2E7VA

Crystal structure of sea domain of transmembrane protease from mus musculus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
115
Chain Sequence
KKAYFYHSSFQILNVEYTEALNSPATHEYRTLSERIEAMITDEFRGSSLKSEFIRTHVVKLRKEGTGVVADVVMKFRSNRKVMKTRIQSVLRRLSSSGNLEIAPSNEITSLTDQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SEA domain of transmembrane protease from Mus musculus
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Transmembrane protease
total genus 37
structure length 115
sequence length 119
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01390 SEA SEA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.960 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SEA domain 2e7vA01
2E7VA 1IVZA 2ACMA
chains in the Genus database with same CATH superfamily
3FMBA 3SEOA 1YSJA 2BV3A 1VRTB 4FVCA 1FXRA 3CCRS 1NJXA 1WNEA 2HAFA 3M2UA 3G8TA 4J90A 5C5JA 1SJRA 4ETXA 2CVEA 3FCHA 4MFBB 5K20B 3E2EA 3RTVA 3BGFA 1RAFB 4W98A 3KK1A 2HFNA 1RT5B 3QGHA 3KYLA 2L3MA 1HR0F 3C6UB 5J2NB 4KTQA 1X7VA 3ET6B 3V2UC 1U1KA 3BYRA 2ERRA 3H7HB 5LSOA 2PMHA 3QT5A 5GADU 3I4PA 4YB7A 4I2PB 3P4UB 4NRTA 3VGVA 3D3BJ 5A2QY 2VG6B 3ENQA 3FDSA 3FNNA 3SQGA 2W9BB 1Y9OA 4WFNQ 1Q7YT 1CS4A 4CT9A 5HAOA 1H0HB 3R27A 2O67A 1I5OB 3RZAA 3I4HX 2ZUAA 3I32A 1BD6A 5U47A 3G71S 3PX4A 1PSDA 1L3SA 3RUBL 2CIMA 2DY1A 3QGGA 2Y8YA 4ZVPB 1XNQF 1CG2A 1NDKA 1FKOB 2V2ZA 2I8EA 3IR6B 3KDOA 3I82A 3LP1B 5C2CA 3WC2A 4NWBA 2K7JA 4BBYA 4J9SA 2V4QA 4F2SA 3WIUA 3C6TA 4ZP6A 2E9RX 1VBXA 3W65A 4NYZA 1X31C 5KG4A 2PIIA 1BE4A 3Q8YA 5CAAA 4PEOA 1FJGJ 2X51A 2HWIA 3GQCA 4J7CA 3QZ7A 4TNOA 4C2MA 4I67A 5RUBA 2UUTA 4GVBA 1IBLF 4WFAQ 2F1FA 4WU2A 1L3VA 4PUOA 1KSPA 1L3TA 1KONA 3QT6A 1TK8A 2J7WA 2XEXA 2DPJA 4LF7F 4UTGA 1S1WA 3MF5A 4DL3A 2M7SA 2XBPA 3E01B 4P72A 3FJ2A 5KFIA 5BYSA 3Q0AA 4F2RA 1Q78A 4GO5X 2AEJA 2QSWA 1P9YA 2YBVA 1IKYA 2EFVA 4ECYA 1B0PA 1JLCB 3NAIA 3HI9A 5A8WA 1N52B 2LXIA 3CCTA 4AT1B 4XTTA 4DXLA 4DR7F 2HHSA 1NDCA 2ZOFA 2XGPA 4UQGA 4C11A 2WW4A 2UXDF 5AXNA 1HI8A 3Q89A 3MEDA 2DGWA 1IKWA 4HH0A 3PW5A 3C46A 2E1RA 2HQCA 3U27A 4DUTA 1HBMA 3M1VB 1JXEA 2JRSA 4QJVA 2J0XA 1N54B 4FXWA 3M8QA 1C2PA 3MM5B 3ETMA 1S6QB 2ASYA 4GC6A 4ED1A 1YJVA 3UN3A 1S12A 1BLUA 1PCAA 2Y1IA 2LEAA 1H98A 3FRYA 1R0AB 3LP0A 4K8RA 1FWPA 5E0OA 3TP2A 1FJEB 4NLPA 4RUHA 2B56A 4K4XA 3W2VA 4CLPA 2BQUA 4ER8A 2YNFA 3BDPA 5HMWA 3DU6A 3J7ZT 1M90T 2MLXA 1REVB 4DN0A 1NK9A 2ASJA 2XWYA 1EIYB 2XS5A 3GG0A 3OSNA 3IGVA 4LQ9A 4P10A 4I7FB 3KMSA 4DV0J 2I0XA 3RAMA 1JKHB 2R7OA 1WHXA 1VI7A 2BA9A 3PM9A 2BJ8A 4USHA 2ZDOA 3UE2A 3WX4A 5KFWA 2FY8A 4NLOA 3R6LB 1P9QC 5HQLA 1NJYA 3PYGA 4EO8A 2Y9HA 3RYLA 4LRAA 3V4IB 4UOGA 4USKA 1J5EF 1CJVA 1HNIB 1WWHA 2UUWA 1G2EA 4Z2XA 2J76E 4IDKA 2RRAA 2P6SA 1UWAA 1QE1B 3GYGA 2OELA 3OW2R 4ECVA 2ZC3A 3GYXB 2R2SA 4ZLLA 3M32B 4V19X 4LUBA 5KAKA 4B08A 2YKMB 4F8RA 3ZXWA 3PO4A 1KRPA 3OBIA 4DL4A 2XCAA 4X2BA 4RW9A 4OYPA 3CJ2A 3HHEA 4ZVFA 2KVIA 2LFVA 1V6HA 2FIUA 1ULRA 2YNFB 2KHCA 3M2VA 4RW8A 1CJUB 3IN5A 1OWXA 1FCAA 2KJVA 5FDLA 1NK6A 2MMYA 3B78A 1SV5B 3KLIB 2NXUA 4OHXA 5DRKA 2XMUA 3R1HA 3ISZA 1WOPA 1S97A 1RHMB 4O44A 1UA1A 1VC6A 4B3MJ 5CXTA 1NSPA 4DQQA 1S1TA 5ETLA 1OSCA 5BXIA 3NGSA 4OI2A 3RR8A 3T1HF 4AL5A 2LEPA 1VRTA 3D6HB 1NJWA 4ZPAA 1Q0NA 1SIWB 2RU3A 3ENVA 2CPYA 5J1PA 4TLQA 2UVWA 3WC0A 3MI7X 5EDWA 2B7BB 3CJSA 3U7JA 2N82B 4O3QA 4RNOA 3VALA 2HQIA 2X7IA 1Y0HA 1SUQB 2HWTA 3HFZB 3C8YA 4B9VA 3HPOA 4MIAA 4DZ6A 3RB3A 1EX8A 2C28A 1UL3A 1ZAXA 1FESA 4IO1A 3KJVB 5A6WA 3CJ3A 2YX4A 1HQUB 4USJC 5K14B 3SV4A 5B0BA 4U7UK 5FIIA 5KFSA 3BQ1A 2E5IA 1S57A 5L38A 5KG0A 3PR4A 4DFKA 5CABA 1FJCA 2CG4A 5F8JA 1NHKL 1T11A 2BEFA 4RUBA 3AY0A 2GV1A 2ZNZA 4ID8A 1S48A 1RWWB 4DV3J 4LSZB 4NLRA 4HACA 1S9FA 3CIMA 1JMTA 3GFXA 1YJTA 4RO0A 2BZ2A 2W9AA 4J9PA 3RAXA 4OX9F 4LF8F 1N5YA 3FFIA 1XR6A 4K4ZA 4ZS6A 1QD1A 2R7VA 2YWFA 2BJDA 1QDUB 3E3XA 4NCBA 2A6MA 3PKYA 2VHGA 2ROGA 4TQSA 3FEZA 4AD6A 3HXMA 2Z2YB 3OVAA 5HP1B 2DY9A 5B0EA 3T3FA 1MROB 2OPQA 3H0PA 5HATA 3HP6A 2HMIA 2CQDA 4IOBA 3UVJB 3F73A 1D9AA 2HPUA 4KV8A 5B08A 4LSLB 1TZ0A 1FVQA 4QWEA 2CJYB 2GO9A 2H54B 3W7BA 3LQVA 2V4JB 1U47A 1PBUA 2HQ3A 2NUUG 4PXDA 2UZAA 3QT8A 5ETMA 4OYIA 4NLWA 2NUHA 5HK4A 4DEZA 4OZLA 1RWMB 2VOOA 1PGZA 3DOLB 4DI6A 2E7XA 1P1TA 3MEKA 4HR2A 3UFCX 1H7WA 1S6PB 4R5PB 2J9EA 1WC6A 1HI0P 2ZZMA 3K5MA 4JB8B 4QYZJ 2K8GA 4P9SA 4L75A 4J9RA 3CJQA 5DM7Q 2UUCJ 3DLLQ 3N6NA 4HH1A 2CUYA 2VDIA 3MMCB 1D8ZA 4BWJA 8ATCB 4OJ3A 4KGVB 3KUHA 2HS3A 3WZ0A 1HBMB 3M1VA 3A13A 4QW9A 1Q8IA 4DR3J 2CDRB 1ZM9A 2HEKA 1VQ6S 1TL1B 4DSFA 2JVRA 1MG7A 1RT6B 4JI2J 4UZCA 1SB6A 4Y6IA 3SMZA 2RB7A 2D9PA 5GAEI 2XCPA 2P9GA 4C7QA 2AD9A 2GS8A 4PZVA 1WTBA 4FXDA 4A46A 4LBPA 2CQIA 3J7Z5 3A8EA 2OSRA 3TA0A 5LXRA 1XMOF 2BABA 5J1EA 1YQHA 3NOGA 4KHRA 1PAEX 3M8ZA 1NMEB 4OZ0A 5EWEA 3RR7A 2HNYB 4MKBA 3M8SA 5CHCB 3OR1B 2HQFA 4FS2A 4YFUA 1XC9A 4DV7J 4I7FA 5G0RA 5F3ZA 2R9LA 3LAMA 3OL6A 4ETZA 2VJUA 1NK8A 1NZAA 3KKFA 5K8NA 4B3OA 1DQ9A 3V4MA 4UY8T 2I5JA 3ILOA 2JC0A 1RTHB 3LPEA 2HRYA 3CGIA 3QLHB 1KN6A 4OYWA 3GONA 4G1PA 2DHHA 2G2YA 5A0YA 4M63A 3TQEA 1BHNA 4USIA 4R8UA 4CO4A 2HQDA 3G4SS 4YDDB 3HHLC 2B7CB 2GC8A 4RBVA 5KFYA 2XZDB 3SSQA 1LWCB 5IM0A 4Q0BB 4L3KA 2WHOA 1VRUB 3ONQA 5KT2A 2W8LA 4P73A 1FRIA 3OPKA 4RW6B 3RGIA 4EU0A 3FMWA 1UETA 4N41A 1BGXT 1X5PA 4HT7A 5CQGA 2DR8A 1TFYA 3HHNB 1EARA 3PYEA 1FEHA 4ZLNA 3BO4A 2JL9A 1FFGB 4TU8A 1VIXA 4MIWA 3PHEA 3HO1A 1TP7A 1FFSB 2ZVIA 3M2VB 2H9ZA 5IT0A 1TUVA 3OSPA 2JEIA 3ENAA 4KIAA 1NSQA 4RU9A 3TANA 4BWMA 4UZBA 3I31A 2D69A 5D0RA 2DIUA 2F65A 4FXVA 2F9DA 4YB6A 3D0HE 3KJQB 1WHWA 4RW9B 2EWHA 4CYUB 4I64A 1NB2A 4U95A 5DZ6A 2J6TA 7FDRA 2XB2D 4DU7A 5E5NA 1F5CA 2H1YA 2ZE2B 5F9NA 4H4KC 1T9XA 1OY9A 3POTA 4KPYA 4ZP9A 3UR3C 1QSSA 3NBPB 1S99A 4OZ5A 4KE5A 1Y5LB 1XIQA 4OYOA 4MFBA 1Q81T 2DCLA 3PZPA 1UA0A 3C16A 2MLZA 4TKTA 4E2FB 1S4FA 2VDHA 4ZLJA 1XTZA 1MSWD 4F3OA 4EBDA 1ZAWA 4OYBA 2LXUA 5D77A 3CIZA 1XJWB 5GAGU 4X62J 1ZOTA 1K73T 4TQRA 3BM7A 1O51A 2GJFA 3MD1A 3KHLA 4OI6A 4WU3A 1DLOA 3HHLD 3P45B 4LMZA 2R8KA 1S6UA 4TY9A 2YNHA 2ABYA 4PWWA 2KJWA 4QWAA 2C2DA 1HQUA 1FWKA 1N0VC 2EBEA 3D5MA 4CIOA 2KH9A 4B9TA 1XQIA 1KOHA 2GAGC 2IMOA 4ZN1A 3OR2A 2DR6A 3B54A 4XDCA 3PVXA 2R7TA 2DGOA 4OI4A 4O3PA 3QZ8A 3OL8A 1FE4A 4IFVA 2DH8A 4ENOA 4AQYJ 3V6KA 2OSQA 2HHHF 3G9CA 2AYEA 2HHQA 4QPXA 3KK1B 4Y2MA 1KC8T 2E9ZA 5LM7E 1S7HA 3R5AA 4DR4J 3GFZA 4HACB 4RJVA 1U1QA 3TAMB 1F5BA 3K5NA 1FDNA 1N56A 2HHTA 4J9MA 4NXMJ 2AGPA 4Y3CA 5HL7Q 4JI4F 1FX2A 2RAQA 4A8QA 2EC2A 4KFBB 3CEDA 2CZ4A 2IVFB 2JZ5A 2YY3A 1PKUA 3G96A 1YJWS 3BV8A 5L8RC 2L41A 5D4NA 1MMNA 5L1IA 1S0MA 4LF4F 1U1MA 3AOAA 3H40A 1S1XB 1FKPA 3I6PA 1F0XA 4IRDA 3BBFA 2XI2A 2DH7A 2DGSA 3W9IA 3C6UA 5KG2A 2XZTB 1RAEB 2XLKA 2KM8B 4C0HA 1TQLA 3UPFA 5KFQA 3BGUA 2VBZA 1BQNA 2WOMB 2R8HA 2KT5A 4JI0J 2AEMA 2AZ1A 4RZRA 2CJQA 2RNEA 5HMZA 4X4PA 1T9TA 1FO1A 1FA0A 4DV1F 4ED3A 1NK0A 1PO6A 3T5JA 2DNGA 3PR5B 3DRPB 3M8PB 3NXZA 3R5GA 2IRYA 4WKYA 4FKYA 5E33A 2H51B 2NYIA 3JAMU 4ZP7A 4C8YA 3J80Y 3NS6A 2D1CA 1CJKB 3LUYA 1M5OC 2OTLS 2PMZD 2RQ4A 3EGWB 2YKNB 1ZTTA 1YG0A 1Q1KA 2IRUA 3EJMA 4ICLA 3L9ZA 4OHZA 3QYYA 3Q22A 1HHSA 4DN9A 2EK6A 1N32F 5G0RB 2EFOA 1Y3JA 3HVTA 5D0GA 4CWBA 2OIHA 4F3QA 1DTTA 2GVZB 3R97A 1AYEA 3M8RA 1S4EA 3G82A 4ID5A 2XSJB 3MTKA 4OV6A 3M8QB 3TNVA 1SL2A 5AT1B 3UDLA 2X3DA 4DF4A 2OGUA 4I1TA 2FUG9 5DQHA 2Z56B 3OLBA 4URGA 1MWZA 4FP9A 1BY9A 3IS9B 5ETKA 2V8HA 2HBQB 5C25A 2V5HG 2ROPA 2GVZA 4ZHRB 2XTJP 3N5FA 1OY6A 2B51A 2XS2A 1UAWA 2O5DA 4KGXB 2Z57B 3JYTB 3I55S 2X1FA 4LIWA 3ITHB 5L1JA 4DSLA 1BWVA 5JXSA 4B9SA 2J0SD 3KJFB 4NOHA 2RS2A 3M4XA 3NY0A 3UO0A 5IS2A 3BYPA 4WPAA 1U1LA 4QWDA 3DLGA 1SL0A 1X4BA 3H25A 3GG1A 3DOMB 4LBIA 2KYXA 4ES1A 1S9GA 4LFAJ 3HKWA 3DNCA 3V5RA 2QLBB 4X4UA 5K14A 3N79A 3Q8RB 1IXKA 1RP5A 1ZPWX 2VQFJ 1ZZFA 4GMKA 1T3OA 4M5GA 1GXTA 2RUSA 2GGPA 1RWVB 4DR5J 1HNZF 1A9NB 5EN1A 4QW8A 2W7PA 4P74A 1SIZA 2AKWB 2H65B 2MGZB 2I2YA 3LALA 4DQSA 3W5YA 4PWDB 6FD1A 1CJTA 4RUCA 5JVGQ 3QPIA 2KYZA 2XHCA 3LP1A 1VQOS 2YNIA 2VBYA 3KDNA 4USWA 4IUFA 2U1AA 5DDQC 4ZPVR 4HKQA 4RL1A 4WF9Q 2VKRA 4NLGA 4JBCA 5IV4A 1S0NA 3AAWB 4UUXA 1T3NA 2YQ3A 4O3RA 1HBUB 2VC0A 3PFEA 1EQ0A 2R7SA 2XMTA 4WCEQ 5E41A 1SV5A 1ZBTA 3KLIA 4DL2A 3FZBA 1N4LA 2LLZA 4QZVB 5DO2A 2V4JA 4M8LA 1S1XA 1DLOB 3BJYA 2HBZB 3NNCA 2LVWA 1UVNA 5KFOA 2WONA 2VIHA 1T03A 4JI1J 1TUWA 5KFMA 3EVWA 4KV8B 2PA8D 4A8FA 1H2UX 3GU0A 2MZRA 3SQGB 2GQCA 4DR6F 2JEGA 4YHHF 2BRLA 3CCWA 2ZM6F 1LOUA 5F8HA 5H9EJ 4GVLA 2FVQA 1TL4A 2LQ9A 4ILRA 4ZVTB 1X8DA 1OS5A 4IFVB 4ZCIA 1L3KA 1R8PA 5CYMB 3D0IE 1KTQA 1TKZA 4DPYA 4ED4A 5HQMA 5LSRA 5E3QA 2XG8A 3BO2A 2BR0A 1TVRA 1MN7A 1RWNB 4ZK7M 2B4VA 2DNNA 2GW8A 4HT5A 1CJTB 2B9EA 2HS0A 4CLLA 2OPSA 1DARA 3QT7A 2E29A 2YNHB 5T41A 1X4GA 1RWXB 1MN9A 3EICA 2GO8A 3D3CJ 3MR7A 3OQ2A 2UUBJ 3KUGA 2HFZA 3CCLS 1QSLA 4ZVOB 1Y10A 2AJ1A 2DBBA 3MDFA 4CO1A 3BKUA 3CCMS 2PFFB 1KQSR 2JJ4D 4DUZJ 1U8SA 4M5DA 3M9MB 4PR6A 4JI3J 1RCOB 2CJ9A 2DNPA 3NNHA 1PJ5A 1RTZA 2HNYA 5IQ6A 2OMLA 4PXBA 2ALZA 5HVFA 2D3ZA 3OTOJ 2Q3PA 3KK2A 1X9WA 1V3ZA 4LFBF 1RA6A 2AV5A 4RNMA 1HFEL 4ED2A 1S76D 1WKLA 5D8HB 4PCQA 2UXCJ 1LWFA 1VGYA 4NZ7A 2EFGA 2E7VA 1UFWA 1PYSB 2QLWA 4ZIVA 2KL8A 4WBFA 2VPXB 2KG0A 2CQHA 4P52A 4ES3A 2OMOA 2VC1A 4IG3B 1X4AA 4UW2A 1YJ7A 3L7UA 3CXCR 3NCRA 5HVGA 5IWAF 3HDSA 3BKFA 1D1UA 4WZQA 2O3DA 3UNYA 1S9EA 