3HR5B 1UM5L 5CIPA 4IBLT 1QLEH 2EDXA 4Y19B 1CU4L 5FCSH 2JJVA 4OF3A 4YDIH 5HDQL 1BAFL 3VD4A 4XCFH 3KLHC 3UZQA 2OR9L 4F80A 4KWUA 4YXKH 1DFBH 1D5BA 4MDIB 3PV6B 5F9OH 1K8IA 5EB9A 4NN7B 2YXFA 1SJVA 5JQ6H 4KVNH 4D0BA 3E1F1 4X6FA 4OCLC 4ACPA 1RUQH 2JB6A 2OYPA 1II4E 4AK1A 1JFQL 1KUMA 5DHYB 3OKKA 2X4UB 4DOHB 3QUXA 2Q8AL 1QSEA 5SV4A 2QR0A 2UY6A 3AROA 1EAPA 1JPFB 3C9NB 3C5ZC 1E0OB 2J8UA 3P4MB 1CD0A 4XTRC 4WFFD 3CDFA 1GXEA 4XT1C 3KDMB 2A2QT 4B53A 1DQJB 1NMBH 3KPSA 4Q7DA 1DN2A 2P8LB 3FB7B 3PGDB 1DUYB 4KRNA 2VZUA 3S34H 2EZ0D 3EYSH 4L3ED 5J9PA 1KJMA 3FO9B 3GZKA 1KBGL 4TQEL 2D0HA 3FO0L 4XAKE 3SE3C 5C0CD 3FFCB 1A4KB 4Y4FB 4ODVH 3F8UB 1HQ4B 2XOTA 3HI5H 3RUGB 4P2CG 1UWGH 4M7KL 2NY5L 1UB5A 5L7XH 4Q9QH 2CPCA 3GSNB 1W0WA 1ZA6A 5E2VL 4Z7VE 3CSPA 1TVDA 3IU4H 3PWUB 4BQ9A 4YXKL 3ZT7A 4QTHA 4OM0H 3QO1B 4WUKH 2A9MH 4UNUA 1ES0A 3RIAK 5INDA 3X3GH 1NANI 1TITA 1I1AC 2A83A 3RZWA 4APQA 1MI5A 5KSAD 2WIMA 5F71A 5EA0L 1CGWA 1NFIB 1DUZA 1SEQH 2BOBB 1IZKA 4ZOAA 3WEXA 5GRWA 2I5YL 3LV3B 4Y4HC 2GT9A 1DBMH 3B6SA 4K9EH 5GQBA 5IESH 1LILA 5DTFA 3VWJA 1SBSH 1FDLH 5JZ7D 2P1YA 5EDXA 2FATL 2OQJB 3OPZL 5LGKA 4NKDA 3U46A 1UWEL 4WI9A 4OBSA 4X7SL 4HS8L 4OTXL 1ZLVH 3B3IB 3OR6B 4WTWA 4GS7B 1A7QH 5E95B 2GSGA 4UNTA 2AXJA 3BN3B 3O2VL 1Y6NR 3HI6H 2LVCA 4EN3C 4R90H 3E8UL 1OLZA 4LCCB 4C57C 1RZ7H 1H15B 3IT8D 3FFCD 3VXTA 3VRJA 1ITBB 3ZE0F 1G7JB 1NGQH 2B7DT 1Q0XH 2P5EE 3B9AA 4X80L 3ULVD 3DTXB 3N1MC 4O2FB 5EZLA 1CFVH 4K9EL 3MV8E 3GJEB 4RAVB 2CXGA 3VXOA 3I75B 1S7VB 4M1DL 4X6EB 4BFBD 4G6ML 5JQHC 3IU4L 5IB5B 5E1AA 2PYEA 3QQ9D 5HHOB 4K8RD 5EG6C 1EMTH 1PGRB 4MQXD 4MA3A 4YHOH 5J1AB 1F90H 4OZGF 1GGIL 4TN9A 5IFAL 3RPKA 2EYSA 1U8KB 3VFRB 3VXRE 4D94A 3O3AB 4FQHB 3VDCA 4DVBB 3H8NA 4YHLL 4M7ZB 5GGUB 2XTJD 3E6FB 3R06A 1AGCA 2VE6A 4JFYA 1AGFB 1IAMA 5FF6A 3CVHA 3O8XD 3SKMA 4M43H 1D5BB 3WUWG 2D7OA 2E8ZA 4PJXA 1FL3A 1NFKA 5F7EH 1DQTA 3LPWA 1F4WH 2NXYC 5DD6A 5C0AE 2FO1A 1LVEA 3UTZA 2A1WL 4JRWA 2IADB 2I07B 3AU1B 3HAEB 2GJZA 3BP4B 5D7IB 5D1ZD 4HFWA 3CFEB 3GGWB 1NJ9B 3NPSC 4H8WL 3DVFA 2FGWH 4JPWL 4WU7A 1F3DJ 4HK3N 4PGJA 4N90D 4LCCA 1KPRB 2VDKH 1EJOH 1F11B 2WMPA 1FPTH 3BD3A 3QDJB 4WW2C 3ZHKA 1Q9LA 3G08B 2R23A 4YH6A 5B4MC 1B4RA 5DYOB 3WNPA 4R8WL 2EIEA 3ZHDA 3W11C 3ULVL 3A6BL 1S7SB 5EIIB 3I2CH 4OGAD 4PRBA 2GYSA 3BQUB 2EKJA 4KK5D 5ANMB 4TUJB 4E5XB 4NSKB 2DD8L 1EHNA 1NANH 3HLAA 2ZG1A 2VQ1B 3THML 5JQ6L 2D9QB 4P46A 4AMKH 1IAOA 3HI1B 5TE7H 5DS8B 1LDPH 4ZO6A 1JZ8A 1OAUH 3QCUL 3NBNA 4XTRD 3TO2A 5HSFA 4ZFFA 3V7MA 3NZHL 4WJ5B 3VFRA 1J10A 4UDUA 1ORQA 4JPKL 5I30L 2QTEA 4IRZH 5E99H 3HNVH 5E5UB 2AJVL 2VUYA 3HFMH 4HMCA 4LFHG 3K4DA 3GRWL 1OAZL 4OIIL 5GXBB 2I07A 2ESVA 3BHBB 3TCXA 