2E7VA

Crystal structure of sea domain of transmembrane protease from mus musculus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
115
Chain Sequence
b'KKAYFYHSSFQILNVEYTEALNSPATHEYRTLSERIEAMITDEFRGSSLKSEFIRTHVVKLRKEGTGVVADVVMKFRSNRKVMKTRIQSVLRRLSSSGNLEIAPSNEITSLTDQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protease
publication title Crystal structure of SEA domain of transmembrane protease from Mus musculus
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 37
structure length 115
sequence length 119
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01390 SEA SEA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.960 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SEA domain 2e7vA01
2ACMA 2E7VA 1IVZA
chains in the Genus database with same CATH superfamily
1FJGJ 3J7A1 4CO4A 4H4OA 2VG7A 1RWUA 1AW0A 1HYSA 1AUSL 3HP6A 1RT4A 1RKJA 2XLKA 4FS2A 2EXUA 4Y65A 5A6PA 1T05A 3FBCA 1SC1B 4DR5F 5K8NA 2BOPA 1WEYA 1IWAA 3V4MA 2X3DA 2KJVA 1C1CA 1TMMA 1K47A 3DLEA 1FEEA 2QSFA 1FHTA 2WCXA 1WELA 5B09A 1Q16B 2VH7A 1YVFA 5B08A 4X4UA 1EZZB 1WC3A 3T5JA 4UZBA 1S9EB 1LFPA 3HHLA 2WW4A 3W62A 3HKZD 2CUYA 3KNGA 5HI7A 3BGRB 2V34A 1UJ6A 2QA4G 2CFXA 2PEHA 1OPIA 1RWOB 4PWUA 1PSDA 1RHQB 1UFKA 1PCAA 3GG1A 1SC4B 2IA0A 3SMZA 3D28A 4NCAA 3ISZA 3DLGA 1S12A 3Q8UA 2XGPA 5FLXU 4OX8A 2HNDA 1MU2A 2ZZNA 3P5TL 3WQPA 5L46A 1E6VB 2HEKA 1RSCA 4I6AA 4IYQA 4QCLA 2KFZA 5ADZA 4J9MA 3A1YG 3LAKA 4CQ1A 3HPOA 2ALYB 4RU9A 4JI5J 1SJ3P 1B64A 1HD1A 4F4KA 3KLHB 3DI6B 3V6HA 3M8SA 3M6XA 3G2XA 3CC4S 4WTYA 3MXHP 4RLEA 1VOMA 1UVKA 3AQOA 1HQ2A 3U1LA 2E5IA 5DZ6A 4F0HA 1SJ4P 1M1GA 4JV5J 3EWGA 4FXDA 2DO0A 1PO6A 2ADCA 4QWCA 4LF9J 2YH0A 1PAEX 2ZBPA 5HBMB 4X4VA 4E2FB 4I67A 1XMQF 2ROPA 4QIVA 3M1VB 3CVKA 3DLJA 1FKPB 2HNYA 1UPMB 3PG9A 2V2QA 4PXEA 1OS5A 4B9SA 3QLHB 2ZH6A 1DZ5A 1CC8A 2OEMA 2I1RA 3A4TA 2ZD1B 4IR9A 3DRXA 2PIIA 1L3TA 2YKMA 2BZ2A 2XMJA 3H0PA 3U7JA 1JNRB 3VGSA 2AYEA 2YX1A 3Q8RB 1Q1KA 4CLLA 4DLGA 1RHMB 2O3DA 3OR2B 2O66A 1Q8BA 3V6KA 1CJTB 4X62F 1IXKA 3DRSB 5J2NA 4ECQA 1JLFB 4DX6A 1VQLS 4I56A 1N6QA 1SH0A 1HHQA 2MZTA 5C25B 2DH7A 1GH8A 1VBXA 5CYJA 3GSIA 3T1YJ 4AYBD 3ITHA 1K1QA 3BZQA 2R7VA 5AXKA 4RW9B 2GGPB 2AZ1A 3PW0A 5DGBA 2RE1A 1V3ZA 3K0JA 4JI6J 3QJPA 1UA1A 3G86A 3MEGA 3AJDA 4NLYA 4GMKA 2ZHOA 3J7ZT 4CLWA 4KY3A 4F0MA 2R7XA 3V81B 3QJJA 4V1Ak 2G2OA 4DL7A 1HNZJ 4NLSA 3R6GB 1Q5VA 2FYXA 1DJ0A 2I2YA 4Q2MA 4B3OA 2J6SA 4FYDA 1R31A 1OWXA 4EI2A 3JSBA 3W9HA 3CDBA 4GC7A 2IMOA 1SKSA 3T1HJ 3I32A 2YKNA 2HVZA 2UU9J 1JLGA 2GNKA 1FXDA 2NS1B 1CS4B 5M2UA 2BYCA 4DV4F 2K2PA 4RX6A 4ZVGA 2YPYA 1VMBA 1U1KA 2MB0B 2DNOA 4ZVTB 1UVIA 2DNZA 3QGHA 1RAAB 4ZMMA 2LQBA 2EFVA 2OPQA 4ETZA 2GIQA 4ECVA 1S1TA 3CC2S 1ZZNA 2CJBA 4ZCKA 4CTAA 2DGVA 1N0VC 3E01B 5D15A 1PC5A 2LA6A 1NAQA 3PO5A 1KR4A 2DISA 1SL0A 2EKNA 2Y1JA 5C24A 4WJBA 1Q4RA 2OELA 2FGCA 1ZM9A 1RKIA 4F8RA 2HLTA 2A10A 3Q8PB 1T94A 4CYUA 2KVQE 4ID8A 4JI2F 4EYHB 3H20A 3FBBA 3K17A 5HATA 1N5YB 1PILA 1YITS 5HJXA 4JOUA 2PA3A 3QBCA 4QJVA 2VIHA 2OLWA 2EK1A 1BLUA 2YQ1A 2A3JA 2P5VA 1FFSB 2D1CA 2AJQA 3QJLA 4X66J 1KFDA 4ZP9A 2CVEA 2KTQA 1R0CB 2CPXA 4WE1A 1X4EA 1LWEA 3GE9A 3W7BA 4HTJA 3DGVA 1RB0A 2GIFA 3DLKA 2M4MA 1AXQA 3EGZA 5J1EA 3I9V9 3GIMA 2BUNA 2UVVA 4ICLA 3O5TB 1LFWA 2BQRA 5KFGA 3LALA 3OUYB 1SKRA 1TP7A 5HQMA 2PE8A 3KUHA 3MF5A 5ETRA 1IKWB 1PBAA 2CNNB 1HQUB 4NMLA 5K8OA 1FERA 5HVHA 4LQ9A 3G9CA 4K8RA 4OZ3A 5F3ZA 5E2QA 3OL9A 4GKKF 5AJ3J 3HSZA 4B02A 1R0AA 3K5NA 3CJ0A 5I42B 4OHZA 1Q7LB 5IFMA 4I69A 3M05A 3D6FB 1OYEA 1KVIA 1X4GA 1VS3A 1LXNA 1VQKS 3IR5B 3MMJA 3B4DA 4JV2A 2NUUG 1G2EA 2DNPA 4I2PB 5HROB 3W66A 1VQPS 4DZDA 2ILZA 1PG5B 2DH8A 1DTQB 4ZS6A 1A7GE 1VQOS 4WFXA 3CCZA 3NS5A 3IG1A 4OZ1A 2KYXA 1WEXA 4O3NA 4WIIA 1N5SA 3DOKA 3KHRA 3H90A 3KK1B 4QU7A 2X1BA 2P9GA 4MTPA 5HN0A 5JVGQ 1L3UA 2KT2A 1FKOA 4C0HA 4CCHA 5JJBA 4NXNF 2OD4A 1R6YA 2VPWB 1FD8A 2XYHB 1M5PC 1GTEA 3H2LA 2HAFA 2IBOA 4ZA1A 3N6NA 3NNHA 2B9EA 4WWSA 1IQTA 3VALA 1SV5B 1FEHA 4KQZA 3RB0A 4EBCA 3J7YU 2BANB 2CQ1A 3GSDA 4P2XA 3OSPA 5J2PA 1F9HA 2XNRA 1G7CB 2GS8A 2PSZA 1TFYA 2VD3A 4ECYA 2G9OA 2J0QD 3POTA 3AH6A 4DXLA 2W01A 1O8BA 3DHXA 1ZTWA 4RO0A 3JSMB 5IQ6A 4KGVB 3BM7A 3QYYA 5J2MB 5KTQA 1QVGR 4JV0A 4YP3A 4E98A 3OTDA 5F8HA 1KRPA 4MKVA 2CAJA 5D0GA 4DDFA 2J8SA 1FK9B 4IFVB 3CCUS 4DUZF 1BQNA 1JKHB 1RT5B 4EU0A 2RHSB 4HHJA 3I87A 2MLYA 2HZAA 4LVOP 4CH0S 1BD6A 2FLOA 3CO9A 2V63A 5GMEA 1RDRA 2R8GA 4B3TJ 1XMQJ 1UW4A 2Q6CA 2HVIA 3CE8A 3LP1A 2LCWA 2K3IA 2XWYA 1TUWA 3HKWA 2AYBA 2BE7D 2CA9A 5L9NA 4KJIA 1YTYA 3IR6B 3GLJA 3K5PA 1TR0A 3T1AA 1KNZA 3VHQA 3GJQB 3FKBA 4LFBF 3C19A 3DRPB 2WBRA 4WU3A 2IDEA 4KSEB 4EUVA 2JVRA 1VQ7S 4RNHA 1X4AA 3VAMA 4O3OA 5DG8A 4NLGA 4RUAA 3MEDA 2YNGA 2I5JB 4X62J 2GQ2A 2WW8A 5DGAA 4NA3A 4X2BA 1RUSA 4DN9A 3I82A 4ZVOB 2COLA 2ASYA 4ANDA 4A8WA 3AY0A 4OJHA 4N76A 2BEFA 3VCDA 3M2RB 4ED0A 4G1QB 1BUXA 1FF2A 4ZVPB 4O4GA 5GAEU 4ITSA 3HVRA 2BMBA 2JFKA 2BR0A 3N6LA 1EHWA 4C3KA 3TAMA 1RTJB 3VR1A 1JJ2R 2FY8A 2KT3A 2O67A 1JLAB 4GC6A 1XMOF 3KKFA 2C2OB 1F1BB 3BQ2A 1BE4A 1U25A 5A8WB 4ZHRA 1K0TA 2GVZA 2MPUA 3CSKA 3ZTSA 4DV4J 1ACMB 3MM6B 4DV3F 3M30A 1DURA 4K59A 4F4YA 2WONB 4Y0FA 2MLXA 1ZA1B 4OIXA 2IC3B 5L1IA 4BBYA 3BS9A 2ZVSA 3BBBA 4PWWA 3ADAC 4HI2A 2DPIA 2UUCF 2DXDA 2DNQA 1T9UA 2ZZTA 1K8AT 5KFJA 2GQCA 4PG5A 3ZZUA 2NQPA 1HNIB 2QMUB 2CJYB 4Y3CA 4DFJA 3BQ0A 4PR6A 4IQXA 5HQ8A 1NJZA 1WC1A 5HL7Q 3PRVA 4M5LA 1DLOB 4JI2J 4QPXA 5AXLA 1C0TA 1XBWA 2XZTB 1RTDB 1U6BA 1QTNB 2W7PA 4X84A 3HX9A 2KG0A 2KHDA 4NPOA 2JEIA 4LIWA 5KFZA 4O44B 5CYQA 1AZSA 4NEZA 4RWXA 3CC7S 2APOA 1TQLA 1EQMA 3IN5A 3PYFA 4Q45A 4ZIVA 3IO1A 1RK8A 3FCHA 2R2UA 2V8VA 2QO3A 2FHJA 4WU2A 4DR4F 1UTAA 1PYSB 1S6QB 3I0SA 5J1PA 2FHKA 1W26A 2KFYA 3N28A 2V2ZA 4DPTA 1FX2A 2FVSA 4FF1A 2HRUA 4F4AA 1Q8IA 4X4SA 3NCRA 2I38A 2L9NA 3NRBA 4WFYA 4AQYF 2CYYA 2QT7A 1H0HB 1UAWA 4DFMA 4DV6F 2XMAA 3TW0A 1UMJA 1FWKA 4JUZA 1S0OA 5F8JA 2C2DA 3O8WA 1Y00A 1HMVA 4J9VA 1Q81T 3I5CA 5KG5A 2CPDA 4A48A 2ZE2B 1U48A 2GV1A 5KFFA 2DR5A 1Q5YA 3TRGA 5KAKA 2D3OR 2PMZD 1MSWD 4NXMF 2RSQA 4OYAA 4DHVA 4NXNJ 4ECRA 3MAAA 2X3GA 5ITHA 4ZOSA 1M1KT 2HQIA 4DV5F 4AL6A 3LOUA 3NGDA 1RWNB 3KLIB 1HBMB 2RDIA 2MZSA 3EYZA 4W4MA 3QATA 3N79A 4OI0A 2AW0A 1QSLA 1HNWJ 1OPZA 2L48A 5A8KB 2FUG9 1WSVA 1GQEA 3ENAA 3BYRA 5A8RA 2Y3YA 1RHUB 4ZJLA 1IKVB 5F8IA 2VHGA 2M9KA 3EVMA 4I68A 1XEZA 3M6VA 3HDSA 3FSXA 3MI7X 5J1NA 3ET6B 4UOCA 2CRLA 4C11A 4FPIA 3OVSA 1MN7A 4NRUA 3WBZA 3V4IB 1HI1A 2ATCB 5EN1A 3MCNA 1K73T 2AJ2A 1PJ5A 2NXEA 2Y1RI 1XC9A 4DUZJ 5B0BA 2AT1B 3J7YI 1HFEL 3IWXA 1N8RT 4KKOB 4FKXA 3F44A 3Q0AA 3FMBA 4DV7F 1FRXA 4EEYA 1EKSA 2W2QP 1XNQF 4UQGA 5E7OB 4F67A 2PMHA 3F56A 3TUJC 3EZOA 2LQ9A 2QTWA 4L3NA 2OFHX 1S1UA 3T9NA 1VRQC 3MGJA 1QAJA 4LFBJ 2C3UA 5KFIA 4KFBB 4JI0J 2H48B 3T3FA 4C8LA 1ZPWX 4M5DB 2XYGB 3NKYA 2BM0A 2IVFB 4C3MA 4NYOA 4U8YA 2JWNA 5KFXA 2LEAA 1RWKB 3VAHA 4P7TA 3ZFVA 4F04B 4ED5A 2IHR1 2HYIB 4ZIWA 3KLEA 3HHDA 3OV7A 3S6EA 4CLSA 3H5YA 3UDLA 2MTLA 4P52A 4RU2A 1HQEB 1UZHA 3R9LA 1NSPA 2N7CA 4OI4A 3HLUA 1JLCA 1Y5NB 4LJMA 4KHPF 4DX7A 1TKTA 4A8QA 5L38A 1U02A 2RF2B 3U02A 4NYPA 2NZ4A 2LDIA 5KFHA 2MZQA 1TAUA 2ZJPQ 1LWXA 4UW2A 3GFZA 2BE2B 2FGOA 2V68A 2MKIA 1S0MA 2DGXA 4NI2B 3PHEA 5CD4A 1XMOJ 3S7RA 4ES1A 3W65A 1TMJA 2E66A 3ETOA 5J2QA 1S9GA 3NCPA 1TL5A 2QC3A 3KXDA 5A0YB 1CJUA 5T14A 1LW0B 1RYRA 1B99A 2XSJB 3MD3A 4DV3J 3AXKA 1X4FA 1F5BA 3TZYA 2QL5B 3PXGa 2JDJA 5GAEI 3UN2A 1S6PA 5A2QY 4GVLA 2VA3A 2VASA 3CD7A 2KU7A 2UUCJ 2F40A 4I7FA 5AXMA 3BSCA 4YB6A 4DS4A 3ISND 4FBUA 3ILJA 5GVQA 4ETXA 3DM2B 3GYXB 2KM8C 4PPDA 4CWBA 3KNAA 1UP1A 3L95X 4ANEA 4U6PA 2VKZG 1FA0A 2LU2A 4TYBA 1TAQA 1JLEB 3FUYA 1CLFA 3PRDA 1E6YB 2A1BA 1WHVA 2EG1A 3TJ9A 2EBEA 1TL1A 1T9YA 1U1LA 2AJFE 3RW7A 1QSSA 2ZM6F 1RBOB 4LSNB 3NGRA 4DR6F 3BO2A 2Y0BB 3PM9A 2HMIB 3DKDA 2JH3A 2V4RA 3CJKA 3RR7A 1W2BR 2WK4A 4WK1A 3F0NA 2XMUA 2P2CB 3NS6A 2J7WA 5DG9A 3MMAB 2KXFA 1WDTA 3GILA 2QYGA 2IIHA 3JSRA 9RUBA 2ZH9A 2KT5A 3W8GA 1LWCA 3GMGA 4CM2A 3KJVA 4DU8A 4ZLNA 4DR4J 1B7FA 4LBHA 2HFSA 1RTHA 2OPSB 3PW5A 2VG5A 1HNVB 4TNOA 1RWWB 3B4MA 2F7VA 3VAFA 5DG7A 1K1SA 1SB6A 1QD1A 1TKZB 1ZM3A 3S01A 3X3UA 1RAEB 5IOLA 3CCRS 2BACA 4AQYJ 4M5IA 2ROEA 4DV6J 3EXCX 4LQ3A 1VC5A 4DF8A 1JLQB 2IAJB 1QAIA 5F41A 3OPKA 3K5OA 3PYGA 3NP5A 1K9MT 3QIPB 4HKQA 4MYUA 2LQJA 4XTTA 4AD6A 3PYEA 5KFAA 4PYDA 5DS7A 1NKBA 4WZMA 1IM4A 2CVIA 3VF0B 2EC2A 3A12A 1IR2A 4QWEA 4RPFA 3RBXA 4NLTA 2ZDOA 3TX8A 1S9EA 3M8QA 4NLXA 2DGSA 4NXMJ 2FVCA 1YJ7A 1NJYA 2AEJA 4NCGB 3GR1A 4DCJB 4DV5J 2AJ4A 1XJWB 1U6FA 4FN5A 3NEKA 2OKQA 4ELVA 2DTJA 5KFBA 1APSA 3OFHA 4LT6A 1I5OB 1RT7A 3HVTA 4H4MB 3I31A 5KFRA 2CADA 2YNIB 4DV1F 2JX2A 4LBIA 4N47A 2G4BA 3GQCA 2B4OA 3NAHA 1Q82T 2DKOB 3IFEA 1E6VA 1T7PA 5A2QU 4ED6A 2YWWA 1RT1B 1GXUA 2HHHF 3EDQB 1ZOTA 2DHXA 2EPIA 2GHWA 1F2HA 3KLHA 2XSFA 4F4ZA 4P72A 1TK8A 1LXJA 3TNVA 2M0GB 4P2FA 3GV8B 4N7TA 3R5GA 1NU4A 4UTGA 2MKKA 4CH1A 1GTHA 3ZZ0A 4DSIA 4HHUA 2IJFA 5HBMA 5F8LA 3KTQA 1T0TV 3M1VA 3HMJG 4M5MA 2I9SA 2NPIA 1FKPA 3QZ7A 1REGX 1GMVA 4ZPTR 3IM9A 3TVKA 1RLCL 4DV7J 2M52A 3AB4B 2QA4S 3OSNA 1SPBP 3BQ1A 1XNQJ 3PYDA 2FJDB 4HDGA 1U47A 3SDEA 5EWGA 4HYKA 2R9LA 2QLBB 1MNEA 4I1TA 3EUNA 1NPRA 1U2FA 3G4SS 5KG7A 4AXJA 2R4FA 1SL2A 3OL8A 1S9FA 3BO4A 2C28A 2KB2A 3OR2A 1CJTA 2HS0A 1VK8A 1UVNA 1D1UA 3QT7A 2D9OA 3RB6A 1JLFA 1G1XA 3BH7B 3OQ2A 1REVA 3OR1B 4O3RA 1RU2A 1HBNB 4KHMA 2JVOA 3ENQA 2HIYA 2QFIA 4C8KA 2CZVC 2F4VF 1VRUB 4A8XA 4I4BA 1L3KA 4TXSA 3UDVA 2ASLA 4IG3B 3VV2B 5B0CA 2GGPA 4KV8B 4NRTA 3QWUA 5KFWA 1T03B 1JB0C 1KSPA 3FC9A 4AL7A 3B54A 4CO5A 2HURA 2DEIA 3N0VA 4JP8A 3WIUA 4KHPJ 1SL1A 1H2TZ 2HBRB 3V81A 2CZ9A 1J5OB 2DBBA 3DHWC 4KO0A 4DOZA 1LK7A 3BEGB 4HH1A 2UVRA 1RQ0A 1S4FA 4W98A 4C8NA 3H4DA 2YKOA 1GFWB 1I94J 1CS4A 2HNZA 4XAKA 2XLIA 1AB8A 3RAXA 5IC6B 3UCZP 1QSYA 3SSQA 1HKAA 4OZ0A 3KOAA 1KFSA 1HI0P 5KT7A 6AT1B 1JJ4A 5KFMA 1OQ3A 3WC2A 4CLZA 4C48A 4DQPA 4YN3B 4MIBA 5F8GA 2XY7A 2B0GA 4UZCA 5D3GB 3K2YA 1DRZA 4CIOA 3E01A 2YX7A 1V6HA 4PRFA 1RHRB 4F4XA 2HK2A 2DNHA 2NSCA 3AD7C 1K0VA 2WVFA 2W8LA 4DLEA 2KH9A 