1OMSA 2F5GA 1YIJS 3DRXA 3CJKA 2JOQA 3KJNB 4Q5VA 1YITS 4MKAA 2D9OA 3CJRA 3MEEB 4M1KA 2DXEA 2YVSA 1R7IA 3TQ1A 4WJBA 4WXWA 3QGPA 4DUYF 4B3OB 4AFFA 2VFVA 1VJWA 2IVMA 3OLAA 2ZH7A 4IH7A 4DL6A 4DR2J 2VA2A 3KLEB 5J2MA 4YR2A 1TL5A 4PQUB 1PG5B 3AB4B 4NA3A 4RW6A 3DRYA 3FZ2A 5EWFA 4C9DA 2G9OA 4B3RJ 2WCXA 4I2QB 2N3OA 5KTQA 1JJ4A 1FKAF 2XMJA 2ZHAA 4Q8FA 4YOEA 2NZCA 4C8KA 1CLFA 1FNXH 3P8BB 5H9FJ 5A8RB 2VA3A 2DHGA 1IBCB 3BR9A 1MU2B 1VMBA 1PBAA 3NL0A 2YKAA 3UCGA 1U4BA 4KKOA 2BM1A 3HF5A 1FDBA 2BANA 1QVFR 3DDNA 4LSNA 1LWCA 5LJ5Y 3SDEB 4FPIA 2DNRA 2MLYA 2IM0A 1HPZB 2CJXB 2LQJA 2GAHC 2ZKTA 3I87A 3PEHA 4PXEA 3ZTQA 3D2WA 2B4UA 1U49A 3WQPA 2DR7A 4PWDA 3H98A 3HMJG 3FBFA 3R5CA 4ID5B 3P49B 2MKJA 2YNGB 1U48A 4F4ZA 3V6DB 2W9CB 4MMOA 2FHJD 3IAS9 3MEEA 1DTQA 1ZYQA 1RU2A 5AE1A 3HKZD 4JYAF 2X3GA 1WSRA 3AD9C 3TUPA 3JSBA 3T1YF 4NXNJ 1HD1A 2RU9A 4Y65A 3A3PB 3D67A 1M5KC 1RISA 4O0NA 3EYZA 4GO7X 1RAIB 2DNMA 5DQGA 1RYSA 3GYNA 2HK2A 1WF0A 3AD7C 1TK5A 2J8AA 3CULA 1XMQJ 2EXUA 1XNRJ 1S6OA 2MKSA 3C16B 1RADB 2BW7A 3PJXA 3I0RA 4FF3A 5IT9Y 4Q8EA 4G65A 2XMVA 4KPCA 4Q2LA 4DPUA 5D78A 5K9FA 4OX9J 1Q4RA 3M2UB 3VQSA 1VQNS 3MHYA 1H7XA 3MR5A 2MB0B 3L3CA 4DR1F 1F2GA 5E7OB 3E8OA 2BUNA 3VAKA 4DF8A 2LDIA 2VFUA 2JWNA 3CJ4A 3TYTA 3QNWB 3BGRA 3O8WA 4NLVA 4ECSA 3FK4A 2HK3A 1UVIA 1M1HA 5BJRA 4M5LA 4E0DA 2AJ4A 2CYYA 5FDLB 3TUJC 5A2QU 2YNGA 1EKSA 1VQ5S 3HD2A 2RQKA 1C0TB 2V8DA 4X66J 5J2NA 4HVZA 4F67A 4C8NA 1K9MT 2XS7A 2HYIB 3I96A 2P9CA 2MY8A 1WACA 4Z37A 3EZ5A 2XGQA 1TVRB 2UVVA 2KZZA 2IA6A 2XMMA 1RYRA 5HN0A 2VUGA 2C3YA 1KQGB 1SQEA 2DNLA 4QIGA 1GAOA 4URSA 3DMJA 2OJ3A 3UCZP 3MM7A 2MSTA 3DRSB 2WOMA 2CQPA 1B0TA 3D7SB 3T41A 2FC8A 5EGYA 4LR7A 1QAIA 4CO2A 5ETSA 5KFXA 3ZTOA 2HLTA 3ILJA 5KG6A 6AT1B 1I94F 3JS9A 4X4NA 3RU0A 1FRKA 1NLKL 2FJEB 3MUTP 2K1RA 4OIXA 4HDGA 1KHVA 1U6ZA 4CLYA 4F04B 1I94J 2RDJA 2I5JB 2RD5C 3GSIA 4ZCMA 5ETRA 5GADI 1GX5A 2R8GA 4KB7A 4KH0B 3MPDA 4ZMMA 1OYEA 4CCHA 3U1LA 1DQ8A 2Q1LA 2XLJA 1RSCA 1RQ0A 1YGYA 2ZOGA 3DOKA 3VCDA 1JNZB 1SKRA 1D8YA 2YKQA 2Q66A 2BE9B 2HFSA 3W62A 1R3NA 2Q6CA 5DG9A 1YRUA 2A18A 2DIVA 3DYAB 3T9NA 3ZNUA 1TL3B 4D3GA 1V9OA 2A10A 2ZWOA 4HHHA 4YB1P 2PT0A 3KHRA 3GB0A 2FVRA 2R2TA 1H72C 2PO4A 5LSLA 1HWUA 3RJMB 2JLGA 4X66F 1UTAA 5KFDA 4LSNB 1RU1A 3AQPA 2KKHA 2AGQA 5KG1A 2OD6A 3P5BP 5HROA 3DC2A 4FN5A 3MM7B 2ZH1A 4LF2A 2HRTA 5JVHQ 4IOCQ 5HMYA 5MLCV 2KRRA 2WK4A 2HZVA 2NPFA 2COLA 4ZLPA 4XO0A 2GHVC 1AXQA 3AFGA 3LGHA 5I3QA 4EYIB 4QOTA 2W9CA 3DRRB 1UWBB 2HURA 2A6OA 4IR9A 3J80U 1HKAA 2YX1A 5DLFA 4X4OA 4A8KA 2PGCA 3ITHA 2M9KA 2YKOA 1PC5A 3KFWX 3JQKA 4UOFA 2ZHBA 3W8PA 1RHQB 1XMQF 1XNRF 3H20A 4L74A 4ZHRA 1IJFB 2RE1A 3M32A 2ADBA 5THWA 1AUDA 3KK3B 1LQ9A 2CNNB 1J5OB 3I9V9 3EZUA 2BANB 1AT1B 2BRKA 2ZHOA 3QSYB 2BVZA 5GMKa 4DX7A 4N47A 3CTRA 3OT9A 4DR5F 3T1YJ 4NXNF 1G4CA 1F9EB 2HNZB 3NNAA 4JYAJ 3K7RA 3SCIE 2AYGA 5IZHA 3M8PA 3V4IA 1KEKA 4TYAA 4O4GA 1KQFB 2DH9A 2SXLA 3HSZA 4ALZA 3BSOA 4DL5A 1S10A 3MM8A 4NCGB 1LNQA 3SSRA 4LR8A 4O44B 2CVIA 1ZZNA 1U2FA 4OYAA 2DRDA 3MM6A 4YDXA 2DNYA 4M5MA 4USUA 2XYGB 2K7KA 1MLAA 2O1PA 4ECRA 2ZBIA 4W92B 4ZA1A 1YLXA 3V6DA 1VC0A 2N3LA 1NAQA 4P2XA 3D68A 3GV7B 3P6YC 2L9NA 4A8OA 2AP6A 4ZVRB 4MKVA 2MJNA 2DHXA 2RVJA 1FK9B 1WOOA 3O2IA 4OYMA 3DU5A 3QWUA 2MKYA 1FFWB 3MM8B 1TFWA 4NYOA 3SDEA 2OEKA 2DNOA 2AGOA 2XO7A 2RHSB 4B3RF 5HVHA 3MMAA 3J81j 1XR5A 1DJ0A 1WC0A 4YS2A 3FGVA 2IJRA 5F8LA 1HNVA 4MAKA 3OTBA 4DR2F 3I0RB 3NGTA 3A12A 1QAXA 1C1CB 2W7AA 4FS1A 2B5JA 4DUYJ 3QQCD 5D0EA 5I3PA 1LWEA 3CCJS 4IRKA 5IT9U 2FTRA 2FY1A 4BDPA 4K4VA 1JLFA 2NQPA 2VFTA 2UV8A 1RCXB 4CH0S 4F4KA 4F0MA 5A6PA 1ZA2B 2NXNA 3DDKA 3D6FB 5IWAJ 4J9QA 1FKOA 3OFHA 4XPCA 3W3SA 1YRTA 5AXLA 1EP4B 1GMVA 3DOKB 4UOHA 3X1LB 3J7YU 3U02A 2JDJA 3CCQS 1AUSL 1FEEA 1OQ6A 2Y1LB 2CWXA 2MHNA 1NB7A 2UXCF 2VG7A 4H54A 3MFIA 1DRZA 3OTCA 4YP3A 3DRPA 4LFBJ 1UVMA 2JHEA 3WHIA 1BXNA 2KRBA 1N5QA 3OTOF 3MR6A 1OY8A 1CPZA 3K5OA 2D41A 3WBZA 3ELHA 1S0VA 1NH7A 1JLGB 1K0TA 2XC9A 1KOOA 4NLXA 4JI3F 3UVJA 1K1QA 1RBOB 2B4OA 2OPSB 4RX6A 1FNMA 2ZEJA 4WFZA 4KYZA 5H1SV 1R0BG 3C2PA 4DUZF 1WC5A 1F1BB 2IC3B 4KGKA 3CD6S 1T9WA 5FLXY 1C0UA 5IXUA 4FYVB 2B8QA 3J7A1 1RHJB 4IOAQ 2AF6A 1EHWA 2IDEA 2AX1A 2KHDA 1YX2A 2UUBF 1G3OA 3TVKA 3S1TA 1DFDA 3AQOA 3CD0A 4D3HA 2VFRA 1DTTB 4DPWA 4F25A 3OXFA 4J9KA 2LEBA 5IOLA 3HZGA 4X4RA 1FDDA 4EMDA 2IM3A 4ZOSA 1NJIT 2IPOB 4E8UA 3KLFA 4K4TA 5KFLA 2XMKA 4KC5A 1B7YB 4DLEA 2I6WA 4RW4B 3H8YA 2BKPA 1GK8A 4B02A 2K3KA 1YZ6A 1QLNA 2CPDA 2JEJA 4U8VA 4LSLA 3NMRA 1JQGA 2FDNA 1CS4B 2ZM6J 1VQSA 3DXBA 4WTYA 3W60A 4F0HA 4YHHJ 3UD4P 4DR6J 1C1BA 3G87A 1GT8A 1HBUA 1NU4A 4G6VB 4C98A 4USMA 4ZPWR 2A2DA 3DLJA 3G2XA 3EMTA 3N01A 3O44A 4IQMA 3VTIA 3IA0A 4C3MA 4JI1F 3L09A 1R8AA 2QT7A 1W7WA 4ELVA 3NGKA 2IMWP 4FBUA 3GV8B 1RWKB 1WI6A 2W4CA 3M8YA 3MM9A 2K2PA 4FDFA 5J2QB 3PW7A 1QAJA 1PIEA 4FF2A 1VHFA 1EAYC 1FRMA 1UMJA 4Y0FA 1WF1A 4RWWA 4DFPA 4W90B 1RTHA 4ZDNA 2R8IA 1WTFA 4DU8A 2ZFHA 2E1MC 3ZTRA 3MTJA 4QR2A 1RA7A 1YBAA 2EKYA 2WW8A 4LF1A 4RR5A 4XK8C 4DBQA 1Z1ZA 3PJ9A 1VQKS 3DM2A 8AT1B 1O5JA 4IQXA 4K50A 1BQMA 3BEGB 4LT6A 1YDLA 1REGX 3I0SA 2V8GA 2QJ3A 3R7SB 2QL7B 3RW7A 3S6EA 2ZBRA 1UJ4A 2F9JA 4FVMA 1ZM4A 2ZOMA 3UN2A 4CT8A 2VQFF 1RKIA 4ZCKA 4DQPA 4DSKA 3BGOP 5KFVA 3M2RB 3CJTA 3LP0B 2DGTA 2VL1A 4NCGA 4S0MA 4LFAF 3JTNA 4RNHA 2ADCA 3H2LA 2M0GB 4O4GB 1UJ5A 4L72B 2VB6A 4ZJQA 1VK8A 2AYBA 2OP5A 4PAAA 3SFUA 4FZVA 1YVFA 2E1PA 2F4FA 3NWRA 4ECWA 2KVQE 1WOSA 2WVDA 2KT2A 2YPYA 4J9VA 4CNZA 4UOCA 5DGAA 5ETVA 1J5OA 1KBRA 2RSQA 5A8KB 3CO0P 3B4MA 4KGZB 4WIQA 1RAJA 1UZHA 1PC4A 1KDNA 4KO0A 5HSPA 2AJ0A 4RNFA 3S8SA 1WJ9A 4NZ6A 1O0PA 2O01C 4DPXA 3JYTA 3HM9A 3AD8C 3R2DJ 3ZZZA 2OLWA 3OFGA 3IGNA 5KFZA 4DX5A 2YH0A 4N56A 4DSEA 5HJYA 1S1WB 2ZUGA 3CMES 2ZD1B 4EO6A 2V9WA 1JWWA 1FT8A 3GIIA 2WSFC 1N6QA 2C42A 3T1AA 3MUMP 3TZWA 4YQWA 2OPRA 5D4OA 3CCZA 1N32J 2BW2A 3SCJE 2VZ9A 1RT1B 2LKZA 1FX4A 3OXGA 5M2RA 3BF4A 3H90A 1HYSB 2D74B 2KXFA 3THVA 4DS4A 3MAHA 2ZJPQ 3MMBB 4QYRA 5C24A 4IH5A 3RRKA 1OQ3A 1JLEA 3M6WA 3ZZUA 5H9EK 2I1RA 4OL8A 2H4YB 3T5KA 1TAUA 3S01A 1B70B 4WP9A 3CD5A 4P6QA 1HBOA 3CPWR 2LECA 1H2VZ 2F7VA 4UQTA 4CI0B 1CQNA 1M5HA 2AHOB 3FQLA 5IT4A 4DV1J 4FNIA 2M2BA 1TV6B 2MQ8A 3UCUP 1N8RT 1QUVA 1IKYB 4FPRA 5ETTA 1NUEA 5EUHA 4JI0F 4CLKA 5C7PA 2ILYA 3DCAA 2OD4A 3EUNA 3MCSA 4EGLA 1R0AA 3OVSA 3OL7A 2DK2A 2ZBQA 4TYBA 3Q23A 1U2CA 5DETA 3VAJA 2EK1A 3SCKE 1TK0A 2OAUA 4B9LA 3CDUA 1CQMA 4DX8H 4DDFA 1FE0A 4C8LA 1MW7A 4DSJA 4LF4J 3O1LA 1VBKA 3KTQA 2YNIB 4GVBB 4IFYB 1SJFA 1S0OA 2IC3A 4ZJLA 3W9JA 3P3DA 2NXEA 5IC6B 1GMWA 5E3CA 3N5BA 4YN3B 4ECQA 4JI4J 1T05A 4NE9C 4ANDA 4QR1A 4NXMF 3T6JA 1CBKA 1GMUA 1SC4B 2IIHA 4CQ1A 4C0OC 2FHMA 3CSKA 4B17A 3RB6A 2GZOA 1SC6A 2MZTA 4K5SA 1LEOA 3EPGA 3TA1A 4EEYA 5K8PA 4DR4F 3R5BA 3GV5B 3I5CA 4L73A 1NJZA 1Z2ZA 2WONB 1T03B 1CULB 1U0SA 4E98A 4AQYF 2HHHJ 3PO5A 1NBEB 2B4PA 1TUGB 3N6LA 3H4BA 2QLJB 1RBAA 1KNZA 1NH8A 2RH3A 4LR9A 2M70A 1R0CB 3IWXA 1RT3B 1LFPA 1WC3A 4NASA 1IVZA 1MROA 3NWGA 3GLJA 4QIEA 5F0UA 4WE1A 3W5ZA 1J27A 5J2QA 3JQJA 2DR9A 1AZSA 5K8MA 2MQOA 2JC1A 3TEGA 1CC8A 3DGPB 2W8KA 3M6VA 2Y0SD 3H42A 4ZIWA 4K4UA 2GVDB 5DM6Q 2FJDB 3VGUA 5IM0B 1PAUB 1RAOA 3ISND 4IDKB 1AW0A 4X62F 4N77A 2IBOA 2QE5A 2L08A 4KGMA 5LOQA 2E66A 4URQU 3BR8A 3DI6A 3FSYA 4Q7AA 3EXCX 1UVLA 2LMIA 3Q24A 3BQ0A 1QTMA 3FQKA 3DM2B 4WE1B 5B0GA 2OPPA 1WELA 2DRAA 1JKHA 2HFUA 4I0WA 1NPRA 1IWGA 4F4XA 3TJAA 2ZH9A 4WXOA 5LL6d 4RBUA 4RW8B 2QFJA 4ICLB 1H38A 3NKYA 3MPWA 1H3DA 2YX7A 5FD1A 3C14B 1VRUA 3TA2A 1FERA 3IR5B 1GEHA 2ZVSA 1U8WA 5J1NA 4OZ3A 2WZ1A 3NCQA 1G1XA 1WG1A 4X4TA 5L39A 1GQEA 2C3PA 3VZIA 4IO9Q 2QL5B 3OL9A 3MMAB 1KP6A 1HYSA 1F3FA 3TJ8A 1RT4B 1SVDA 1D3WA 3BGLA 2QMWA 3DKDA 2XNRA 1C4CA 4WKRA 2NLWA 3N9UC 2R3VA 1IQZA 1ROFA 1XERA 3HVAA 4NYPA 4NRUA 3VAMA 5B0FA 1TELA 2VFSA 4OMFG 4JOUA 3DGVA 4C3LA 2GFFA 2HLUA 3DOMA 4K4WA 1GFWB 2EEYA 1JLBB 2VF3A 3B4DA 1D9DA 4FF4A 4C4WA 1APSA 3BKTA 1JNRB 3O3LA 3DHWC 1HHQA 3X3UA 5FLXU 1RWPB 1RTIB 2PMWA 1WEXA 3KLEA 4CNYA 4PQUA 1KWMA 4EZ6A 4QWBA 8RUCA 2C3MA 5T7LB 1SCJB 2XSFA 3ILLA 4L6V3 2ZH2A 2CPHA 3FEXB 3VGSA 1EB0A 4MYUA 2N7YA 2CA9A 2GNKA 3CF5Q 4KQZA 1QE1A 2WVEA 1IKXB 1L5UA 1O8BA 1ZETA 2B5JB 3MCOA 1JLAA 1NDPA 1MU2A 2RQCA 5D4LA 1SQGA 2M5YA 2MQMA 4DV7F 1HNVB 4N8NA 5B0DA 2VICA 1VQLS 2MGZA 3DDIA 3I56S 9RUBA 3M7VA 1GNKA 2ZDPA 3JB9k 1IWAA 3K8VA 3TUIC 4IG0B 1U1NA 2CZ9A 2JVOA 2LU1A 1JB0C 3M8WA 4P2SA 3SXLA 1XMOJ 2Q43A 2Z58B 2DNKA 2K3IA 3M9NB 3QJJA 1JX4A 1D09B 3UNGC 3H4DA 1IKXA 3IG1B 5E3RA 2GJIA 4JI2F 2DO0A 3QRQA 3NP5A 4LJMA 4O4RA 5DDRC 4NEYA 3W8GA 4R0JA 1ICEB 3FRZA 1F5AA 4K7QA 1KVIA 3MWBA 3L7PA 3IBFB 1S1VA 1F3VA 2PC6A 3R6GB 4DR3F 4ED6A 2Y1JA 5GMDA 1HNZJ 3HD1A 1HWKA 5ETOA 1RTIA 1Q53A 3GE9A 1M5VC 2QGFB 1V5VA 1LW0A 1WDTA 1HI1A 3ZC4A 4YUDA 3F56A 4IR1A 2AQ4A 2JFDA 4ILMA 1CC7A 3AHPA 2UUCF 5GAGI 1WHYA 3O5TB 2EG2A 2HVIA 1Y7PA 3PXGa 2ZC4A 1S1UA 4DLGA 2FJWA 2X1AA 2OEJA 1AA1B 3US5A 3LPYA 1TL3A 3J7YI 3BB5A 3PKMA 4LIRA 2VONA 5HP1A 4HTIA 1HQEB 2G1DA 2W25A 2EG1A 2E1CA 1R6YA 1NKEA 4DJBA 4LQ3A 1LW0B 1JLQA 4BHQA 3NMAA 2MKHA 1UCNA 1LW2B 4NX9A 1KFDA 3DXSX 3MAQA 2F3JA 2IM2A 1Q79A 3J7AN 3MCMA 2ASDA 1MWQA 3MR2A 3H5YA 3PV8A 5F8NA 3KXDA 2Z2ZA 1B3TA 5DGBA 1C0TA 3FBCA 4Q43A 1T0TV 3QWPA 1Q5YA 1RE1B 2EFNA 2XULA 1UEUA 3M30B 4PKDB 2HFOA 4C0BA 1X4EA 1NPKA 3MECA 3W2VB 2DPIA 4LF8J 1NM2A 2BJ3A 3B82A 