3F62A 3I6KA 3UTQB 5DEGA 1DQDH 2BSRB 5K9QG 3EYUL 4QYOA 5DMJB 1WJ3A 5DD3H 3KPQB 1ZLWH 3LIZL 1WC7B 3K8KA 4RFOH 4YFLF 5D2LF 5JOFA 5E9DB 2VDLL 2X9YA 4YBQC 4G5ZL 5D7KE 5D2LB 2FIKA 1D5XA 4O51A 3G5XB 1DEDA 4LLQB 3RA7L 1A0QL 2Y6SD 3GMQB 1DDHA 1DQQA 2BVEA 1L0QA 1A4JA 1I1AD 1FNGB 1CYGA 2KH2B 2IQAB 2EDKA 5HPOA 4LLYA 3GM8A 1DQDL 2LAAA 5IM7A 1IKNC 5JXAH 2HVKA 3CFCL 1DANT 1U91A 2XZZA 4LKXB 3NCFB 4CDGC 1VDGA 2CKNA 1WZKA 1A7OH 4OD1L 3CFJB 2ZNWA 1UEYA 3L3OA 4JM4L 5CHNB 4QF1A 1JZ2A 4JFEA 4NKOA 1G84A 3VXSD 3ZDXF 1OAQL 3AM8A 4R4BB 1F13A 3O4LA 3QHFL 2FO4B 2IG2H 2D3VA 2HH0L 3HG1B 3T77A 2OTWB 2L0DA 4HS3A 5HYJA 5T1LA 3SJVB 1NLBH 1OF2B 5FF6B 3FQTA 3LEYH 5C0JA 2QJDA 4Z7WE 2HFGH 4XBPA 3LH2L 5EUKB 3LIZH 4R90L 5EH1A 2HKHH 1I3GL 3CMOH 4YIQA 5BVJB 4MHHG 3MRKB 5BJTA 1FO0B 2XRAH 1IC4H 4KPHL 1MJUH 4HUWB 1I7UB 3SCMB 3KPPB 3U6RB 1VADA 4F3FB 5KOMC 3C5ZA 2H32H 4MDJA 1EVUA 1NJ9A 4AJ0A 1A9EB 3AMKA 3IJYA 3EO0B 4F7EA 5DZNA 1MFAL 1PYWB 1HYRC 1GHFH 2X89A 2F53D 3RDTA 3RGVC 4L1DA 4OQTH 2MNUA 3HC3L 1TJIH 5KJRL 1YECL 4P4KC 1J9CT 4U6YB 3VGGA 4Z9KB 3V6FB 2NXZB 4I5BB 1BVKA 3T8XB 1QRNE 3RRQA 2YD6A 3PV6A 3QXWA 5CD5C 3C5ZD 4K7FA 1NLDH 3MNWA 3BESR 5IB3A 2NY4C 5A3IC 2PF6A 2IQAA 4XH2B 4JE4B 2DQJH 1XGPA 1AE6L 4HJGA 4ZO8A 5FOJA 4YAQB 4OUUB 1JHTA 2FX8H 4PJCA 4UT7H 4NQUA 4JDTH 3RU8L 1OL0A 5L2JB 2BVUA 3KJ4B 3OKLB 4GMSH 3GK8H 4M61B 3ZTJG 5EO0A 4DQOH 2X2YA 4GXVL 4X8JB 4KQ4H 2OL3A 5HYSA 4YXHL 3WJLA 2CMRL 4X5WA 2F19H 4OZ4A 3S7GA 4R26H 4EEEA 3QPQD 3QZWG 1DLFH 1FLRH 1F45A 2ZOLB 1FG2B 3MLZH 4GKZB 5T1MB 3CZFB 4IS6A 1UQSB 3ZKMD 3DX8B 3D18A 4U6XA 1MPAH 5T1LB 4V1DE 5GGTA 2EDYA 2MHAA 3I6LD 3IF1A 2IALA 3WLBB 5I18L 4LLDB 5I76B 4IMLA 4JN1L 5IBTL 3TJEH 4WWID 4Y16B 1QBML 3MRGA 1N2RA 3ECBB 3VXMB 2VR4A 5TF1L 1GGBL 5D7JB 4D0DB 3T2NL 2X4OB 1LP9F 4M93B 1XF2A 5TPWL 1IGCL 3V6FA 4JPWH 3MA7A 5DGRA 3VFVA 4WFHD 4QRSB 4YX2H 1BGXH 1HEZB 3VGAB 5L88L 1NCUA 5F72S 3AAZA 5JPNA 4PRNB 3NIGE 2D7NA 4U6YA 1AGCB 1TCMA 4KH2A 2XQYG 3BAEH 1S5HB 1NCDH 1CICD 4GSDH 2FD6L 5HHXH 3WXWL 4U0QB 4ZPTA 4PGDA 4YEFA 5F8QC 4CNIA 3WD5L 1U8MB 3BI9X 5FM5O 5GIRB 3A6CL 4J3XA 3EDFA 1JZ4A 1CD9B 5F8RC 3EYUH 4IIQA 5IB2B 3EGSA 4X9HA 4MJ2A 4DKEL 4ZDHB 4BZ1L 3AY4C 2ZSVB 3VXMD 4LPXA 3RTQD 4ODTH 1WISA 1XF1A 2VXVL 2ZP0T 3TV3H 2GQHA 4X6DA 4E42A 2BRQA 4W4NA 4D9RD 4UILH 2ZCLH 2DM4A 3NCBB 2A38A 4TVSa 9CGTA 5CBAB 4X6EA 3ARVA 4KTEL 3U0PB 3D3VE 3M17A 5DD5H 1J88A 5HI3D 5E8DL 4PGCA 3RL2A 5HXMA 1R6VA 3AMLA 1FLTX 2R4RL 1EZVY 1AHWB 3BRFA 5A16B 3MLYH 4E41E 4JFOB 4OLUH 3RWGA 4BZ1H 3HS0A 3BGAA 1R5VA 3QFJE 3O3AA 3B9EA 5KANI 2OZ4A 1EXUA 2PW2B 4G8IB 1FL6B 1OY3B 2AABL 3MLWL 1UKQA 5L9DH 3F5WA 4CU7A 4EI5A 3VXRB 5DK3A 4BQ8A 4ODSL 