2GVDA 2VB6A 2LLZA 2CG4A 1LEOA 4WKYA 3MR7A 4FYXB 3NMRA 4K2JA 2F8EX 1JXEA 3VQSA 4XPCA 3SIPB 1X5SA 1N5YA 4FXWA 4PAAA 2NUHA 2JSXA 4ECTA 2FQQB 4RUBA 3Q8QB 3BGUA 1RT6A 1PJ6A 2QLWA 1C0UB 1NK7A 1IJEB 1BWEA 1QUPA 4IG0A 3HT0A 2ZM6J 3C6UA 3B6BA 2LEPA 3GZ7A 2XHCA 3TWZA 3P45B 2IJRA 5HMZA 1PC4A 3OTCA 4A8KA 1MROA 2XO6A 3NMAA 3CMQA 5HO4A 1EJ7L 1U1NA 1IKWA 3C66A 3UNGC 2C2EA 1HQUA 4JI3F 5BXIA 2CPHA 3D1OA 4QOTA 2J7KA 4KYZA 3KK2A 4OHVA 1LQ9A 4DUYF 1S5ZA 2QL9B 1UVJA 2V4QA 4ENOA 2DR9A 1H38A 3CCVS 1SBRA 3D6HB 2HHUA 5I42A 1WUUA 3R7NB 4F50A 1UJ4A 4TKTA 2HZVA 4GO7X 1HWIA 2Y1IA 2AEFA 4RW8B 3R1HA 1EQ0A 2UXCJ 3W2VA 3LP2B 3TA2A 4I2PA 3T6JA 4CLUA 1QLNA 4YB1P 5G0RB 3EPIA 1DTQA 1VC6A 1BGXT 2VFUA 3H25A 1YJ9S 5DDPC 1HWJA 1KTQA 1S48A 2P9EA 1VYAA 3KK1A 4N8NA 2B51A 2VJUA 3IBFB 4P2MA 3TUIC 2K7KA 2AJ1A 1BXNA 5KFOA 2E1CA 4A8OA 3QO9B 3UI3A 4Z37A 1LV5A 3GV5B 3MOJB 2A6MA 3ULHA 2YPZA 3QT6A 1SV5A 4XDDA 3BDEA 5HVGA 3R1LA 4TVAB 3LP0B 2XMTA 4PZVA 3M32A 2BANA 4DCOB 3CCQS 3GIIA 3X1LB 2JLGA 1ZM2A 2QL7B 3TVZA 1JLBB 3UVJB 3PKMA 3JSYA 2HVHA 2J0SD 3GYNA 1VR6A 2CDRB 1YZ7A 5FD1A 2DD8S 3J80Y 4DV1J 1H74A 2HHSA 4RZRA 5EWFA 4ED7A 1YJNS 3H42A 3JSMA 4KT0C 5L1KA 2CPIA 1U45A 5CXTA 1KHWA 2HHHJ 4O0NA 2Y8WA 2WVCA 2ZUGA 5J2MA 2XZDB 2H4YB 1NLKL 1DAXA 3AD9C 3VGUA 3JAMY 4K4SA 2J9EA 1UWBB 2PD1A 5JMNA 4QIWD 1OIAA 3EZ5A 2AZ3A 2HS3A 3KHGA 5F3TA 4JI7F 1FK9A 4DL5A 3T9ZA 3NWRA 3HK2A 1JKHA 3MMBB 1Q95G 2QA1A 2F8MA 1ZS6A 2Z8QA 2OPRB 1M0SA 4NZ6A 4OX7A 4IRDA 2H5IB 1N56A 4IKAA 3R2DJ 3MUTP 4USIA 4FYYB 3NBPA 4F3QA 3T5KA 4RR5A 3B82A 3ELHA 1T3OA 1SI9A 1NZAA 3R5JB 5K9FA 2ZOFA 1O0PA 1AUDA 4HACB 2A2CA 3DRPA 4B08A 2UP1A 2C22A 2Q3PA 2MQPA 2RT3A 3CCSS 1RCXB 1YG0A 2HHVA 1EAYC 2HLUA 5IXUA 3HM9A 1SKWA 1HWKA 3EDRB 5K8PA 2CNOB 1YBTA 4P7VA 3V6DB 3MCOA 3MTJA 1X0FA 5H9EK 3TA0A 2PI4A 2HFVA 3A8KA 2UUWA 2F4VJ 3MM7B 1T95A 2HHQA 4URQU 3TEHB 2MDAA 1JX4A 3DU5A 1TL3B 2IA6A 5EGYA 2W9BB 4KIAA 4ZVSB 1NDKA 2C2NA 4ID5B 4QYZK 4OLOA 2ZFHA 1Q8KA 3LA0A 5CYMB 4ZCLA 1DY3A 1FJGF 3D6TB 2R2TA 2HGNA 5DM6Q 1RHJB 2JJ4D 2AX1A 3OD2A 4J9SA 1O6XA 3GV7B 1BQMA 4BWMA 2B9WA 4KRWA 2DNLA 3MM6A 4L76A 4IQMA 4OJGA 1F6TA 4O3PA 1NK8A 2WONA 1YKWA 1BC6A 5HAOA 4R0JA 1RBAA 2YKPA 2KVIA 3IA0A 1UFLA 1SJFA 5LJ3Y 5GAGI 1KOOA 1F60B 2L9WA 3FCWA 2MMYA 2RNEA 2RDJA 2FC8A 4CLTA 3J80U 2P6TA 2IYIA 2VU5A 3ENWA 2H1YA 2UUBJ 2ACYA 2XS2A 2HQ3A 3FDSA 1F9FA 3D0GE 4AXIA 4G3IA 4IRCA 2V5HG 1EETA 3FSIA 3JAMU 3TEGA 1RTDA 2VL1A 4C8YA 2R7UA 2KL8A 2CQ3A 4OHXA 4X4NA 3KMQA 2GMJA 1FD2A 1NSAA 1S79A 3O44A 3EVWA 3TQEA 4DX5A 2CWKA 1RT4B 3K58A 3KJFB 4BDPA 2POKA 4JI5F 2E7XA 2CPYA 3L9ZA 4DI6A 1U1PA 1QTMA 3KUEA 1FFGB 4LSLA 2FLPA 1H7WA 3ILOA 3FCVA 1XNRF 2YWKA 4ZP7A 2G0JA 2VG6B 1ZM4A 4UQTA 3DLEB 2DGWA 4USHA 4OMFG 4DPXA 3KJNB 1P1LA 1B3TA 4JI3J 3B8HA 1X4CA 2M70A 4MFBB 1I51B 2FVRA 1PGZA 1C1BB 2BV3A 1XWLA 4NMXA 1RJJA 2GFFA 1CG2A 3SSSA 4F4WA 3BJYA 2AGOA 2ZITA 3P3DA 4CT9A 5MAOA 2AKWB 3CJ3A 2FZGB 2MKYA 1F3VA 2LQ8A 2QSWA 1YSJA 3P5BP 2LKZA 2ERRA 3EPGA 3IBWA 1X9SA 1D0EA 5D0EA 2F5GA 2OSRA 3CEDA 3NS7B 5KG4A 3OL6A 2W8KA 1H2VZ 1C4AA 4RBUA 2ZE2A 4LUBA 2HNDB 4DPOA 4LFCF 1QY7A 3HI9A 4HDHA 2ZOGA 3MECA 2HHWA 1RWXB 2CJXB 3N6MA 3HO1A 4LRBA 4DR2F 1URNA 1R8PA 4M94A 2MQ8A 2DT9A 4R8UB 2ZNZA 4ED1A 5DDQC 1GAOA 3CD6S 1HHTP 3KLIA 3PDNA 3GTYX 4KH0B 6FD1A 2MQMA 1FXLA 3NWGA 4C97A 4Y6IA 2XMKA 4RNOA 2CNKB 3IWNC 1JMTA 3NL0A 2HZCA 3WX8A 1PYOB 2DNKA 1RXOB 4DUTA 5A8KA 2WSCC 1SJQA 4WFZA 1FWLA 2HHPA 4RJVA 5RUBA 1VRTB 3W60A 2CQ4A 2MZJA 2Z2YB 3GJRB 2P8IA 7FDRA 1R8AA 3M9NB 3OFGA 3KLVA 4A8YA 4NLVA 1R6VA 3SSRA 2V8HA 5L9XA 4LSZB 2PT0A 3MFHA 3HSDA 3HXMA 3L7PA 8AT1B 1F2GA 3DXBA 5L8RC 2B6AA 4JI7J 1OY8A 3GWCA 2ABYA 4CNZA 2IM3A 5M2RA 3J7Z5 1VI7A 2R8HA 1CJVB 1N33J 3LH2S 5FLXY 1VJWA 2QG9B 3CMES 2CDQA 1RCOB 2E44A 2X1GA 4IO9Q 1VC0A 4M8LA 2J76E 1WOPA 1ZPVA 2DR6A 3BR9A 1RT3B 1FCAA 2BBEA 1QJHA 2YX4A 5LSOA 3ZZOA 2OMLA 1ULRA 2MKSA 1FJ7A 4BC7A 3QT5A 2UXDF 2M8HA 2RU9A 3OJUA 3H2UB 4WXWA 1H3DA 4P71A 4HHHA 2HFNA 2AIRB 1JWWA 3TI0A 2GCFA 1DQ9A 5EWEA 3H5SA 4J37A 3OTBA 2M5YA 1RI7A 4M5DA 4ZJQA 2GA7A 3LUYA 3UN3A 1NKCA 1FI4A 3THPA 4ANCA 3EM1A 1S1XA 3A3OB 2EBGA 3NY0A 2VJVA 5FDLB 3PO4A 1Y10A 3IP0A 4LF6F 3DOMB 3W5YA 2MQNA 5KFNA 5IV3A 2KHCA 3VGVA 2JLFA 3UE2A 1HQEA 3BO3A 3US5A 2G2YA 4DQSA 2C2KB 4G1PA 2R7TA 4PWDB 4P2SA 3KHLA 3NGUA 1KC8T 3P6YC 2OPQB 2ZJRQ 2RF2A 1Q8LA 4BC9A 3DMJB 1PIEA 4Q8FA 2ZBCA 4FF3A 1GXLA 1Y7PA 2BE2A 5AJ3F 3MUMP 5IT9Y 2CNLB 2CJQA 4NI2A 2F65A 1WTBA 3IGVA 3VZIA 4HLBA 2BRKA 4J5OA 3OBIA 3M7VA 3I5BA 4EZ6A 1RA6A 3PR4A 3KG4A 4N5SA 3PIOQ 1FNMA 4L3KA 4S0MA 2YY3A 2K1RA 3IMQJ 3VVTA 1MWQA 1Q79A 4TU7A 4WPAA 1U09A 3H7HB 3OVBA 4ZJOA 4C4WA 2E1AA 1ZAXA 4WZQA 3MURP 1NDCA 4QYRA 2BDPA 2ZZMA 2CQ0A 2VBYA 5HK4A 2H65B 4OI3A 2VBXA 1OY9A 2HWHA 1FDDA 3DLKB 3UCGA 4ZVEA 1AYEA 4ICLB 5B0DA 4RUHA 1NEEA 2VOPA 3OXGA 3MMCB 2W7OA 4DX8H 4YFUA 4M5HA 5E33A 3GG0A 3L09A 5CA5A 2IVMA 1JLEA 3R5CA 2XNQA 5D4OA 4OYOA 2WSFC 1E6YA 1FRHA 2ILYA 4QW9A 5CCLA 4F3OA 1S77D 4KAIA 4PKDB 2BJ8A 4DSEA 2CJKA 3ISNC 5DM7Q 2EFQA 3M9MB 4U7UK 5DQHA 4QW8A 2G1DA 1TFWA 3U1MA 1LW2B 4DV0F 2NYHA 3N9UC 2OP5A 3MCSA 1NSQA 5SZTA 1YWXA 4RUCA 2Z4PA 1TV6B 4KGKA 3KLFB 1IR0A 5G4DA 5KG6A 4ZPVR 2N4DA 1FDBA 3KWMA 1XNRJ 4WXOA 2LXFA 2Y8YA 3H5XA 1WORA 3DOKB 3QZ8A 4OLPA 1OMSA 1HNVA 2ZC4A 1FKOB 2EWHA 3CTRA 3Q2SC 3T19A 2MYFA 2YWFA 2RRBA 1RTIA 4B3TF 1U4BA 3CGIA 3G87A 1TKZA 5IWAJ 1OYDA 3LW5C 4CRJA 3EGWB 2Q43A 3R6LB 1X5OA 1ICEB 2BJDA 1D8ZA 1S4EA 4J9KA 1J2VA 1WEZA 4P75A 4EGLA 1JLQA 2CJAA 3UW1A 1RWPB 4E0DA 1NK4A 3T5HA 3W2WB 1HBOA 5KT2A 3QIPA 3FVYA 5J2PB 4OV6A 3DGPB 2JEGA 4ZVUB 3LPYA 2RD5C 3WDOA 3PVXA 1Q78A 5I3UA 3FBFA 3M2UB 2ZH4A 2BW2A 3HHLD 3LPEA 4UF4A 4X4TA 3POTB 2RQCA 4LFCJ 3TUZC 3TQ1A 4CZCA 3KHHA 2RKIB 4KE5A 5ETQA 1DQAA 5IT9U 3THVA 4LVNP 4X4RA 4DR2J 3MAHA 1HW8A 3K59A 2Y9HA 2KO1A 2CJ9A 1SKUB 4USTA 4DR3J 1Y3JA 1KN6A 4WTOB 3SCIE 1VIXA 3I55S 2V4JB 3EJMA 4ED3A 7FD1A 4H4MA 3FZBA 1JNZB 1AFJA 2XEXA 1BQNB 1CBKA 5B0AA 2C42A 2R2SA 2AWZA 1ZBTA 1IR1A 3BSOA 2CQCA 3WZ0A 2Q6BA 4GVBA 2XI3A 4MK9A 4JV1A 5EUHA 2PMWA 4YHHJ 2HGLA 1NJXA 2KFNA 3MR3A 2JFDA 4IH5A 4DR7F 5KFVA 4LRCA 4RBVA 1IBKF 3HFZB 3RBZA 2D74B 4ES3A 4DL2A 5HMXA 2NXJA 3CCLS 3RU0A 5IQQA 3NNCA 1WG5A 4QR2A 4FVCA 1U2CA 3V2UC 1PKUA 2ZH1A 3KYLA 2V2VA 2IVYA 2UXBF 3S8SA 3MEDB 2YNGB 1OY6A 1ROFA 1SC3B 4YDXA 2VPZB 7AT1B 5CABA 3CCTA 5KFSA 3HVAA 5DO2A 1S1VB 3PX0A 2P6SA 2FY1A 4BWJA 4NLUA 2AP6A 1LK5A 4R0EA 1XTZA 3TJAA 2UXDJ 5THWA 4O4GB 4HT5A 2RMLA 3Q22A 2FTRA 3T6BA 4CNYA 2DH9A 2DITA 4M63A 2HKEA 1QM9A 3CMAS 1T02A 3IRXB 4FNIA 1IBMJ 3RJMB 3TAMB 3UR0A 3OHBA 3OR1A 2R7OA 1VQMS 2X1FA 1WSRA 4RNNA 4F3MA 1NDPA 2GC8A 4LF6J 4ZVRB 4ZHRB 3G71S 4IH6A 3SCJE 2VQEF 3M9OB 4JI1F 1T03A 4ZN3A 3M30B 3CJRA 4NLDA 1Y9OA 3PJ9A 5AXNA 4Y2AA 4FXVA 3UDEA 2AGQA 1EIYB 2ASDA 5BYSA 4NEYA 2GIRA 2GO8A 2M2BA 1B70B 1Z1ZA 1IQZA 1C2PA 3SCLE 4ZP8A 1WTFA 2J9DE 1MLAA 4CT8A 2W1BA 3PHTA 4PXBA 2M88A 1QVFR 2XCAA 2ZWOA 3HHKA 4OZ2A 1JXVA 4QR0A 4MIWA 3JTPA 2FHMA 2QLFB 3J81Y 3MAQA 2CPZA 3Q83A 2FVPA 5GAHU 4QIGA 2RQ4A 2DVIA 3DFEA 3LF0A 1SQEA 1NUEA 1UETA 5KG0A 3G6VA 2XY5A 3E8OA 2KI2A 4ED2A 2V6AA 2QJ3A 5D77A 1CJKB 3PRBA 1L3VA 2XWXA 5CYQB 2Z58B 1KTVA 2C3YA 4V19J 1EX8A 1OQ6A 3OFEA 4FZVA 2RIJA 4GKJJ 2OO4A 2B7BB 4FNHA 2XS7A 4Y28C 3K7RA 1HNWF 1VQ9S 2HVDA 4ED8A 3GIJA 1DTTA 2B43A 1HBUB 1NK9A 2FJEB 2VBZA 3KK3B 1FRIA 3TZWA 3CJ8A 4J9RA 1S6UA 4QZVB 2NSBA 1ZYQA 4DV0J 2AD9A 1YIJS 2HVEA 5C5JA 1NCLA 2QLJB 2RUSA 4HT7A 4I6WA 1BHNA 4ELUA 3D0IE 1HMVB 1TKDA 3EGVA 2VC0A 3CD5A 4ERDA 4HR2A 4YDDB 3AT1B 3IM8A 4OZ5A 2CQBA 1IKXB 4ZLLA 4EBEA 1I3OB 3A8IA 4OJ3A 2G2ZA 2C2ZB 2GW8A 2ACMA 2LU1A 1DFDA 2KJWA 5F9LA 3N4WA 3MAAB 3A13A 2WB4A 2YNHB 5KFDA 2UZAA 4DU7A 3LP2A 5G0RA 2G1HA 3D5MA 4Y2KA 3VWSA 5A76A 3MPDA 4Q2LA 2MJNA 5HP1B 2IM2A 3DCAA 5CCMA 4U95A 4M5NA 1VISA 1YK9A 4JI0F 5EDWA 2QLXA 2AV5A 3UD3P 1KKHA 4DL6A 2CQ2A 5ETOA 3QO9A 1D9FA 2R42A 4KHRA 1SIWB 5KFCA 4RW6A 1W7WA 2RB7A 3AA8A 3BSNA 1VQ6S 3OT9A 1JLBA 1UFWA 2W4DA 3J81U 3D54A 3A3NB 2DO4A 3BDPA 1FWPA 1SH2A 2DK2A 5I3PA 2ZH5A 4C0OC 4YUDA 2WB1D 1O51A 1S10A 5C2GA 1ZAVA 1WD6A 4YMEA 3NG8A 2XMVA 4ZCIA 4CLKA 3N5BA 3LWMA 2H4WB 3WIVA 2R8JA 4DPWA 3QRRA 4DR7J 5HMYA 1UWBA 4NX9A 5KG1A 3ZZRA 4DJBA 1IBKJ 2XGQA 3TZXA 3QSYB 3VGTA 4B3SF 2Y1LB 4ZITA 5LMUF 4A8MP 3MMBA 1TK0A 5L1LA 3WC0A 2OPRA 2UXBJ 1R43A 4JI8F 4LF7J 3GJSB 1HPZA 4ECXA 3G6XA 3I56S 4I0WA 2C3MA 4ZKAA 1DQ8A 3KLEB 3CXCR 2B4VA 1R8HA 3CCWA 3TANA 1R3NA 3IBCB 4HACA 4R25A 3R5BA 3MPUB 1JLCB 2XB2D 2CPFA 4R5PA 4LFAJ 4WCEQ 3AAWB 3MR5A 3C6TA 3L4BC 4MKYA 5HANA 1FX4A 3V6DA 2J6UA 2IY5B 2QFJA 3ETMA 3C3LA 4PQAA 2VQFF 1Y3KA 3MM7A 2XLJA 1NH8A 2ZKTA 1CQMA 3Q86A 1XR5A 3IGNA 2VQEJ 5C42B 4M5KA 2NZCA 1NJIT 1RT2A 1TL3A 4JI1J 1CC7A 2YNFA 4PXCA 1CEZA 1B0TA 2DNGA 1HW9A 1IKYA 4B3MF 4IOCQ 1FXRA 4J9UE 5F0UA 2XCPA 1S6PB 2YKAA 4TY8A 5KFYA 1S72S 2QMWA 4ZP6A 2DNMA 1X7VA 4PABA 5IV4A 4OI2A 4C2MA 2AMCB 1D09B 1WF2A 3W5XA 4EK2A 2H9ZA 2FJXA 4TLRA 2IYGA 2I0XA 1XQIA 4K7QA 2EVZA 4WIQA 4IDKA 1KQSR 2DR7A 2B4PA 3CJSA 4LREA 2PDAA 2WOMB 2RS8A 4V19X 3IR7B 3OL7A 3TA1A 3EXYA 1BMQB 3W9JA 5D0RA 3SCKE 2ZBIA 1TL1B 8ATCB 2PI5A 2C2RA 3FZ2A 3G82B 1SUQB 3M8ZA 3QMQA 1XIQA 4XIUA 2QGFB 3CD0A 1FT8A 5T7LB 1TL7B 1VK3A 2ZNYA 4BHQA 4GO5X 1B0PA 1IBLJ 2DNRA 3CJKB 2VONA 4OZJA 4LRFA 2HRYA 3D66A 4Y34A 2F8HA 4LF4F 1IN0A 4LF8F 4TU9A 4IO1A 3MOZA 1YLXA 1WI6A 3Q24A 1LWCB 4OYPA 1N0UA 1KEKA 2K06A 4ZLPA 2V94A 3CJTA 1RTHB 2BOAA 3AJ1A 2VG5B 3UNYA 5GAHI 2UVUA 5LXYA 4P74A 4BCAA 3K8VA 4OZNA 3PW7A 1EKRA 3W8PA 4C7QA 4I2QA 4LF5F 1FTRA 1Y5LB 4QQBA 2FHJD 4EO8A 5E3PA 3JXOA 2G13A 2VG6A 3PX4A 4ZVFA 1NSKL 4MFBA 3U27A 4DS5A 1N88A 2CPEA 2RQMA 2HWTA 3NOCA 1RZMA 1C1BA 1HIYA 3QGPA 2XM3A 4J9PA 3AOCA 4ZCMA 3M8QB 5HVFA 2DR8A 3D6MB 5BR8F 4ECWA 1LOUA 3DRRA 1NHKL 2ASJA 2ZEJA 4H4KC 2O01C 1XR7A 3TO8A 2E5LF 3BN4A 2E9TA 3H40A 5K14B 2Z30B 1OSCA 1HR0F 1RT7B 3HVTB 1KLMB 2RILA 3O2IA 4ECUA 3K8WA 2XBPA 1M5KC 5I3QA 4Z7CA 4M95A 3D1HA 3I0RA 2PGCA 2HPUA 2OTJS 2V0NA 3SXLA 2ZBQA 4R8UA 2HSEB 1WNEA 2ZH3A 2HG4A 4J9OA 1DHMA 5E3AA 4BS2A 4DMZA 2E1PA 5DLFA 2U1AA 5T41A 4RW7B 