3CDWA 3I5BA 2Y1RI 1T7PA 4DWIA 3BS9A 1KTVA 2MZQA 4JP8A 4DV3F 1LFWA 4WFXA 1LW2A 3VAHA 2DRBA 1KD1T 2QA4G 1SKSA 2UV8G 1UPMB 1TL1A 4CO5A 4F50A 2QG9B 3CB4A 3DLKB 3QAUA 1X9SA 4CLWA 3PG9A 3UW1A 4NA1A 3VR1A 1FDAA 4ECXA 2JLEA 3AB2B 2YH1A 3GJTB 1AFIA 4M94A 1T02A 5EWGA 5F0WA 1B0VA 1TAQA 2BMBA 3TJ9A 3ULHA 5I42A 3CT9A 4PPDA 5F9LA 1VQ8S 3FBBA 2E7WA 2MQLA 1FKPB 3SBMA 2JSXA 1F9HA 4WZMA 4IH6A 1NHUA 2R2UA 3KLGA 3LTOA 2FHKA 2CJAA 5KG3A 3CMAS 3IXQA 2H5EA 2N4CA 1U0HB 1K8AT 1U25A 1TL7B 3EDQB 3LOUA 5EHHA 3CJ8A 2PI4A 2C2NA 1JIHA 2IJFA 1D0EA 1E6VA 3SYZA 2PEHA 1SQFA 3VF0B 1VQMS 3FKBA 4YB5A 3T1HJ 2ZWPA 3TOQA 3W5XA 3ZNJ1 4C8MA 3QRPA 3HULA 1FHTA 4O3OA 1HMVB 1Y11A 1SH0A 2VBWA 2Y8WA 2V8VA 3OXLA 3CC7S 4B3MF 1S7IA 2C22A 2WB4A 4C48A 3AT1B 3EZOA 1JLFB 4K2JA 2GX8A 3CDEA 3RRGA 1KLMB 1RACB 2FYXA 4O23A 4OHVA 3SSSA 2J5AA 3QFWA 5HBMB 3G8SA 4I6AA 4J9LA 2VPYB 3CJ5A 3PX0A 2C2RA 1SI9A 4Y28C 3ZZPA 1S49A 2CAJA 2QYGA 3VAFA 3LF0A 3ZZYA 2H4WB 1R8CA 3GCXP 3CC2S 3EGZA 3KOAA 4ED7A 1HWLA 2A2CA 1VQ4S 4M5NA 2RDIA 3VZHA 4AUKA 2V4RA 2CQ4A 4C11B 4MTPA 4TVAB 2GGPB 2KU7A 4H4KA 3F0NA 1N5VA 2CQ1A 2QSFA 4CH7A 2GQQA 3Q8PB 3NG8A 2DB1A 3C66A 4X4SA 2YWKA 4NEZA 1Y3KA 4F4YA 2IYGA 2MTLA 1L3UA 2HMIB 3H5XA 1JJ2R 1HPZA 2HFVA 2RS8A 2DT9A 1RUSA 2XZWA 2FB0A 2WSCC 3H59A 3QATA 1Q82T 1R27B 4UY85 2EBGA 2CQGA 2QO3A 3TZZA 1OJ4A 3MD3A 2VG5B 3EXYA 3Q8UA 4IYQA 4RUAA 2Z2LA 3KNGA 1RI7A 1RT1A 1MWYA 1X60A 2ATLA 1FF2A 2BYCA 3VHQA 3A1YG 3ZTPA 1CJVB 1HNIA 4DV0F 2E5HA 5CYMA 4I68A 4ECUA 2AJQA 3KLHB 2ZE2A 1VQ9S 2HG4A 2HNDA 2YWWA 4MK7A 2XSJA 1VLOA 2MPUA 2FGOA 3FC9A 4KAIA 3GIJA 2DHAA 3I9ZA 2F40A 1AB8A 2BE7D 2LQ8A 3IMQJ 2E5JA 1XEZA 2WTFA 3VVUA 1ITPA 1R31A 3PW4A 2RJZA 3CDAA 4DL0C 2MQNA 2J9DA 1Q7LB 1TV6A 4KO0B 1VQYA 4P71A 2W2NP 3NGDA 4DFMA 3W2WA 2FVCA 1WG4A 3T5HA 2CPEA 4KH1B 2MQQA 1SL1A 2YWEA 3SI8A 3SZ2A 2MKIA 1LV5A 2MKCA 2XHWA 2W01A 2R7WA 2V50A 5F8MA 4NCAA 5KFJA 1NK4A 4C8ZA 3TUZC 2UXDJ 3N4WA 1UVJA 1NPPA 1EQMA 1WHVA 1EJ7L 4WFYA 4CO0A 4YR3A 3EVMA 2CNLB 2Y3YA 4WYLA 1X5OA 1RAAB 5LXYA 1GX6A 1KHWA 1RABB 3D54A 2RRBA 4K59A 4DR7J 1OPZA 1JJCB 4C8OA 2XYPB 1S1UB 3OJUA 3C15B 4CH1A 2OO4A 3H5UA 5D6GA 5KFGA 2RUGA 3OJSA 3BSAA 3IRXB 3ETOA 1EZZB 2DNZA 2IM1A 2J9DE 4OI3A 1YJ9S 2V0NA 3OTDA 4OQJA 2Z0GA 3GSDA 4U8YA 4LF7J 1X0PA 4PG4A 5MAOA 2QMXA 1UP1A 4EUVA 2W2QP 3VQTA 3W66A 1IBLJ 4TY8A 2D3OR 1SC3B 3DOLA 2V67A 1VOMA 4Y2KA 3L4BC 3SFGA 1HWIA 5H9FK 3NLCA 4DPTA 1FJGF 1EKRA 4QCLA 1V3RA 3BZQA 3MPYA 1E6VB 2B8PA 2PE8A 3M30A 4OHWA 4NPOA 4H4MB 3SIPB 2F8HA 3PHTA 1LK5A 5J2MB 1X0FA 3IFEA 1UPPA 4QU6A 1NHVA 3ADAC 4FYDA 3TAMA 3THPA 1YK9A 3GIMA 2FVSA 3DLEB 5IC4B 2QRRA 1YJRA 2QYCA 3BN7A 3MR3A 2BQ3A 3CDBA 1XNQJ 3IM8A 3E01A 3ZZ0A 2Z4PA 3T9ZA 1UZDA 3PACA 3CJKB 4DS5A 3D1QA 4ITSA 4XIUA 5CZVA 1TMJA 2FPHX 3BPSP 5I42B 4NZ0A 1T94A 1YHQS 1K1SA 2CXEA 1C0UB 3QO9B 4MJKA 1VK3A 3QRRA 5EX3A 3PX6A 1RT2A 1P6TA 2M8HA 3EDRB 2C2KB 2MY7A 3AA8A 5B0CA 5C42A 2J7UA 4ZPTR 3BREA 3QAEA 1YJUA 1C4AA 4EI2A 2UVRA 2KO1A 3U1MA 1NKCA 1HR0J 3BPDA 2R2RA 4RKUC 1SBRA 4DFJA 2PA3A 4J5OA 1GMWD 4WP3A 1BMQB 4R0EA 4OZNA 1GH8A 4A8XA 1S72S 2CFXA 2CPJA 2G2ZA 3DRRA 3EX7B 1JLBA 1H2TZ 3HJFA 4ZJOA 5KFKA 1SXLA 1VFJA 2MSSA 5M2UA 2L9WA 2XY6A 5BR8F 3W61A 1NK7A 3D4JA 2HIYA 3PCOB 4UF4A 3CD7A 1FRXA 2V6AA 4Q45A 4EZ9A 3HT3A 4CRJA 1XWLA 1IKVB 3AJ2A 3AOCA 1QTNB 4ZVSB 5B7WA 2G13A 3CCUS 1N36F 4PQAA 1YBTA 1A0OB 4DG1A 3GP9A 2CKWA 1RBLA 2N7CA 1U09A 3GR0A 5I3UA 4JV5F 1RGVA 1WC1A 2HVEA 3AXKA 1LK7A 2A0FB 2W4PA 3B6BA 2HKEA 1IBMF 1Y4ZB 2IJNA 3PRBA 2PD1A 3AODA 4GRSA 1N48A 2KDOA 2Y0BB 4N76A 2F4VF 3Q8QB 4KJIA 2ROEA 4A8WA 1WKJA 7FD1A 4C3KA 5KOWA 3CE8A 3LGMA 2E5GA 4F26A 4TU9A 4OJ1A 2CJKA 2G4BA 2V2KA 2VOPA 2JX2A 1HARA 2YTCA 1AZSB 2ZZTA 3ISNC 3DLGB 1WKKA 5BYQA 3I5AA 2XLIA 2ZH8A 4WK3A 3SV3A 2QEXS 5D15A 5J2PB 3Q2TC 1RK8A 2DEJA 2J7KA 3K5PA 4I6YA 4PYAA 3SQOP 3V81B 2HW3A 3A8KA 1NO8A 5CYQA 4U9RA 1T8EA 1NNDA 1IJEB 1JLEB 1OYDA 4DZDA 1IBKF 2AT1B 2J8SA 4DV5F 3KHHA 1URRA 5AXKA 2M8DB 2E5LF 3LWMA 3DI6B 2APOA 5A8KA 2FZKB 2C3UA 1JK9B 3JSRA 4X84A 2RKIA 4BS2A 4K4SA 4LVNP 4Y2IA 4R8UB 3HHKA 1FVSA 2FLLA 1S77D 3LA0A 1ELOA 3GJSB 5KT7A 2VV5A 3CVKA 4DG1B 2CPFA 3TR5A 3TO8A 2XY5A 4WTOB 4N7TA 1C1CA 2B6AA 2P6TA 4ZPDA 3WIVA 4ZVQB 3IWNC 3U1NA 2BQRA 4LREA 3C3LA 3IO1A 2M88A 2U2FA 4KSEB 4HTJA 1S1VB 4X4QA 3W64A 1NXIA 1N0UA 2GQ2A 4FYXB 3ZZRA 2KG1A 1RT7A 2EC0A 4HHJA 3O6QA 3UWTA 3GMGA 2R42A 1HBOB 3PIPQ 5F8GA 5T7LA 1RHKB 1FTCA 2LDYA 5KOXA 3D66A 2ZH5A 5D3GB 1I6JA 1LXNA 3PYDA 2XWXA 4F02A 2DITA 1NCLA 1T9UA 4OFZA 4ECTA 4QBUA 2AJFE 2I38A 4J37A 2B6AB 3H5SA 4O0IA 1FRLA 2HAIA 4AL6A 3F41A 3W2WB 1TMMA 4B9MA 2MDAA 2B0GA 4OYXA 2HHVA 1QM9A 1NZ8A 1NDLA 1QUPA 1SJ1A 4HHUA 3LW5C 5CCMA 3UDEA 3QO9A 1KFSA 3POTB 2KFYA 2LXFA 2CWKA 1R43A 1M1GA 4O3SA 2QMUB 1XN9A 3D6TB 3KG4A 1JLGA 3NRBA 5KFUA 4CM0A 7AT1B 5GAHU 4DQRA 5D4PA 4LF9F 1TKZB 2CQ0A 4HI2A 4J91A 3N6MA 4I2QA 5HLFA 1R8BA 3DGPA 3JSMA 4G3IA 2WVFA 5A8WB 5DG7A 3K5LA 3QFHA 4HEA9 4A47A 5AE3A 2RHQB 1XR7A 1IN0A 5HI7A 3TZXA 3PW2A 2QN6B 3D6MB 4OX6A 4DR1J 4LRCA 1SPBP 4CTAA 1I3OB 1I51B 3PW0A 2NR0A 3NGRA 1RTJB 4ANCA 2CDQA 2WVBA 1DZ5A 2V2VA 3Q83A 2WBMA 2RQMA 3CCVS 1U6BA 1VQPS 1CJKA 3N28A 1YI2S 5CZXA 2W2PP 4QU7A 2YPZA 3JSMB 2YKNA 2QA1A 3EVOA 4R25A 1WF2A 3L95X 2HVHA 3KUEA 2DTJA 3EWGA 5KFCA 3CWJA 3BSCA 4Q0BA 1Q8LA 3ZTSA 1V5IB 1GXLA 1SJ3P 3A8JA 4CLZA 1N5YB 2UU9F 2F8EX 5I4MA 4NMXA 1NEEA 3D1HA 3TZYA 1O6XA 1RT2B 2KI2A 2HHUA 4ZVGA 3R8YA 4IRCA 2ZNYA 4X64F 3EPIA 3MAAA 2CJBA 1N34F 1R89A 2HIQA 4P75A 3N0VA 1IM4A 4PRFA 4NLTA 1Q95G 3KWMA 3BQ2A 1X4DA 5GVQA 2W2MP 4XAKA 3LGNA 5LJ3Y 1U02A 5L1KA 2FLPA 3AA9A 5HQ8A 4DV4F 3OHBA 2G1HA 5LT5A 3KK2B 4GKKF 2BX6A 3I0SB 1FI4A 4OX8A 4MT1A 2ZH4A 3G6ES 4OJGA 2XI3A 2K1RB 4A8YA 4KY3A 3GPAA 2MKKA 3IBWA 5KG7A 3RAQA 2RIJA 3W1YC 5LMUJ 3W9HA 3FVYA 4PYDA 2MEWA 3UI3A 2IRXA 1DQAA 3A3OB 3NBPA 4ZVEA 1NK5A 3LWLA 1X9MA 4JI6J 3IM9A 3H2UB 3GIKA 1U24A 3KG0A 1ZA1B 5I3UB 2DGXA 1QVGR 4RPFA 3BH6B 4J9NA 4Y00A 1UEKA 3IS9A 4JI7J 4DCPB 1RTDA 1DBDA 4CYUA 1IKVA 4BC7A 3RB0A 5FJ4A 1SH2A 2G0IA 1IUJA 3DN9A 4TLRA 1KVJA 4O3NA 1HBNA 1Q86T 4LF6J 3GFHA 2HVZA 3CJ0A 3F44A 3QLHA 4QIWD 2POKA 3UDVA 5CD4H 3RBEA 1VYAA 1A7GE 4MYTA 4OYZA 1UJ6A 1SKWA 1TL7A 4PWUA 5A76A 5B09A 2V94A 4ILLA 2J0QD 2DGUA 1H74A 3V81A 5AE2A 2OH2A 4B3SJ 2QL9B 2VG6A 2W9BA 2LQ5A 2VASA 2NS1B 4LFCJ 4ERDA 1R6VA 2R7QA 2E9TA 4ED8A 1DTQB 1KLNA 1YZ7A 3KMQA 4I69A 3R5JB 3AH6A 3R1LA 1VISA 4LVOP 2BE2B 1W26A 2GCFA 2OUGA 3HJVA 3ILIA 3GIRA 3Q86A 1F9FA 2ZJRQ 1N33F 4PABA 1RHUB 2CQ3A 3KNAA 1JLQB 5DLGA 2VQEJ 2F8MA 1RLDA 5A0YB 1G7CB 3QJLA 4DX6A 4B3TF 2QFIA 3NOCA 4ZCLA 1HNWF 1U1OA 2RILA 3EE3A 2C1EB 4UT4A 2HNDB 3TI0A 1P8GA 1BUXA 2HHPA 4U96A 5JUMA 2DEIA 1H6KX 1VIOA 1WD6A 2EW9A 5T14A 2PFDA 2W7OA 3C15A 3G6YA 3CCES 2VBXA 2P9EA 2FD2A 3RBXA 1N6QB 4QIFA 4PG8A 4Y2CA 2GMHA 2IY5B 2R7UA 1FXDA 3G82B 4Q44A 3T6BA 2ZH6A 2DHSA 1JJHA 4TXSA 4CLFA 5HMXA 4GKJJ 4NLYA 1CSJA 1PYOB 1ZM2A 1IR0A 1B99A 2QLFB 2J0WA 3M05A 2KXNB 2IAJA 5DG8A 4TY8B 1ZAVA 3AOBA 3BN4A 1S59A 3FBEA 3RBDA 5HJXA 5ETNA 3EGVA 3DLBA 4DSIA 1GTHA 2GJ2A 4HI1A 4X65J 1RT7B 4ATNA 3HSGA 2VH7A 4ZKAA 5ITHA 1X5SA 5JMNA 3PYFA 2Z8QA 3KLHA 4HYKA 2RF2A 3DRSA 4J9UE 4F4AA 1LXJA 2J6UA 2DO4A 3MCNA 1NSKL 1WC4A 2VD3A 5L9NA 2HZAA 4IG0A 1V3SA 1ZS6A 5BYRA 2LU2A 3WDOA 1TKTB 3OHAA 3A8IA 3A4TA 4B9NA 3IRXA 3JXOA 2XMWA 3KLVA 4HL9A 3FCWA 2FJVA 4KR0B 2NZ4A 1HW8A 1WUUA 1ZM3A 1T9YA 2BBEA 2CADA 4QPTA 5KFRA 1M5SA 2NXJA 1OIAA 3TWZA 1HL6A 3CUNA 3NAHA 4OX7A 2MQPA 3ZZTA 5DZ7A 1RAGB 1YRXA 4J9OA 1M0SA 2P8IA 2AYMA 2X1BA 4I4BA 1QSYA 4JI5F 4Y34A 4JV2A 5LMNF 4M5HA 2NPIA 2ILZA 1HNXJ 3HHLB 4DV6F 2D3UA 2BJ7A 1FTRA 1HIYA 2HBYB 3BH7B 4BC9A 5KFTA 2NREA 4WYWA 1UW4A 1N88A 2OFGX 5HLFB 1RT6A 4YY3F 3FEYB 3NS7B 3ZO7A 1PJ7A 2W2OP 3G8QA 2WRMA 3K8WA 3PTWA 4ANEA 5SUHA 4USTA 3BO3A 4K0KF 3W63A 1S79A 6FDRA 2HNZA 3C19A 3AJDA 2RF2B 1AROP 2C3OA 2HZCA 1UFLA 4IG3A 3HVRA 4DV2J 4B9UA 3LAKA 2CPXA 2UXBJ 1FJ7A 2YWGA 3OV7A 5K8OA 2ACYA 2BJ1A 2E44A 2LYVA 2HSEB 2GHWA 2DXFA 2MZSA 4LRDA 1FNOA 2HQGA 5HO4A 4KHPJ 3OFFA 3GILA 1GTEA 3R5DA 1VBYA 3GR1A 3LP2A 2DXDA 2WVCA 5IQQA 1U26A 1KS2A 2A1BA 3FUYA 2W4DA 3V6HA 3IP0A 1UKUA 2VG5A 2YQ1A 4AL7A 3K2YA 5DQIA 4X4VA 3C14A 2FHJA 2OKQA 4F36A 1UWBA 1SH3A 4QIVA 3MURP 3K57A 1VQ7S 2KT3A 3GJRB 5KFBA 2IYIA 1RWOB 4XDDA 1RDRA 2CQ2A 2V68A 3IC1A 5SZTA 1SJ4P 2C2ZB 2CPIA 2P5VA 1ACMB 1URNA 2FLNA 5L46A 3MPUB 3M6UA 3TVYA 2OPPB 1T95A 1U7LA 5AJ3F 2CQBA 4OZ2A 4ELUA 4KT0C 1S6QA 4FBTA 2AW0A 2LA4A 1YJNS 3VGTA 3KHGA 1FD8A 4N8OA 4ZVHA 4A48A 2V8PA 2ZH3A 3IAM9 2EFQA 2Q79A 5C42B 2OEMA 4ZVUB 2RKIB 1IR2A 5A8RA 4U7UD 2BKOA 2UUAF 1SKUB 4ED5A 1YBUA 2AEFA 2MZJA 3R7BB 5KG5A 1FXLA 2NSBA 3D0GE 2HRUA 3CO9A 1CVJA 3R2CJ 4JI8J 1KLMA 3OFEA 5HBMA 2HGNA 1BQMB 4YEAA 4JI8F 1DY3A 3HZEA 2EFPA 5E3AA 3D1OA 2I9SA 4W4MA 1EETA 4ZPCA 1RKJA 1F60B 2VODA 2BJEA 1U0HA 1TR0A 2UUAJ 1MNEA 2OI2A 2OHDA 4P2MA 4CDIA 2DR5A 1CEZA 4I2PA 3RRHA 2PI5A 2AWZA 4RWXA 3D9BA 3NCPA 1YTYA 3P5TL 1HQ2A 2R7RA 5AJ3J 2CNKB 4PUOB 1Y5NB 2RMLA 3M6XA 1VLYA 3BGRB 4FNHA 1N5TA 3S7RA 3R7NB 2BDPA 2HGLA 1RB0A 1WEZA 2DGVA 3MFHA 2XY7A 4CZCA 1H73A 3FFIB 3K89A 4PPZA 5ADZA 5HANA 1W2IA 4BCAA 2CG8A 2FHOB 4L76A 2XMAA 3QMQA 3QSIA 4NMLA 3A3NB 1LWXA 2AIRB 1JLAB 1Q5VA 2P2CB 4P7TA 4DCJB 5KFHA 4YR0A 2OTJS 4KHPF 3HCXA 4DPOA 4QYZK 1CJUA 2JFKA 2M52A 4MIBA 3PDNA 1IM6A 1EP4A 2UXBF 1LKZA 3RB4A 4DV2F 