4ELKA 5K59E 4JY5H 3ZE2E 2VDRH 4JHBA 3EJYC 1QFWI 6FABH 5A2LH 3UCRA 1FE8L 2Z91A 4KJQD 1GL4B 1V7MH 2W9DL 2O5ZL 2V17H 2R69L 1SY6H 1W8NA 1LE9B 1LO2H 1R3HB 4FP8H 1GAFL 1P4BH 3SKUD 5F9WC 1S5IL 4KV5F 4PJEB 4N8VB 2HP4A 5I1IH 2JE8A 3I9GH 5D5MF 3EYSL 4P49A 3KNBB 3F7VB 2ZOKB 5DA0B 4KKAC 4S0SD 4OLYH 1AC0A 3EOTL 3FCTB 5HVFB 1KT2A 4GAGL 3IKCB 1GHFL 3L5IA 3TLRA 1IM9B 4LSVH 4PRAA 4OD3H 3VFWA 2X5PA 4H1LH 4U4BA 5DQ9A 1T66C 3H2WA 4L4TA 4XP5L 5FGCB 2W07A 1AC6A 3EAKA 4DGIL 5DVNA 3VCLB 1ZT1A 1KJVA 3EKCA 2CRZA 5EIVA 3RGVD 3BRGC 1VCAA 2P49B 4PRPE 1NEZG 1CE6A 4G9DA 3N85H 4RMQA 5A16A 5L9DL 4M6AA 3MJ8B 5EU6A 3WIIL 3RY5A 4PG9B 3UROR 3O6FD 5BRZA 1MY5A 3C60B 3G5YA 4AIXA 1GC1C 3T09A 4NC0B 1R3JA 4KJYA 2UWEB 3UTSB 4E5XA 1UB5B 5MP6H 1K5NB 2B4CH 4Z77B 3D3VB 2QQLH 4YO0A 1HE7A 4FQ1L 5EWIL 3U2SB 2BXZA 4U1NA 1AD9B 3QFJA 2IQ9L 2M26A 4MJ6B 1M7XA 4I48B 5IB4B 4JG1H 3I84A 2VXQH 3T4AB 1QFWH 4K07A 2CO7B 3LPGA 5L2KE 1KIRA 3O6FA 5BRZD 3IGAB 4I18A 5CEZD 2BK8A 3EYOB 3ARGB 2B2XH 3PG2A 5FYJU 2X9WA 5E2TL 2CMRH 1JPSH 3L3GA 2EH7H 3QPQC 5J9PB 2YUVA 4ZS6C 1LE9A 4Z95H 5TDPB 1ERNA 4HKXA 2AQ2A 5JORB 3MBEC 4OI8A 4PR5A 4HWBA 5DJDB 3CDGA 1HINL 1PG7L 5CSZA 2VLME 1B88A 2Y07H 3QULA 2AKRB 4PUBH 5JO5B 3D39D 4MWFA 1EA9C 4PRIE 3N85L 4KC3B 4ZUUB 5IUSA 2LFGA 2A6JB 1M6OB 5KSBE 1LO0H 4OBRA 1FCGA 2FEEI 1RZ8B 3WHXB 3RNQB 3KHQA 3OR7B 5F7MC 3U0PA 2ATPB 3NIDF 1EIBA 1JNHA 4YX2L 5INDB 3KYKL 4RAUA 1U91B 2W0FB 3LOWA 5I1GL 4LVHB 1I8LC 2B20A 3W9EA 3IDGB 5EULV 3BGMB 3HUJB 2P45B 3WS3A 5E70A 3MR9B 2F53B 3MRQA 3V6ZA 4LOUC 3VMPA 2ICEA 3PL6D 1Z0NA 4NZRL 2W0PA 1G9MC 4HUUB 3PABB 3WHE0 3DV6A 4M9PA 1UEMA 2NY3B 4HUKB 4G6AD 3ZT6A 3OWEA 4Y5YA 4NKMB 3ZSSA 5J12B 1DBBH 4Z7OF 4ZPVB 1K5NA 4AL8H 3CAFA 2H6PA 3BPNB 1FG2A 5C0EB 3FB8A 4PJ9D 4WHTA 3VGHA 4H0HB 4IRSA 1VB9A 3I02A 3S4SB 1GZQA 5GGSA 3C2AL 3MJ6A 2UVFA 4QNPE 3MROA 1Y0LB 4C4KT 3VGDA 1Q9WB 4LLAA 1GOGA 1DVFD 2ITCA 1UFUA 2YZ8A 1IM9A 3SO3B 2VLRB 2EYSB 1S9WB 4D0DA 3MX0A 1I3VA 2AABH 3AS1A 5DZLA 3STLB 1IGIL 2NY3C 3H9HA 2Y7QB 3IAPA 5IGXL 1MRCL 4XWOC 4YZFF 3REWB 3RL1B 1FZJB 4NZRH 4XRCB 1S78D 2EDWA 5JHDA 2BP3A 4GJTB 4UUJA 3OTTA 4PBWD 4XPAL 3QIBD 3QDGD 4X6BA 1RZFH 2XFXB 5ISZE 3WSQH 1DVFA 3GSWB 4PTUB 5B8CC 4M00A 1HWGB 2WLZA 1U9KA 4RGNE 1J1OH 3U83A 3HNSH 1P7QD 1YQVL 3GEWB 4L8BA 4LVNC 3MRJA 3LCYA 3MYJB 1RURL 4P46C 5BS0A 3OKLA 2ICWB 5EO0B 3ARDD 3U1SL 4O58L 1MCNA 5CJXA 1GH7A 4PG2A 4HF5H 3BT2H 4J6RH 4Y2DA 1WWCA 3SDCA 3T65B 1FE8H 2ZOLA 4KK9C 3QCTL 5BZWB 2YPKA 4EQ3A 3P9LB 3CXHJ 3CH1B 1MJ7H 4UQ2B 1TIUA 3MBEB 1UJ3B 1MQKL 4YNYA 4AM0A 4PJ9C 1NCBH 5BQ7A 4HKBA 4KMTL 4M4PA 5F9WB 2HLFD 1J86A 3FHAA 2HVJA 4Z7WA 3EOAA 2R0WL 2X40A 3CFBB 5DJDA 1NSNH 3FOLA 