3C2PA 3RGIA 5CZVA 2GAGC 3D4JA 2JEFA 3PR5B 2Q1LA 5LSLA 3BSAA 3QRPA 3AOBA 1NKEA 5CH7B 5D8HB 1XR6A 2K7JA 1VRTA 3CIZA 2WAQD 1HWLA 3RRKA 2B4UA 4ATNA 1W25A 3MHYA 4HVZA 2VODA 4ZPCA 1I94F 3I4PA 3SDEB 3VQTA 4AT1B 1VQ8S 1UA0A 1YHQS 3DYAB 4P9SA 3VTIA 4TN2A 1RAIB 5B0EA 2QYCA 4B3SJ 4FF4A 5LMUJ 2W9CB 1CJVA 1NMEB 2UUAJ 2Y0SD 4LR7A 2FZCB 4PYAA 1WHYA 4ALZA 1WC6A 1REVB 3KLGA 2B7CB 5H1SV 4G1IA 3NGTA 1H2UX 2VPYB 4MT1A 4PUOA 2R7SA 3RAQA 4JI8J 5KFKA 2NXNA 4Q0BB 2BM1A 1RT3A 4X65F 3CCMS 4M5JA 2J5AA 2Z2MA 2ZH7A 2JZ5A 3A3PB 1TU0B 3MD1A 4F7VA 3KG0A 1U1MA 2ADBA 1T9WA 2LMIA 4K0KF 3THTA 1D9AA 2GZOA 1NZ8A 3TAQA 3HVWA 4K50A 4C6AA 3C15B 3VZHA 2V8PA 4L73A 4UOGA 3SQGA 4WP3A 4KO0B 1UJ5A 2V50A 2HQCA 3M4XA 5HLFA 3ZZZA 4PPZA 5FDLA 1S1WA 5ETNA 1ZETA 3DOMA 4OI6A 3MFIA 3G6ES 1VBYA 2HNZB 2CQPA 3IC1A 3P4UB 2MEWA 2VQFJ 4NZ7A 2VOOA 1MWYA 4B9NA 4NASA 4NLRA 4E8UA 4YEAA 2D9PA 4PWDA 4K2XA 4K4YA 1MN9A 2PC6A 1MWZA 1FDNA 2E9ZA 1KHVA 2M8DB 1QAXA 2OAUA 2HGMA 3HD1A 1VDHA 1U2RA 3DMJA 2N7YA 4B3MJ 4ZPAA 3R7BB 3NAIA 4WKRA 1EB0A 4MJKA 1V5VA 1JK9B 2FB0A 5DRKA 1F0XA 1CULB 5AT1B 2XG8A 1TVRB 4PG7A 2KXNB 3P8BB 3RBDA 1ZZFA 2FHOB 4CO3A 2FLNA 2GVDB 1UEUA 3HHEA 1Y0HA 2UXCF 5BJRA 3CUNA 2HW3A 2XYPB 3MM5B 5EX3A 2OPPB 4F0KA 1RAFB 4IFYB 2HQGA 2GJIA 2Z56B 3HFKA 3PIPQ 3M2VB 2GJFA 3BPSP 4ECSA 2OMOA 5F0WA 1VJQA 1RT6B 3IXQA 2HFZA 2MSSA 2R8KA 1YI2S 3UR3C 4ZVQB 1D3WA 2PN6A 2V67A 3GIKA 2O5DA 5IT0A 1NHUA 2RUGA 3FEZA 3LGMA 4O4RA 4IG0B 3ZNUA 3C6UB 2ZWPA 2A18A 1R8CA 3SFGA 3TYTA 1MROB 4Y2IA 3MMCA 1LWFB 1X9MA 3BGRA 2W2NP 1FRLA 2GJ2A 2A2DA 4USVA 2X7IA 1MW7A 1WKKA 1TKXB 3MPWA 3RG6A 3TAPA 1U8SA 1AROP 2JL9A 1VQNS 3AD8C 1EP4B 2FDNA 4LF4J 2FD2A 5LXRA 4LF8J 3KK2B 4DR1F 2LQ5A 3SI8A 5HJYA 1FVSA 1RADB 3MM9B 3ZZPA 2IM0A 2SXLA 5SUHA 3R8YA 1LW2A 2IRYA 3EGNA 4Q43A 2ZC3A 1TV6A 1KBRA 3KLFA 1S49A 3W2VB 3DLBA 4UOFA 3DI6A 3GPAA 4DR5J 4LF5J 3MM8B 2PA8D 1NBEB 1R0BG 3N5FA 2FJWA 1W2IA 4OYZA 1KONA 3D9BA 2GMLA 3DOLB 1SXLA 3CDWA 4KGZB 5E3CA 1P1TA 2ZOMA 3G96A 5D4NA 3GCXP 2MGZB 3CDAA 4XDCA 2VZ9A 5BR8J 2WVBA 2RAQA 1SC6A 5K20B 2J9CA 3FFIB 4USMA 2EFOA 5E5NA 3OXFA 2E5LJ 3ENVA 4QBUA 4PXDA 2IDLA 5KOWA 4A8FA 1SVDA 3M32B 1HNXF 3QLHA 2Q66A 1Q0NA 4PG8A 2GHVC 3W2WA 4PG4A 2RHQB 4YB7A 2ZD1A 1HR0J 3DGPA 3HULA 2VPXB 3M2UA 3VVUA 2NREA 1WG4A 2VKRA 3DRSA 3GCWP 2V8DA 3AOAA 4A46A 2RKIA 5B7WA 1D8YA 2XI2A 5C25A 1U1OA 4KPYA 1XK8A 4KH1B 2D69A 4WP9A 1M5VC 1UVLA 3CO0P 3E2EA 3T5LA 2RJZA 4RW9A 2I6WA 2DIVA 1X60A 2ZJQQ 2V4JA 1U0HB 3SFUA 5GAGU 3LQVA 3CPWR 3HHLC 4N56A 1OJ4A 4PQUB 2W25A 1GXTA 3LGNA 3K57A 4F25A 3QRQA 2VUGA 4OQJA 3OHAA 3NBPB 1X0PA 3AFGA 4L72B 3PKYA 4F2RA 2XY6A 1H72C 4U7UD 4FYWB 5ETSA 2WRMA 3AA9A 2ATLA 1HARA 1VLOA 3JTOA 3H59A 4KPCA 1ZH5A 1YBUA 2VICA 5IM0B 1EARA 4ZN1A 3MPYA 1S59A 3G8SA 1J5EF 1B4SA 3GB0A 2XC9A 3HT3A 1IVZA 4URSA 1VBZA 4J91A 5DDRC 1PYTA 2HQFA 4DSKA 2FZKB 3D2WA 1GMWA 2UUBF 1S1VA 4X65J 4G65A 4Q7AA 3BBCA 4AE5A 1NPKA 4A47A 1RGVA 4NA2A 4CDIA 4IOBA 4K0KJ 2OUGA 3RUBL 3MEKA 2E29A 3IRXA 3EZUA 4C8ZA 4Q44A 3CNQP 1BQXA 4NWBA 2NR0A 3PJWA 3BKUA 2IFXA 2P9CA 4CO2A 2VBWA 1HLWA 1FE4A 1LKZA 5LT5A 2W4CA 1F5AA 4YB5A 1NK6A 5ETTA 4MH8A 2LDYA 2CKWA 3H98A 4OX9F 1BQMB 3KDOA 4LF1A 1TUGB 4ES2A 4ILLA 5E41A 1YJRA 3C46A 4QIEA 3DC2A 1YQHA 2JRSA 2F9JA 2DY9A 2AEMA 3R97A 4RL1A 4FDFA 1KP6A 3EICA 3OUYA 1MMDA 1RHKB 2IRXA 4K4ZA 3CF5Q 4DPYA 4WFAQ 1RACB 5D6GA 2DHGA 4DWIA 2AJ0A 2F4FA 3H8YA 3TZZA 2ROGA 2MY7A 1NNDA 2CIMA 1ZA2B 4ILRA 3RB3A 5A6WA 2HWIA 2DRBA 3C16B 3L7OA 5DJBA 2H5JB 1WOSA 3BGLA 1WHWA 3OTOF 1Y11A 3EE3A 1P6TA 1FJCA 1WC4A 3AJ2A 3V5RA 1EETB 2QIFA 3R5AA 2OD6A 3KUGA 3MEEB 5HROA 2RQKA 5I4MA 2XO7A 2NYIA 1GMWD 4QWBA 3W61A 1SH3A 4UT4A 4DBQA 4MAKA 4OYXA 1AA1B 3EX7B 4YR0A 1N52B 4K4TA 1V5IB 1YJTA 1Y4ZB 4AL5A 5H9EJ 2WZ1A 1CJKA 3IS9B 3CW2C 1Z2ZA 2BQUA 5CQGA 3I96A 1S0VA 5EHHA 2W7AA 5L1JA 2J0XA 5IZHA 2UV8G 4LSLB 3S1TA 2DIUA 3CULA 2BX6A 3UO0A 4NA1A 4KC5A 4QYZJ 1RE1B 4LRAA 5E3RA 3RR8A 1XN9A 4CO1A 2YWHA 2ZVIA 3LGHA 4GKKJ 4DR1J 1IUJA 3L7UA 2BJ3A 1HBUA 2R7WA 4BLGA 1YRUA 4X4OA 3C14B 3SYZA 3KK3A 1SIZA 2MQOA 1IBCB 1C4CA 3QAEA 4QU6A 1S0NA 1X4BA 1FKAF 3FBEA 3MZIA 5KT3A 2J7UA 2H51B 4O0IA 4IFVA 3NGKA 4CO0A 1RAGB 1IKXA 2B5JB 1N33F 1RT5A 5D78A 5E3QA 3MECB 1L3SA 2VFTA 3AB2B 3D3BJ 5IC4B 5LM7E 2XS5A 4ER8A 4ZPWR 1HI8A 2VFVA 1TK5A 2VFSA 3C8YA 4ECZA 3U1NA 4LIRA 4QR1A 4WYLA 4K4XA 3PJXA 2YNHA 4C9DA 2XMWA 3JQMA 5CAAA 4DG1B 3IRWP 5L39A 3JYTB 1ZAWA 3W9IA 5HP1A 1HA1A 1HNXJ 3RW6A 1BWVA 4ED4A 1X31C 4B9UA 3TVYA 1H7XA 5K5MA 2HHTA 5MLCV 3W64A 1RYSA 3GR0A 5U47A 3RAMA 3PZPA 5JUMA 2I5JA 1WF1A 2F9DA 2NPFA 5C2CA 1S6OA 4DN0A 4FS1A 1T8EA 2HBQB 3MPVA 3FNNA 1VFJA 2W2MP 3OFFA 2XTJP 2N3LA 1QE1B 3CJ4A 3PEJA 3DDKA 1RWVB 1J27A 1GX5A 3M2RA 1BY9A 4G1QA 4K4WA 2OSQA 2AGPA 5D4PA 5C7PA 1JXLA 1NDLA 2B6AB 1U8WA 4U9RA 5B0GA 2VF3A 2PO4A 3MUVP 3FQLA 1U1QA 4JB8B 1GMUA 4RKUC 1G3OA 3HD2A 3RZAA 2LA4A 1RTJA 2VC1A 5KT5A 2LECA 9ATCB 1V3SA 3ZTRA 4TU8A 3OLBA 1NH7A 4PG6A 2G0IA 2RU3A 1JLAA 3G8TA 4WK3A 4MYTA 2DRDA 4FKYA 3QT8A 4Q5VA 2B3TB 4USJC 3QGGA 5A8WA 5KT6A 5F8MA 1XMBA 4D3GA 3ZZYA 3FRZA 3QPIA 3M8PB 2V9WA 1PAUB 5M2PA 1J5EJ 2I8EA 2IC3A 4O23A 1S1XB 1UW9A 3PFEA 4ILMA 4RW4B 1N5VA 1N5QA 1WKLA 2HBYB 1SJ1A 3FEXB 5KT4A 3LTOA 2Z2ZA 5H9FJ 3GFYA 1YRXA 2OI2A 2PEBA 2AQ4A 2DHHA 3PFOA 2C2MB 1HNIA 2E5JA 2E9RX 3OJSA 2QX0A 1SCJB 5KFLA 1VQSA 4OHYA 4CLPA 1UEVA 1DLOA 5AE1A 2MY8A 4UY85 3SZ2A 3EMTA 3ZXWA 2DEJA 4DFPA 1T9XA 2E7VA 1WJ9A 2Z57B 4H4OB 4OX9J 4O44A 2VG7B 1O5JA 1HYSB 1WWHA 3BGOP 5C42A 4Y2MA 2K1RB 4NLWA 3L3CA 1T05B 4W92B 2YQ0A 4DL0C 2KN4A 3V6JA 3DDNA 4TLQA 4J9NA 1TL4A 3CJ2A 4DQRA 2QN6B 1C1CB 4F02A 2BKPA 3BKFA 2RRAA 1FRJA 2KZZA 1FRMA 1ITPA 5GADU 2MKHA 3HJVA 1S6QA 2R7QA 3E3XA 3CJ5A 5LJ5Y 3M8WA 5IWAF 3HHLB 4ZDNA 1N34F 1UCNA 1AFIA 3OTOJ 4F2SA 3O6QA 4DQIA 3Q8SB 5KFUA 2WOMA 3ILLA 2XMMA 3JTNA 3RTVA 2DXEA 1Y5IB 2Z0GA 8RUCA 1R8BA 4EMDA 2HFUA 1M90T 2FJAB 2LYVA 3ILIA 3DLGB 2OEKA 3G82A 1SUQA 3WX4A 2ZKUA 1MU2B 1PBUA 3RB4A 2GAHC 3FK4A 2YKQA 5T7LA 1TL7A 1NM2A 2CPJA 2L41A 3MDFA 2LFVA 2DRAA 2D7SA 1A0OB 3ZZTA 1S97A 4TY9A 4DR3F 3UD5A 4W90B 2HRTA 1HBMA 3AQPA 3IAM9 3JB9k 1UWAA 1LNQA 3VAJA 4USWA 4F36A 4RBTA 3AXMA 1FFWB 2JEJA 4CH7A 3FEYB 4YR2A 2BJ1A 3QGIA 3HZGA 4DEZA 3WHIA 4WP8A 1RTIB 2CWXA 3KDNA 3J81j 4CM0A 2W2PP 1F5CA 2DGUA 2FIUA 1WOOA 2DGOA 1IKVA 2J8AA 3HCXA 4C0BA 1NO8A 2KZMA 2HNYB 4YHHF 4DZ6A 3ET6A 3FJ2A 2AYMA 1HBOB 5DZ7A 2GQQA 3QIDA 3MCMA 3V4IA 2Z2LA 2YKMB 1QUVA 2QMXA 2MHEA 4L74A 2BA9A 3SV3A 4NZ0A 5I3UB 3DU6A 2CG8A 4U8VA 2YWGA 4UUWA 1RWMB 3TJ8A 2DXFA 1RAJA 1JIHA 5J2NB 2EEYA 4KKOA 1KQFB 1KLNA 2MZ1A 1N6QB 3BF4A 5CD4H 4NYZA 4HL9A 2HAIA 1YJVA 1YJWS 3ITHB 4DSFA 2HS4A 3SBMA 4X4QA 5K14A 1FRKA 2OGUA 4B3RF 1KLMA 3ZTOA 4IOAQ 1U24A 1Q86T 2EFNA 3MEGB 3N01A 4RNMA 2IRUA 3B78A 4IUFA 4KFBA 1U49A 1IBMF 2DNYA 2RH3A 2O1PA 3LAMA 3VAIA 1JQGA 1T3NA 4KR0B 4HEA9 4GVBB 3NLCA 2UVWA 2MJUA 2BQ3A 2V9KA 1P8GA 4B3OB 3PNIA 2YKNB 1FDAA 1JLGB 2L3MA 4NCBA 3NGSA 4B9LA 2YWEA 4RW7A 5LSRA 4F26A 4C98A 4O3SA 5KFPA 3CCJS 4OHWA 2W2OP 4OYBA 1Q53A 2JLEA 2KRBA 3SQOP 3G8QA 1NXIA 1FNXH 2KG1A 1S1TB 4DQQA 4A8SA 2HBZB 4DV2F 1NB7A 3P49B 1U0SA 2CQHA 4CTAB 4J9QA 1QDUB 3JS9A 2LEBA 3UQSA 3BBFA 3CB4A 3BYPA 3HF5A 2J0WA 2ZHBA 5C24B 1N54B 3DYAA 3RRGA 4NLQA 4OFZA 4C3LA 2J6TA 5A0YA 1LW0A 1VQ5S 4A4JA 2XSJA 4CYUB 2W9CA 1RA7A 4K4VA 1G6BA 1S57A 2A6OA 1A9NB 2RRNA 1X4HA 1DBDA 2G0CA 4UY8T 1M5HA 2C3OA 2QV6A 2DY1A 1MMLA 4J7CA 4Q0BA 3FQKA 3I9ZA 4WE1B 3BKTA 3T41A 1LWEB 2L08A 3UD4P 1GX6A 5J1EB 4C8OA 1FVQA 1RAHB 3DM2A 3LO3A 1Q7YT 2HQDA 2MXYA 3PCOB 3QWPA 2YXLA 4WBFA 3LWLA 3DLHA 3C15A 4GKJF 1S7IA 2NLWA 2X1AA 4LBPA 3R2CJ 1R7IA 4B9TA 2WTFA 1X8DA 5KFEA 4NE9C 4CP5A 2OIHA 1WG1A 1R0AB 1N32F 4ELTA 3OTEA 4LSNA 4EBDA 4XO0A 4NLOA 1HHSA 2FC9A 2XQCA 4JYAF 1JJHA 3ONQA 2D3ZA 4KB7A 1X9WA 4TQSA 1KOHA 1TUVA 2HMIA 2JNJA 1VIOA 4B9VA 2QE5A 3DNCA 2BXJA 3O1LA 3HZEA 1B7YB 2A0FB 3MMAA 4TQRA 2YQ3A 4QWAA 1WACA 3D7SB 1T9VA 5HMWA 1URRA 3FGVA 3I4HX 4P73A 3IG1B 2E5HA 5HQLA 4X4PA 3M6UA 5DQGA 3R5DA 4OJ1A 4KGMA 3CDUA 1CULA 3HFVA 4OYIA 5GMKa 1FTCA 2OPSA 3CDEA 2YH1A 3NCQA 2DPJA 1TVRA 3TOQA 2H5EA 4OX6A 3Q8YA 4KBIA 5KG2A 1YRTA 2ZUAA 1N34J 4J9LA 3MM5A 2OPPA 2R2RA 3HHNB 3TARA 4IFYA 5AE3A 2D41A 3K5MA 3M2VA 1S7HA 2IAJA 4TYAA 1Z2LA 4FP9A 3DLLQ 2W24A 3TP2A 2U2FA 1DTTB 1KQGB 1X5PA 2DGQA 3NNAA 5ETKA 2VDHA 4DR6J 2BJ7A 5KG3A 5E0OA 2OJ3A 4JBCA 2B8PA 5GADI 4FF2A 4G6VB 1LWFA 4NCGA 2B56A 3BH6B 1YZ6A 5FIIA 4DF4A 1OSDA 1S76D 4HI1A 1TKXA 4KGXB 2QRRA 4YY3F 2OEJA 1EP4A 3EVOA 1CSJA 4P10A 4NL5A 1AT1B 1N36F 1RTZA 2DYAA 5DLGA 2CQGA 2DHSA 1RP5A 3RYLA 1HD0A 4ZPDA 5D0HA 2YNIA 2EC0A 4I64A 3MM9A 4AUKA 2RS2A 3VAGA 1YX2A 1U26A 5F9NA 3PW4A 2AU0A 4B9MA 2E1MC 3M8YA 1RT1A 4MKBA 3PACA 3LP1B 2JOQA 3NXZA 3MM8A 4Q8EA 3TR5A 1KWMA 2DJWA 1KDNA 3W1YC 4FVMA 3KJQB 2GX8A 4IRKA 3DOLA 1G4CA 1WI8A 4CLFA 4ZK7M 2F1FA 4JI4F 4YS2A 2AX0A 4DCPB 3PTWA 4LF7F 3BB5A 2KKHA 4C8MA 1B0VA 2GMHA 2MGZA 4OZLA 2NCKL 3FFIA 2J9DA 4X64F 3I6PA 2N82B 3NOGA 4EFAC 4RW6B 4LRDA 1NPPA 4QWDA 3GIRA 1RAOA 2ALZA 3K5LA 4B17A 4B3RJ 2DHAA 4MIAA 3JQKA 2FJVA 3AODA 3D0HE 2R3VA 4LFAF 1RABB 4YR3A 4LR8A 2UV8A 2X51A 2KM8B 2C1EB 2K8GA 2VDIA 3BPDA 2V69A 1F3FA 1HBNA 2L9DA 3DXSX 2N4CA 3SEOA 2XZWA 2KRRA 1RBLA 1TTHB 5JXSA 1VRUA 4UUXA 1P9YA 1YJUA 4OL8A 2Q79A 2EW9A 5ETPA 4IG3A 1L5UA 4KV8A 2NXUA 2GVZB 2B8QA 4U96A 5F8NA 1U0HA 4LF2A 2BKOA 1VQ4S 4NOHA 4OYMA 3GFHA 6FDRA 2JC0A 4PQUA 5IS2A 2HIQA 1UPPA 4XK8C 2D3O1 4USUA 1J5OA 2LP4A 5GMDA 1HPZB 1IM6A 3R7SB 2VV5A 4LMZA 3HSJA 4DV2J 1Z4UA 1KVJA 1UZDA 2E7WA 4K4UA 2VFRA 1GK8A 4PEOA 1VBKA 2BABA 3DN9A 3MTKA 5IM0A 2FJBB 5FJ4A 2E5GA 4H54A 1S99A 4R5PB 1RU1A 4I6YA 4P6QA 4Z7YA 1M5OC 4U67Q 1I6JA 1V3RA 1VCTA 3C6TB 1C0TB 3H4BA 3ZTQA 2CXEA 4AFFA 2CQDA 4GRSA 2BRLA 3PY8A 2MSTA 5AE2A 2V8GA 5D3GA 1GNKA 2M3DA 5ETMA 4USKA 3TUPA 4EYIB 2ZDPA 4DFKA 4ZLJA 5IT4A 2DCUB 4MKAA 1IBLF 2IJNA 2BE9B 3O3LA 1RT2B 1AZSB 2YNFB 3MR6A 3D3CJ 1CPZA 3OLAA 1QAYA 1IKYB 3QQCD 2BKNA 3A8EA 4LR9A 1WKJA 3CJQA 4H4KA 3QFHA 2EG2A 2RDDA 1SQGA 2LXUA 4TY8B 2IBKA 2E1RA 3W63A 1IJFB 5LMNF 5CHCB 5DQIA 1KQKA 1TELA 1FNOA 3I0SB 1C0UA 3G6YA 