2CZVC 2G0JA 2IHR1 3IR7B 3PNIA 5KT5A 3IG1A 3R3TA 3M9OB 3K58A 2M4MA 3J81U 2AU0A 2PEBA 2CNOB 3LANA 2IFXA 2DCUB 2B9XA 4K0KJ 1R8HA 3PEJA 3G86A 2A3JA 4QR0A 4PG7A 5DS7A 4AXIA 3MMJA 4F0KA 4U67Q 1VC5A 2EVZA 2HBRB 2HS4A 3Q2SC 1T05B 1RT5A 3D28A 5CH7B 4YY3J 3BSNA 2JLFA 3HFKA 1YWXA 3UR0A 2BM0A 4RBTA 4PG6A 4JV0A 5C24B 1DURA 3DMJB 2N4DA 4DV6J 1IR1A 4AE5A 1WI8A 2Q6BA 4BLGA 1HNXF 4M5KA 3MEDB 5LMNJ 3VAGA 2B9WA 3PJWA 1M1KT 1RWUA 2K06A 4JI5J 1UVKA 2ZD1A 1TKTA 4P7VA 1U1PA 2QV6A 2IA0A 3WX8A 4WIIA 5GAEU 1K47A 2BOAA 2IBKA 4H4OA 2G0CA 4EYHB 4ELTA 1S5ZA 4TU7A 5G4DA 4JV1A 2ALYB 2JEFA 2ASLA 5ETQA 1VCTA 2KM8C 3HHLA 3DYAA 4DQIA 3CC4S 3MZIA 1G6BA 4CM2A 1E6YA 1OPIA 2LA6A 1X5TA 4RW7B 4DCOB 4Z7CA 1VBZA 4OHYA 2BXJA 1MMDA 3JTPA 2GHPA 2KB2A 4U7CA 3HX9A 1JLCA 2D7SA 2FZCB 2O66A 2HHXA 4CO3A 4P2FA 2QX0A 4AYBD 3DFEA 3MXHP 2H5JB 2FJBB 1QAYA 2V9KA 4X65F 2Z2MA 2R4FA 2QA2A 3BBCA 3UD5A 2FVPA 1WEYA 4XPEA 3JSYA 5IV3A 4N5SA 4IKAA 4NLQA 4OV1A 4CLSA 5M2PA 5HROB 1IQTA 2HWHA 3T19A 3JAMY 4M5JA 4GKJF 3TEHB 3G6VA 3THTA 3PY8A 4A8MP 2V69A 3HSDA 1Q8BA 1X4FA 2J6SA 2UP1A 3UDCA 2DISA 3P96A 3UD3P 4K2XA 2OFHX 1LWFB 4AXJA 1SC1B 2PN6A 1S6PA 1S1TB 1BQNB 2NYHA 2QIFA 4R5PA 3SCLE 3QBCA 3MUVP 4GC7A 1RT3A 1W25A 4MK9A 2WAQD 3GCWP 1ZPVA 1REVA 4OZ1A 4USVA 3OTEA 3R9LA 4EWTA 5CD4A 3AXMA 4NI2A 4LF5F 3EGNA 1HNWJ 1W2BR 1E6YB 2NXCA 2MXYA 4B3TJ 2V2QA 4M5DB 4CP5A 1TKXA 2VQEF 3HK2A 2V63A 3G6XA 1JXLA 1GXUA 3MMBA 2XQCA 1N33J 2DNHA 2ZBPA 4NLDA 1A6LA 1UEVA 3GJQB 5F8IA 2B43A 2BACA 5GAHI 3KLGB 3MM9B 2IDLA 3HFVA 3QJPA 4M95A 2YKPA 2W24A 3MM5A 1HW9A 1K44A 2R7XA 4EBEA 1NRKA 1XBWA 3ICLA 3TAQA 3QGIA 4LFCF 2QA4S 3MAAB 2OPRB 4YMEA 4B3SF 2EI5A 3UQSA 4LRFA 4U6PA 2W1BA 4A4JA 1RTDB 1HMVA 2VJVA 3MMCA 2D3O1 3HLUA 1RZMA 2J9CA 4ES2A 2B9YA 4KRWA 4LF6F 5KFEA 3TW0A 3ZFVA 2AZ3A 2ZZNA 2DVIA 3QIPA 2WSEC 2YWHA 4NL5A 3CNQP 3GFYA 5K5MA 4C97A 2XM3A 3MGJA 2VPZB 3H2VE 1XK8A 2HHWA 4JI7F 5AXMA 1JXVA 4WP8A 2DGQA 3T5LA 4NI2B 2XNQA 3Q8SB 2GIRA 1DAXA 2ZKUA 4JI6F 2FLOA 1BWEA 5GMEA 3DHXA 4ZN3A 3RG6A 5LMUF 3PRVA 1I1GA 5L1LA 1VS3A 1VR6A 2GA7A 2JH3A 2YKMA 3PIOQ 4OLOA 1BQXA 3V6JA 3ET6A 2E1AA 2EPIA 2LQBA 2DNQA 3HT0A 3OD2A 4G1IA 2DKOB 1U45A 1AFJA 1TKDA 3IBCB 4KKOB 4I6WA 3LH2S 2NCKL 4DV4J 3MOJB 4GKKJ 2GIQA 4OI0A 4ED0A 5C2GA 3FCVA 4PXCA 2XYHB 2FZGB 4I56A 1OO0B 5CYJA 1TU0B 2XO6A 1B4SA 2FJXA 2R8JA 4L3NA 3LO3A 2L9DA 3ENWA 2MZ1A 1B64A 2WB1D 2PDAA 1P1LA 3E51A 3JQMA 4PG5A 4DHVA 4NLSA 4V1Ak 2CQCA 5ETPA 2YQ0A 2NSCA 4K5RA 4X64J 1RAHB 4FYYB 5CYQB 1N34J 1OSDA 1TTHB 1FRJA 2YXLA 5E3PA 4EBCA 4ZPBA 1PILA 2Z30B 3QIPB 4KFBA 4Z7YA 1VHIA 1SJQA 3KJVA 2CPZA 2IAJB 3MECB 4C6AA 2UU9J 5D3GA 3EM1A 1FD2A 3K17A 5F3TA 5KFAA 3CMQA 2BOPA 4OJHA 1HBNB 1RTJA 1FRHA 3L7OA 3MPVA 1HQEA 4HDHA 5CA5A 4CLTA 2HGMA 5KFFA 3CW2C 3DLHA 4DMZA 5DJBA 3NEKA 3MM6B 2VU5A 3MEGA 1KR4A 4IFYA 1J5EJ 1ZH5A 2B3TB 1N5SA 2GMLA 3PRDA 4H4OB 2DYAA 2KTQA 3PFOA 5EX0A 3CCSS 2DJWA 3BDEA 5F41A 4KHMA 1NKBA 1LWEB 2HVDA 4RNNA 2V34A 4LRBA 5DDOC 3TAPA 5KT3A 2H5IB 3C6TB 4RLEA 3DLEA 1FK9A 1PYTA 1HLWA 4OZJA 1IKWB 5IFMA 4G1QA 4H4MA 1RJJA 3VWSA 1CULA 4FKXA 3FSIA 2PSZA 1RLCL 2ACMA 4RW4A 1P27B 4A8SA 3RW6A 1F2HA 4CTAB 2RDDA 4LF9J 4MKYA 1KKHA 4F7VA 1YKWA 4WWSA 3KLFB 2M3DA 1T9VA 2QLXA 4NLUA 2QC3A 3OR1A 3K0JA 3BBBA 3OUYA 2QZ8A 4RW7A 2EKNA 3HVWA 2MYFA 3JTOA 2ZITA 4G1QB 2ATCB 4MK8A 2ZJQQ 1S9EB 2RT3A 2VPWB 3VVTA 2BJ9A 5KFPA 4RU2A 1Z2LA 2MHEA 2OPQB 1J2VA 3MEGB 1Q16B 4Y2AA 5JJBA 3FSXA 4NA2A 2KZMA 3UN5A 2GIFA 2G2OA 1RT4A 2GVDA 4UUWA 2C2EA 1VRQC 2RRNA 2IVYA 1KQKA 3KG1A 4EK2A 3OUYB 1BC6A 3IWLA 3OR2B 2MJUA 2VG7B 3NS5A 3Q8VA 3B8HA 4EFAC 3HVTB 3GTYX 4HLBA 4QWCA 1HHTP 1X4CA 2H3EB 5KT6A 1TKXB 3GZ7A 5D0HA 2WBRA 4OI1A 4F3MA 5CCLA 1U1RA 2BE2A 1F6TA 1ZTWA 1WDDA 2LP4A 4ZP8A 1WSVA 1WG5A 1XMBA 2C2OB 4FYWB 4V19J 2KFZA 3HSJA 5J1EB 3VV2B 5E2QA 1HA1A 1MMLA 2JNJA 3TVZA 1M5PC 4WK1A 1D9FA 2GMJA 2C2MB 1EETB 2FQQB 3VAIA 5C25B 4Q2MA 3TRGA 4LF5J 2AX0A 2E5LJ 3TX0A 4ECZA 2UVUA 1K0VA 2KN4A 1RHRB 1U2RA 4DV5J 2QTWA 2AJ2A 1Y5IB 3ZZOA 9ATCB 1IBKJ 2FC9A 3MOZA 4CLUA 3M2RA 2BKNA 2L48A 4JUZA 2H48B 4DOZA 3AJ1A 1Z4UA 2FGCA 1X4HA 3J81Y 3KK3A 1UW9A 1HWJA 1QJHA 3DLKA 2VKZG 1Q8KA 3GWCA 4OLPA 3RBZA 4KBIA 1KVKA 1B7FA 1QY7A 2KXHA 1C1BB 5DDPC 2X1GA 2KFNA 1VJQA 2DD8S 4TN2A 1DHMA 1IBMJ 2F63A 3NGUA 2F4VJ 4WFBQ 1S9GB 3QIDA 5KFNA 4JV5J 4ZITA 4FF1A 1HD0A 1PJ6A 1FWLA 2FJAB 2LCWA 3TX8A 1SUQA 3HHDA 5KT4A 3K59A 5B0AA 2AMCB 1U6FA 1N36J 1NSAA 4LBHA 4DL7A 2CRLA 4F4WA 4MH8A 3IRWP 4K4YA 3TARA 3OVBA 5J2PA 4QQBA 3LP2B 5L9XA 1RXOB 4M5IA 1VDHA 2ZBCA 1Y00A 1WORA 5BR8J 1UFKA
chains in the Genus database with same CATH topology
2E7VA 1IVZA 2ACMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7V A;  1IVZ A;  2ACM A; 
#chains in the Genus database with same CATH topology
 3FMB A;  3SEO A;  1YSJ A;  2BV3 A;  1VRT B;  4FVC A;  1FXR A;  3CCR S;  1NJX A;  1WNE A;  2HAF A;  3M2U A;  3G8T A;  4J90 A;  5C5J A;  1SJR A;  4ETX A;  2CVE A;  3FCH A;  4MFB B;  5K20 B;  3E2E A;  3RTV A;  3BGF A;  1RAF B;  4W98 A;  3KK1 A;  2HFN A;  1RT5 B;  3QGH A;  3KYL A;  2L3M A;  1HR0 F;  3C6U B;  5J2N B;  4KTQ A;  1X7V A;  3ET6 B;  3V2U C;  1U1K A;  3BYR A;  2ERR A;  3H7H B;  5LSO A;  2PMH A;  3QT5 A;  5GAD U;  3I4P A;  4YB7 A;  4I2P B;  3P4U B;  4NRT A;  3VGV A;  3D3B J;  5A2Q Y;  2VG6 B;  3ENQ A;  3FDS A;  3FNN A;  3SQG A;  2W9B B;  1Y9O A;  4WFN Q;  1Q7Y T;  1CS4 A;  4CT9 A;  5HAO A;  1H0H B;  3R27 A;  2O67 A;  1I5O B;  3RZA A;  3I4H X;  2ZUA A;  3I32 A;  1BD6 A;  5U47 A;  3G71 S;  3PX4 A;  1PSD A;  1L3S A;  3RUB L;  2CIM A;  2DY1 A;  3QGG A;  2Y8Y A;  4ZVP B;  1XNQ F;  1CG2 A;  1NDK A;  1FKO B;  2V2Z A;  2I8E A;  3IR6 B;  3KDO A;  3I82 A;  3LP1 B;  5C2C A;  3WC2 A;  4NWB A;  2K7J A;  4BBY A;  4J9S A;  2V4Q A;  4F2S A;  3WIU A;  3C6T A;  4ZP6 A;  2E9R X;  1VBX A;  3W65 A;  4NYZ A;  1X31 C;  5KG4 A;  2PII A;  1BE4 A;  3Q8Y A;  5CAA A;  4PEO A;  1FJG J;  2X51 A;  2HWI A;  3GQC A;  4J7C A;  3QZ7 A;  4TNO A;  4C2M A;  4I67 A;  5RUB A;  2UUT A;  4GVB A;  1IBL F;  4WFA Q;  2F1F A;  4WU2 A;  1L3V A;  4PUO A;  1KSP A;  1L3T A;  1KON A;  3QT6 A;  1TK8 A;  2J7W A;  2XEX A;  2DPJ A;  4LF7 F;  4UTG A;  1S1W A;  3MF5 A;  4DL3 A;  2M7S A;  2XBP A;  3E01 B;  4P72 A;  3FJ2 A;  5KFI A;  5BYS A;  3Q0A A;  4F2R A;  1Q78 A;  4GO5 X;  2AEJ A;  2QSW A;  1P9Y A;  2YBV A;  1IKY A;  2EFV A;  4ECY A;  1B0P A;  1JLC B;  3NAI A;  3HI9 A;  5A8W A;  1N52 B;  2LXI A;  3CCT A;  4AT1 B;  4XTT A;  4DXL A;  4DR7 F;  2HHS A;  1NDC A;  2ZOF A;  2XGP A;  4UQG A;  4C11 A;  2WW4 A;  2UXD F;  5AXN A;  1HI8 A;  3Q89 A;  3MED A;  2DGW A;  1IKW A;  4HH0 A;  3PW5 A;  3C46 A;  2E1R A;  2HQC A;  3U27 A;  4DUT A;  1HBM A;  3M1V B;  1JXE A;  2JRS A;  4QJV A;  2J0X A;  1N54 B;  4FXW A;  3M8Q A;  1C2P A;  3MM5 B;  3ETM A;  1S6Q B;  2ASY A;  4GC6 A;  4ED1 A;  1YJV A;  3UN3 A;  1S12 A;  1BLU A;  1PCA A;  2Y1I A;  2LEA A;  1H98 A;  3FRY A;  1R0A B;  3LP0 A;  4K8R A;  1FWP A;  5E0O A;  3TP2 A;  1FJE B;  4NLP A;  4RUH A;  2B56 A;  4K4X A;  3W2V A;  4CLP A;  2BQU A;  4ER8 A;  2YNF A;  3BDP A;  5HMW A;  3DU6 A;  3J7Z T;  1M90 T;  2MLX A;  1REV B;  4DN0 A;  1NK9 A;  2ASJ A;  2XWY A;  1EIY B;  2XS5 A;  3GG0 A;  3OSN A;  3IGV A;  4LQ9 A;  4P10 A;  4I7F B;  3KMS A;  4DV0 J;  2I0X A;  3RAM A;  1JKH B;  2R7O A;  1WHX A;  1VI7 A;  2BA9 A;  3PM9 A;  2BJ8 A;  4USH A;  2ZDO A;  3UE2 A;  3WX4 A;  5KFW A;  2FY8 A;  4NLO A;  3R6L B;  1P9Q C;  5HQL A;  1NJY A;  3PYG A;  4EO8 A;  2Y9H A;  3RYL A;  4LRA A;  3V4I B;  4UOG A;  4USK A;  1J5E F;  1CJV A;  1HNI B;  1WWH A;  2UUW A;  1G2E A;  4Z2X A;  2J76 E;  4IDK A;  2RRA A;  2P6S A;  1UWA A;  1QE1 B;  3GYG A;  2OEL A;  3OW2 R;  4ECV A;  2ZC3 A;  3GYX B;  2R2S A;  4ZLL A;  3M32 B;  4V19 X;  4LUB A;  5KAK A;  4B08 A;  2YKM B;  4F8R A;  3ZXW A;  3PO4 A;  1KRP A;  3OBI A;  4DL4 A;  2XCA A;  4X2B A;  4RW9 A;  4OYP A;  3CJ2 A;  3HHE A;  4ZVF A;  2KVI A;  2LFV A;  1V6H A;  2FIU A;  1ULR A;  2YNF B;  2KHC A;  3M2V A;  4RW8 A;  1CJU B;  3IN5 A;  1OWX A;  1FCA A;  2KJV A;  5FDL A;  1NK6 A;  2MMY A;  3B78 A;  1SV5 B;  3KLI B;  2NXU A;  4OHX A;  5DRK A;  2XMU A;  3R1H A;  3ISZ A;  1WOP A;  1S97 A;  1RHM B;  4O44 A;  1UA1 A;  1VC6 A;  4B3M J;  5CXT A;  1NSP A;  4DQQ A;  1S1T A;  5ETL A;  1OSC A;  5BXI A;  3NGS A;  4OI2 A;  3RR8 A;  3T1H F;  4AL5 A;  2LEP A;  1VRT A;  3D6H B;  1NJW A;  4ZPA A;  1Q0N A;  1SIW B;  2RU3 A;  3ENV A;  2CPY A;  5J1P A;  4TLQ A;  2UVW A;  3WC0 A;  3MI7 X;  5EDW A;  2B7B B;  3CJS A;  3U7J A;  2N82 B;  4O3Q A;  4RNO A;  3VAL A;  2HQI A;  2X7I A;  1Y0H A;  1SUQ B;  2HWT A;  3HFZ B;  3C8Y A;  4B9V A;  3HPO A;  4MIA A;  4DZ6 A;  3RB3 A;  1EX8 A;  2C28 A;  1UL3 A;  1ZAX A;  1FES A;  4IO1 A;  3KJV B;  5A6W A;  3CJ3 A;  2YX4 A;  1HQU B;  4USJ C;  5K14 B;  3SV4 A;  5B0B A;  4U7U K;  5FII A;  5KFS A;  3BQ1 A;  2E5I A;  1S57 A;  5L38 A;  5KG0 A;  3PR4 A;  4DFK A;  5CAB A;  1FJC A;  2CG4 A;  5F8J A;  1NHK L;  1T11 A;  2BEF A;  4RUB A;  3AY0 A;  2GV1 A;  2ZNZ A;  4ID8 A;  1S48 A;  1RWW B;  4DV3 J;  4LSZ B;  4NLR A;  4HAC A;  1S9F A;  3CIM A;  1JMT A;  3GFX A;  1YJT A;  4RO0 A;  2BZ2 A;  2W9A A;  4J9P A;  3RAX A;  4OX9 F;  4LF8 F;  1N5Y A;  3FFI A;  1XR6 A;  4K4Z A;  4ZS6 A;  1QD1 A;  2R7V A;  2YWF A;  