5HI4D 1YQ2A 1F4HA 3TGXA 5JDSB 4HC1A 4OT1L 5HYJE 1I9IH 2ADJA 4K94C 1GPOH 4Y2DD 1XT5A 3SDCD 3JBG7 1ACYH 1CDIA 1N7MH 5CSGA 3DBXB 5D8JL 1KV3A 3ILPA 1DQQB 3TEUA 3HR5A 2BSSB 2X4PB 2EYTA 3T3MF 4OB5L 4X5XA 3HE6D 1NC4A 2HN7B 2IMNA 3HUJF 3LZFH 4EVNA 3U30B 3NFNA 2L7JA 4NFBA 5JMOC 4KDTA 1IMHC 3BP5A 1HOCB 1K3IA 4GW4B 2IQ9H 5J0BA 4B41A 4NC1C 3IETA 4K3JL 4TSCH 5SWSE 1Q9KA 3DHMA 3MLTA 2VXQL 2XQBH 4PRIA 5FK9A 1JGEA 2C7UB 4RA0C 4NC2B 1RFDL 4DCQB 1KTDB 4L29A 4L9LA 4OSUL 3H42L 2FGWL 4UIMA 4LARL 4MB4A 4NKIL 1RK0B 4RWYL 5HBBA 3HPLB 2VH5H 2VZ1A 2O5XH 5DEGB 4JFEB 4PJXF 2B1HL 1CXIA 1R3KB 2YWYA 4R7NA 5TGBB 1JL8A 3MRLB 1EHLH 4F58L 3WFZA 2KZWA 3ZYZA 1QBBA 3O4LB 5CZVL 3N0PB 2FHCA 1JYWA 4HHAB 2CUMA 2X4QB 4D3CH 5DRWA 3Q1SH 1IC7H 2J6EA 3AM8C 5DVLA 5LGHL 3LKOB 1P9MA 3ZTJH 1UXSB 2A74B 2D03H 1WV7T 1YUHA 4G43A 3SKNB 4R7DB 4AM0B 2Q6WB 1FYTA 4X6DB 4EBQH 1H8NA 4P2RA 3GSVB 1ACYL 2DQEH 4O9HL 1JPGA 1BVLA 4GG8B 3FKUS 2N4IA 5HPMB 4PJIE 3V79C 3S36H 3IJHA 4ONFH 1TPXC 3MRMA 1ZGLB 3DX7B 5DJXB 1QKZH 4NM8L 1MF2H 3MRIB 1F4XH 1RZKH 2HTKC 5KVGL 1B0RB 1M05B 5F3BA 2O5YL 4KVCL 4R4NC 4DN3H 4UTAL 5IW1A 4XGZB 3OXSB 4DQOL 1NUGA 1U8IA 2V7NA 3C2SA 2CK0H 4M6ML 1KTLA 2EYTB 4JCMA 5F88A 1HI6B 3OJVC 3ZE1F 3QBTB 1A6UL 1QSVA 3TC9A 5DMGD 3PJSB 1XF4A 3C60D 5DHVH 2CDFA 3EO9H 1OAKH 3TA3C 4FOMA 4PJCB 4LCUA 2G9HA 4OZIE 4LMQE 4X4XA 3H9SB 2YD9A 4WGWB 2R0KH 3FT2B 4U6VL 1RAMA 2IADA 4I0PC 4XVTL 3SDXA 4D9QE 1AH1A 3O6FC 1D9KC 3BZDA 2IAMC 1ZKAA 4L4JA 2Z8SA 5D7IA 1L0YA 3O0RH 1R3KA 4ENEC 4NO5B 1MHEB 4MNQE 4H25B 1AP2B 3SDXF 4YFDB 4XVJL 2E27L 3S35L 1VFOA 2X6MA 1MAJA 1LO3L 3HPJA 3MBEA 4M3JA 4HV8A 1NBQA 2ITDA 2I25N 4ZS7L 2AV1A 2PR4L 4JFFB 4AEHL 3LQMA 1A7NH 1Q9OB 2MPAL 3GIVB 2G75A 1CLOL 3QXAA 3MV8B 1LE5B 3EYQD 1D6VH 1MFAH 3FQUA 3EDJA 4RNRB 4CVXB 4KJPC 3BWAA 1TPXB 1IGYB 1XF3A 5C2BH 5F7WC 1WFTA 1JHTB 1U8KA 2APFA 3TZVA 4O2EB 2HKFH 4BFEA 2JCCE 4F57L 1JTPA 2G60H 4NCC1 1H5BA 4AG4L 3ARED 4KTYA 4J4PC 3K1DA 4JFHE 1I3RA 3T4AA 5JIHA 3O4OC 3SCMD 1SVZA 4X9BA 4HX1A 1A21A 4DVRH 1WFUA 1I8LA 1PQZA 2IEPA 5AZ2H 1LP9A 3IAQA 2VLLB 4LNRB 4M6OL 4UBDC 3ARQA 2GTZA 4XB8A 1KIPA 2VN4A 3KPNA 1QPPA 5ESVB 1P6AB 3WXVH 1D7FA 3TV3L 5E08H 3T1FB 4FQIL 4QY8A 3BKML 5C0FB 3N06B 1J87A 2E9IA 3MV7E 2MTPA 5CAYB 5D9SB 3HMXA 4M5YL 1NBYA 4JREC 4WEBH 5BO1H 2F8OA 5L7XL 1X6NA 3PWNA 3EO1A 3QT2A 4XVJH 4KK6C 4LNVA 5ID1B 5FO7B 4HT1H 1JYVA 1INQA 5I73C 4S1RH 2EXWD 1DBML 4WGVB 2OI9C 2COQA 2ZZUT 3IS0X 4A2MA 1PJ9A 4JANA 3QULB 2CO6B 3DARA 5D2LA 3AY4A 2VO5A 1KIQA 1ZANL 2VABB 4GRWB 3RIFK 1MI5D 2Z31B 1KPRA 3MJGX 3FFCE 4TVPH 1FZMA 1X4YA 3WKML 2DKMA 1YJDH 3MBXH 1UB6B 4JRYE 2XWJB 2YA1A 4KQ4L 1J5OH 2X7LA 2XZQL 4U31A 3PF2A 5DMYA 