4WFNQ 4N41A 1M5SA 3J7AN 3MR2A 1P27B 2FVQA 3OVAA 1D9DA 4WYWA 1SJRA 1R27B 1N32J 1TZ0A 3LANA 4IDKB 4JYAJ 2KXHA 1NRKA 2JC1A 5KFTA 2MQLA 1KVKA 2VA2A 4RNFA 2R7RA 5HSPA 1NK5A 2LVWA 1YBAA 3HSGA 3DDIA 5KOXA 3GFXA 3Q8VA 3AHPA 1FESA 2WBMA 2N3OA 4ZVHA 4OYWA 2OHDA 3BGFA 3GU0A 2JHEA 4EWTA 3A8JA 2YBVA 3QAUA 3C16A 3UFCX 2IPOB 5ETLA 3ZC4A 3CT9A 2DGTA 3KFWX 3PX6A 2WVEA 1VLYA 2XULA 2CZ4A 4RW8A 4O3QA 5BYQA 2EFPA 2MKCA 1KD1T 4MMOA 3MEEA 5DETA 4ZPBA 4UOHA 1UL3A 2MKJA 4CI0B 1MG7A 2CQIA 4DL4A 2QZ8A 5B0FA 2R8IA 2BJEA 3DRYA 1H6KX 1OO0B 3OXLA 4IH7A 4HH0A 3IWLA 1WHXA 3H5UA 4MK8A 2V2KA 3IS9A 1FJEB 1JJCB 5A8RB 4DPUA 2MLZA 3CWJA 5DDOC 4I2QB 2GO9A 3F41A 1ELOA 2ZH2A 4CLYA 1WDDA 2FLLA 1UEKA 2BJ9A 1A6LA 2RVJA 3LP0A 4KTQA 2H54B 1WC5A 4C11B 4JV5F 4DSLA 3UWTA 4YY3J 2DNNA 4QIFA 2W9AA 3UVJA 1N36J 4DUYJ 4LF9F 4Y00A 1I1GA 1T9TA 1XERA 2F63A 1YDLA 4D3HA 3W3SA 3ICLA 3ZTPA 2HHXA 3C14A 4L75A 1NHVA 2EFGA 3KG1A 3M6WA 3DRRB 4FBTA 3QSIA 5BYRA 1VQYA 3BN7A 3KMSA 4FYVB 1K44A 1VHIA 2WHOA 4EO6A 3QNWB 3BREA 1X4DA 2PFFB 4MK7A 3D68A 1NK0A 2AHOB 3BV8A 1H73A 2ZBRA 2XHWA 2WSEC 2GHPA 3GJTB 1ZTTA 1S1UB 1WF0A 2H3EB 3CIMA 2K3KA 3RRHA 4DSJA 4YQWA 5K8MA 2B5JA 2UUAF 3BR8A 1RLDA 2DCLA 3I0RB 4XPEA 4JI4J 3GYGA 4Y2CA 4QPTA 1HL6A 4FPRA 3UDCA 1U6ZA 3PV8A 3T1YF 4L6V3 2OFGX 3P96A 5H9FK 3FMWA 4DG1A 4N77A 2MHNA 4X64J 3JYTA 2B9YA 5EX0A 2WVDA 2HFOA 4JI6F 1M1HA 2W4PA 1P9QC 3VAKA 2BVZA 1N4LA 1GEHA 4K5RA 5CZXA 2OTLS 3E51A 2MZRA 2C3PA 3W5ZA 2M7SA 1HWUA 4URGA 3MWBA 1KS2A 1TKTB 5LOQA 2LXIA 2FPHX 1HNZF 2YTCA 4M5GA 4PCQA 2EK6A 1CVJA 4N8OA 3PEHA 5JVHQ 4WF9Q 2ZH8A 3D67A 4WFBQ 3D1QA 3UPFA 4M1KA 3T1HF 2UU9F 1VGYA 1IWGA 2AYGA 1QE1A 1CQNA 3M8RA 3GONA 3GP9A 1NB2A 4K5SA 1H98A 5J2QB 1S9GB 3K89A 3HJFA 1R89A 3OW2R 1CJUB 3R3TA 2W9BA 3IAS9 2MQQA 1GT8A 2EKYA 1VHFA 2HK3A 4ID5A 4OI1A 4U7CA 3KLGB 1WC0A 2KYZA 5ETVA 4Z2XA 1N48A 1RISA 3JQJA 4PUOB 3FSYA 3PW2A 2QA2A 4IR1A 5CYMA 1FE0A 3F73A 2BW7A 4I7FB 3FRYA 4DL3A 3H2VE 5LL6d 1UVMA 2QEXS 3UN5A 4J90A 5KFQA 3Q89A 1T11A 3M8PA 4EZ9A 1FO1A 1N5TA 2KDOA 1MMNA 2ZHAA 3RBEA 3QFWA 3SQGB 2YVSA 2PFDA 4X66F 4RW4A 5HLFB 3Q23A 1PJ7A 2F3JA 1U7LA 1DARA 3ZNJ1 1S1WB 2NXCA 1UKUA 4YOEA 3CCES 4HTIA 2UUTA 3I5AA 2EI5A 3ZO7A 2OH2A 2IMWP 3TX0A 1SQFA 3Q2TC 2DB1A 2D3UA 1YGYA 3UCUP 1V9OA 4RWWA 2AF6A 2B9XA 2IM1A 4OV1A 3R27A 1NJWA 3SV4A 4NLPA 1X5TA 5D4LA 5LMNJ 3KJVB 1F9EB 1U1RA
chains in the Genus database with same CATH topology
2ACMA 2E7VA 1IVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACM A;  2E7V A;  1IVZ A; 
#chains in the Genus database with same CATH topology
 1FJG J;  3J7A 1;  4CO4 A;  4H4O A;  2VG7 A;  1RWU A;  1AW0 A;  1HYS A;  1AUS L;  3HP6 A;  1RT4 A;  1RKJ A;  2XLK A;  4FS2 A;  2EXU A;  4Y65 A;  5A6P A;  1T05 A;  3FBC A;  1SC1 B;  4DR5 F;  5K8N A;  2BOP A;  1WEY A;  1IWA A;  3V4M A;  2X3D A;  2KJV A;  1C1C A;  1TMM A;  1K47 A;  3DLE A;  1FEE A;  2QSF A;  1FHT A;  2WCX A;  1WEL A;  5B09 A;  1Q16 B;  2VH7 A;  1YVF A;  5B08 A;  4X4U A;  1EZZ B;  1WC3 A;  3T5J A;  4UZB A;  1S9E B;  1LFP A;  3HHL A;  2WW4 A;  3W62 A;  3HKZ D;  2CUY A;  3KNG A;  5HI7 A;  3BGR B;  2V34 A;  1UJ6 A;  2QA4 G;  2CFX A;  2PEH A;  1OPI A;  1RWO B;  4PWU A;  1PSD A;  1RHQ B;  1UFK A;  1PCA A;  3GG1 A;  1SC4 B;  2IA0 A;  3SMZ A;  3D28 A;  4NCA A;  3ISZ A;  3DLG A;  1S12 A;  3Q8U A;  2XGP A;  5FLX U;  4OX8 A;  2HND A;  1MU2 A;  2ZZN A;  3P5T L;  3WQP A;  5L46 A;  1E6V B;  2HEK A;  1RSC A;  4I6A A;  4IYQ A;  4QCL A;  2KFZ A;  5ADZ A;  4J9M A;  3A1Y G;  3LAK A;  4CQ1 A;  3HPO A;  2ALY B;  4RU9 A;  4JI5 J;  1SJ3 P;  1B64 A;  1HD1 A;  4F4K A;  3KLH B;  3DI6 B;  3V6H A;  3M8S A;  3M6X A;  3G2X A;  3CC4 S;  4WTY A;  3MXH P;  4RLE A;  1VOM A;  1UVK A;  3AQO A;  1HQ2 A;  3U1L A;  2E5I A;  5DZ6 A;  4F0H A;  1SJ4 P;  1M1G A;  4JV5 J;  3EWG A;  4FXD A;  2DO0 A;  1PO6 A;  2ADC A;  4QWC A;  4LF9 J;  2YH0 A;  1PAE X;  2ZBP A;  5HBM B;  4X4V A;  4E2F B;  4I67 A;  1XMQ F;  2ROP A;  4QIV A;  3M1V B;  3CVK A;  3DLJ A;  1FKP B;  2HNY A;  1UPM B;  3PG9 A;  2V2Q A;  4PXE A;  1OS5 A;  4B9S A;  3QLH B;  2ZH6 A;  1DZ5 A;  1CC8 A;  2OEM A;  2I1R A;  3A4T A;  2ZD1 B;  4IR9 A;  3DRX A;  2PII A;  1L3T A;  2YKM A;  2BZ2 A;  2XMJ A;  3H0P A;  3U7J A;  1JNR B;  3VGS A;  2AYE A;  2YX1 A;  3Q8R B;  1Q1K A;  4CLL A;  4DLG A;  1RHM B;  2O3D A;  3OR2 B;  2O66 A;  1Q8B A;  3V6K A;  1CJT B;  4X62 F;  1IXK A;  3DRS B;  5J2N A;  4ECQ A;  1JLF B;  4DX6 A;  1VQL S;  4I56 A;  1N6Q A;  1SH0 A;  1HHQ A;  2MZT A;  5C25 B;  2DH7 A;  1GH8 A;  1VBX A;  5CYJ A;  3GSI A;  3T1Y J;  4AYB D;  3ITH A;  1K1Q A;  3BZQ A;  2R7V A;  5AXK A;  4RW9 B;  2GGP B;  2AZ1 A;  3PW0 A;  5DGB A;  2RE1 A;  1V3Z A;  3K0J A;  4JI6 J;  3QJP A;  1UA1 A;  3G86 A;  3MEG A;  3AJD A;  4NLY A;  4GMK A;  2ZHO A;  3J7Z T;  4CLW A;  4KY3 A;  4F0M A;  2R7X A;  3V81 B;  3QJJ A;  4V1A k;  2G2O A;  4DL7 A;  1HNZ J;  4NLS A;  3R6G B;  1Q5V A;  2FYX A;  1DJ0 A;  2I2Y A;  4Q2M A;  4B3O A;  2J6S A;  4FYD A;  1R31 A;  1OWX A;  4EI2 A;  3JSB A;  3W9H A;  3CDB A;  4GC7 A;  2IMO A;  1SKS A;  3T1H J;  3I32 A;  2YKN A;  2HVZ A;  2UU9 J;  1JLG A;  2GNK A;  1FXD A;  2NS1 B;  1CS4 B;  5M2U A;  2BYC A;  4DV4 F;  2K2P A;  4RX6 A;  4ZVG A;  2YPY A;  1VMB A;  1U1K A;  2MB0 B;  2DNO A;  4ZVT B;  1UVI A;  2DNZ A;  3QGH A;  1RAA B;  4ZMM A;  2LQB A;  2EFV A;  2OPQ A;  4ETZ A;  2GIQ A;  4ECV A;  1S1T A;  3CC2 S;  1ZZN A;  2CJB A;  4ZCK A;  4CTA A;  2DGV A;  1N0V C;  3E01 B;  5D15 A;  1PC5 A;  2LA6 A;  1NAQ A;  3PO5 A;  1KR4 A;  2DIS A;  1SL0 A;  2EKN A;  2Y1J A;  5C24 A;  4WJB A;  1Q4R A;  2OEL A;  2FGC A;  1ZM9 A;  1RKI A;  4F8R A;  2HLT A;  2A10 A;  3Q8P B;  1T94 A;  4CYU A;  2KVQ E;  4ID8 A;  4JI2 F;  4EYH B;  3H20 A;  3FBB A;  3K17 A;  5HAT A;  1N5Y B;  1PIL A;  1YIT S;  5HJX A;  4JOU A;  2PA3 A;  3QBC A;  4QJV A;  2VIH A;  2OLW A;  2EK1 A;  1BLU A;  2YQ1 A;  2A3J A;  2P5V A;  1FFS B;  2D1C A;  2AJQ A;  3QJL A;  4X66 J;  1KFD A;  4ZP9 A;  2CVE A;  2KTQ A;  1R0C B;  2CPX A;  4WE1 A;  1X4E A;  1LWE A;  3GE9 A;  3W7B A;  4HTJ A;  3DGV A;  1RB0 A;  2GIF A;  3DLK A;  2M4M A;  1AXQ A;  3EGZ A;  5J1E A;  3I9V 9;  3GIM A;  2BUN A;  2UVV A;  4ICL A;  3O5T B;  1LFW A;  2BQR A;  5KFG A;  3LAL A;  3OUY B;  1SKR A;  1TP7 A;  5HQM A;  2PE8 A;  3KUH A;  3MF5 A;  5ETR A;  1IKW B;  1PBA A;  2CNN B;  1HQU B;  4NML A;  5K8O A;  1FER A;  5HVH A;  4LQ9 A;  3G9C A;  4K8R A;  4OZ3 A;  5F3Z A;  5E2Q A;  3OL9 A;  4GKK F;  5AJ3 J;  3HSZ A;  4B02 A;  1R0A A;  3K5N A;  3CJ0 A;  5I42 B;  4OHZ A;  1Q7L B;  5IFM A;  4I69 A;  3M05 A;  3D6F B;  1OYE A;  1KVI A;  1X4G A;  1VS3 A;  1LXN A;  1VQK S;  3IR5 B;  3MMJ A;  3B4D A;  4JV2 A;  2NUU G;  1G2E A;  2DNP A;  4I2P B;  5HRO B;  3W66 A;  1VQP S;  4DZD A;  2ILZ A;  1PG5 B;  2DH8 A;  1DTQ B;  4ZS6 A;  1A7G E;  1VQO S;  4WFX A;  3CCZ A;  3NS5 A;  3IG1 A;  4OZ1 A;  2KYX A;  1WEX A;  4O3N A;  4WII A;  1N5S A;  3DOK A;  3KHR A;  3H90 A;  3KK1 B;  4QU7 A;  2X1B A;  2P9G A;  4MTP A;  5HN0 A;  5JVG Q;  1L3U A;  2KT2 A;  1FKO A;  4C0H A;  4CCH A;  5JJB A;  4NXN F;  2OD4 A;  1R6Y A;  2VPW B;  1FD8 A;  2XYH B;  1M5P C;  1GTE A;  3H2L A;  2HAF A;  2IBO A;  4ZA1 A;  3N6N A;  3NNH A;  2B9E A;  4WWS A;  1IQT A;  3VAL A;  1SV5 B;  1FEH A;  4KQZ A;  3RB0 A;  4EBC A;  3J7Y U;  2BAN B;  2CQ1 A;  3GSD A;  4P2X A;  3OSP A;  5J2P A;  1F9H A;  2XNR A;  1G7C B;  2GS8 A;  2PSZ A;  1TFY A;  2VD3 A;  4ECY A;  2G9O A;  2J0Q D;  3POT A;  3AH6 A;  4DXL A;  2W01 A;  1O8B A;  3DHX A;  1ZTW A;  4RO0 A;  3JSM B;  5IQ6 A;  4KGV B;  3BM7 A;  3QYY A;  5J2M B;  5KTQ A;  1QVG R;  4JV0 A;  4YP3 A;  4E98 A;  3OTD A;  5F8H A;  1KRP A;  4MKV A;  2CAJ A;  5D0G A;  4DDF A;  2J8S A;  1FK9 B;  4IFV B;  3CCU S;  4DUZ F;  1BQN A;  1JKH B;  1RT5 B;  4EU0 A;  2RHS B;  4HHJ A;  3I87 A;  2MLY A;  2HZA A;  4LVO P;  4CH0 S;  1BD6 A;  2FLO A;  3CO9 A;  2V63 A;  5GME A;  1RDR A;  2R8G A;  4B3T J;  1XMQ J;  1UW4 A;  2Q6C A;  2HVI A;  3CE8 A;  3LP1 A;  2LCW A;  2K3I A;  2XWY A;  1TUW A;  3HKW A;  2AYB A;  2BE7 D;  2CA9 A;  5L9N A;  4KJI A;  1YTY A;  3IR6 B;  3GLJ A;  3K5P A;  1TR0 A;  3T1A A;  1KNZ A;  3VHQ A;  3GJQ B;  3FKB A;  4LFB F;  3C19 A;  3DRP B;  2WBR A;  4WU3 A;  2IDE A;  4KSE B;  4EUV A;  2JVR A;  1VQ7 S;  4RNH A;  1X4A A;  3VAM A;  4O3O A;  5DG8 A;  4NLG A;  4RUA A;  3MED A;  2YNG A;  2I5J B;  4X62 J;  2GQ2 A;  2WW8 A;  5DGA A;  4NA3 A;  4X2B A;  1RUS A;  4DN9 A;  3I82 A;  4ZVO B;  2COL A;  2ASY A;  4AND A;  4A8W A;  3AY0 A;  4OJH A;  4N76 A;  2BEF A;  3VCD A;  3M2R B;  4ED0 A;  4G1Q B;  1BUX A;  1FF2 A;  4ZVP B;  4O4G A;  5GAE U;  4ITS A;  3HVR A;  2BMB A;  2JFK A;  2BR0 A;  3N6L A;  1EHW A;  4C3K A;  3TAM A;  1RTJ B;  3VR1 A;  1JJ2 R;  2FY8 A;  2KT3 A;  2O67 A;  1JLA B;  4GC6 A;  1XMO F;  3KKF A;  2C2O B;  1F1B B;  3BQ2 A;  1BE4 A;  1U25 A;  5A8W B;  4ZHR A;  1K0T A;  2GVZ A;  2MPU A;  3CSK A;  3ZTS A;  4DV4 J;  1ACM B;  3MM6 B;  4DV3 F;  3M30 A;  1DUR A;  4K59 A;  4F4Y A;  2WON B;  4Y0F A;  2MLX A;  1ZA1 B;  4OIX A;  2IC3 B;  5L1I A;  4BBY A;  3BS9 A;  2ZVS A;  3BBB A;  4PWW A;  3ADA C;  4HI2 A;  2DPI A;  2UUC F;  2DXD A;  2DNQ A;  1T9U A;  2ZZT A;  1K8A T;  5KFJ A;  2GQC A;  4PG5 A;  3ZZU A;  2NQP A;  1HNI B;  2QMU B;  2CJY B;  4Y3C A;  4DFJ A;  3BQ0 A;  4PR6 A;  4IQX A;  5HQ8 A;  1NJZ A;  1WC1 A;  5HL7 Q;  3PRV A;  4M5L A;  1DLO B;  4JI2 J;  4QPX A;  5AXL A;  1C0T A;  1XBW A;  2XZT B;  1RTD B;  1U6B A;  1QTN B;  2W7P A;  4X84 A;  3HX9 A;  2KG0 A;  2KHD A;  4NPO A;  2JEI A;  4LIW A;  5KFZ A;  4O44 B;  5CYQ A;  1AZS A;  4NEZ A;  4RWX A;  3CC7 S;  2APO A;  1TQL A;  1EQM A;  3IN5 A;  3PYF A;  4Q45 A;  4ZIV A;  3IO1 A;  1RK8 A;  3FCH A;  2R2U A;  2V8V A;  2QO3 A;  2FHJ A;  4WU2 A;  4DR4 F;  1UTA A;  1PYS B;  1S6Q B;  3I0S A;  5J1P A;  2FHK A;  1W26 A;  2KFY A;  3N28 A;  2V2Z A;  4DPT A;  1FX2 A;  2FVS A;  4FF1 A;  2HRU A;  4F4A A;  1Q8I A;  4X4S A;  3NCR A;  2I38 A;  2L9N A;  