2BJD A;  1QDU B;  3E3X A;  4NCB A;  2A6M A;  3PKY A;  2VHG A;  2ROG A;  4TQS A;  3FEZ A;  4AD6 A;  3HXM A;  2Z2Y B;  3OVA A;  5HP1 B;  2DY9 A;  5B0E A;  3T3F A;  1MRO B;  2OPQ A;  3H0P A;  5HAT A;  3HP6 A;  2HMI A;  2CQD A;  4IOB A;  3UVJ B;  3F73 A;  1D9A A;  2HPU A;  4KV8 A;  5B08 A;  4LSL B;  1TZ0 A;  1FVQ A;  4QWE A;  2CJY B;  2GO9 A;  2H54 B;  3W7B A;  3LQV A;  2V4J B;  1U47 A;  1PBU A;  2HQ3 A;  2NUU G;  4PXD A;  2UZA A;  3QT8 A;  5ETM A;  4OYI A;  4NLW A;  2NUH A;  5HK4 A;  4DEZ A;  4OZL A;  1RWM B;  2VOO A;  1PGZ A;  3DOL B;  4DI6 A;  2E7X A;  1P1T A;  3MEK A;  4HR2 A;  3UFC X;  1H7W A;  1S6P B;  4R5P B;  2J9E A;  1WC6 A;  1HI0 P;  2ZZM A;  3K5M A;  4JB8 B;  4QYZ J;  2K8G A;  4P9S A;  4L75 A;  4J9R A;  3CJQ A;  5DM7 Q;  2UUC J;  3DLL Q;  3N6N A;  4HH1 A;  2CUY A;  2VDI A;  3MMC B;  1D8Z A;  4BWJ A;  8ATC B;  4OJ3 A;  4KGV B;  3KUH A;  2HS3 A;  3WZ0 A;  1HBM B;  3M1V A;  3A13 A;  4QW9 A;  1Q8I A;  4DR3 J;  2CDR B;  1ZM9 A;  2HEK A;  1VQ6 S;  1TL1 B;  4DSF A;  2JVR A;  1MG7 A;  1RT6 B;  4JI2 J;  4UZC A;  1SB6 A;  4Y6I A;  3SMZ A;  2RB7 A;  2D9P A;  5GAE I;  2XCP A;  2P9G A;  4C7Q A;  2AD9 A;  2GS8 A;  4PZV A;  1WTB A;  4FXD A;  4A46 A;  4LBP A;  2CQI A;  3J7Z 5;  3A8E A;  2OSR A;  3TA0 A;  5LXR A;  1XMO F;  2BAB A;  5J1E A;  1YQH A;  3NOG A;  4KHR A;  1PAE X;  3M8Z A;  1NME B;  4OZ0 A;  5EWE A;  3RR7 A;  2HNY B;  4MKB A;  3M8S A;  5CHC B;  3OR1 B;  2HQF A;  4FS2 A;  4YFU A;  1XC9 A;  4DV7 J;  4I7F A;  5G0R A;  5F3Z A;  2R9L A;  3LAM A;  3OL6 A;  4ETZ A;  2VJU A;  1NK8 A;  1NZA A;  3KKF A;  5K8N A;  4B3O A;  1DQ9 A;  3V4M A;  4UY8 T;  2I5J A;  3ILO A;  2JC0 A;  1RTH B;  3LPE A;  2HRY A;  3CGI A;  3QLH B;  1KN6 A;  4OYW A;  3GON A;  4G1P A;  2DHH A;  2G2Y A;  5A0Y A;  4M63 A;  3TQE A;  1BHN A;  4USI A;  4R8U A;  4CO4 A;  2HQD A;  3G4S S;  4YDD B;  3HHL C;  2B7C B;  2GC8 A;  4RBV A;  5KFY A;  2XZD B;  3SSQ A;  1LWC B;  5IM0 A;  4Q0B B;  4L3K A;  2WHO A;  1VRU B;  3ONQ A;  5KT2 A;  2W8L A;  4P73 A;  1FRI A;  3OPK A;  4RW6 B;  3RGI A;  4EU0 A;  3FMW A;  1UET A;  4N41 A;  1BGX T;  1X5P A;  4HT7 A;  5CQG A;  2DR8 A;  1TFY A;  3HHN B;  1EAR A;  3PYE A;  1FEH A;  4ZLN A;  3BO4 A;  2JL9 A;  1FFG B;  4TU8 A;  1VIX A;  4MIW A;  3PHE A;  3HO1 A;  1TP7 A;  1FFS B;  2ZVI A;  3M2V B;  2H9Z A;  5IT0 A;  1TUV A;  3OSP A;  2JEI A;  3ENA A;  4KIA A;  1NSQ A;  4RU9 A;  3TAN A;  4BWM A;  4UZB A;  3I31 A;  2D69 A;  5D0R A;  2DIU A;  2F65 A;  4FXV A;  2F9D A;  4YB6 A;  3D0H E;  3KJQ B;  1WHW A;  4RW9 B;  2EWH A;  4CYU B;  4I64 A;  1NB2 A;  4U95 A;  5DZ6 A;  2J6T A;  7FDR A;  2XB2 D;  4DU7 A;  5E5N A;  1F5C A;  2H1Y A;  2ZE2 B;  5F9N A;  4H4K C;  1T9X A;  1OY9 A;  3POT A;  4KPY A;  4ZP9 A;  3UR3 C;  1QSS A;  3NBP B;  1S99 A;  4OZ5 A;  4KE5 A;  1Y5L B;  1XIQ A;  4OYO A;  4MFB A;  1Q81 T;  2DCL A;  3PZP A;  1UA0 A;  3C16 A;  2MLZ A;  4TKT A;  4E2F B;  1S4F A;  2VDH A;  4ZLJ A;  1XTZ A;  1MSW D;  4F3O A;  4EBD A;  1ZAW A;  4OYB A;  2LXU A;  5D77 A;  3CIZ A;  1XJW B;  5GAG U;  4X62 J;  1ZOT A;  1K73 T;  4TQR A;  3BM7 A;  1O51 A;  2GJF A;  3MD1 A;  3KHL A;  4OI6 A;  4WU3 A;  1DLO A;  3HHL D;  3P45 B;  4LMZ A;  2R8K A;  1S6U A;  4TY9 A;  2YNH A;  2ABY A;  4PWW A;  2KJW A;  4QWA A;  2C2D A;  1HQU A;  1FWK A;  1N0V C;  2EBE A;  3D5M A;  4CIO A;  2KH9 A;  4B9T A;  1XQI A;  1KOH A;  2GAG C;  2IMO A;  4ZN1 A;  3OR2 A;  2DR6 A;  3B54 A;  4XDC A;  3PVX A;  2R7T A;  2DGO A;  4OI4 A;  4O3P A;  3QZ8 A;  3OL8 A;  1FE4 A;  4IFV A;  2DH8 A;  4ENO A;  4AQY J;  3V6K A;  2OSQ A;  2HHH F;  3G9C A;  2AYE A;  2HHQ A;  4QPX A;  3KK1 B;  4Y2M A;  1KC8 T;  2E9Z A;  5LM7 E;  1S7H A;  3R5A A;  4DR4 J;  3GFZ A;  4HAC B;  4RJV A;  1U1Q A;  3TAM B;  1F5B A;  3K5N A;  1FDN A;  1N56 A;  2HHT A;  4J9M A;  4NXM J;  2AGP A;  4Y3C A;  5HL7 Q;  4JI4 F;  1FX2 A;  2RAQ A;  4A8Q A;  2EC2 A;  4KFB B;  3CED A;  2CZ4 A;  2IVF B;  2JZ5 A;  2YY3 A;  1PKU A;  3G96 A;  1YJW S;  3BV8 A;  5L8R C;  2L41 A;  5D4N A;  1MMN A;  5L1I A;  1S0M A;  4LF4 F;  1U1M A;  3AOA A;  3H40 A;  1S1X B;  1FKP A;  3I6P A;  1F0X A;  4IRD A;  3BBF A;  2XI2 A;  2DH7 A;  2DGS A;  3W9I A;  3C6U A;  5KG2 A;  2XZT B;  1RAE B;  2XLK A;  2KM8 B;  4C0H A;  1TQL A;  3UPF A;  5KFQ A;  3BGU A;  2VBZ A;  1BQN A;  2WOM B;  2R8H A;  2KT5 A;  4JI0 J;  2AEM A;  2AZ1 A;  4RZR A;  2CJQ A;  2RNE A;  5HMZ A;  4X4P A;  1T9T A;  1FO1 A;  1FA0 A;  4DV1 F;  4ED3 A;  1NK0 A;  1PO6 A;  3T5J A;  2DNG A;  3PR5 B;  3DRP B;  3M8P B;  3NXZ A;  3R5G A;  2IRY A;  4WKY A;  4FKY A;  5E33 A;  2H51 B;  2NYI A;  3JAM U;  4ZP7 A;  4C8Y A;  3J80 Y;  3NS6 A;  2D1C A;  1CJK B;  3LUY A;  1M5O C;  2OTL S;  2PMZ D;  2RQ4 A;  3EGW B;  2YKN B;  1ZTT A;  1YG0 A;  1Q1K A;  2IRU A;  3EJM A;  4ICL A;  3L9Z A;  4OHZ A;  3QYY A;  3Q22 A;  1HHS A;  4DN9 A;  2EK6 A;  1N32 F;  5G0R B;  2EFO A;  1Y3J A;  3HVT A;  5D0G A;  4CWB A;  2OIH A;  4F3Q A;  1DTT A;  2GVZ B;  3R97 A;  1AYE A;  3M8R A;  1S4E A;  3G82 A;  4ID5 A;  2XSJ B;  3MTK A;  4OV6 A;  3M8Q B;  3TNV A;  1SL2 A;  5AT1 B;  3UDL A;  2X3D A;  4DF4 A;  2OGU A;  4I1T A;  2FUG 9;  5DQH A;  2Z56 B;  3OLB A;  4URG A;  1MWZ A;  4FP9 A;  1BY9 A;  3IS9 B;  5ETK A;  2V8H A;  2HBQ B;  5C25 A;  2V5H G;  2ROP A;  2GVZ A;  4ZHR B;  2XTJ P;  3N5F A;  1OY6 A;  2B51 A;  2XS2 A;  1UAW A;  2O5D A;  4KGX B;  2Z57 B;  3JYT B;  3I55 S;  2X1F A;  4LIW A;  3ITH B;  5L1J A;  4DSL A;  1BWV A;  5JXS A;  4B9S A;  2J0S D;  3KJF B;  4NOH A;  2RS2 A;  3M4X A;  3NY0 A;  3UO0 A;  5IS2 A;  3BYP A;  4WPA A;  1U1L A;  4QWD A;  3DLG A;  1SL0 A;  1X4B A;  3H25 A;  3GG1 A;  3DOM B;  4LBI A;  2KYX A;  4ES1 A;  1S9G A;  4LFA J;  3HKW A;  3DNC A;  3V5R A;  2QLB B;  4X4U A;  5K14 A;  3N79 A;  3Q8R B;  1IXK A;  1RP5 A;  1ZPW X;  2VQF J;  1ZZF A;  4GMK A;  1T3O A;  4M5G A;  1GXT A;  2RUS A;  2GGP A;  1RWV B;  4DR5 J;  1HNZ F;  1A9N B;  5EN1 A;  4QW8 A;  2W7P A;  4P74 A;  1SIZ A;  2AKW B;  2H65 B;  2MGZ B;  2I2Y A;  3LAL A;  4DQS A;  3W5Y A;  4PWD B;  6FD1 A;  1CJT A;  4RUC A;  5JVG Q;  3QPI A;  2KYZ A;  2XHC A;  3LP1 A;  1VQO S;  2YNI A;  2VBY A;  3KDN A;  4USW A;  4IUF A;  2U1A A;  5DDQ C;  4ZPV R;  4HKQ A;  4RL1 A;  4WF9 Q;  2VKR A;  4NLG A;  4JBC A;  5IV4 A;  1S0N A;  3AAW B;  4UUX A;  1T3N A;  2YQ3 A;  4O3R A;  1HBU B;  2VC0 A;  3PFE A;  1EQ0 A;  2R7S A;  2XMT A;  4WCE Q;  5E41 A;  1SV5 A;  1ZBT A;  3KLI A;  4DL2 A;  3FZB A;  1N4L A;  2LLZ A;  4QZV B;  5DO2 A;  2V4J A;  4M8L A;  1S1X A;  1DLO B;  3BJY A;  2HBZ B;  3NNC A;  2LVW A;  1UVN A;  5KFO A;  2WON A;  2VIH A;  1T03 A;  4JI1 J;  1TUW A;  5KFM A;  3EVW A;  4KV8 B;  2PA8 D;  4A8F A;  1H2U X;  3GU0 A;  2MZR A;  3SQG B;  2GQC A;  4DR6 F;  2JEG A;  4YHH F;  2BRL A;  3CCW A;  2ZM6 F;  1LOU A;  5F8H A;  5H9E J;  4GVL A;  2FVQ A;  1TL4 A;  2LQ9 A;  4ILR A;  4ZVT B;  1X8D A;  1OS5 A;  4IFV B;  4ZCI A;  1L3K A;  1R8P A;  5CYM B;  3D0I E;  1KTQ A;  1TKZ A;  4DPY A;  4ED4 A;  5HQM A;  5LSR A;  5E3Q A;  2XG8 A;  3BO2 A;  2BR0 A;  1TVR A;  1MN7 A;  1RWN B;  4ZK7 M;  2B4V A;  2DNN A;  2GW8 A;  4HT5 A;  1CJT B;  2B9E A;  2HS0 A;  4CLL A;  2OPS A;  1DAR A;  3QT7 A;  2E29 A;  2YNH B;  5T41 A;  1X4G A;  1RWX B;  1MN9 A;  3EIC A;  2GO8 A;  3D3C J;  3MR7 A;  3OQ2 A;  2UUB J;  3KUG A;  2HFZ A;  3CCL S;  1QSL A;  4ZVO B;  1Y10 A;  2AJ1 A;  2DBB A;  3MDF A;  4CO1 A;  3BKU A;  3CCM S;  2PFF B;  1KQS R;  2JJ4 D;  4DUZ J;  1U8S A;  4M5D A;  3M9M B;  4PR6 A;  4JI3 J;  1RCO B;  2CJ9 A;  2DNP A;  3NNH A;  1PJ5 A;  1RTZ A;  2HNY A;  5IQ6 A;  2OML A;  4PXB A;  2ALZ A;  5HVF A;  2D3Z A;  3OTO J;  2Q3P A;  3KK2 A;  1X9W A;  1V3Z A;  4LFB F;  1RA6 A;  2AV5 A;  4RNM A;  1HFE L;  4ED2 A;  1S76 D;  1WKL A;  5D8H B;  4PCQ A;  2UXC J;  1LWF A;  1VGY A;  4NZ7 A;  2EFG A;  2E7V A;  1UFW A;  1PYS B;  2QLW A;  4ZIV A;  2KL8 A;  4WBF A;  2VPX B;  2KG0 A;  2CQH A;  4P52 A;  4ES3 A;  2OMO A;  2VC1 A;  4IG3 B;  1X4A A;  4UW2 A;  1YJ7 A;  3L7U A;  3CXC R;  3NCR A;  5HVG A;  5IWA F;  3HDS A;  3BKF A;  1D1U A;  4WZQ A;  2O3D A;  3UNY A;  1S9E A;  1OMS A;  2F5G A;  1YIJ S;  3DRX A;  3CJK A;  2JOQ A;  3KJN B;  4Q5V A;  1YIT S;  4MKA A;  2D9O A;  3CJR A;  3MEE B;  4M1K A;  2DXE A;  2YVS A;  1R7I A;  3TQ1 A;  4WJB A;  4WXW A;  3QGP A;  4DUY F;  4B3O B;  4AFF A;  2VFV A;  1VJW A;  2IVM A;  3OLA A;  2ZH7 A;  4IH7 A;  4DL6 A;  4DR2 J;  2VA2 A;  3KLE B;  5J2M A;  4YR2 A;  1TL5 A;  4PQU B;  1PG5 B;  3AB4 B;  4NA3 A;  4RW6 A;  3DRY A;  3FZ2 A;  5EWF A;  4C9D A;  2G9O A;  4B3R J;  2WCX A;  4I2Q B;  2N3O A;  5KTQ A;  1JJ4 A;  1FKA F;  2XMJ A;  2ZHA A;  4Q8F A;  4YOE A;  2NZC A;  4C8K A;  1CLF A;  1FNX H;  3P8B B;  5H9F J;  5A8R B;  2VA3 A;  2DHG A;  1IBC B;  3BR9 A;  1MU2 B;  1VMB A;  1PBA A;  3NL0 A;  2YKA A;  3UCG A;  1U4B A;  4KKO A;  2BM1 A;  3HF5 A;  1FDB A;  2BAN A;  1QVF R;  3DDN A;  4LSN A;  1LWC A;  5LJ5 Y;  3SDE B;  4FPI A;  2DNR A;  2MLY A;  2IM0 A;  1HPZ B;  2CJX B;  2LQJ A;  2GAH C;  2ZKT A;  3I87 A;  3PEH A;  4PXE A;  3ZTQ A;  3D2W A;  2B4U A;  1U49 A;  3WQP A;  2DR7 A;  4PWD A;  3H98 A;  3HMJ G;  3FBF A;  3R5C A;  4ID5 B;  3P49 B;  2MKJ A;  2YNG B;  1U48 A;  4F4Z A;  3V6D B;  2W9C B;  4MMO A;  