1IT9L 1BZ7A 1NGQL 4TUKL 1ZHLA 3WUZA 4G6JH 4LF3B 2PTTA 3IDGA 3MV8A 1LE5A 4QHMB 5KAQG 4XMLH 3QUZA 1HIMH 3WCYA 3GDBA 4ZQKB 5D1XB 2YEZA 3D1MC 5HGHB 1QVOB 3HZYB 2C3XA 4DAGL 3UPRA 1U92A 2WIIA 2X4NA 1WIUA 4KAQH 4HPYH 4ZDHA 5DS8A 1N4XH 2QKIB 3WKMH 1FN4A 3LQZB 3B2UC 4P5TD 5AWNL 3QDMD 1NGZA 4X98A 1BQLH 2R8SL 5B8CA 1I7RA 5DD0H 5ACLA 3U0WL 3EDKA 3PGCA 3I02B 3WLWD 4OD3L 4GKNB 2K9UA 5C6PB 3SGDH 1QACA 3CH1A 4Y16D 1HWHB 1IGCH 5F3HA 4CVWA 1CE1L 3H9SA 2JJSC 5FO9B 5A1AA 2NY2C 4J3WA 4PLJC 5CJXC 5CEXB 1Y6MR 1F42A 4GG6E 4N68A 4PS4H 2YK1L 3UTQA 1F02I 5L2KA 4I2XB 4L3CB 3EO1B 2AJZA 3IDXH 1J0KA 3GM0A 5EBWB 4NKQB 1F6AA 3MXWH 1JTTA 1KNOA 1XH3A 4PJ9A 1BBJA 4QY8B 3U7WH 1YYLL 3BPOC 1UJ3C 2EEAA 4PJ7A 4QTHB 4IRSD 4AQOA 5M95B 5DJ0A 2APBA 3OGOE 3VGBA 2VDKL 4LHUB 4OFYA 3LS5L 2NY7H 2CK0L 2BHYA 2OJEA 5DUBB 3OF6D 4MSWA 1BZ7B 1E4XH 5C0BD 3RL1A 4GBXB 1J1PL 3MNVB 1IC5L 4NQTA 4RBPH 4Z0BL 1XF3B 1TQBC 2G2RB 3OAYH 4UIMB 5GISH 3QDGE 1TNNA 1HHJA 4Z8FH 4JO4H 1RK0A 3CH8A 1X44A 2AQ1A 2GITA 3LEXA 2A9NH 4KI5F 4L5FL 4GW1A 4RSVA 3GFUA 1JZ6A 2ZUQB 3L3KA 3U46B 2Q20A 1T7VA 4QF1B 1NGZB 2EDFA 3I2CL 4QHUA 1F2QA 2YPLA 1F4YL 4L9LC 1B2WL 2NY7L 3LS5H 4MCYA 4TTGA 2F8XC 1G7QB 1MVFA 3MLUL 4RGMC 3QIBC 1R3LB 1GIGL 3VMNA 4OLUL 3VFWB 4RFOL 4PRPD 4ALAH 1UVQA 4U6VH 5CBEA 4YJZL 2A74A 4OCWL 5HYFA 1ZT1B 2QHRH 2DQUL 4WUKL 2B1AH 5IB5A 2D7PA 2H32B 1QSZA 4PV9B 4PJHA 1EDQA 1BOYA 1Q0YL 5IB1B 4F7PA 5DQDH 5K9OA 3VG9C 5F1OB 3VD7A 1ZA3B 2IALB 3WLBA 1CDBA 2BC4B 3BDYL 1T0MB 5FUCE 4HWEH 2P24A 2BHUA 4HIJA 5I71C 4KZDH 5IK3A 2VAAA 3VXQA 5I75C 1F3DH 4AT6B 4NNYA 1J1PH 3HG1D 4AG4H 3GRWH 4F37F 2OMBA 4QTIH 4PRIB 5JDJA 2DQFB 3JWDL 5GISL 4MZ3A 3GMMB 1KFAH 3G6JF 4UIKH 5H94B 1HEZA 4KDWA 4XC3H 5IQ7H 1BQHG 1A0QH 2NR6D 2VDOH 4JFPB 5HHOD 1A7PH 2R2BA 1HHGA 5DO2D 5IG7A 3CGTA 2X1PA 3E0GA 1HSAB 3WS3B 2F5BL 5D1QB 1K4CB 3P77B 4P2RD 5IIEA 5JW3H 5FKAB 4ISVA 4BSWB 2OMNA 1T3FB 2YRPA 4M6NH 3PWLB 4JGUA 4F9PA 3RWEB 3KYAA 3HZKA 1I8MA 2VLKE 1FSKC 1P4LB 3OKKB 3TH2T 5CEYA 4S0TD 3F6LA 3WE6B 1KBGH 2BY1A 2R2CA 1ZVHA 4Y5YC 4ZUUA 3H9YA 2YD3A 3LPFA 1WWAX 1S8DA 4QWWD 3FZUD 5JW3L 3TWCH 3Q0HA 3JWDC 1CT8A 2G5BB 1LO5B 5F6HJ 1B0WA 3HB3C 4P9HC 3EOBA 3BSZH 5TDNA 3LB6D 4BQCA 4U6XB 1A6PA 2PW1A 3UJIH 3OKNB 3U9UB 1T04B 5ENWA 3GIVA 4NBXB 2FJFB 1OHQA 4WUUD 2X1QA 4HJ0D 3DX6A 4EOWL 3BPLB 4GRLA 4HIEB 2C5DC 5T1LD 4HWNA 5DJCA 3O2WL 1F6LL 3IDYC 1YPZB 3TWCL 1YQVH 4P5KB 2BVPB 5IMLB 1IAIM 3BH9A 3MUGB 2W9EH 4XRCA 4PJDB 3GUTA 1QFHA 5I8CB 1ADQA 3QUKA 1UKSA 3G6DH 3RHWK 4H1LB 3BH8A 3NZ8B 5ISZA 3GMNB 2BDNL 2R8SH 4GMTH 3SKJL 5JPNB 2CIIA 4EZMA 3OKEA 1JI1A 1FQ9C 1EEYB 3D6GA 4R2GB 4JDTL 1KYOJ 2GSIB 3NIFE 4OFVA 2CDFB 3QXDB 5D2NB 1MEXH 1BWWA 