3NRB A;  4WFY A;  4AQY F;  2CYY A;  2QT7 A;  1H0H B;  1UAW A;  4DFM A;  4DV6 F;  2XMA A;  3TW0 A;  1UMJ A;  1FWK A;  4JUZ A;  1S0O A;  5F8J A;  2C2D A;  3O8W A;  1Y00 A;  1HMV A;  4J9V A;  1Q81 T;  3I5C A;  5KG5 A;  2CPD A;  4A48 A;  2ZE2 B;  1U48 A;  2GV1 A;  5KFF A;  2DR5 A;  1Q5Y A;  3TRG A;  5KAK A;  2D3O R;  2PMZ D;  1MSW D;  4NXM F;  2RSQ A;  4OYA A;  4DHV A;  4NXN J;  4ECR A;  3MAA A;  2X3G A;  5ITH A;  4ZOS A;  1M1K T;  2HQI A;  4DV5 F;  4AL6 A;  3LOU A;  3NGD A;  1RWN B;  3KLI B;  1HBM B;  2RDI A;  2MZS A;  3EYZ A;  4W4M A;  3QAT A;  3N79 A;  4OI0 A;  2AW0 A;  1QSL A;  1HNW J;  1OPZ A;  2L48 A;  5A8K B;  2FUG 9;  1WSV A;  1GQE A;  3ENA A;  3BYR A;  5A8R A;  2Y3Y A;  1RHU B;  4ZJL A;  1IKV B;  5F8I A;  2VHG A;  2M9K A;  3EVM A;  4I68 A;  1XEZ A;  3M6V A;  3HDS A;  3FSX A;  3MI7 X;  5J1N A;  3ET6 B;  4UOC A;  2CRL A;  4C11 A;  4FPI A;  3OVS A;  1MN7 A;  4NRU A;  3WBZ A;  3V4I B;  1HI1 A;  2ATC B;  5EN1 A;  3MCN A;  1K73 T;  2AJ2 A;  1PJ5 A;  2NXE A;  2Y1R I;  1XC9 A;  4DUZ J;  5B0B A;  2AT1 B;  3J7Y I;  1HFE L;  3IWX A;  1N8R T;  4KKO B;  4FKX A;  3F44 A;  3Q0A A;  3FMB A;  4DV7 F;  1FRX A;  4EEY A;  1EKS A;  2W2Q P;  1XNQ F;  4UQG A;  5E7O B;  4F67 A;  2PMH A;  3F56 A;  3TUJ C;  3EZO A;  2LQ9 A;  2QTW A;  4L3N A;  2OFH X;  1S1U A;  3T9N A;  1VRQ C;  3MGJ A;  1QAJ A;  4LFB J;  2C3U A;  5KFI A;  4KFB B;  4JI0 J;  2H48 B;  3T3F A;  4C8L A;  1ZPW X;  4M5D B;  2XYG B;  3NKY A;  2BM0 A;  2IVF B;  4C3M A;  4NYO A;  4U8Y A;  2JWN A;  5KFX A;  2LEA A;  1RWK B;  3VAH A;  4P7T A;  3ZFV A;  4F04 B;  4ED5 A;  2IHR 1;  2HYI B;  4ZIW A;  3KLE A;  3HHD A;  3OV7 A;  3S6E A;  4CLS A;  3H5Y A;  3UDL A;  2MTL A;  4P52 A;  4RU2 A;  1HQE B;  1UZH A;  3R9L A;  1NSP A;  2N7C A;  4OI4 A;  3HLU A;  1JLC A;  1Y5N B;  4LJM A;  4KHP F;  4DX7 A;  1TKT A;  4A8Q A;  5L38 A;  1U02 A;  2RF2 B;  3U02 A;  4NYP A;  2NZ4 A;  2LDI A;  5KFH A;  2MZQ A;  1TAU A;  2ZJP Q;  1LWX A;  4UW2 A;  3GFZ A;  2BE2 B;  2FGO A;  2V68 A;  2MKI A;  1S0M A;  2DGX A;  4NI2 B;  3PHE A;  5CD4 A;  1XMO J;  3S7R A;  4ES1 A;  3W65 A;  1TMJ A;  2E66 A;  3ETO A;  5J2Q A;  1S9G A;  3NCP A;  1TL5 A;  2QC3 A;  3KXD A;  5A0Y B;  1CJU A;  5T14 A;  1LW0 B;  1RYR A;  1B99 A;  2XSJ B;  3MD3 A;  4DV3 J;  3AXK A;  1X4F A;  1F5B A;  3TZY A;  2QL5 B;  3PXG a;  2JDJ A;  5GAE I;  3UN2 A;  1S6P A;  5A2Q Y;  4GVL A;  2VA3 A;  2VAS A;  3CD7 A;  2KU7 A;  2UUC J;  2F40 A;  4I7F A;  5AXM A;  3BSC A;  4YB6 A;  4DS4 A;  3ISN D;  4FBU A;  3ILJ A;  5GVQ A;  4ETX A;  3DM2 B;  3GYX B;  2KM8 C;  4PPD A;  4CWB A;  3KNA A;  1UP1 A;  3L95 X;  4ANE A;  4U6P A;  2VKZ G;  1FA0 A;  2LU2 A;  4TYB A;  1TAQ A;  1JLE B;  3FUY A;  1CLF A;  3PRD A;  1E6Y B;  2A1B A;  1WHV A;  2EG1 A;  3TJ9 A;  2EBE A;  1TL1 A;  1T9Y A;  1U1L A;  2AJF E;  3RW7 A;  1QSS A;  2ZM6 F;  1RBO B;  4LSN B;  3NGR A;  4DR6 F;  3BO2 A;  2Y0B B;  3PM9 A;  2HMI B;  3DKD A;  2JH3 A;  2V4R A;  3CJK A;  3RR7 A;  1W2B R;  2WK4 A;  4WK1 A;  3F0N A;  2XMU A;  2P2C B;  3NS6 A;  2J7W A;  5DG9 A;  3MMA B;  2KXF A;  1WDT A;  3GIL A;  2QYG A;  2IIH A;  3JSR A;  9RUB A;  2ZH9 A;  2KT5 A;  3W8G A;  1LWC A;  3GMG A;  4CM2 A;  3KJV A;  4DU8 A;  4ZLN A;  4DR4 J;  1B7F A;  4LBH A;  2HFS A;  1RTH A;  2OPS B;  3PW5 A;  2VG5 A;  1HNV B;  4TNO A;  1RWW B;  3B4M A;  2F7V A;  3VAF A;  5DG7 A;  1K1S A;  1SB6 A;  1QD1 A;  1TKZ B;  1ZM3 A;  3S01 A;  3X3U A;  1RAE B;  5IOL A;  3CCR S;  2BAC A;  4AQY J;  4M5I A;  2ROE A;  4DV6 J;  3EXC X;  4LQ3 A;  1VC5 A;  4DF8 A;  1JLQ B;  2IAJ B;  1QAI A;  5F41 A;  3OPK A;  3K5O A;  3PYG A;  3NP5 A;  1K9M T;  3QIP B;  4HKQ A;  4MYU A;  2LQJ A;  4XTT A;  4AD6 A;  3PYE A;  5KFA A;  4PYD A;  5DS7 A;  1NKB A;  4WZM A;  1IM4 A;  2CVI A;  3VF0 B;  2EC2 A;  3A12 A;  1IR2 A;  4QWE A;  4RPF A;  3RBX A;  4NLT A;  2ZDO A;  3TX8 A;  1S9E A;  3M8Q A;  4NLX A;  2DGS A;  4NXM J;  2FVC A;  1YJ7 A;  1NJY A;  2AEJ A;  4NCG B;  3GR1 A;  4DCJ B;  4DV5 J;  2AJ4 A;  1XJW B;  1U6F A;  4FN5 A;  3NEK A;  2OKQ A;  4ELV A;  2DTJ A;  5KFB A;  1APS A;  3OFH A;  4LT6 A;  1I5O B;  1RT7 A;  3HVT A;  4H4M B;  3I31 A;  5KFR A;  2CAD A;  2YNI B;  4DV1 F;  2JX2 A;  4LBI A;  4N47 A;  2G4B A;  3GQC A;  2B4O A;  3NAH A;  1Q82 T;  2DKO B;  3IFE A;  1E6V A;  1T7P A;  5A2Q U;  4ED6 A;  2YWW A;  1RT1 B;  1GXU A;  2HHH F;  3EDQ B;  1ZOT A;  2DHX A;  2EPI A;  2GHW A;  1F2H A;  3KLH A;  2XSF A;  4F4Z A;  4P72 A;  1TK8 A;  1LXJ A;  3TNV A;  2M0G B;  4P2F A;  3GV8 B;  4N7T A;  3R5G A;  1NU4 A;  4UTG A;  2MKK A;  4CH1 A;  1GTH A;  3ZZ0 A;  4DSI A;  4HHU A;  2IJF A;  5HBM A;  5F8L A;  3KTQ A;  1T0T V;  3M1V A;  3HMJ G;  4M5M A;  2I9S A;  2NPI A;  1FKP A;  3QZ7 A;  1REG X;  1GMV A;  4ZPT R;  3IM9 A;  3TVK A;  1RLC L;  4DV7 J;  2M52 A;  3AB4 B;  2QA4 S;  3OSN A;  1SPB P;  3BQ1 A;  1XNQ J;  3PYD A;  2FJD B;  4HDG A;  1U47 A;  3SDE A;  5EWG A;  4HYK A;  2R9L A;  2QLB B;  1MNE A;  4I1T A;  3EUN A;  1NPR A;  1U2F A;  3G4S S;  5KG7 A;  4AXJ A;  2R4F A;  1SL2 A;  3OL8 A;  1S9F A;  3BO4 A;  2C28 A;  2KB2 A;  3OR2 A;  1CJT A;  2HS0 A;  1VK8 A;  1UVN A;  1D1U A;  3QT7 A;  2D9O A;  3RB6 A;  1JLF A;  1G1X A;  3BH7 B;  3OQ2 A;  1REV A;  3OR1 B;  4O3R A;  1RU2 A;  1HBN B;  4KHM A;  2JVO A;  3ENQ A;  2HIY A;  2QFI A;  4C8K A;  2CZV C;  2F4V F;  1VRU B;  4A8X A;  4I4B A;  1L3K A;  4TXS A;  3UDV A;  2ASL A;  4IG3 B;  3VV2 B;  5B0C A;  2GGP A;  4KV8 B;  4NRT A;  3QWU A;  5KFW A;  1T03 B;  1JB0 C;  1KSP A;  3FC9 A;  4AL7 A;  3B54 A;  4CO5 A;  2HUR A;  2DEI A;  3N0V A;  4JP8 A;  3WIU A;  4KHP J;  1SL1 A;  1H2T Z;  2HBR B;  3V81 A;  2CZ9 A;  1J5O B;  2DBB A;  3DHW C;  4KO0 A;  4DOZ A;  1LK7 A;  3BEG B;  4HH1 A;  2UVR A;  1RQ0 A;  1S4F A;  4W98 A;  4C8N A;  3H4D A;  2YKO A;  1GFW B;  1I94 J;  1CS4 A;  2HNZ A;  4XAK A;  2XLI A;  1AB8 A;  3RAX A;  5IC6 B;  3UCZ P;  1QSY A;  3SSQ A;  1HKA A;  4OZ0 A;  3KOA A;  1KFS A;  1HI0 P;  5KT7 A;  6AT1 B;  1JJ4 A;  5KFM A;  1OQ3 A;  3WC2 A;  4CLZ A;  4C48 A;  4DQP A;  4YN3 B;  4MIB A;  5F8G A;  2XY7 A;  2B0G A;  4UZC A;  5D3G B;  3K2Y A;  1DRZ A;  4CIO A;  3E01 A;  2YX7 A;  1V6H A;  4PRF A;  1RHR B;  4F4X A;  2HK2 A;  2DNH A;  2NSC A;  3AD7 C;  1K0V A;  2WVF A;  2W8L A;  4DLE A;  2KH9 A;  2GVD A;  2VB6 A;  2LLZ A;  2CG4 A;  1LEO A;  4WKY A;  3MR7 A;  4FYX B;  3NMR A;  4K2J A;  2F8E X;  1JXE A;  3VQS A;  4XPC A;  3SIP B;  1X5S A;  1N5Y A;  4FXW A;  4PAA A;  2NUH A;  2JSX A;  4ECT A;  2FQQ B;  4RUB A;  3Q8Q B;  3BGU A;  1RT6 A;  1PJ6 A;  2QLW A;  1C0U B;  1NK7 A;  1IJE B;  1BWE A;  1QUP A;  4IG0 A;  3HT0 A;  2ZM6 J;  3C6U A;  3B6B A;  2LEP A;  3GZ7 A;  2XHC A;  3TWZ A;  3P45 B;  2IJR A;  5HMZ A;  1PC4 A;  3OTC A;  4A8K A;  1MRO A;  2XO6 A;  3NMA A;  3CMQ A;  5HO4 A;  1EJ7 L;  1U1N A;  1IKW A;  3C66 A;  3UNG C;  2C2E A;  1HQU A;  4JI3 F;  5BXI A;  2CPH A;  3D1O A;  4QOT A;  2J7K A;  4KYZ A;  3KK2 A;  4OHV A;  1LQ9 A;  4DUY F;  1S5Z A;  2QL9 B;  1UVJ A;  2V4Q A;  4ENO A;  2DR9 A;  1H38 A;  3CCV S;  1SBR A;  3D6H B;  2HHU A;  5I42 A;  1WUU A;  3R7N B;  4F50 A;  1UJ4 A;  4TKT A;  2HZV A;  4GO7 X;  1HWI A;  2Y1I A;  2AEF A;  4RW8 B;  3R1H A;  1EQ0 A;  2UXC J;  3W2V A;  3LP2 B;  3TA2 A;  4I2P A;  3T6J A;  4CLU A;  1QLN A;  4YB1 P;  5G0R B;  3EPI A;  1DTQ A;  1VC6 A;  1BGX T;  2VFU A;  3H25 A;  1YJ9 S;  5DDP C;  1HWJ A;  1KTQ A;  1S48 A;  2P9E A;  1VYA A;  3KK1 A;  4N8N A;  2B51 A;  2VJU A;  3IBF B;  4P2M A;  3TUI C;  2K7K A;  2AJ1 A;  1BXN A;  5KFO A;  2E1C A;  4A8O A;  3QO9 B;  3UI3 A;  4Z37 A;  1LV5 A;  3GV5 B;  3MOJ B;  2A6M A;  3ULH A;  2YPZ A;  3QT6 A;  1SV5 A;  4XDD A;  3BDE A;  5HVG A;  3R1L A;  4TVA B;  3LP0 B;  2XMT A;  4PZV A;  3M32 A;  2BAN A;  4DCO B;  3CCQ S;  3GII A;  3X1L B;  2JLG A;  1ZM2 A;  2QL7 B;  3TVZ A;  1JLB B;  3UVJ B;  3PKM A;  3JSY A;  2HVH A;  2J0S D;  3GYN A;  1VR6 A;  2CDR B;  1YZ7 A;  5FD1 A;  2DD8 S;  3J80 Y;  4DV1 J;  1H74 A;  2HHS A;  4RZR A;  5EWF A;  4ED7 A;  1YJN S;  3H42 A;  3JSM A;  4KT0 C;  5L1K A;  2CPI A;  1U45 A;  5CXT A;  1KHW A;  2HHH J;  4O0N A;  2Y8W A;  2WVC A;  2ZUG A;  5J2M A;  2XZD B;  2H4Y B;  1NLK L;  1DAX A;  3AD9 C;  3VGU A;  3JAM Y;  4K4S A;  2J9E A;  1UWB B;  2PD1 A;  5JMN A;  4QIW D;  1OIA A;  3EZ5 A;  2AZ3 A;  2HS3 A;  3KHG A;  5F3T A;  4JI7 F;  1FK9 A;  4DL5 A;  3T9Z A;  3NWR A;  3HK2 A;  1JKH A;  3MMB B;  1Q95 G;  2QA1 A;  2F8M A;  1ZS6 A;  2Z8Q A;  2OPR B;  1M0S A;  4NZ6 A;  4OX7 A;  4IRD A;  2H5I B;  1N56 A;  4IKA A;  3R2D J;  3MUT P;  4USI A;  4FYY B;  3NBP A;  4F3Q A;  3T5K A;  4RR5 A;  3B82 A;  3ELH A;  1T3O A;  1SI9 A;  1NZA A;  3R5J B;  5K9F A;  2ZOF A;  1O0P A;  1AUD A;  4HAC B;  2A2C A;  3DRP A;  4B08 A;  2UP1 A;  2C22 A;  2Q3P A;  2MQP A;  2RT3 A;  3CCS S;  1RCX B;  1YG0 A;  2HHV A;  1EAY C;  2HLU A;  5IXU A;  3HM9 A;  1SKW A;  1HWK A;  3EDR B;  5K8P A;  2CNO B;  1YBT A;  4P7V A;  3V6D B;  3MCO A;  3MTJ A;  1X0F A;  5H9E K;  3TA0 A;  2PI4 A;  2HFV A;  3A8K A;  2UUW A;  2F4V J;  3MM7 B;  1T95 A;  2HHQ A;  4URQ U;  3TEH B;  2MDA A;  1JX4 A;  3DU5 A;  1TL3 B;  2IA6 A;  5EGY A;  2W9B B;  4KIA A;  4ZVS B;  1NDK A;  2C2N A;  4ID5 B;  4QYZ K;  4OLO A;  2ZFH A;  1Q8K A;  3LA0 A;  5CYM B;  4ZCL A;  1DY3 A;  1FJG F;  3D6T B;  2R2T A;  2HGN A;  5DM6 Q;  1RHJ B;  2JJ4 D;  2AX1 A;  3OD2 A;  4J9S A;  1O6X A;  3GV7 B;  1BQM A;  4BWM A;  2B9W A;  4KRW A;  2DNL A;  3MM6 A;  4L76 A;  4IQM A;  4OJG A;  1F6T A;  4O3P A;  1NK8 A;  2WON A;  1YKW A;  1BC6 A;  5HAO A;  4R0J A;  1RBA A;  2YKP A;  2KVI A;  3IA0 A;  1UFL A;  1SJF A;  5LJ3 Y;  5GAG I;  1KOO A;  1F60 B;  2L9W A;  3FCW A;  2MMY A;  2RNE A;  2RDJ A;  2FC8 A;  4CLT A;  3J80 U;  2P6T A;  2IYI A;  2VU5 A;  3ENW A;  2H1Y A;  2UUB J;  2ACY A;  2XS2 A;  2HQ3 A;  3FDS A;  1F9F A;  3D0G E;  4AXI A;  4G3I A;  4IRC A;  2V5H G;  1EET A;  3FSI A;  3JAM U;  3TEG A;  1RTD A;  2VL1 A;  4C8Y A;  2R7U A;  2KL8 A;  