2FHJ D;  3IAS 9;  3MEE A;  1DTQ A;  1ZYQ A;  1RU2 A;  5AE1 A;  3HKZ D;  4JYA F;  2X3G A;  1WSR A;  3AD9 C;  3TUP A;  3JSB A;  3T1Y F;  4NXN J;  1HD1 A;  2RU9 A;  4Y65 A;  3A3P B;  3D67 A;  1M5K C;  1RIS A;  4O0N A;  3EYZ A;  4GO7 X;  1RAI B;  2DNM A;  5DQG A;  1RYS A;  3GYN A;  2HK2 A;  1WF0 A;  3AD7 C;  1TK5 A;  2J8A A;  3CUL A;  1XMQ J;  2EXU A;  1XNR J;  1S6O A;  2MKS A;  3C16 B;  1RAD B;  2BW7 A;  3PJX A;  3I0R A;  4FF3 A;  5IT9 Y;  4Q8E A;  4G65 A;  2XMV A;  4KPC A;  4Q2L A;  4DPU A;  5D78 A;  5K9F A;  4OX9 J;  1Q4R A;  3M2U B;  3VQS A;  1VQN S;  3MHY A;  1H7X A;  3MR5 A;  2MB0 B;  3L3C A;  4DR1 F;  1F2G A;  5E7O B;  3E8O A;  2BUN A;  3VAK A;  4DF8 A;  2LDI A;  2VFU A;  2JWN A;  3CJ4 A;  3TYT A;  3QNW B;  3BGR A;  3O8W A;  4NLV A;  4ECS A;  3FK4 A;  2HK3 A;  1UVI A;  1M1H A;  5BJR A;  4M5L A;  4E0D A;  2AJ4 A;  2CYY A;  5FDL B;  3TUJ C;  5A2Q U;  2YNG A;  1EKS A;  1VQ5 S;  3HD2 A;  2RQK A;  1C0T B;  2V8D A;  4X66 J;  5J2N A;  4HVZ A;  4F67 A;  4C8N A;  1K9M T;  2XS7 A;  2HYI B;  3I96 A;  2P9C A;  2MY8 A;  1WAC A;  4Z37 A;  3EZ5 A;  2XGQ A;  1TVR B;  2UVV A;  2KZZ A;  2IA6 A;  2XMM A;  1RYR A;  5HN0 A;  2VUG A;  2C3Y A;  1KQG B;  1SQE A;  2DNL A;  4QIG A;  1GAO A;  4URS A;  3DMJ A;  2OJ3 A;  3UCZ P;  3MM7 A;  2MST A;  3DRS B;  2WOM A;  2CQP A;  1B0T A;  3D7S B;  3T41 A;  2FC8 A;  5EGY A;  4LR7 A;  1QAI A;  4CO2 A;  5ETS A;  5KFX A;  3ZTO A;  2HLT A;  3ILJ A;  5KG6 A;  6AT1 B;  1I94 F;  3JS9 A;  4X4N A;  3RU0 A;  1FRK A;  1NLK L;  2FJE B;  3MUT P;  2K1R A;  4OIX A;  4HDG A;  1KHV A;  1U6Z A;  4CLY A;  4F04 B;  1I94 J;  2RDJ A;  2I5J B;  2RD5 C;  3GSI A;  4ZCM A;  5ETR A;  5GAD I;  1GX5 A;  2R8G A;  4KB7 A;  4KH0 B;  3MPD A;  4ZMM A;  1OYE A;  4CCH A;  3U1L A;  1DQ8 A;  2Q1L A;  2XLJ A;  1RSC A;  1RQ0 A;  1YGY A;  2ZOG A;  3DOK A;  3VCD A;  1JNZ B;  1SKR A;  1D8Y A;  2YKQ A;  2Q66 A;  2BE9 B;  2HFS A;  3W62 A;  1R3N A;  2Q6C A;  5DG9 A;  1YRU A;  2A18 A;  2DIV A;  3DYA B;  3T9N A;  3ZNU A;  1TL3 B;  4D3G A;  1V9O A;  2A10 A;  2ZWO A;  4HHH A;  4YB1 P;  2PT0 A;  3KHR A;  3GB0 A;  2FVR A;  2R2T A;  1H72 C;  2PO4 A;  5LSL A;  1HWU A;  3RJM B;  2JLG A;  4X66 F;  1UTA A;  5KFD A;  4LSN B;  1RU1 A;  3AQP A;  2KKH A;  2AGQ A;  5KG1 A;  2OD6 A;  3P5B P;  5HRO A;  3DC2 A;  4FN5 A;  3MM7 B;  2ZH1 A;  4LF2 A;  2HRT A;  5JVH Q;  4IOC Q;  5HMY A;  5MLC V;  2KRR A;  2WK4 A;  2HZV A;  2NPF A;  2COL A;  4ZLP A;  4XO0 A;  2GHV C;  1AXQ A;  3AFG A;  3LGH A;  5I3Q A;  4EYI B;  4QOT A;  2W9C A;  3DRR B;  1UWB B;  2HUR A;  2A6O A;  4IR9 A;  3J80 U;  1HKA A;  2YX1 A;  5DLF A;  4X4O A;  4A8K A;  2PGC A;  3ITH A;  2M9K A;  2YKO A;  1PC5 A;  3KFW X;  3JQK A;  4UOF A;  2ZHB A;  3W8P A;  1RHQ B;  1XMQ F;  1XNR F;  3H20 A;  4L74 A;  4ZHR A;  1IJF B;  2RE1 A;  3M32 A;  2ADB A;  5THW A;  1AUD A;  3KK3 B;  1LQ9 A;  2CNN B;  1J5O B;  3I9V 9;  3EZU A;  2BAN B;  1AT1 B;  2BRK A;  2ZHO A;  3QSY B;  2BVZ A;  5GMK a;  4DX7 A;  4N47 A;  3CTR A;  3OT9 A;  4DR5 F;  3T1Y J;  4NXN F;  1G4C A;  1F9E B;  2HNZ B;  3NNA A;  4JYA J;  3K7R A;  3SCI E;  2AYG A;  5IZH A;  3M8P A;  3V4I A;  1KEK A;  4TYA A;  4O4G A;  1KQF B;  2DH9 A;  2SXL A;  3HSZ A;  4ALZ A;  3BSO A;  4DL5 A;  1S10 A;  3MM8 A;  4NCG B;  1LNQ A;  3SSR A;  4LR8 A;  4O44 B;  2CVI A;  1ZZN A;  1U2F A;  4OYA A;  2DRD A;  3MM6 A;  4YDX A;  2DNY A;  4M5M A;  4USU A;  2XYG B;  2K7K A;  1MLA A;  2O1P A;  4ECR A;  2ZBI A;  4W92 B;  4ZA1 A;  1YLX A;  3V6D A;  1VC0 A;  2N3L A;  1NAQ A;  4P2X A;  3D68 A;  3GV7 B;  3P6Y C;  2L9N A;  4A8O A;  2AP6 A;  4ZVR B;  4MKV A;  2MJN A;  2DHX A;  2RVJ A;  1FK9 B;  1WOO A;  3O2I A;  4OYM A;  3DU5 A;  3QWU A;  2MKY A;  1FFW B;  3MM8 B;  1TFW A;  4NYO A;  3SDE A;  2OEK A;  2DNO A;  2AGO A;  2XO7 A;  2RHS B;  4B3R F;  5HVH A;  3MMA A;  3J81 j;  1XR5 A;  1DJ0 A;  1WC0 A;  4YS2 A;  3FGV A;  2IJR A;  5F8L A;  1HNV A;  4MAK A;  3OTB A;  4DR2 F;  3I0R B;  3NGT A;  3A12 A;  1QAX A;  1C1C B;  2W7A A;  4FS1 A;  2B5J A;  4DUY J;  3QQC D;  5D0E A;  5I3P A;  1LWE A;  3CCJ S;  4IRK A;  5IT9 U;  2FTR A;  2FY1 A;  4BDP A;  4K4V A;  1JLF A;  2NQP A;  2VFT A;  2UV8 A;  1RCX B;  4CH0 S;  4F4K A;  4F0M A;  5A6P A;  1ZA2 B;  2NXN A;  3DDK A;  3D6F B;  5IWA J;  4J9Q A;  1FKO A;  3OFH A;  4XPC A;  3W3S A;  1YRT A;  5AXL A;  1EP4 B;  1GMV A;  3DOK B;  4UOH A;  3X1L B;  3J7Y U;  3U02 A;  2JDJ A;  3CCQ S;  1AUS L;  1FEE A;  1OQ6 A;  2Y1L B;  2CWX A;  2MHN A;  1NB7 A;  2UXC F;  2VG7 A;  4H54 A;  3MFI A;  1DRZ A;  3OTC A;  4YP3 A;  3DRP A;  4LFB J;  1UVM A;  2JHE A;  3WHI A;  1BXN A;  2KRB A;  1N5Q A;  3OTO F;  3MR6 A;  1OY8 A;  1CPZ A;  3K5O A;  2D41 A;  3WBZ A;  3ELH A;  1S0V A;  1NH7 A;  1JLG B;  1K0T A;  2XC9 A;  1KOO A;  4NLX A;  4JI3 F;  3UVJ A;  1K1Q A;  1RBO B;  2B4O A;  2OPS B;  4RX6 A;  1FNM A;  2ZEJ A;  4WFZ A;  4KYZ A;  5H1S V;  1R0B G;  3C2P A;  4DUZ F;  1WC5 A;  1F1B B;  2IC3 B;  4KGK A;  3CD6 S;  1T9W A;  5FLX Y;  1C0U A;  5IXU A;  4FYV B;  2B8Q A;  3J7A 1;  1RHJ B;  4IOA Q;  2AF6 A;  1EHW A;  2IDE A;  2AX1 A;  2KHD A;  1YX2 A;  2UUB F;  1G3O A;  3TVK A;  3S1T A;  1DFD A;  3AQO A;  3CD0 A;  4D3H A;  2VFR A;  1DTT B;  4DPW A;  4F25 A;  3OXF A;  4J9K A;  2LEB A;  5IOL A;  3HZG A;  4X4R A;  1FDD A;  4EMD A;  2IM3 A;  4ZOS A;  1NJI T;  2IPO B;  4E8U A;  3KLF A;  4K4T A;  5KFL A;  2XMK A;  4KC5 A;  1B7Y B;  4DLE A;  2I6W A;  4RW4 B;  3H8Y A;  2BKP A;  1GK8 A;  4B02 A;  2K3K A;  1YZ6 A;  1QLN A;  2CPD A;  2JEJ A;  4U8V A;  4LSL A;  3NMR A;  1JQG A;  2FDN A;  1CS4 B;  2ZM6 J;  1VQS A;  3DXB A;  4WTY A;  3W60 A;  4F0H A;  4YHH J;  3UD4 P;  4DR6 J;  1C1B A;  3G87 A;  1GT8 A;  1HBU A;  1NU4 A;  4G6V B;  4C98 A;  4USM A;  4ZPW R;  2A2D A;  3DLJ A;  3G2X A;  3EMT A;  3N01 A;  3O44 A;  4IQM A;  3VTI A;  3IA0 A;  4C3M A;  4JI1 F;  3L09 A;  1R8A A;  2QT7 A;  1W7W A;  4ELV A;  3NGK A;  2IMW P;  4FBU A;  3GV8 B;  1RWK B;  1WI6 A;  2W4C A;  3M8Y A;  3MM9 A;  2K2P A;  4FDF A;  5J2Q B;  3PW7 A;  1QAJ A;  1PIE A;  4FF2 A;  1VHF A;  1EAY C;  1FRM A;  1UMJ A;  4Y0F A;  1WF1 A;  4RWW A;  4DFP A;  4W90 B;  1RTH A;  4ZDN A;  2R8I A;  1WTF A;  4DU8 A;  2ZFH A;  2E1M C;  3ZTR A;  3MTJ A;  4QR2 A;  1RA7 A;  1YBA A;  2EKY A;  2WW8 A;  4LF1 A;  4RR5 A;  4XK8 C;  4DBQ A;  1Z1Z A;  3PJ9 A;  1VQK S;  3DM2 A;  8AT1 B;  1O5J A;  4IQX A;  4K50 A;  1BQM A;  3BEG B;  4LT6 A;  1YDL A;  1REG X;  3I0S A;  2V8G A;  2QJ3 A;  3R7S B;  2QL7 B;  3RW7 A;  3S6E A;  2ZBR A;  1UJ4 A;  2F9J A;  4FVM A;  1ZM4 A;  2ZOM A;  3UN2 A;  4CT8 A;  2VQF F;  1RKI A;  4ZCK A;  4DQP A;  4DSK A;  3BGO P;  5KFV A;  3M2R B;  3CJT A;  3LP0 B;  2DGT A;  2VL1 A;  4NCG A;  4S0M A;  4LFA F;  3JTN A;  4RNH A;  2ADC A;  3H2L A;  2M0G B;  4O4G B;  1UJ5 A;  4L72 B;  2VB6 A;  4ZJQ A;  1VK8 A;  2AYB A;  2OP5 A;  4PAA A;  3SFU A;  4FZV A;  1YVF A;  2E1P A;  2F4F A;  3NWR A;  4ECW A;  2KVQ E;  1WOS A;  2WVD A;  2KT2 A;  2YPY A;  4J9V A;  4CNZ A;  4UOC A;  5DGA A;  5ETV A;  1J5O A;  1KBR A;  2RSQ A;  5A8K B;  3CO0 P;  3B4M A;  4KGZ B;  4WIQ A;  1RAJ A;  1UZH A;  1PC4 A;  1KDN A;  4KO0 A;  5HSP A;  2AJ0 A;  4RNF A;  3S8S A;  1WJ9 A;  4NZ6 A;  1O0P A;  2O01 C;  4DPX A;  3JYT A;  3HM9 A;  3AD8 C;  3R2D J;  3ZZZ A;  2OLW A;  3OFG A;  3IGN A;  5KFZ A;  4DX5 A;  2YH0 A;  4N56 A;  4DSE A;  5HJY A;  1S1W B;  2ZUG A;  3CME S;  2ZD1 B;  4EO6 A;  2V9W A;  1JWW A;  1FT8 A;  3GII A;  2WSF C;  1N6Q A;  2C42 A;  3T1A A;  3MUM P;  3TZW A;  4YQW A;  2OPR A;  5D4O A;  3CCZ A;  1N32 J;  2BW2 A;  3SCJ E;  2VZ9 A;  1RT1 B;  2LKZ A;  1FX4 A;  3OXG A;  5M2R A;  3BF4 A;  3H90 A;  1HYS B;  2D74 B;  2KXF A;  3THV A;  4DS4 A;  3MAH A;  2ZJP Q;  3MMB B;  4QYR A;  5C24 A;  4IH5 A;  3RRK A;  1OQ3 A;  1JLE A;  3M6W A;  3ZZU A;  5H9E K;  2I1R A;  4OL8 A;  2H4Y B;  3T5K A;  1TAU A;  3S01 A;  1B70 B;  4WP9 A;  3CD5 A;  4P6Q A;  1HBO A;  3CPW R;  2LEC A;  1H2V Z;  2F7V A;  4UQT A;  4CI0 B;  1CQN A;  1M5H A;  2AHO B;  3FQL A;  5IT4 A;  4DV1 J;  4FNI A;  2M2B A;  1TV6 B;  2MQ8 A;  3UCU P;  1N8R T;  1QUV A;  1IKY B;  4FPR A;  5ETT A;  1NUE A;  5EUH A;  4JI0 F;  4CLK A;  5C7P A;  2ILY A;  3DCA A;  2OD4 A;  3EUN A;  3MCS A;  4EGL A;  1R0A A;  3OVS A;  3OL7 A;  2DK2 A;  2ZBQ A;  4TYB A;  3Q23 A;  1U2C A;  5DET A;  3VAJ A;  2EK1 A;  3SCK E;  1TK0 A;  2OAU A;  4B9L A;  3CDU A;  1CQM A;  4DX8 H;  4DDF A;  1FE0 A;  4C8L A;  1MW7 A;  4DSJ A;  4LF4 J;  3O1L A;  1VBK A;  3KTQ A;  2YNI B;  4GVB B;  4IFY B;  1SJF A;  1S0O A;  2IC3 A;  4ZJL A;  3W9J A;  3P3D A;  2NXE A;  5IC6 B;  1GMW A;  5E3C A;  3N5B A;  4YN3 B;  4ECQ A;  4JI4 J;  1T05 A;  4NE9 C;  4AND A;  4QR1 A;  4NXM F;  3T6J A;  1CBK A;  1GMU A;  1SC4 B;  2IIH A;  4CQ1 A;  4C0O C;  2FHM A;  3CSK A;  4B17 A;  3RB6 A;  2GZO A;  1SC6 A;  2MZT A;  4K5S A;  1LEO A;  3EPG A;  3TA1 A;  4EEY A;  5K8P A;  4DR4 F;  3R5B A;  3GV5 B;  3I5C A;  4L73 A;  1NJZ A;  1Z2Z A;  2WON B;  1T03 B;  1CUL B;  1U0S A;  4E98 A;  4AQY F;  2HHH J;  3PO5 A;  1NBE B;  2B4P A;  1TUG B;  3N6L A;  3H4B A;  2QLJ B;  1RBA A;  1KNZ A;  1NH8 A;  2RH3 A;  4LR9 A;  2M70 A;  1R0C B;  3IWX A;  1RT3 B;  1LFP A;  1WC3 A;  4NAS A;  1IVZ A;  1MRO A;  3NWG A;  