3IRPX 5IF0A 2DIAA 4GW1B 1CGYA 2YSSA 3LY6A 2AW2A 5K9KB 3GMQA 5C0AA 5E6ZA 1MH5A 4JGMA 3KNBA 1LK3L 4JFDD 4M1DH 3MUZ1 1REIA 3IYLW 4LBEB 5TE7L 1BD2B 3FB7A 3PGDA 3IKCA 5IFJB 1J8HD 1MCQA 2EIZB 5JHLL 5C0IA 3BW9B 1OAXH 4P23A 4PJ5D 2R2HB 3HR6A 4R26L 4RAHA 4H26A 4PJCE 1U6AL 4Q0XL 3PWPA 3JTTA 3VFMA 5JHDB 3EYVA 1TVBA 2DKSA 3GK8L 1PY9A 4FQJL 4MS8D 4LQFL 4MX7B 3QDMB 4HWBH 4ZTPL 5GGTL 2DICA 5C9JB 1YN6B 2ED8A 3IU3B 3OKNA 3SQOH 4JJ5A 2AERT 4C56A 3QIWA 4OZHB 3IFPA 1TZGH 5DC9B 4DN4L 2NY0D 3QG7H 3PWPD 3GIZL 3V6OA 4HBCH 2DQIH 2IPUG 3IDUA 2QSCH 1OSPL 4YGVB 2FO4A 2VLJD 3QWRD 4H1LA 3T2NH 2HT3C 5C08E 3TF7C 2VISA 5J11B 3EYQC 1RZGA 2R0ZH 2AEQH 3P9LA 4D9QD 3BH9B 4KGJA 4L4VA 4MJ5B 1I1FA 3EOYG 1V7NH 3FT4B 1HHHB 4HPOH 5D1QA 3WD5H 3M07A 4XI5C 3UJTH 4PB9H 3VFOB 2QEJA 4UI2A 1A9EA 3IJYB 3Q6GL 3OGCA 3QRGH 4BZ2L 1QA9B 1FL3B 1AXTL 1ZE3C 2GUOA 2ZCLL 5TGBA 3NVQA 4HUWA 3RWJA 3BOVA 1VGEL 3SCMA 5M7QA 3IVKB 3KLDA 1EK3A 4UTBH 5FGCE 2BNQA 1OSPH 5EOTA 2AJYH 4NRYA 1FRGL 3AS0A 4LBEA 3JSSA 4YDVB 5DC0A 5SV3A 5B3NA 3OX8A 4AH2A 2GJ6D 3GI9L 5ICXA 3O4LE 4KGLA 1RIHH 3LSOA 1MCLA 2UZIH 1GYAA 2DTSA 2X4PA 1KNOB 1JMXA 5I1JH 3TO4B 1XCTB 1Z0MA 1S78C 4PRAB 5AAWA 1XF5B 1BVKB 4WHYH 4JREB 4KQ3L 5C07D 2FL5B 4K71C 2ENYA 1GOHA 1UCBL 4EKXA 1ZEAL 2XV6B 15C8L 1QFPA 3GSNH 1EAJA 1FVEB 1NCCL 1PLGH 4NHUA 5DQDL 3W9DA 3D39A 3L5JA 5KG9B 3BZFB 2H1PH 2NTFB 5KS9F 4Y16C 1MVUB 5JXED 1BF8A 3PWVA 4GKSB 4CKVX 1GZPA 1CXLA 3HFML 1RHHB 1Q1JH 3BZ4B 4FFVC 3ARBC 3NH7L 3GMOA 5AUMB 4ZUTA 1Q94A 3GJFH 4MXQC 4XCYB 1CD8A 4QWWC 5KANG 1U92B 4RMSA 3QUKB 3X3GL 2DWDB 1T1XB 1MHHA 1W0VB 5FYKH 1VGEH 1V3KA 2NNAB 3NCMA 4X98B 3DGGA 3QCUH 1NMCC 4O02L 2R56H 2VDRL 4E41B 2J6EL 2DQGL 3MRGB 3KPLB 2WBJD 2FSEB 2E6QA 5E8OB 3MRBA 4PJ5E 1HNGA 1T0PB 5C07B 2Z8WC 4PJHE 2DM2A 4LPCA 1EO7A 3DI2B 5ICYA 4PGEB 4POYA 2F54A 4ODUA 4OZIB 1E4XI 3TN0C 1KENL 2AEIT 4ERSL 2CRMA 4PJFE 4XVSL 1D9KA 3I9GL 2IAMA 4Z7QE 5B39A 4I0PB 3P0YL 2G60L 5H2BB 5FCUH 4BA8A 5HHMD 4M7JH 2W0FA 4GRWF 1MLCA 5E8EA 5I1IL 4FXKB 4K23L 2BERA 3GMPA 4PJ5B 5DJYA 1DEEA 2G75B 3BXNB 3L7FA 2ATPA 5IJKA 4PJDF 5HVGB 3VFUA 4IOIA 2DYPB 2XA3A 3SKJH 1KENH 4ERSH 2EXYD 3B9KC 5MP6L 1OB1B 4O2CA 1QO3B 1I7ZA 3O3EA 1CGTA 1YNTB 4MNHA 1Z3GL 4X7TB 1JF5A 1ED3A 4D0BB 1DJSA 4XP5H 5J13B 5BV7B 5DI8A 3VXPA 1NDMA 1R5IA 2OM5A 1BREA 2PO6A 4K94H 4J8RA 1G9ML 1ZSDB 2R56L 3BE1L 3LEXB 4Q97A 3PWVB 3VG0L 4M5ZL 3GBNH 2VDQL 5T3XE 5ESVA 1RUPH 3CLFL 5CP3H 3FB5B 4XVUC 2ADIB 5HJ3A 4J3UA 4TSAH 2RCSL 1X3DA 3QWQB 4HFUL 1F4WL 2CR6A 2CKBL 4XVTH 4CMMB 2O5YH 5D5MB 4G9FA 2HFTA 5F7UA 1AGDA 3UO1L 2P24B 1WZ1H 1FNAA 1I75A 3MRKA 4WEMB 1FGNH 3WFEH 2C3VA 1MIEH 3GBNL 3GKWH 4YDVA 4P2QB 4F8QA 5H35B 1FL6A 