2CQ3 A;  4OHX A;  4X4N A;  3KMQ A;  2GMJ A;  1FD2 A;  1NSA A;  1S79 A;  3O44 A;  3EVW A;  3TQE A;  4DX5 A;  2CWK A;  1RT4 B;  3K58 A;  3KJF B;  4BDP A;  2POK A;  4JI5 F;  2E7X A;  2CPY A;  3L9Z A;  4DI6 A;  1U1P A;  1QTM A;  3KUE A;  1FFG B;  4LSL A;  2FLP A;  1H7W A;  3ILO A;  3FCV A;  1XNR F;  2YWK A;  4ZP7 A;  2G0J A;  2VG6 B;  1ZM4 A;  4UQT A;  3DLE B;  2DGW A;  4USH A;  4OMF G;  4DPX A;  3KJN B;  1P1L A;  1B3T A;  4JI3 J;  3B8H A;  1X4C A;  2M70 A;  4MFB B;  1I51 B;  2FVR A;  1PGZ A;  1C1B B;  2BV3 A;  1XWL A;  4NMX A;  1RJJ A;  2GFF A;  1CG2 A;  3SSS A;  4F4W A;  3BJY A;  2AGO A;  2ZIT A;  3P3D A;  4CT9 A;  5MAO A;  2AKW B;  3CJ3 A;  2FZG B;  2MKY A;  1F3V A;  2LQ8 A;  2QSW A;  1YSJ A;  3P5B P;  2LKZ A;  2ERR A;  3EPG A;  3IBW A;  1X9S A;  1D0E A;  5D0E A;  2F5G A;  2OSR A;  3CED A;  3NS7 B;  5KG4 A;  3OL6 A;  2W8K A;  1H2V Z;  1C4A A;  4RBU A;  2ZE2 A;  4LUB A;  2HND B;  4DPO A;  4LFC F;  1QY7 A;  3HI9 A;  4HDH A;  2ZOG A;  3MEC A;  2HHW A;  1RWX B;  2CJX B;  3N6M A;  3HO1 A;  4LRB A;  4DR2 F;  1URN A;  1R8P A;  4M94 A;  2MQ8 A;  2DT9 A;  4R8U B;  2ZNZ A;  4ED1 A;  5DDQ C;  1GAO A;  3CD6 S;  1HHT P;  3KLI A;  3PDN A;  3GTY X;  4KH0 B;  6FD1 A;  2MQM A;  1FXL A;  3NWG A;  4C97 A;  4Y6I A;  2XMK A;  4RNO A;  2CNK B;  3IWN C;  1JMT A;  3NL0 A;  2HZC A;  3WX8 A;  1PYO B;  2DNK A;  1RXO B;  4DUT A;  5A8K A;  2WSC C;  1SJQ A;  4WFZ A;  1FWL A;  2HHP A;  4RJV A;  5RUB A;  1VRT B;  3W60 A;  2CQ4 A;  2MZJ A;  2Z2Y B;  3GJR B;  2P8I A;  7FDR A;  1R8A A;  3M9N B;  3OFG A;  3KLV A;  4A8Y A;  4NLV A;  1R6V A;  3SSR A;  2V8H A;  5L9X A;  4LSZ B;  2PT0 A;  3MFH A;  3HSD A;  3HXM A;  3L7P A;  8AT1 B;  1F2G A;  3DXB A;  5L8R C;  2B6A A;  4JI7 J;  1OY8 A;  3GWC A;  2ABY A;  4CNZ A;  2IM3 A;  5M2R A;  3J7Z 5;  1VI7 A;  2R8H A;  1CJV B;  1N33 J;  3LH2 S;  5FLX Y;  1VJW A;  2QG9 B;  3CME S;  2CDQ A;  1RCO B;  2E44 A;  2X1G A;  4IO9 Q;  1VC0 A;  4M8L A;  2J76 E;  1WOP A;  1ZPV A;  2DR6 A;  3BR9 A;  1RT3 B;  1FCA A;  2BBE A;  1QJH A;  2YX4 A;  5LSO A;  3ZZO A;  2OML A;  1ULR A;  2MKS A;  1FJ7 A;  4BC7 A;  3QT5 A;  2UXD F;  2M8H A;  2RU9 A;  3OJU A;  3H2U B;  4WXW A;  1H3D A;  4P71 A;  4HHH A;  2HFN A;  2AIR B;  1JWW A;  3TI0 A;  2GCF A;  1DQ9 A;  5EWE A;  3H5S A;  4J37 A;  3OTB A;  2M5Y A;  1RI7 A;  4M5D A;  4ZJQ A;  2GA7 A;  3LUY A;  3UN3 A;  1NKC A;  1FI4 A;  3THP A;  4ANC A;  3EM1 A;  1S1X A;  3A3O B;  2EBG A;  3NY0 A;  2VJV A;  5FDL B;  3PO4 A;  1Y10 A;  3IP0 A;  4LF6 F;  3DOM B;  3W5Y A;  2MQN A;  5KFN A;  5IV3 A;  2KHC A;  3VGV A;  2JLF A;  3UE2 A;  1HQE A;  3BO3 A;  3US5 A;  2G2Y A;  4DQS A;  2C2K B;  4G1P A;  2R7T A;  4PWD B;  4P2S A;  3KHL A;  3NGU A;  1KC8 T;  3P6Y C;  2OPQ B;  2ZJR Q;  2RF2 A;  1Q8L A;  4BC9 A;  3DMJ B;  1PIE A;  4Q8F A;  2ZBC A;  4FF3 A;  1GXL A;  1Y7P A;  2BE2 A;  5AJ3 F;  3MUM P;  5IT9 Y;  2CNL B;  2CJQ A;  4NI2 A;  2F65 A;  1WTB A;  3IGV A;  3VZI A;  4HLB A;  2BRK A;  4J5O A;  3OBI A;  3M7V A;  3I5B A;  4EZ6 A;  1RA6 A;  3PR4 A;  3KG4 A;  4N5S A;  3PIO Q;  1FNM A;  4L3K A;  4S0M A;  2YY3 A;  2K1R A;  3IMQ J;  3VVT A;  1MWQ A;  1Q79 A;  4TU7 A;  4WPA A;  1U09 A;  3H7H B;  3OVB A;  4ZJO A;  4C4W A;  2E1A A;  1ZAX A;  4WZQ A;  3MUR P;  1NDC A;  4QYR A;  2BDP A;  2ZZM A;  2CQ0 A;  2VBY A;  5HK4 A;  2H65 B;  4OI3 A;  2VBX A;  1OY9 A;  2HWH A;  1FDD A;  3DLK B;  3UCG A;  4ZVE A;  1AYE A;  4ICL B;  5B0D A;  4RUH A;  1NEE A;  2VOP A;  3OXG A;  3MMC B;  2W7O A;  4DX8 H;  4YFU A;  4M5H A;  5E33 A;  3GG0 A;  3L09 A;  5CA5 A;  2IVM A;  1JLE A;  3R5C A;  2XNQ A;  5D4O A;  4OYO A;  2WSF C;  1E6Y A;  1FRH A;  2ILY A;  4QW9 A;  5CCL A;  4F3O A;  1S77 D;  4KAI A;  4PKD B;  2BJ8 A;  4DSE A;  2CJK A;  3ISN C;  5DM7 Q;  2EFQ A;  3M9M B;  4U7U K;  5DQH A;  4QW8 A;  2G1D A;  1TFW A;  3U1M A;  1LW2 B;  4DV0 F;  2NYH A;  3N9U C;  2OP5 A;  3MCS A;  1NSQ A;  5SZT A;  1YWX A;  4RUC A;  2Z4P A;  1TV6 B;  4KGK A;  3KLF B;  1IR0 A;  5G4D A;  5KG6 A;  4ZPV R;  2N4D A;  1FDB A;  3KWM A;  1XNR J;  4WXO A;  2LXF A;  2Y8Y A;  3H5X A;  1WOR A;  3DOK B;  3QZ8 A;  4OLP A;  1OMS A;  1HNV A;  2ZC4 A;  1FKO B;  2EWH A;  3CTR A;  3Q2S C;  3T19 A;  2MYF A;  2YWF A;  2RRB A;  1RTI A;  4B3T F;  1U4B A;  3CGI A;  3G87 A;  1TKZ A;  5IWA J;  1OYD A;  3LW5 C;  4CRJ A;  3EGW B;  2Q43 A;  3R6L B;  1X5O A;  1ICE B;  2BJD A;  1D8Z A;  1S4E A;  4J9K A;  1J2V A;  1WEZ A;  4P75 A;  4EGL A;  1JLQ A;  2CJA A;  3UW1 A;  1RWP B;  4E0D A;  1NK4 A;  3T5H A;  3W2W B;  1HBO A;  5KT2 A;  3QIP A;  3FVY A;  5J2P B;  4OV6 A;  3DGP B;  2JEG A;  4ZVU B;  3LPY A;  2RD5 C;  3WDO A;  3PVX A;  1Q78 A;  5I3U A;  3FBF A;  3M2U B;  2ZH4 A;  2BW2 A;  3HHL D;  3LPE A;  4UF4 A;  4X4T A;  3POT B;  2RQC A;  4LFC J;  3TUZ C;  3TQ1 A;  4CZC A;  3KHH A;  2RKI B;  4KE5 A;  5ETQ A;  1DQA A;  5IT9 U;  3THV A;  4LVN P;  4X4R A;  4DR2 J;  3MAH A;  1HW8 A;  3K59 A;  2Y9H A;  2KO1 A;  2CJ9 A;  1SKU B;  4UST A;  4DR3 J;  1Y3J A;  1KN6 A;  4WTO B;  3SCI E;  1VIX A;  3I55 S;  2V4J B;  3EJM A;  4ED3 A;  7FD1 A;  4H4M A;  3FZB A;  1JNZ B;  1AFJ A;  2XEX A;  1BQN B;  1CBK A;  5B0A A;  2C42 A;  2R2S A;  2AWZ A;  1ZBT A;  1IR1 A;  3BSO A;  2CQC A;  3WZ0 A;  2Q6B A;  4GVB A;  2XI3 A;  4MK9 A;  4JV1 A;  5EUH A;  2PMW A;  4YHH J;  2HGL A;  1NJX A;  2KFN A;  3MR3 A;  2JFD A;  4IH5 A;  4DR7 F;  5KFV A;  4LRC A;  4RBV A;  1IBK F;  3HFZ B;  3RBZ A;  2D74 B;  4ES3 A;  4DL2 A;  5HMX A;  2NXJ A;  3CCL S;  3RU0 A;  5IQQ A;  3NNC A;  1WG5 A;  4QR2 A;  4FVC A;  1U2C A;  3V2U C;  1PKU A;  2ZH1 A;  3KYL A;  2V2V A;  2IVY A;  2UXB F;  3S8S A;  3MED B;  2YNG B;  1OY6 A;  1ROF A;  1SC3 B;  4YDX A;  2VPZ B;  7AT1 B;  5CAB A;  3CCT A;  5KFS A;  3HVA A;  5DO2 A;  1S1V B;  3PX0 A;  2P6S A;  2FY1 A;  4BWJ A;  4NLU A;  2AP6 A;  1LK5 A;  4R0E A;  1XTZ A;  3TJA A;  2UXD J;  5THW A;  4O4G B;  4HT5 A;  2RML A;  3Q22 A;  2FTR A;  3T6B A;  4CNY A;  2DH9 A;  2DIT A;  4M63 A;  2HKE A;  1QM9 A;  3CMA S;  1T02 A;  3IRX B;  4FNI A;  1IBM J;  3RJM B;  3TAM B;  3UR0 A;  3OHB A;  3OR1 A;  2R7O A;  1VQM S;  2X1F A;  1WSR A;  4RNN A;  4F3M A;  1NDP A;  2GC8 A;  4LF6 J;  4ZVR B;  4ZHR B;  3G71 S;  4IH6 A;  3SCJ E;  2VQE F;  3M9O B;  4JI1 F;  1T03 A;  4ZN3 A;  3M30 B;  3CJR A;  4NLD A;  1Y9O A;  3PJ9 A;  5AXN A;  4Y2A A;  4FXV A;  3UDE A;  2AGQ A;  1EIY B;  2ASD A;  5BYS A;  4NEY A;  2GIR A;  2GO8 A;  2M2B A;  1B70 B;  1Z1Z A;  1IQZ A;  1C2P A;  3SCL E;  4ZP8 A;  1WTF A;  2J9D E;  1MLA A;  4CT8 A;  2W1B A;  3PHT A;  4PXB A;  2M88 A;  1QVF R;  2XCA A;  2ZWO A;  3HHK A;  4OZ2 A;  1JXV A;  4QR0 A;  4MIW A;  3JTP A;  2FHM A;  2QLF B;  3J81 Y;  3MAQ A;  2CPZ A;  3Q83 A;  2FVP A;  5GAH U;  4QIG A;  2RQ4 A;  2DVI A;  3DFE A;  3LF0 A;  1SQE A;  1NUE A;  1UET A;  5KG0 A;  3G6V A;  2XY5 A;  3E8O A;  2KI2 A;  4ED2 A;  2V6A A;  2QJ3 A;  5D77 A;  1CJK B;  3PRB A;  1L3V A;  2XWX A;  5CYQ B;  2Z58 B;  1KTV A;  2C3Y A;  4V19 J;  1EX8 A;  1OQ6 A;  3OFE A;  4FZV A;  2RIJ A;  4GKJ J;  2OO4 A;  2B7B B;  4FNH A;  2XS7 A;  4Y28 C;  3K7R A;  1HNW F;  1VQ9 S;  2HVD A;  4ED8 A;  3GIJ A;  1DTT A;  2B43 A;  1HBU B;  1NK9 A;  2FJE B;  2VBZ A;  3KK3 B;  1FRI A;  3TZW A;  3CJ8 A;  4J9R A;  1S6U A;  4QZV B;  2NSB A;  1ZYQ A;  4DV0 J;  2AD9 A;  1YIJ S;  2HVE A;  5C5J A;  1NCL A;  2QLJ B;  2RUS A;  4HT7 A;  4I6W A;  1BHN A;  4ELU A;  3D0I E;  1HMV B;  1TKD A;  3EGV A;  2VC0 A;  3CD5 A;  4ERD A;  4HR2 A;  4YDD B;  3AT1 B;  3IM8 A;  4OZ5 A;  2CQB A;  1IKX B;  4ZLL A;  4EBE A;  1I3O B;  3A8I A;  4OJ3 A;  2G2Z A;  2C2Z B;  2GW8 A;  2ACM A;  2LU1 A;  1DFD A;  2KJW A;  5F9L A;  3N4W A;  3MAA B;  3A13 A;  2WB4 A;  2YNH B;  5KFD A;  2UZA A;  4DU7 A;  3LP2 A;  5G0R A;  2G1H A;  3D5M A;  4Y2K A;  3VWS A;  5A76 A;  3MPD A;  4Q2L A;  2MJN A;  5HP1 B;  2IM2 A;  3DCA A;  5CCM A;  4U95 A;  4M5N A;  1VIS A;  1YK9 A;  4JI0 F;  5EDW A;  2QLX A;  2AV5 A;  3UD3 P;  1KKH A;  4DL6 A;  2CQ2 A;  5ETO A;  3QO9 A;  1D9F A;  2R42 A;  4KHR A;  1SIW B;  5KFC A;  4RW6 A;  1W7W A;  2RB7 A;  3AA8 A;  3BSN A;  1VQ6 S;  3OT9 A;  1JLB A;  1UFW A;  2W4D A;  3J81 U;  3D54 A;  3A3N B;  2DO4 A;  3BDP A;  1FWP A;  1SH2 A;  2DK2 A;  5I3P A;  2ZH5 A;  4C0O C;  4YUD A;  2WB1 D;  1O51 A;  1S10 A;  5C2G A;  1ZAV A;  1WD6 A;  4YME A;  3NG8 A;  2XMV A;  4ZCI A;  4CLK A;  3N5B A;  3LWM A;  2H4W B;  3WIV A;  2R8J A;  4DPW A;  3QRR A;  4DR7 J;  5HMY A;  1UWB A;  4NX9 A;  5KG1 A;  3ZZR A;  4DJB A;  1IBK J;  2XGQ A;  3TZX A;  3QSY B;  3VGT A;  4B3S F;  2Y1L B;  4ZIT A;  5LMU F;  4A8M P;  3MMB A;  1TK0 A;  5L1L A;  3WC0 A;  2OPR A;  2UXB J;  1R43 A;  4JI8 F;  4LF7 J;  3GJS B;  1HPZ A;  4ECX A;  3G6X A;  3I56 S;  4I0W A;  2C3M A;  4ZKA A;  1DQ8 A;  3KLE B;  3CXC R;  2B4V A;  1R8H A;  3CCW A;  3TAN A;  1R3N A;  3IBC B;  4HAC A;  4R25 A;  3R5B A;  3MPU B;  1JLC B;  2XB2 D;  2CPF A;  4R5P A;  4LFA J;  4WCE Q;  3AAW B;  3MR5 A;  3C6T A;  3L4B C;  4MKY A;  5HAN A;  1FX4 A;  3V6D A;  2J6U A;  2IY5 B;  2QFJ A;  3ETM A;  3C3L A;  4PQA A;  2VQF F;  1Y3K A;  3MM7 A;  2XLJ A;  1NH8 A;  2ZKT A;  1CQM A;  3Q86 A;  1XR5 A;  3IGN A;  2VQE J;  5C42 B;  4M5K A;  2NZC A;  1NJI T;  1RT2 A;  1TL3 A;  4JI1 J;  1CC7 A;  2YNF A;  4PXC A;  1CEZ A;  1B0T A;  2DNG A;  1HW9 A;  1IKY A;  4B3M F;  4IOC Q;  1FXR A;  4J9U E;  5F0U A;  2XCP A;  1S6P B;  2YKA A;  4TY8 A;  5KFY A;  1S72 S;  2QMW A;  4ZP6 A;  2DNM A;  1X7V A;  4PAB A;  5IV4 A;  4OI2 A;  4C2M A;  2AMC B;  1D09 B;  1WF2 A;  3W5X A;  4EK2 A;  2H9Z A;  2FJX A;  4TLR A;  2IYG A;  2I0X A;  1XQI A;  4K7Q A;  2EVZ A;  4WIQ A;  4IDK A;  1KQS R;  2DR7 A;  2B4P A;  3CJS A;  4LRE A;  2PDA A;  2WOM B;  2RS8 A;  4V19 X;  3IR7 B;  3OL7 A;  3TA1 A;  3EXY A;  1BMQ B;  3W9J A;  5D0R A;  3SCK E;  2ZBI A;  1TL1 B;  8ATC B;  2PI5 A;  2C2R A;  3FZ2 A;  3G82 B;  1SUQ B;  3M8Z A;  3QMQ A;  1XIQ A;  4XIU A;  2QGF B;  3CD0 A;  1FT8 A;  5T7L B;  