3GLJ A;  4QIE A;  5F0U A;  4WE1 A;  3W5Z A;  1J27 A;  5J2Q A;  3JQJ A;  2DR9 A;  1AZS A;  5K8M A;  2MQO A;  2JC1 A;  3TEG A;  1CC8 A;  3DGP B;  2W8K A;  3M6V A;  2Y0S D;  3H42 A;  4ZIW A;  4K4U A;  2GVD B;  5DM6 Q;  2FJD B;  3VGU A;  5IM0 B;  1PAU B;  1RAO A;  3ISN D;  4IDK B;  1AW0 A;  4X62 F;  4N77 A;  2IBO A;  2QE5 A;  2L08 A;  4KGM A;  5LOQ A;  2E66 A;  4URQ U;  3BR8 A;  3DI6 A;  3FSY A;  4Q7A A;  3EXC X;  1UVL A;  2LMI A;  3Q24 A;  3BQ0 A;  1QTM A;  3FQK A;  3DM2 B;  4WE1 B;  5B0G A;  2OPP A;  1WEL A;  2DRA A;  1JKH A;  2HFU A;  4I0W A;  1NPR A;  1IWG A;  4F4X A;  3TJA A;  2ZH9 A;  4WXO A;  5LL6 d;  4RBU A;  4RW8 B;  2QFJ A;  4ICL B;  1H38 A;  3NKY A;  3MPW A;  1H3D A;  2YX7 A;  5FD1 A;  3C14 B;  1VRU A;  3TA2 A;  1FER A;  3IR5 B;  1GEH A;  2ZVS A;  1U8W A;  5J1N A;  4OZ3 A;  2WZ1 A;  3NCQ A;  1G1X A;  1WG1 A;  4X4T A;  5L39 A;  1GQE A;  2C3P A;  3VZI A;  4IO9 Q;  2QL5 B;  3OL9 A;  3MMA B;  1KP6 A;  1HYS A;  1F3F A;  3TJ8 A;  1RT4 B;  1SVD A;  1D3W A;  3BGL A;  2QMW A;  3DKD A;  2XNR A;  1C4C A;  4WKR A;  2NLW A;  3N9U C;  2R3V A;  1IQZ A;  1ROF A;  1XER A;  3HVA A;  4NYP A;  4NRU A;  3VAM A;  5B0F A;  1TEL A;  2VFS A;  4OMF G;  4JOU A;  3DGV A;  4C3L A;  2GFF A;  2HLU A;  3DOM A;  4K4W A;  1GFW B;  2EEY A;  1JLB B;  2VF3 A;  3B4D A;  1D9D A;  4FF4 A;  4C4W A;  1APS A;  3BKT A;  1JNR B;  3O3L A;  3DHW C;  1HHQ A;  3X3U A;  5FLX U;  1RWP B;  1RTI B;  2PMW A;  1WEX A;  3KLE A;  4CNY A;  4PQU A;  1KWM A;  4EZ6 A;  4QWB A;  8RUC A;  2C3M A;  5T7L B;  1SCJ B;  2XSF A;  3ILL A;  4L6V 3;  2ZH2 A;  2CPH A;  3FEX B;  3VGS A;  1EB0 A;  4MYU A;  2N7Y A;  2CA9 A;  2GNK A;  3CF5 Q;  4KQZ A;  1QE1 A;  2WVE A;  1IKX B;  1L5U A;  1O8B A;  1ZET A;  2B5J B;  3MCO A;  1JLA A;  1NDP A;  1MU2 A;  2RQC A;  5D4L A;  1SQG A;  2M5Y A;  2MQM A;  4DV7 F;  1HNV B;  4N8N A;  5B0D A;  2VIC A;  1VQL S;  2MGZ A;  3DDI A;  3I56 S;  9RUB A;  3M7V A;  1GNK A;  2ZDP A;  3JB9 k;  1IWA A;  3K8V A;  3TUI C;  4IG0 B;  1U1N A;  2CZ9 A;  2JVO A;  2LU1 A;  1JB0 C;  3M8W A;  4P2S A;  3SXL A;  1XMO J;  2Q43 A;  2Z58 B;  2DNK A;  2K3I A;  3M9N B;  3QJJ A;  1JX4 A;  1D09 B;  3UNG C;  3H4D A;  1IKX A;  3IG1 B;  5E3R A;  2GJI A;  4JI2 F;  2DO0 A;  3QRQ A;  3NP5 A;  4LJM A;  4O4R A;  5DDR C;  4NEY A;  3W8G A;  4R0J A;  1ICE B;  3FRZ A;  1F5A A;  4K7Q A;  1KVI A;  3MWB A;  3L7P A;  3IBF B;  1S1V A;  1F3V A;  2PC6 A;  3R6G B;  4DR3 F;  4ED6 A;  2Y1J A;  5GMD A;  1HNZ J;  3HD1 A;  1HWK A;  5ETO A;  1RTI A;  1Q53 A;  3GE9 A;  1M5V C;  2QGF B;  1V5V A;  1LW0 A;  1WDT A;  1HI1 A;  3ZC4 A;  4YUD A;  3F56 A;  4IR1 A;  2AQ4 A;  2JFD A;  4ILM A;  1CC7 A;  3AHP A;  2UUC F;  5GAG I;  1WHY A;  3O5T B;  2EG2 A;  2HVI A;  1Y7P A;  3PXG a;  2ZC4 A;  1S1U A;  4DLG A;  2FJW A;  2X1A A;  2OEJ A;  1AA1 B;  3US5 A;  3LPY A;  1TL3 A;  3J7Y I;  3BB5 A;  3PKM A;  4LIR A;  2VON A;  5HP1 A;  4HTI A;  1HQE B;  2G1D A;  2W25 A;  2EG1 A;  2E1C A;  1R6Y A;  1NKE A;  4DJB A;  4LQ3 A;  1LW0 B;  1JLQ A;  4BHQ A;  3NMA A;  2MKH A;  1UCN A;  1LW2 B;  4NX9 A;  1KFD A;  3DXS X;  3MAQ A;  2F3J A;  2IM2 A;  1Q79 A;  3J7A N;  3MCM A;  2ASD A;  1MWQ A;  3MR2 A;  3H5Y A;  3PV8 A;  5F8N A;  3KXD A;  2Z2Z A;  1B3T A;  5DGB A;  1C0T A;  3FBC A;  4Q43 A;  1T0T V;  3QWP A;  1Q5Y A;  1RE1 B;  2EFN A;  2XUL A;  1UEU A;  3M30 B;  4PKD B;  2HFO A;  4C0B A;  1X4E A;  1NPK A;  3MEC A;  3W2V B;  2DPI A;  4LF8 J;  1NM2 A;  2BJ3 A;  3B82 A;  3CDW A;  3I5B A;  2Y1R I;  1T7P A;  4DWI A;  3BS9 A;  1KTV A;  2MZQ A;  4JP8 A;  4DV3 F;  1LFW A;  4WFX A;  1LW2 A;  3VAH A;  2DRB A;  1KD1 T;  2QA4 G;  1SKS A;  2UV8 G;  1UPM B;  1TL1 A;  4CO5 A;  4F50 A;  2QG9 B;  3CB4 A;  3DLK B;  3QAU A;  1X9S A;  4CLW A;  3PG9 A;  3UW1 A;  4NA1 A;  3VR1 A;  1FDA A;  4ECX A;  2JLE A;  3AB2 B;  2YH1 A;  3GJT B;  1AFI A;  4M94 A;  1T02 A;  5EWG A;  5F0W A;  1B0V A;  1TAQ A;  2BMB A;  3TJ9 A;  3ULH A;  5I42 A;  3CT9 A;  4PPD A;  5F9L A;  1VQ8 S;  3FBB A;  2E7W A;  2MQL A;  1FKP B;  3SBM A;  2JSX A;  1F9H A;  4WZM A;  4IH6 A;  1NHU A;  2R2U A;  3KLG A;  3LTO A;  2FHK A;  2CJA A;  5KG3 A;  3CMA S;  3IXQ A;  2H5E A;  2N4C A;  1U0H B;  1K8A T;  1U25 A;  1TL7 B;  3EDQ B;  3LOU A;  5EHH A;  3CJ8 A;  2PI4 A;  2C2N A;  1JIH A;  2IJF A;  1D0E A;  1E6V A;  3SYZ A;  2PEH A;  1SQF A;  3VF0 B;  1VQM S;  3FKB A;  4YB5 A;  3T1H J;  2ZWP A;  3TOQ A;  3W5X A;  3ZNJ 1;  4C8M A;  3QRP A;  3HUL A;  1FHT A;  4O3O A;  1HMV B;  1Y11 A;  1SH0 A;  2VBW A;  2Y8W A;  2V8V A;  3OXL A;  3CC7 S;  4B3M F;  1S7I A;  2C22 A;  2WB4 A;  4C48 A;  3AT1 B;  3EZO A;  1JLF B;  4K2J A;  2GX8 A;  3CDE A;  3RRG A;  1KLM B;  1RAC B;  2FYX A;  4O23 A;  4OHV A;  3SSS A;  2J5A A;  3QFW A;  5HBM B;  3G8S A;  4I6A A;  4J9L A;  2VPY B;  3CJ5 A;  3PX0 A;  2C2R A;  1SI9 A;  4Y28 C;  3ZZP A;  1S49 A;  2CAJ A;  2QYG A;  3VAF A;  3LF0 A;  3ZZY A;  2H4W B;  1R8C A;  3GCX P;  3CC2 S;  3EGZ A;  3KOA A;  4ED7 A;  1HWL A;  2A2C A;  1VQ4 S;  4M5N A;  2RDI A;  3VZH A;  4AUK A;  2V4R A;  2CQ4 A;  4C11 B;  4MTP A;  4TVA B;  2GGP B;  2KU7 A;  4H4K A;  3F0N A;  1N5V A;  2CQ1 A;  2QSF A;  4CH7 A;  2GQQ A;  3Q8P B;  3NG8 A;  2DB1 A;  3C66 A;  4X4S A;  2YWK A;  4NEZ A;  1Y3K A;  4F4Y A;  2IYG A;  2MTL A;  1L3U A;  2HMI B;  3H5X A;  1JJ2 R;  1HPZ A;  2HFV A;  2RS8 A;  2DT9 A;  1RUS A;  2XZW A;  2FB0 A;  2WSC C;  3H59 A;  3QAT A;  1Q82 T;  1R27 B;  4UY8 5;  2EBG A;  2CQG A;  2QO3 A;  3TZZ A;  1OJ4 A;  3MD3 A;  2VG5 B;  3EXY A;  3Q8U A;  4IYQ A;  4RUA A;  2Z2L A;  3KNG A;  1RI7 A;  1RT1 A;  1MWY A;  1X60 A;  2ATL A;  1FF2 A;  2BYC A;  3VHQ A;  3A1Y G;  3ZTP A;  1CJV B;  1HNI A;  4DV0 F;  2E5H A;  5CYM A;  4I68 A;  4ECU A;  2AJQ A;  3KLH B;  2ZE2 A;  1VQ9 S;  2HG4 A;  2HND A;  2YWW A;  4MK7 A;  2XSJ A;  1VLO A;  2MPU A;  2FGO A;  3FC9 A;  4KAI A;  3GIJ A;  2DHA A;  3I9Z A;  2F40 A;  1AB8 A;  2BE7 D;  2LQ8 A;  3IMQ J;  2E5J A;  1XEZ A;  2WTF A;  3VVU A;  1ITP A;  1R31 A;  3PW4 A;  2RJZ A;  3CDA A;  4DL0 C;  2MQN A;  2J9D A;  1Q7L B;  1TV6 A;  4KO0 B;  1VQY A;  4P71 A;  2W2N P;  3NGD A;  4DFM A;  3W2W A;  2FVC A;  1WG4 A;  3T5H A;  2CPE A;  4KH1 B;  2MQQ A;  1SL1 A;  2YWE A;  3SI8 A;  3SZ2 A;  2MKI A;  1LV5 A;  2MKC A;  2XHW A;  2W01 A;  2R7W A;  2V50 A;  5F8M A;  4NCA A;  5KFJ A;  1NK4 A;  4C8Z A;  3TUZ C;  2UXD J;  3N4W A;  1UVJ A;  1NPP A;  1EQM A;  1WHV A;  1EJ7 L;  4WFY A;  4CO0 A;  4YR3 A;  3EVM A;  2CNL B;  2Y3Y A;  4WYL A;  1X5O A;  1RAA B;  5LXY A;  1GX6 A;  1KHW A;  1RAB B;  3D54 A;  2RRB A;  4K59 A;  4DR7 J;  1OPZ A;  1JJC B;  4C8O A;  2XYP B;  1S1U B;  3OJU A;  3C15 B;  4CH1 A;  2OO4 A;  3H5U A;  5D6G A;  5KFG A;  2RUG A;  3OJS A;  3BSA A;  3IRX B;  3ETO A;  1EZZ B;  2DNZ A;  2IM1 A;  2J9D E;  4OI3 A;  1YJ9 S;  2V0N A;  3OTD A;  4OQJ A;  2Z0G A;  3GSD A;  4U8Y A;  4LF7 J;  1X0P A;  4PG4 A;  5MAO A;  2QMX A;  1UP1 A;  4EUV A;  2W2Q P;  3VQT A;  3W66 A;  1IBL J;  4TY8 A;  2D3O R;  1SC3 B;  3DOL A;  2V67 A;  1VOM A;  4Y2K A;  3L4B C;  3SFG A;  1HWI A;  5H9F K;  3NLC A;  4DPT A;  1FJG F;  1EKR A;  4QCL A;  1V3R A;  3BZQ A;  3MPY A;  1E6V B;  2B8P A;  2PE8 A;  3M30 A;  4OHW A;  4NPO A;  4H4M B;  3SIP B;  2F8H A;  3PHT A;  1LK5 A;  5J2M B;  1X0F A;  3IFE A;  1UPP A;  4QU6 A;  1NHV A;  3ADA C;  4FYD A;  3TAM A;  3THP A;  1YK9 A;  3GIM A;  2FVS A;  3DLE B;  5IC4 B;  2QRR A;  1YJR A;  2QYC A;  3BN7 A;  3MR3 A;  2BQ3 A;  3CDB A;  1XNQ J;  3IM8 A;  3E01 A;  3ZZ0 A;  2Z4P A;  3T9Z A;  1UZD A;  3PAC A;  3CJK B;  4DS5 A;  3D1Q A;  4ITS A;  4XIU A;  5CZV A;  1TMJ A;  2FPH X;  3BPS P;  5I42 B;  4NZ0 A;  1T94 A;  1YHQ S;  1K1S A;  2CXE A;  1C0U B;  3QO9 B;  4MJK A;  1VK3 A;  3QRR A;  5EX3 A;  3PX6 A;  1RT2 A;  1P6T A;  2M8H A;  3EDR B;  2C2K B;  2MY7 A;  3AA8 A;  5B0C A;  5C42 A;  2J7U A;  4ZPT R;  3BRE A;  3QAE A;  1YJU A;  1C4A A;  4EI2 A;  2UVR A;  2KO1 A;  3U1M A;  1NKC A;  1HR0 J;  3BPD A;  2R2R A;  4RKU C;  1SBR A;  4DFJ A;  2PA3 A;  4J5O A;  1GMW D;  4WP3 A;  1BMQ B;  4R0E A;  4OZN A;  1GH8 A;  4A8X A;  1S72 S;  2CFX A;  2CPJ A;  2G2Z A;  3DRR A;  3EX7 B;  1JLB A;  1H2T Z;  3HJF A;  4ZJO A;  5KFK A;  1SXL A;  1VFJ A;  2MSS A;  5M2U A;  2L9W A;  2XY6 A;  5BR8 F;  3W61 A;  1NK7 A;  3D4J A;  2HIY A;  3PCO B;  4UF4 A;  3CD7 A;  1FRX A;  2V6A A;  4Q45 A;  4EZ9 A;  3HT3 A;  4CRJ A;  1XWL A;  1IKV B;  3AJ2 A;  3AOC A;  1QTN B;  4ZVS B;  5B7W A;  2G13 A;  3CCU S;  1N36 F;  4PQA A;  1YBT A;  1A0O B;  4DG1 A;  3GP9 A;  2CKW A;  1RBL A;  2N7C A;  1U09 A;  3GR0 A;  5I3U A;  4JV5 F;  1RGV A;  1WC1 A;  2HVE A;  3AXK A;  1LK7 A;  2A0F B;  2W4P A;  3B6B A;  2HKE A;  1IBM F;  1Y4Z B;  2IJN A;  3PRB A;  2PD1 A;  3AOD A;  4GRS A;  1N48 A;  2KDO A;  2Y0B B;  4N76 A;  2F4V F;  3Q8Q B;  4KJI A;  2ROE A;  4A8W A;  1WKJ A;  7FD1 A;  4C3K A;  5KOW A;  3CE8 A;  3LGM A;  2E5G A;  4F26 A;  4TU9 A;  4OJ1 A;  2CJK A;  2G4B A;  2V2K A;  2VOP A;  2JX2 A;  1HAR A;  2YTC A;  1AZS B;  2ZZT A;  3ISN C;  3DLG B;  1WKK A;  5BYQ A;  3I5A A;  2XLI A;  2ZH8 A;  4WK3 A;  3SV3 A;  2QEX S;  5D15 A;  5J2P B;  3Q2T C;  1RK8 A;  2DEJ A;  2J7K A;  3K5P A;  4I6Y A;  4PYA A;  3SQO P;  3V81 B;  2HW3 A;  3A8K A;  1NO8 