5E24E 1TDQA 2IFFH 4CN6A 4TNWK 2GI7A 4MAUL 4HLZG 1KCSH 2CR3A 2HWZL 4E9LA 3VXRA 2X4TA 5BZDB 1KEML 3QI9C 4Z95L 3CFDB 3MXVL 4QGYA 5DJYB 4MAYC 5E56A 4OCYL 3WJLC 4LSRL 2NMSA 1FVDB 3WDHA 3VE0A 2JJWA 2EE9A 3G6JB 4NHUB 3DHJA 4KHTL 2VDML 3ULSB 3RJQB 4APQB 1ETZA 3BPCA 3UP1A 3O0RL 1X7QA 4CVUA 25C8H 1MELA 4KTEH 1W8OA 4G8FA 5J56B 2FEDC 4YPGB 2A77L 3IXAA 5LAXB 3O3UN 4XXDA 4KMLB 4Z7UF 4I4WA 2Q3AA 5CZXD 1EH9A 2WWKT 2P5EA 1EGJA 4V2CB 3GHBH 4Z78B 5F6IB 2CGRL 2L7UA 3QUZC 1A6AA 3FONA 1JP5A 4XPHH 4H88L 1YEDA 3DECA 1TZGL 2FX9L 4GUPB 1CCZA 1KIUA 2H41A 1KCRH 4KROB 1ORSA 5F6IC 5M94B 4U1JA 1R24A 2J5LC 3P30H 1S7UA 1U8NA 3O2DH 2FJHB 4CU6A 4MCZB 3PQYA 3F12B 3WFEL 1VERA 5TH2A 5I1JL 4MQSB 4U1HA 1DBBL 1G7JA 1F8TL 5IVXB 1Q72H 2P5ED 1WFNA 3MRBB 3QIBB 1UZ6F 4I77H 4WEUD 1HILB 3LDBB 1AXSB 4IHOB 3KPPA 5IVXF 2YC1A 5ACMA 4TNVK 3Q6GH 1U41A 4MLIA 4Y5VA 2HT2C 5GGRB 4KKBD 1T5XA 5DRNB 3QNYA 4BFIB 2QSTA 3U9UA 3N9GL 4FQHA 2VQUA 1AD0A 4J4PD 3L7EB 3OB0K 3SOBL 4ODHH 1J1XL 3RKDC 4P23C 3PHOA 5I1DB 4W6YB 3BAEL 1PEZA 2O26U 1ZHNA 4YGAB 4KROC 3T4YA 2VOTA 3DBXA 1IQWL 1CQYA 4P99A 3D2UD 3QR2A 3GMNA 2EDTA 3AXLA 4HG4J 1BQSA 4MVBD 1DANU 3OKEB 5IQ9B 3QEGL 4XBEH 1AQKH 3U7YH 5IMLA 1RZKC 1IGIH 3UTPE 2UYLB 4PR5B 3SDDD 5GS0C 1X5HA 3NZ8A 3RVUC 1QBLH 4O02H 4RMUA 4C83A 3PJSA 1U93B 1MCBA 1DSFH 3CVIL 3NCEB 4GLRH 1E28A 3FO1B 4JM4H 2G9HB 5CUSL 4MJ4A 4AQ1B 4XXDB 2H45A 1N59A 3SO5A 3FQWA 2YPVH 3IVKA 1XZ0A 4O58H 4S1QH 1EFXB 5ITFB 2AV7B 2NY2B 1P5VA 1WTGT 3QEHA 1E4WL 4L8CA 5DD0L 4GKZA 3D0LB 2X70A 4APQD 4CN1A 3QCTH 2I60H 1FGVH 1S9VB 3QH3B 3VXSA 2R2HA 3O41A 1S3KL 3ETBF 3MLYL 5H8DA 3WJJA 5EO1B 2DBLH 1QSFE 2Q7YB 1C16A 5ALCL 4M7ZC 3VI4E 5JA9A 3LH2H 3QIBA 3O3BB 4FMKA 4ZTOL 4WWKC 1YUHB 5HPMA 3VH8B 4HUVB 5K9OB 2Q87A 3PQYB 2Q76B 5DHVA 3DV4B 2AJSH 4KHXL 4Z0XB 4OV5A 3WYRA 4NYLA 3DX7A 5CP3A 4S1QL 1V05A 3NPSB 1OWRM 2OK0H 4EUPB 1J0JA 3NABH 4OF7A 5IR1B 5BS0D 2JLLA 4JEGB 3MRQB 5DHYA 1JV5B 3RI5K 1YNKH 1YN6A 1MY7A 4RIRB 5F7KC 5I8EB 3RAJL 2NXYB 1MQKH 2BNQD 4N1CA 3AREB 4JRXB 4NM4H 5FA3A 1DQMH 5I1DA 4OIAA 4Q6YA 3O11A 4L3EA 3TVMA 2VDQH 1EHLL 4Q74A 1F4AA 4K23H 4JFPA 4GRWH 1SJHB 1HHGB 1R3IL 2V7NB 2SEBB 1VGKA 4U6HA 3JWOL 1ZLUK 4S1SH 3Q1SL 1C5BH 1PG7X 4QOKD 3A0OA 1MNUH 4LSTL 4OLXH 1P1ZB 1JGDB 3QDHA 2WP3O 3C8HA 4C83B 4D8PB 3D0LA 2VWEC 1FP5A 3NFSL 3AB0B 3WE6A 4HFUH 4P5TB 3SBWA 1NPUA 1A9BB 2XY1A 2BFVL 2EICA 1RULL 4XX1E 4P2OA 1BEYH 4Q6IA 2FH6A 3WS6A 5LQBH 2ICES 1S7WB 1YEGL 5E94B 4HAFA 4Y19D 2HJLA 1DBJL 2XZAH 1PW3A 1XGRA 3SE9H 1MI5B 4BSVB 3RUGE 3ULUC 3MGAA 4IDJL 2HJFA 4Y8AA 4HWZB 4YDKH 3UEZA 5E2WL 3GSRA 3EFDL 5IMOA 1I9JH 3EFFB 1MF2L 3MRNB 3QNYB 4KXZI 3RX5A 4G7YL 5K9JH 4KJPD 5DT1L 2NY6D 