1TL7 B;  1VK3 A;  2ZNY A;  4BHQ A;  4GO5 X;  1B0P A;  1IBL J;  2DNR A;  3CJK B;  2VON A;  4OZJ A;  4LRF A;  2HRY A;  3D66 A;  4Y34 A;  2F8H A;  4LF4 F;  1IN0 A;  4LF8 F;  4TU9 A;  4IO1 A;  3MOZ A;  1YLX A;  1WI6 A;  3Q24 A;  1LWC B;  4OYP A;  1N0U A;  1KEK A;  2K06 A;  4ZLP A;  2V94 A;  3CJT A;  1RTH B;  2BOA A;  3AJ1 A;  2VG5 B;  3UNY A;  5GAH I;  2UVU A;  5LXY A;  4P74 A;  4BCA A;  3K8V A;  4OZN A;  3PW7 A;  1EKR A;  3W8P A;  4C7Q A;  4I2Q A;  4LF5 F;  1FTR A;  1Y5L B;  4QQB A;  2FHJ D;  4EO8 A;  5E3P A;  3JXO A;  2G13 A;  2VG6 A;  3PX4 A;  4ZVF A;  1NSK L;  4MFB A;  3U27 A;  4DS5 A;  1N88 A;  2CPE A;  2RQM A;  2HWT A;  3NOC A;  1RZM A;  1C1B A;  1HIY A;  3QGP A;  2XM3 A;  4J9P A;  3AOC A;  4ZCM A;  3M8Q B;  5HVF A;  2DR8 A;  3D6M B;  5BR8 F;  4ECW A;  1LOU A;  3DRR A;  1NHK L;  2ASJ A;  2ZEJ A;  4H4K C;  2O01 C;  1XR7 A;  3TO8 A;  2E5L F;  3BN4 A;  2E9T A;  3H40 A;  5K14 B;  2Z30 B;  1OSC A;  1HR0 F;  1RT7 B;  3HVT B;  1KLM B;  2RIL A;  3O2I A;  4ECU A;  3K8W A;  2XBP A;  1M5K C;  5I3Q A;  4Z7C A;  4M95 A;  3D1H A;  3I0R A;  2PGC A;  2HPU A;  2OTJ S;  2V0N A;  3SXL A;  2ZBQ A;  4R8U A;  2HSE B;  1WNE A;  2ZH3 A;  2HG4 A;  4J9O A;  1DHM A;  5E3A A;  4BS2 A;  4DMZ A;  2E1P A;  5DLF A;  2U1A A;  5T41 A;  4RW7 B;  3C2P A;  3RGI A;  5CZV A;  2GAG C;  3D4J A;  2JEF A;  3PR5 B;  2Q1L A;  5LSL A;  3BSA A;  3QRP A;  3AOB A;  1NKE A;  5CH7 B;  5D8H B;  1XR6 A;  2K7J A;  1VRT A;  3CIZ A;  2WAQ D;  1HWL A;  3RRK A;  2B4U A;  4ATN A;  1W25 A;  3MHY A;  4HVZ A;  2VOD A;  4ZPC A;  1I94 F;  3I4P A;  3SDE B;  3VQT A;  4AT1 B;  1VQ8 S;  1UA0 A;  1YHQ S;  3DYA B;  4P9S A;  3VTI A;  4TN2 A;  1RAI B;  5B0E A;  2QYC A;  4B3S J;  4FF4 A;  5LMU J;  2W9C B;  1CJV A;  1NME B;  2UUA J;  2Y0S D;  4LR7 A;  2FZC B;  4PYA A;  1WHY A;  4ALZ A;  1WC6 A;  1REV B;  3KLG A;  2B7C B;  5H1S V;  4G1I A;  3NGT A;  1H2U X;  2VPY B;  4MT1 A;  4PUO A;  2R7S A;  3RAQ A;  4JI8 J;  5KFK A;  2NXN A;  4Q0B B;  2BM1 A;  1RT3 A;  4X65 F;  3CCM S;  4M5J A;  2J5A A;  2Z2M A;  2ZH7 A;  2JZ5 A;  3A3P B;  1TU0 B;  3MD1 A;  4F7V A;  3KG0 A;  1U1M A;  2ADB A;  1T9W A;  2LMI A;  4K0K F;  3THT A;  1D9A A;  2GZO A;  1NZ8 A;  3TAQ A;  3HVW A;  4K50 A;  4C6A A;  3C15 B;  3VZH A;  2V8P A;  4L73 A;  4UOG A;  3SQG A;  4WP3 A;  4KO0 B;  1UJ5 A;  2V50 A;  2HQC A;  3M4X A;  5HLF A;  3ZZZ A;  4PPZ A;  5FDL A;  1S1W A;  5ETN A;  1ZET A;  3DOM A;  4OI6 A;  3MFI A;  3G6E S;  1VBY A;  2HNZ B;  2CQP A;  3IC1 A;  3P4U B;  2MEW A;  2VQF J;  4NZ7 A;  2VOO A;  1MWY A;  4B9N A;  4NAS A;  4NLR A;  4E8U A;  4YEA A;  2D9P A;  4PWD A;  4K2X A;  4K4Y A;  1MN9 A;  2PC6 A;  1MWZ A;  1FDN A;  2E9Z A;  1KHV A;  2M8D B;  1QAX A;  2OAU A;  2HGM A;  3HD1 A;  1VDH A;  1U2R A;  3DMJ A;  2N7Y A;  4B3M J;  4ZPA A;  3R7B B;  3NAI A;  4WKR A;  1EB0 A;  4MJK A;  1V5V A;  1JK9 B;  2FB0 A;  5DRK A;  1F0X A;  1CUL B;  5AT1 B;  2XG8 A;  1TVR B;  4PG7 A;  2KXN B;  3P8B B;  3RBD A;  1ZZF A;  2FHO B;  4CO3 A;  2FLN A;  2GVD B;  1UEU A;  3HHE A;  1Y0H A;  2UXC F;  5BJR A;  3CUN A;  2HW3 A;  2XYP B;  3MM5 B;  5EX3 A;  2OPP B;  4F0K A;  1RAF B;  4IFY B;  2HQG A;  2GJI A;  2Z56 B;  3HFK A;  3PIP Q;  3M2V B;  2GJF A;  3BPS P;  4ECS A;  2OMO A;  5F0W A;  1VJQ A;  1RT6 B;  3IXQ A;  2HFZ A;  2MSS A;  2R8K A;  1YI2 S;  3UR3 C;  4ZVQ B;  1D3W A;  2PN6 A;  2V67 A;  3GIK A;  2O5D A;  5IT0 A;  1NHU A;  2RUG A;  3FEZ A;  3LGM A;  4O4R A;  4IG0 B;  3ZNU A;  3C6U B;  2ZWP A;  2A18 A;  1R8C A;  3SFG A;  3TYT A;  1MRO B;  4Y2I A;  3MMC A;  1LWF B;  1X9M A;  3BGR A;  2W2N P;  1FRL A;  2GJ2 A;  2A2D A;  4USV A;  2X7I A;  1MW7 A;  1WKK A;  1TKX B;  3MPW A;  3RG6 A;  3TAP A;  1U8S A;  1ARO P;  2JL9 A;  1VQN S;  3AD8 C;  1EP4 B;  2FDN A;  4LF4 J;  2FD2 A;  5LXR A;  4LF8 J;  3KK2 B;  4DR1 F;  2LQ5 A;  3SI8 A;  5HJY A;  1FVS A;  1RAD B;  3MM9 B;  3ZZP A;  2IM0 A;  2SXL A;  5SUH A;  3R8Y A;  1LW2 A;  2IRY A;  3EGN A;  4Q43 A;  2ZC3 A;  1TV6 A;  1KBR A;  3KLF A;  1S49 A;  3W2V B;  3DLB A;  4UOF A;  3DI6 A;  3GPA A;  4DR5 J;  4LF5 J;  3MM8 B;  2PA8 D;  1NBE B;  1R0B G;  3N5F A;  2FJW A;  1W2I A;  4OYZ A;  1KON A;  3D9B A;  2GML A;  3DOL B;  1SXL A;  3CDW A;  4KGZ B;  5E3C A;  1P1T A;  2ZOM A;  3G96 A;  5D4N A;  3GCX P;  2MGZ B;  3CDA A;  4XDC A;  2VZ9 A;  5BR8 J;  2WVB A;  2RAQ A;  1SC6 A;  5K20 B;  2J9C A;  3FFI B;  4USM A;  2EFO A;  5E5N A;  3OXF A;  2E5L J;  3ENV A;  4QBU A;  4PXD A;  2IDL A;  5KOW A;  4A8F A;  1SVD A;  3M32 B;  1HNX F;  3QLH A;  2Q66 A;  1Q0N A;  4PG8 A;  2GHV C;  3W2W A;  4PG4 A;  2RHQ B;  4YB7 A;  2ZD1 A;  1HR0 J;  3DGP A;  3HUL A;  2VPX B;  3M2U A;  3VVU A;  2NRE A;  1WG4 A;  2VKR A;  3DRS A;  3GCW P;  2V8D A;  3AOA A;  4A46 A;  2RKI A;  5B7W A;  1D8Y A;  2XI2 A;  5C25 A;  1U1O A;  4KPY A;  1XK8 A;  4KH1 B;  2D69 A;  4WP9 A;  1M5V C;  1UVL A;  3CO0 P;  3E2E A;  3T5L A;  2RJZ A;  4RW9 A;  2I6W A;  2DIV A;  1X60 A;  2ZJQ Q;  2V4J A;  1U0H B;  3SFU A;  5GAG U;  3LQV A;  3CPW R;  3HHL C;  4N56 A;  1OJ4 A;  4PQU B;  2W25 A;  1GXT A;  3LGN A;  3K57 A;  4F25 A;  3QRQ A;  2VUG A;  4OQJ A;  3OHA A;  3NBP B;  1X0P A;  3AFG A;  4L72 B;  3PKY A;  4F2R A;  2XY6 A;  1H72 C;  4U7U D;  4FYW B;  5ETS A;  2WRM A;  3AA9 A;  2ATL A;  1HAR A;  1VLO A;  3JTO A;  3H59 A;  4KPC A;  1ZH5 A;  1YBU A;  2VIC A;  5IM0 B;  1EAR A;  4ZN1 A;  3MPY A;  1S59 A;  3G8S A;  1J5E F;  1B4S A;  3GB0 A;  2XC9 A;  3HT3 A;  1IVZ A;  4URS A;  1VBZ A;  4J91 A;  5DDR C;  1PYT A;  2HQF A;  4DSK A;  2FZK B;  3D2W A;  1GMW A;  2UUB F;  1S1V A;  4X65 J;  4G65 A;  4Q7A A;  3BBC A;  4AE5 A;  1NPK A;  4A47 A;  1RGV A;  4NA2 A;  4CDI A;  4IOB A;  4K0K J;  2OUG A;  3RUB L;  3MEK A;  2E29 A;  3IRX A;  3EZU A;  4C8Z A;  4Q44 A;  3CNQ P;  1BQX A;  4NWB A;  2NR0 A;  3PJW A;  3BKU A;  2IFX A;  2P9C A;  4CO2 A;  2VBW A;  1HLW A;  1FE4 A;  1LKZ A;  5LT5 A;  2W4C A;  1F5A A;  4YB5 A;  1NK6 A;  5ETT A;  4MH8 A;  2LDY A;  2CKW A;  3H98 A;  4OX9 F;  1BQM B;  3KDO A;  4LF1 A;  1TUG B;  4ES2 A;  4ILL A;  5E41 A;  1YJR A;  3C46 A;  4QIE A;  3DC2 A;  1YQH A;  2JRS A;  2F9J A;  2DY9 A;  2AEM A;  3R97 A;  4RL1 A;  4FDF A;  1KP6 A;  3EIC A;  3OUY A;  1MMD A;  1RHK B;  2IRX A;  4K4Z A;  3CF5 Q;  4DPY A;  4WFA Q;  1RAC B;  5D6G A;  2DHG A;  4DWI A;  2AJ0 A;  2F4F A;  3H8Y A;  3TZZ A;  2ROG A;  2MY7 A;  1NND A;  2CIM A;  1ZA2 B;  4ILR A;  3RB3 A;  5A6W A;  2HWI A;  2DRB A;  3C16 B;  3L7O A;  5DJB A;  2H5J B;  1WOS A;  3BGL A;  1WHW A;  3OTO F;  1Y11 A;  3EE3 A;  1P6T A;  1FJC A;  1WC4 A;  3AJ2 A;  3V5R A;  1EET B;  2QIF A;  3R5A A;  2OD6 A;  3KUG A;  3MEE B;  5HRO A;  2RQK A;  5I4M A;  2XO7 A;  2NYI A;  1GMW D;  4QWB A;  3W61 A;  1SH3 A;  4UT4 A;  4DBQ A;  4MAK A;  4OYX A;  1AA1 B;  3EX7 B;  4YR0 A;  1N52 B;  4K4T A;  1V5I B;  1YJT A;  1Y4Z B;  4AL5 A;  5H9E J;  2WZ1 A;  1CJK A;  3IS9 B;  3CW2 C;  1Z2Z A;  2BQU A;  5CQG A;  3I96 A;  1S0V A;  5EHH A;  2W7A A;  5L1J A;  2J0X A;  5IZH A;  2UV8 G;  4LSL B;  3S1T A;  2DIU A;  3CUL A;  2BX6 A;  3UO0 A;  4NA1 A;  4KC5 A;  4QYZ J;  1RE1 B;  4LRA A;  5E3R A;  3RR8 A;  1XN9 A;  4CO1 A;  2YWH A;  2ZVI A;  3LGH A;  4GKK J;  4DR1 J;  1IUJ A;  3L7U A;  2BJ3 A;  1HBU A;  2R7W A;  4BLG A;  1YRU A;  4X4O A;  3C14 B;  3SYZ A;  3KK3 A;  1SIZ A;  2MQO A;  1IBC B;  1C4C A;  3QAE A;  4QU6 A;  1S0N A;  1X4B A;  1FKA F;  3FBE A;  3MZI A;  5KT3 A;  2J7U A;  2H51 B;  4O0I A;  4IFV A;  3NGK A;  4CO0 A;  1RAG B;  1IKX A;  2B5J B;  1N33 F;  1RT5 A;  5D78 A;  5E3Q A;  3MEC B;  1L3S A;  2VFT A;  3AB2 B;  3D3B J;  5IC4 B;  5LM7 E;  2XS5 A;  4ER8 A;  4ZPW R;  1HI8 A;  2VFV A;  1TK5 A;  2VFS A;  3C8Y A;  4ECZ A;  3U1N A;  4LIR A;  4QR1 A;  4WYL A;  4K4X A;  3PJX A;  2YNH A;  4C9D A;  2XMW A;  3JQM A;  5CAA A;  4DG1 B;  3IRW P;  5L39 A;  3JYT B;  1ZAW A;  3W9I A;  5HP1 A;  1HA1 A;  1HNX J;  3RW6 A;  1BWV A;  4ED4 A;  1X31 C;  4B9U A;  3TVY A;  1H7X A;  5K5M A;  2HHT A;  5MLC V;  3W64 A;  1RYS A;  3GR0 A;  5U47 A;  3RAM A;  3PZP A;  5JUM A;  2I5J A;  1WF1 A;  2F9D A;  2NPF A;  5C2C A;  1S6O A;  4DN0 A;  4FS1 A;  1T8E A;  2HBQ B;  3MPV A;  3FNN A;  1VFJ A;  2W2M P;  3OFF A;  2XTJ P;  2N3L A;  1QE1 B;  3CJ4 A;  3PEJ A;  3DDK A;  1RWV B;  1J27 A;  1GX5 A;  3M2R A;  1BY9 A;  4G1Q A;  4K4W A;  2OSQ A;  2AGP A;  5D4P A;  5C7P A;  1JXL A;  1NDL A;  2B6A B;  1U8W A;  4U9R A;  5B0G A;  2VF3 A;  2PO4 A;  3MUV P;  3FQL A;  1U1Q A;  4JB8 B;  1GMU A;  4RKU C;  1G3O A;  3HD2 A;  3RZA A;  2LA4 A;  1RTJ A;  2VC1 A;  5KT5 A;  2LEC A;  9ATC B;  1V3S A;  3ZTR A;  4TU8 A;  3OLB A;  1NH7 A;  4PG6 A;  2G0I A;  2RU3 A;  1JLA A;  3G8T A;  4WK3 A;  4MYT A;  2DRD A;  4FKY A;  3QT8 A;  4Q5V A;  2B3T B;  4USJ C;  3QGG A;  5A8W A;  5KT6 A;  5F8M A;  1XMB A;  4D3G A;  3ZZY A;  3FRZ A;  3QPI A;  3M8P B;  2V9W A;  1PAU B;  5M2P A;  1J5E J;  2I8E A;  2IC3 A;  4O23 A;  1S1X B;  1UW9 A;  3PFE A;  4ILM A;  4RW4 B;  1N5V A;  1N5Q A;  1WKL A;  2HBY B;  1SJ1 A;  3FEX B;  5KT4 A;  3LTO A;  2Z2Z A;  5H9F J;  3GFY A;  1YRX A;  2OI2 A;  2PEB A;  2AQ4 A;  2DHH A;  3PFO A;  2C2M B;  1HNI A;  2E5J A;  2E9R X;  3OJS A;  2QX0 A;  1SCJ B;  5KFL A;  1VQS A;  4OHY A;  4CLP A;  1UEV A;  1DLO A;  5AE1 A;  2MY8 A;  4UY8 5;  3SZ2 A;  3EMT A;  3ZXW A;  2DEJ A;  4DFP A;  1T9X A;  2E7V A;  1WJ9 A;  2Z57 B;  4H4O B;  4OX9 J;  4O44 A;  2VG7 B;  1O5J A;  1HYS B;  1WWH A;  3BGO P;  5C42 A;  4Y2M A;  2K1R B;  4NLW A;  3L3C A;  1T05 B;  4W92 B;  2YQ0 A;  4DL0 C;  2KN4 A;  3V6J A;  3DDN A;  4TLQ A;  4J9N A;  1TL4 A;  3CJ2 A;  4DQR A;  2QN6 B;  1C1C B;  4F02 A;  2BKP A;  3BKF A;  2RRA A;  1FRJ A;  2KZZ A;  1FRM A;  1ITP A;  5GAD U;  2MKH A;  3HJV A;  1S6Q A;  2R7Q A;  3E3X A;  3CJ5 A;  5LJ5 Y;  3M8W A;  5IWA F;  3HHL B;  4ZDN A;  1N34 F;  1UCN A;  1AFI A;  3OTO J;  4F2S A;  3O6Q A;  4DQI A;  3Q8S B;  5KFU A;  2WOM A;  3ILL A;  2XMM A;  3JTN A;  3RTV A;  2DXE A;  1Y5I