4Z0XA 2FECI 5SWSA 4PLNC 3G5YB 5TJWK 1UKTA 2R4SL 3TESA 2WANA 4GRLC 3EO9L 3OJDA 4U0RC 3MLPA 4YHYC 3U9PL 4C55A 3H7BB 5IJKC 3KG5A 5CCKL 1QVOA 5DUPH 4JFXA 3H6JA 1FYTD 1CTOA 1L7IL 1TVHA 5LBSH 3BKCL 1VGKB 1WGOA 2PXYC 3GHEH 1YC7A 3MLVL 3OZ9L 3NFSH 4KRPD 4ZO9A 3VFSB 2I26N 2ADJB 3W0WE 2R0KL 2PYED 1P1ZA 2PO6C 1X5AA 3FQXA 4WUUE 4LAQL 1D6EB 2HVJB 3F7VA 4C58B 1D9KB 4JB9H 4U1GB 1SY6A 5L0QB 5D6DC 4NQEE 4KZEL 3OKOB 5E4IA 4DKFH 4NP4L 5IWLA 2MSPA 1Z9MA 2Y36L 3BKCH 1P2CA 2E9BA 3VFTA 4WTXA 1VFMA 5E6IC 4MWFB 3WN5A 5BW7C 1NC2A 2EYRB 1HCFX 2PTVA 3RWCB 2NY1B 1VEOA 1AGFA 3MJ8A 1BOGA 5EU6B 2Q8BH 4PG9A 2DAVA 4XNMA 3ZKND 2HTLC 1IGML 5DEZA 4JKMA 2CRYA 1EUUA 5C0BB 3MRPB 4K3DH 1FFOB 1KPUB 4EI6B 43CAA 1T89A 2XT1B 1PZ5A 3HKFA 4N0UA 5GZOC 2EDOA 1JI2A 3N9GH 3QRGL 3BEVA 3UYRL 2ZG2A 4EQ2A 5J11C 4FTVB 4MAYA 4RZCA 1MHPL 1FN4B 1UQSA 2V2TA 1MFCH 3AS2A 4ZQKA 4G6MH 5KSBB 2W65B 4UB0L 4OZ4B 4RAVA 1VFAB 2C3GA 4YHZH 3V6OC 1A3QA 4YZFE 5CJ8A 1KJ2L 1ADQH 2ERJB 1SY6L 5IROA 3VGEA 4YHNA 2HT3D 4CMMA 4NZUL 3L3GB 3ABZA 5F9JA 3NAAH 2P5WE 2AVGA 2AK4A 4I3RH 4JPVL 5GJSH 3FB5A 5LCVL 5DMIL 1M7IB 3O9WB 4PP2B 3E3QE 3EHBD 2X09A 4GKNA 4KRPC 5C3LD 2BMKB 5FGSA 4OLZL 2FHFA 1FCCA 4XHJD 4K8RL 1FAIL 4JN2B 4OSUH 4UV4L 3MGOB 4Y4FC 1IAOB 2ADGB 3PXHA 4M62L 5GGUA 4DWHA 1A14H 2WV3A 5FYJL 2Q8BL 5F7EL 3JTSB 3RY6A 1TCRA 2DLGA 4ZFZA 5HDOA 5E4EC 4NN5B 4MD5B 2IAND 2VAAB 1S3KH 1A64A 1HN1A 3QIUB 4J3VA 3TIEB 3T4YB 1T20A 3X13B 1U8HB 1P2CB 5E6ID 1T2JA 3DX9B 5FYKE 1B0GA 2XKSA 2M2DA 3H9SD 1JF1B 3MNVA 1C5CL 3AREC 1KEGL 1C1EH 4AIZB 3MV7B 4N5EC 1KCVH 4X6FB 1WWWX 4QT5B 3SDCC 4QHKI 3ULVC 2F53A 3RDTD 3V6ZB 3JWNC 1FNHA 4R2GC 4UUJB 1HIML 5EC1A 4IRJD 5T5NG 1VPOL 1IKFL 4WU7B 2YA0A 3L3DA 3WHE1 4P57A 4Z7NF 3TYGH 5FOBB 4WRLA 4Y5YB 1QYGH 4IIQB 1X5IA 5IB2A 4XMLL 5EBMA 2DWDA 3NTCH 3VH8G 1QEWB 2I5YH 1U8JB 4Y4HD 1QNZL 4W4OA 5D70L 5T3XD 5BVPH 5C09B 4P59L 5GGSB 2VQ1A 5E5RB 4HLJA 5CJOL 3P40A 3MOQA 4YNYB 1BVZA 2PW2A 3A67H 5FDYA 4JRXD 3IDIB 2OSLB 1QZ1A 3A6BH 2CH8A 2NTFA 2OTUA 3GI9H 1PG7H 3EFDH 3NIGF 5AWNH 2AEPH 2CLVA 2RJMA 3MJ7A 4UT9H 4H5SB 4JO3L 1R5VB 3U7WL 1MFEH 4C54A 1X5YA 1QNZH 3SGJC 1B3JA 4KQ3H 1YYML 5FHBH 1CFSA 4ZUSB 1CLYL 5T1KA 1T1YA 2BVOB 3TBTA 3BEWA 5ABDE 3LMJL 2NTSP 4BK4A 2EDRA 1CFQA 2OXHA 2X44D 2YD2A 5DD1L 3BVNB 1G6RA 4TPRH 5FGRA 4YQXL 3MLRH 2AAVA 3GO1H 5DRXB 2P5WA 3GSXB 1FIGL 5DJZA 1PZ5B 1A7NL 4GFTB 5AEAA 3NACL 4RGNB 3B9KA 3GSQA 4FTVA 4BYHA 3OR6A 4MDJB 2XN9A 5CINH 2F54B 4NO0D 3L95B 5GRJL 4OF5A 4CMHB 1V3LA 3S36X 3HE6B 4I9WD 1XR8A 4JZNB 3QJHA 3RNKA 1WBZB 3V4UL 2GJJA 4WWKB 1LHZA 5FV2A 2UVEA 1I8KB 2EE3A 5F96H 1JJUA 2DRUA 2Z92A 2YR3A 4MAUH 2XQYK 2X1OA 2WBKA 1CICB 5IMKB 1UWXH 3G6JE