B;  2Z0G A;  8RUC A;  1R8B A;  4EMD A;  2HFU A;  1M90 T;  2FJA B;  2LYV A;  3ILI A;  3DLG B;  2OEK A;  3G82 A;  1SUQ A;  3WX4 A;  2ZKU A;  1MU2 B;  1PBU A;  3RB4 A;  2GAH C;  3FK4 A;  2YKQ A;  5T7L A;  1TL7 A;  1NM2 A;  2CPJ A;  2L41 A;  3MDF A;  2LFV A;  2DRA A;  2D7S A;  1A0O B;  3ZZT A;  1S97 A;  4TY9 A;  4DR3 F;  3UD5 A;  4W90 B;  2HRT A;  1HBM A;  3AQP A;  3IAM 9;  3JB9 k;  1UWA A;  1LNQ A;  3VAJ A;  4USW A;  4F36 A;  4RBT A;  3AXM A;  1FFW B;  2JEJ A;  4CH7 A;  3FEY B;  4YR2 A;  2BJ1 A;  3QGI A;  3HZG A;  4DEZ A;  3WHI A;  4WP8 A;  1RTI B;  2CWX A;  3KDN A;  3J81 j;  4CM0 A;  2W2P P;  1F5C A;  2DGU A;  2FIU A;  1WOO A;  2DGO A;  1IKV A;  2J8A A;  3HCX A;  4C0B A;  1NO8 A;  2KZM A;  2HNY B;  4YHH F;  4DZ6 A;  3ET6 A;  3FJ2 A;  2AYM A;  1HBO B;  5DZ7 A;  2GQQ A;  3QID A;  3MCM A;  3V4I A;  2Z2L A;  2YKM B;  1QUV A;  2QMX A;  2MHE A;  4L74 A;  2BA9 A;  3SV3 A;  4NZ0 A;  5I3U B;  3DU6 A;  2CG8 A;  4U8V A;  2YWG A;  4UUW A;  1RWM B;  3TJ8 A;  2DXF A;  1RAJ A;  1JIH A;  5J2N B;  2EEY A;  4KKO A;  1KQF B;  1KLN A;  2MZ1 A;  1N6Q B;  3BF4 A;  5CD4 H;  4NYZ A;  4HL9 A;  2HAI A;  1YJV A;  1YJW S;  3ITH B;  4DSF A;  2HS4 A;  3SBM A;  4X4Q A;  5K14 A;  1FRK A;  2OGU A;  4B3R F;  1KLM A;  3ZTO A;  4IOA Q;  1U24 A;  1Q86 T;  2EFN A;  3MEG B;  3N01 A;  4RNM A;  2IRU A;  3B78 A;  4IUF A;  4KFB A;  1U49 A;  1IBM F;  2DNY A;  2RH3 A;  2O1P A;  3LAM A;  3VAI A;  1JQG A;  1T3N A;  4KR0 B;  4HEA 9;  4GVB B;  3NLC A;  2UVW A;  2MJU A;  2BQ3 A;  2V9K A;  1P8G A;  4B3O B;  3PNI A;  2YKN B;  1FDA A;  1JLG B;  2L3M A;  4NCB A;  3NGS A;  4B9L A;  2YWE A;  4RW7 A;  5LSR A;  4F26 A;  4C98 A;  4O3S A;  5KFP A;  3CCJ S;  4OHW A;  2W2O P;  4OYB A;  1Q53 A;  2JLE A;  2KRB A;  3SQO P;  3G8Q A;  1NXI A;  1FNX H;  2KG1 A;  1S1T B;  4DQQ A;  4A8S A;  2HBZ B;  4DV2 F;  1NB7 A;  3P49 B;  1U0S A;  2CQH A;  4CTA B;  4J9Q A;  1QDU B;  3JS9 A;  2LEB A;  3UQS A;  3BBF A;  3CB4 A;  3BYP A;  3HF5 A;  2J0W A;  2ZHB A;  5C24 B;  1N54 B;  3DYA A;  3RRG A;  4NLQ A;  4OFZ A;  4C3L A;  2J6T A;  5A0Y A;  1LW0 A;  1VQ5 S;  4A4J A;  2XSJ A;  4CYU B;  2W9C A;  1RA7 A;  4K4V A;  1G6B A;  1S57 A;  2A6O A;  1A9N B;  2RRN A;  1X4H A;  1DBD A;  2G0C A;  4UY8 T;  1M5H A;  2C3O A;  2QV6 A;  2DY1 A;  1MML A;  4J7C A;  4Q0B A;  3FQK A;  3I9Z A;  4WE1 B;  3BKT A;  3T41 A;  1LWE B;  2L08 A;  3UD4 P;  1GX6 A;  5J1E B;  4C8O A;  1FVQ A;  1RAH B;  3DM2 A;  3LO3 A;  1Q7Y T;  2HQD A;  2MXY A;  3PCO B;  3QWP A;  2YXL A;  4WBF A;  3LWL A;  3DLH A;  3C15 A;  4GKJ F;  1S7I A;  2NLW A;  2X1A A;  4LBP A;  3R2C J;  1R7I A;  4B9T A;  2WTF A;  1X8D A;  5KFE A;  4NE9 C;  4CP5 A;  2OIH A;  1WG1 A;  1R0A B;  1N32 F;  4ELT A;  3OTE A;  4LSN A;  4EBD A;  4XO0 A;  4NLO A;  1HHS A;  2FC9 A;  2XQC A;  4JYA F;  1JJH A;  3ONQ A;  2D3Z A;  4KB7 A;  1X9W A;  4TQS A;  1KOH A;  1TUV A;  2HMI A;  2JNJ A;  1VIO A;  4B9V A;  2QE5 A;  3DNC A;  2BXJ A;  3O1L A;  3HZE A;  1B7Y B;  2A0F B;  3MMA A;  4TQR A;  2YQ3 A;  4QWA A;  1WAC A;  3D7S B;  1T9V A;  5HMW A;  1URR A;  3FGV A;  3I4H X;  4P73 A;  3IG1 B;  2E5H A;  5HQL A;  4X4P A;  3M6U A;  5DQG A;  3R5D A;  4OJ1 A;  4KGM A;  3CDU A;  1CUL A;  3HFV A;  4OYI A;  5GMK a;  1FTC A;  2OPS A;  3CDE A;  2YH1 A;  3NCQ A;  2DPJ A;  1TVR A;  3TOQ A;  2H5E A;  4OX6 A;  3Q8Y A;  4KBI A;  5KG2 A;  1YRT A;  2ZUA A;  1N34 J;  4J9L A;  3MM5 A;  2OPP A;  2R2R A;  3HHN B;  3TAR A;  4IFY A;  5AE3 A;  2D41 A;  3K5M A;  3M2V A;  1S7H A;  2IAJ A;  4TYA A;  1Z2L A;  4FP9 A;  3DLL Q;  2W24 A;  3TP2 A;  2U2F A;  1DTT B;  1KQG B;  1X5P A;  2DGQ A;  3NNA A;  5ETK A;  2VDH A;  4DR6 J;  2BJ7 A;  5KG3 A;  5E0O A;  2OJ3 A;  4JBC A;  2B8P A;  5GAD I;  4FF2 A;  4G6V B;  1LWF A;  4NCG A;  2B56 A;  3BH6 B;  1YZ6 A;  5FII A;  4DF4 A;  1OSD A;  1S76 D;  4HI1 A;  1TKX A;  4KGX B;  2QRR A;  4YY3 F;  2OEJ A;  1EP4 A;  3EVO A;  1CSJ A;  4P10 A;  4NL5 A;  1AT1 B;  1N36 F;  1RTZ A;  2DYA A;  5DLG A;  2CQG A;  2DHS A;  1RP5 A;  3RYL A;  1HD0 A;  4ZPD A;  5D0H A;  2YNI A;  2EC0 A;  4I64 A;  3MM9 A;  4AUK A;  2RS2 A;  3VAG A;  1YX2 A;  1U26 A;  5F9N A;  3PW4 A;  2AU0 A;  4B9M A;  2E1M C;  3M8Y A;  1RT1 A;  4MKB A;  3PAC A;  3LP1 B;  2JOQ A;  3NXZ A;  3MM8 A;  4Q8E A;  3TR5 A;  1KWM A;  2DJW A;  1KDN A;  3W1Y C;  4FVM A;  3KJQ B;  2GX8 A;  4IRK A;  3DOL A;  1G4C A;  1WI8 A;  4CLF A;  4ZK7 M;  2F1F A;  4JI4 F;  4YS2 A;  2AX0 A;  4DCP B;  3PTW A;  4LF7 F;  3BB5 A;  2KKH A;  4C8M A;  1B0V A;  2GMH A;  2MGZ A;  4OZL A;  2NCK L;  3FFI A;  2J9D A;  4X64 F;  3I6P A;  2N82 B;  3NOG A;  4EFA C;  4RW6 B;  4LRD A;  1NPP A;  4QWD A;  3GIR A;  1RAO A;  2ALZ A;  3K5L A;  4B17 A;  4B3R J;  2DHA A;  4MIA A;  3JQK A;  2FJV A;  3AOD A;  3D0H E;  2R3V A;  4LFA F;  1RAB B;  4YR3 A;  4LR8 A;  2UV8 A;  2X51 A;  2KM8 B;  2C1E B;  2K8G A;  2VDI A;  3BPD A;  2V69 A;  1F3F A;  1HBN A;  2L9D A;  3DXS X;  2N4C A;  3SEO A;  2XZW A;  2KRR A;  1RBL A;  1TTH B;  5JXS A;  1VRU A;  4UUX A;  1P9Y A;  1YJU A;  4OL8 A;  2Q79 A;  2EW9 A;  5ETP A;  4IG3 A;  1L5U A;  4KV8 A;  2NXU A;  2GVZ B;  2B8Q A;  4U96 A;  5F8N A;  1U0H A;  4LF2 A;  2BKO A;  1VQ4 S;  4NOH A;  4OYM A;  3GFH A;  6FDR A;  2JC0 A;  4PQU A;  5IS2 A;  2HIQ A;  1UPP A;  4XK8 C;  2D3O 1;  4USU A;  1J5O A;  2LP4 A;  5GMD A;  1HPZ B;  1IM6 A;  3R7S B;  2VV5 A;  4LMZ A;  3HSJ A;  4DV2 J;  1Z4U A;  1KVJ A;  1UZD A;  2E7W A;  4K4U A;  2VFR A;  1GK8 A;  4PEO A;  1VBK A;  2BAB A;  3DN9 A;  3MTK A;  5IM0 A;  2FJB B;  5FJ4 A;  2E5G A;  4H54 A;  1S99 A;  4R5P B;  1RU1 A;  4I6Y A;  4P6Q A;  4Z7Y A;  1M5O C;  4U67 Q;  1I6J A;  1V3R A;  1VCT A;  3C6T B;  1C0T B;  3H4B A;  3ZTQ A;  2CXE A;  4AFF A;  2CQD A;  4GRS A;  2BRL A;  3PY8 A;  2MST A;  5AE2 A;  2V8G A;  5D3G A;  1GNK A;  2M3D A;  5ETM A;  4USK A;  3TUP A;  4EYI B;  2ZDP A;  4DFK A;  4ZLJ A;  5IT4 A;  2DCU B;  4MKA A;  1IBL F;  2IJN A;  2BE9 B;  3O3L A;  1RT2 B;  1AZS B;  2YNF B;  3MR6 A;  3D3C J;  1CPZ A;  3OLA A;  1QAY A;  1IKY B;  3QQC D;  2BKN A;  3A8E A;  4LR9 A;  1WKJ A;  3CJQ A;  4H4K A;  3QFH A;  2EG2 A;  2RDD A;  1SQG A;  2LXU A;  4TY8 B;  2IBK A;  2E1R A;  3W63 A;  1IJF B;  5LMN F;  5CHC B;  5DQI A;  1KQK A;  1TEL A;  1FNO A;  3I0S B;  1C0U A;  3G6Y A;  4WFN Q;  4N41 A;  1M5S A;  3J7A N;  3MR2 A;  1P27 B;  2FVQ A;  3OVA A;  1D9D A;  4WYW A;  1SJR A;  1R27 B;  1N32 J;  1TZ0 A;  3LAN A;  4IDK B;  4JYA J;  2KXH A;  1NRK A;  2JC1 A;  5KFT A;  2MQL A;  1KVK A;  2VA2 A;  4RNF A;  2R7R A;  5HSP A;  1NK5 A;  2LVW A;  1YBA A;  3HSG A;  3DDI A;  5KOX A;  3GFX A;  3Q8V A;  3AHP A;  1FES A;  2WBM A;  2N3O A;  4ZVH A;  4OYW A;  2OHD A;  3BGF A;  3GU0 A;  2JHE A;  4EWT A;  3A8J A;  2YBV A;  3QAU A;  3C16 A;  3UFC X;  2IPO B;  5ETL A;  3ZC4 A;  3CT9 A;  2DGT A;  3KFW X;  3PX6 A;  2WVE A;  1VLY A;  2XUL A;  2CZ4 A;  4RW8 A;  4O3Q A;  5BYQ A;  2EFP A;  2MKC A;  1KD1 T;  4MMO A;  3MEE A;  5DET A;  4ZPB A;  4UOH A;  1UL3 A;  2MKJ A;  4CI0 B;  1MG7 A;  2CQI A;  4DL4 A;  2QZ8 A;  5B0F A;  2R8I A;  2BJE A;  3DRY A;  1H6K X;  1OO0 B;  3OXL A;  4IH7 A;  4HH0 A;  3IWL A;  1WHX A;  3H5U A;  4MK8 A;  2V2K A;  3IS9 A;  1FJE B;  1JJC B;  5A8R B;  4DPU A;  2MLZ A;  3CWJ A;  5DDO C;  4I2Q B;  2GO9 A;  3F41 A;  1ELO A;  2ZH2 A;  4CLY A;  1WDD A;  2FLL A;  1UEK A;  2BJ9 A;  1A6L A;  2RVJ A;  3LP0 A;  4KTQ A;  2H54 B;  1WC5 A;  4C11 B;  4JV5 F;  4DSL A;  3UWT A;  4YY3 J;  2DNN A;  4QIF A;  2W9A A;  3UVJ A;  1N36 J;  4DUY J;  4LF9 F;  4Y00 A;  1I1G A;  1T9T A;  1XER A;  2F63 A;  1YDL A;  4D3H A;  3W3S A;  3ICL A;  3ZTP A;  2HHX A;  3C14 A;  4L75 A;  1NHV A;  2EFG A;  3KG1 A;  3M6W A;  3DRR B;  4FBT A;  3QSI A;  5BYR A;  1VQY A;  3BN7 A;  3KMS A;  4FYV B;  1K44 A;  1VHI A;  2WHO A;  4EO6 A;  3QNW B;  3BRE A;  1X4D A;  2PFF B;  4MK7 A;  3D68 A;  1NK0 A;  2AHO B;  3BV8 A;  1H73 A;  2ZBR A;  2XHW A;  2WSE C;  2GHP A;  3GJT B;  1ZTT A;  1S1U B;  1WF0 A;  2H3E B;  3CIM A;  2K3K A;  3RRH A;  4DSJ A;  4YQW A;  5K8M A;  2B5J A;  2UUA F;  3BR8 A;  1RLD A;  2DCL A;  3I0R B;  4XPE A;  4JI4 J;  3GYG A;  4Y2C A;  4QPT A;  1HL6 A;  4FPR A;  3UDC A;  1U6Z A;  3PV8 A;  3T1Y F;  4L6V 3;  2OFG X;  3P96 A;  5H9F K;  3FMW A;  4DG1 A;  4N77 A;  2MHN A;  4X64 J;  3JYT A;  2B9Y A;  5EX0 A;  2WVD A;  2HFO A;  4JI6 F;  1M1H A;  2W4P A;  1P9Q C;  3VAK A;  2BVZ A;  1N4L A;  1GEH A;  4K5R A;  5CZX A;  2OTL S;  3E51 A;  2MZR A;  2C3P A;  3W5Z A;  2M7S A;  1HWU A;  4URG A;  3MWB A;  1KS2 A;  1TKT B;  5LOQ A;  2LXI A;  2FPH X;  1HNZ F;  2YTC A;  4M5G A;  4PCQ A;  2EK6 A;  1CVJ A;  4N8O A;  3PEH A;  5JVH Q;  4WF9 Q;  2ZH8 A;  3D67 A;  4WFB Q;  3D1Q A;  3UPF A;  4M1K A;  3T1H F;  2UU9 F;  1VGY A;  1IWG A;  2AYG A;  1QE1 A;  1CQN A;  3M8R A;  3GON A;  3GP9 A;  1NB2 A;  4K5S A;  1H98 A;  5J2Q B;  1S9G B;  3K89 A;  3HJF A;  1R89 A;  3OW2 R;  1CJU B;  3R3T A;  2W9B A;  3IAS 9;  2MQQ A;  1GT8 A;  2EKY A;  1VHF A;  2HK3 A;  4ID5 A;  4OI1 A;  4U7C A;  3KLG B;  1WC0 A;  2KYZ A;  5ETV A;  4Z2X A;  1N48 A;  1RIS A;  3JQJ A;  4PUO B;  3FSY A;  3PW2 A;  2QA2 A;  4IR1 A;  5CYM A;  1FE0 A;  3F73 A;  2BW7 A;  4I7F B;  3FRY A;  4DL3 A;  3H2V E;  5LL6 d;  1UVM A;  2QEX S;  3UN5 A;  4J90 A;  5KFQ A;  3Q89 A;  1T11 A;  3M8P A;  4EZ9 A;  1FO1 A;  1N5T A;  2KDO A;  1MMN A;  2ZHA A;  3RBE A;  3QFW A;  3SQG B;  2YVS A;  2PFD A;  4X66 F;  4RW4 A;  5HLF B;  3Q23 A;  1PJ7 A;  2F3J A;  1U7L A;  1DAR A;  3ZNJ 1;  1S1W B;  2NXC A;  1UKU A;  4YOE A;  3CCE S;  4HTI A;  2UUT A;  3I5A A;  2EI5 A;  3ZO7 A;  2OH2 A;  2IMW P;  3TX0 A;  1SQF A;  3Q2T C;  2DB1 A;  2D3U A;  1YGY A;  3UCU P;  1V9O A;  4RWW A;  2AF6 A;  2B9X A;  2IM1 A;  4OV1 A;  3R27 A;  1NJW A;  3SV4 A;  4NLP A;  1X5T A;  5D4L A;  5LMN J;  3KJV B;  1F9E B;  1U1R A; 
#chains in the Genus database with same CATH homology
 2ACM A;  2E7V A;  1IVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...