A;  5CYQ A;  4U9R A;  1T8E A;  1NND A;  1IJE B;  1JLE B;  1OYD A;  4DZD A;  1IBK F;  2AT1 B;  2J8S A;  4DV5 F;  3KHH A;  1URR A;  5AXK A;  2M8D B;  2E5L F;  3LWM A;  3DI6 B;  2APO A;  5A8K A;  2FZK B;  2C3U A;  1JK9 B;  3JSR A;  4X84 A;  2RKI A;  4BS2 A;  4K4S A;  4LVN P;  4Y2I A;  4R8U B;  3HHK A;  1FVS A;  2FLL A;  1S77 D;  3LA0 A;  1ELO A;  3GJS B;  5KT7 A;  2VV5 A;  3CVK A;  4DG1 B;  2CPF A;  3TR5 A;  3TO8 A;  2XY5 A;  4WTO B;  4N7T A;  1C1C A;  2B6A A;  2P6T A;  4ZPD A;  3WIV A;  4ZVQ B;  3IWN C;  3U1N A;  2BQR A;  4LRE A;  3C3L A;  3IO1 A;  2M88 A;  2U2F A;  4KSE B;  4HTJ A;  1S1V B;  4X4Q A;  3W64 A;  1NXI A;  1N0U A;  2GQ2 A;  4FYX B;  3ZZR A;  2KG1 A;  1RT7 A;  2EC0 A;  4HHJ A;  3O6Q A;  3UWT A;  3GMG A;  2R42 A;  1HBO B;  3PIP Q;  5F8G A;  5T7L A;  1RHK B;  1FTC A;  2LDY A;  5KOX A;  3D66 A;  2ZH5 A;  5D3G B;  1I6J A;  1LXN A;  3PYD A;  2XWX A;  4F02 A;  2DIT A;  1NCL A;  1T9U A;  4OFZ A;  4ECT A;  4QBU A;  2AJF E;  2I38 A;  4J37 A;  2B6A B;  3H5S A;  4O0I A;  1FRL A;  2HAI A;  4AL6 A;  3F41 A;  3W2W B;  1TMM A;  4B9M A;  2MDA A;  2B0G A;  4OYX A;  2HHV A;  1QM9 A;  1NZ8 A;  1NDL A;  1QUP A;  1SJ1 A;  4HHU A;  3LW5 C;  5CCM A;  3UDE A;  3QO9 A;  1KFS A;  3POT B;  2KFY A;  2LXF A;  2CWK A;  1R43 A;  1M1G A;  4O3S A;  2QMU B;  1XN9 A;  3D6T B;  3KG4 A;  1JLG A;  3NRB A;  5KFU A;  4CM0 A;  7AT1 B;  5GAH U;  4DQR A;  5D4P A;  4LF9 F;  1TKZ B;  2CQ0 A;  4HI2 A;  4J91 A;  3N6M A;  4I2Q A;  5HLF A;  1R8B A;  3DGP A;  3JSM A;  4G3I A;  2WVF A;  5A8W B;  5DG7 A;  3K5L A;  3QFH A;  4HEA 9;  4A47 A;  5AE3 A;  2RHQ B;  1XR7 A;  1IN0 A;  5HI7 A;  3TZX A;  3PW2 A;  2QN6 B;  3D6M B;  4OX6 A;  4DR1 J;  4LRC A;  1SPB P;  4CTA A;  1I3O B;  1I51 B;  3PW0 A;  2NR0 A;  3NGR A;  1RTJ B;  4ANC A;  2CDQ A;  2WVB A;  1DZ5 A;  2V2V A;  3Q83 A;  2WBM A;  2RQM A;  3CCV S;  1U6B A;  1VQP S;  1CJK A;  3N28 A;  1YI2 S;  5CZX A;  2W2P P;  4QU7 A;  2YPZ A;  3JSM B;  2YKN A;  2QA1 A;  3EVO A;  4R25 A;  1WF2 A;  3L95 X;  2HVH A;  3KUE A;  2DTJ A;  3EWG A;  5KFC A;  3CWJ A;  3BSC A;  4Q0B A;  1Q8L A;  3ZTS A;  1V5I B;  1GXL A;  1SJ3 P;  3A8J A;  4CLZ A;  1N5Y B;  2UU9 F;  2F8E X;  5I4M A;  4NMX A;  1NEE A;  3D1H A;  3TZY A;  1O6X A;  1RT2 B;  2KI2 A;  2HHU A;  4ZVG A;  3R8Y A;  4IRC A;  2ZNY A;  4X64 F;  3EPI A;  3MAA A;  2CJB A;  1N34 F;  1R89 A;  2HIQ A;  4P75 A;  3N0V A;  1IM4 A;  4PRF A;  4NLT A;  1Q95 G;  3KWM A;  3BQ2 A;  1X4D A;  5GVQ A;  2W2M P;  4XAK A;  3LGN A;  5LJ3 Y;  1U02 A;  5L1K A;  2FLP A;  3AA9 A;  5HQ8 A;  4DV4 F;  3OHB A;  2G1H A;  5LT5 A;  3KK2 B;  4GKK F;  2BX6 A;  3I0S B;  1FI4 A;  4OX8 A;  4MT1 A;  2ZH4 A;  3G6E S;  4OJG A;  2XI3 A;  2K1R B;  4A8Y A;  4KY3 A;  3GPA A;  2MKK A;  3IBW A;  5KG7 A;  3RAQ A;  2RIJ A;  3W1Y C;  5LMU J;  3W9H A;  3FVY A;  4PYD A;  2MEW A;  3UI3 A;  2IRX A;  1DQA A;  3A3O B;  3NBP A;  4ZVE A;  1NK5 A;  3LWL A;  1X9M A;  4JI6 J;  3IM9 A;  3H2U B;  3GIK A;  1U24 A;  3KG0 A;  1ZA1 B;  5I3U B;  2DGX A;  1QVG R;  4RPF A;  3BH6 B;  4J9N A;  4Y00 A;  1UEK A;  3IS9 A;  4JI7 J;  4DCP B;  1RTD A;  1DBD A;  4CYU A;  1IKV A;  4BC7 A;  3RB0 A;  5FJ4 A;  1SH2 A;  2G0I A;  1IUJ A;  3DN9 A;  4TLR A;  1KVJ A;  4O3N A;  1HBN A;  1Q86 T;  4LF6 J;  3GFH A;  2HVZ A;  3CJ0 A;  3F44 A;  3QLH A;  4QIW D;  2POK A;  3UDV A;  5CD4 H;  3RBE A;  1VYA A;  1A7G E;  4MYT A;  4OYZ A;  1UJ6 A;  1SKW A;  1TL7 A;  4PWU A;  5A76 A;  5B09 A;  2V94 A;  4ILL A;  2J0Q D;  2DGU A;  1H74 A;  3V81 A;  5AE2 A;  2OH2 A;  4B3S J;  2QL9 B;  2VG6 A;  2W9B A;  2LQ5 A;  2VAS A;  2NS1 B;  4LFC J;  4ERD A;  1R6V A;  2R7Q A;  2E9T A;  4ED8 A;  1DTQ B;  1KLN A;  1YZ7 A;  3KMQ A;  4I69 A;  3R5J B;  3AH6 A;  3R1L A;  1VIS A;  4LVO P;  2BE2 B;  1W26 A;  2GCF A;  2OUG A;  3HJV A;  3ILI A;  3GIR A;  3Q86 A;  1F9F A;  2ZJR Q;  1N33 F;  4PAB A;  1RHU B;  2CQ3 A;  3KNA A;  1JLQ B;  5DLG A;  2VQE J;  2F8M A;  1RLD A;  5A0Y B;  1G7C B;  3QJL A;  4DX6 A;  4B3T F;  2QFI A;  3NOC A;  4ZCL A;  1HNW F;  1U1O A;  2RIL A;  3EE3 A;  2C1E B;  4UT4 A;  2HND B;  3TI0 A;  1P8G A;  1BUX A;  2HHP A;  4U96 A;  5JUM A;  2DEI A;  1H6K X;  1VIO A;  1WD6 A;  2EW9 A;  5T14 A;  2PFD A;  2W7O A;  3C15 A;  3G6Y A;  3CCE S;  2VBX A;  2P9E A;  2FD2 A;  3RBX A;  1N6Q B;  4QIF A;  4PG8 A;  4Y2C A;  2GMH A;  2IY5 B;  2R7U A;  1FXD A;  3G82 B;  4Q44 A;  3T6B A;  2ZH6 A;  2DHS A;  1JJH A;  4TXS A;  4CLF A;  5HMX A;  4GKJ J;  4NLY A;  1CSJ A;  1PYO B;  1ZM2 A;  1IR0 A;  1B99 A;  2QLF B;  2J0W A;  3M05 A;  2KXN B;  2IAJ A;  5DG8 A;  4TY8 B;  1ZAV A;  3AOB A;  3BN4 A;  1S59 A;  3FBE A;  3RBD A;  5HJX A;  5ETN A;  3EGV A;  3DLB A;  4DSI A;  1GTH A;  2GJ2 A;  4HI1 A;  4X65 J;  1RT7 B;  4ATN A;  3HSG A;  2VH7 A;  4ZKA A;  5ITH A;  1X5S A;  5JMN A;  3PYF A;  2Z8Q A;  3KLH A;  4HYK A;  2RF2 A;  3DRS A;  4J9U E;  4F4A A;  1LXJ A;  2J6U A;  2DO4 A;  3MCN A;  1NSK L;  1WC4 A;  2VD3 A;  5L9N A;  2HZA A;  4IG0 A;  1V3S A;  1ZS6 A;  5BYR A;  2LU2 A;  3WDO A;  1TKT B;  3OHA A;  3A8I A;  3A4T A;  4B9N A;  3IRX A;  3JXO A;  2XMW A;  3KLV A;  4HL9 A;  3FCW A;  2FJV A;  4KR0 B;  2NZ4 A;  1HW8 A;  1WUU A;  1ZM3 A;  1T9Y A;  2BBE A;  2CAD A;  4QPT A;  5KFR A;  1M5S A;  2NXJ A;  1OIA A;  3TWZ A;  1HL6 A;  3CUN A;  3NAH A;  4OX7 A;  2MQP A;  3ZZT A;  5DZ7 A;  1RAG B;  1YRX A;  4J9O A;  1M0S A;  2P8I A;  2AYM A;  2X1B A;  4I4B A;  1QSY A;  4JI5 F;  4Y34 A;  4JV2 A;  5LMN F;  4M5H A;  2NPI A;  2ILZ A;  1HNX J;  3HHL B;  4DV6 F;  2D3U A;  2BJ7 A;  1FTR A;  1HIY A;  2HBY B;  3BH7 B;  4BC9 A;  5KFT A;  2NRE A;  4WYW A;  1UW4 A;  1N88 A;  2OFG X;  5HLF B;  1RT6 A;  4YY3 F;  3FEY B;  3NS7 B;  3ZO7 A;  1PJ7 A;  2W2O P;  3G8Q A;  2WRM A;  3K8W A;  3PTW A;  4ANE A;  5SUH A;  4UST A;  3BO3 A;  4K0K F;  3W63 A;  1S79 A;  6FDR A;  2HNZ A;  3C19 A;  3AJD A;  2RF2 B;  1ARO P;  2C3O A;  2HZC A;  1UFL A;  4IG3 A;  3HVR A;  4DV2 J;  4B9U A;  3LAK A;  2CPX A;  2UXB J;  1FJ7 A;  2YWG A;  3OV7 A;  5K8O A;  2ACY A;  2BJ1 A;  2E44 A;  2LYV A;  2HSE B;  2GHW A;  2DXF A;  2MZS A;  4LRD A;  1FNO A;  2HQG A;  5HO4 A;  4KHP J;  3OFF A;  3GIL A;  1GTE A;  3R5D A;  1VBY A;  3GR1 A;  3LP2 A;  2DXD A;  2WVC A;  5IQQ A;  1U26 A;  1KS2 A;  2A1B A;  3FUY A;  2W4D A;  3V6H A;  3IP0 A;  1UKU A;  2VG5 A;  2YQ1 A;  4AL7 A;  3K2Y A;  5DQI A;  4X4V A;  3C14 A;  2FHJ A;  2OKQ A;  4F36 A;  1UWB A;  1SH3 A;  4QIV A;  3MUR P;  3K57 A;  1VQ7 S;  2KT3 A;  3GJR B;  5KFB A;  2IYI A;  1RWO B;  4XDD A;  1RDR A;  2CQ2 A;  2V68 A;  3IC1 A;  5SZT A;  1SJ4 P;  2C2Z B;  2CPI A;  2P5V A;  1ACM B;  1URN A;  2FLN A;  5L46 A;  3MPU B;  3M6U A;  3TVY A;  2OPP B;  1T95 A;  1U7L A;  5AJ3 F;  2CQB A;  4OZ2 A;  4ELU A;  4KT0 C;  1S6Q A;  4FBT A;  2AW0 A;  2LA4 A;  1YJN S;  3VGT A;  3KHG A;  1FD8 A;  4N8O A;  4ZVH A;  4A48 A;  2V8P A;  2ZH3 A;  3IAM 9;  2EFQ A;  2Q79 A;  5C42 B;  2OEM A;  4ZVU B;  2RKI B;  1IR2 A;  5A8R A;  4U7U D;  2BKO A;  2UUA F;  1SKU B;  4ED5 A;  1YBU A;  2AEF A;  2MZJ A;  3R7B B;  5KG5 A;  1FXL A;  2NSB A;  3D0G E;  2HRU A;  3CO9 A;  1CVJ A;  3R2C J;  4JI8 J;  1KLM A;  3OFE A;  5HBM A;  2HGN A;  1BQM B;  4YEA A;  4JI8 F;  1DY3 A;  3HZE A;  2EFP A;  5E3A A;  3D1O A;  2I9S A;  4W4M A;  1EET A;  4ZPC A;  1RKJ A;  1F60 B;  2VOD A;  2BJE A;  1U0H A;  1TR0 A;  2UUA J;  1MNE A;  2OI2 A;  2OHD A;  4P2M A;  4CDI A;  2DR5 A;  1CEZ A;  4I2P A;  3RRH A;  2PI5 A;  2AWZ A;  4RWX A;  3D9B A;  3NCP A;  1YTY A;  3P5T L;  1HQ2 A;  2R7R A;  5AJ3 J;  2CNK B;  4PUO B;  1Y5N B;  2RML A;  3M6X A;  1VLY A;  3BGR B;  4FNH A;  1N5T A;  3S7R A;  3R7N B;  2BDP A;  2HGL A;  1RB0 A;  1WEZ A;  2DGV A;  3MFH A;  2XY7 A;  4CZC A;  1H73 A;  3FFI B;  3K89 A;  4PPZ A;  5ADZ A;  5HAN A;  1W2I A;  4BCA A;  2CG8 A;  2FHO B;  4L76 A;  2XMA A;  3QMQ A;  3QSI A;  4NML A;  3A3N B;  1LWX A;  2AIR B;  1JLA B;  1Q5V A;  2P2C B;  4P7T A;  4DCJ B;  5KFH A;  4YR0 A;  2OTJ S;  4KHP F;  3HCX A;  4DPO A;  4QYZ K;  1CJU A;  2JFK A;  2M52 A;  4MIB A;  3PDN A;  1IM6 A;  1EP4 A;  2UXB F;  1LKZ A;  3RB4 A;  4DV2 F;  2CZV C;  2G0J A;  2IHR 1;  3IR7 B;  3PNI A;  5KT5 A;  3IG1 A;  3R3T A;  3M9O B;  3K58 A;  2M4M A;  3J81 U;  2AU0 A;  2PEB A;  2CNO B;  3LAN A;  2IFX A;  2DCU B;  2B9X A;  4K0K J;  1R8H A;  3PEJ A;  3G86 A;  2A3J A;  4QR0 A;  4PG7 A;  5DS7 A;  4AXI A;  3MMJ A;  4F0K A;  4U67 Q;  1VC5 A;  2EVZ A;  2HBR B;  2HS4 A;  3Q2S C;  1T05 B;  1RT5 A;  3D28 A;  5CH7 B;  4YY3 J;  3BSN A;  2JLF A;  3HFK A;  1YWX A;  3UR0 A;  2BM0 A;  4RBT A;  4PG6 A;  4JV0 A;  5C24 B;  1DUR A;  3DMJ B;  2N4D A;  4DV6 J;  1IR1 A;  4AE5 A;  1WI8 A;  2Q6B A;  4BLG A;  1HNX F;  4M5K A;  3MED B;  5LMN J;  3VAG A;  2B9W A;  3PJW A;  1M1K T;  1RWU A;  2K06 A;  4JI5 J;  1UVK A;  2ZD1 A;  1TKT A;  4P7V A;  1U1P A;  2QV6 A;  2IA0 A;  3WX8 A;  4WII A;  5GAE U;  1K47 A;  2BOA A;  2IBK A;  4H4O A;  2G0C A;  4EYH B;  4ELT A;  1S5Z A;  4TU7 A;  5G4D A;  4JV1 A;  2ALY B;  2JEF A;  2ASL A;  5ETQ A;  1VCT A;  2KM8 C;  3HHL A;  3DYA A;  4DQI A;  3CC4 S;  3MZI A;  1G6B A;  4CM2 A;  1E6Y A;  1OPI A;  2LA6 A;  1X5T A;  4RW7 B;  4DCO B;  4Z7C A;  1VBZ A;  4OHY A;  2BXJ A;  1MMD A;  3JTP A;  2GHP A;  2KB2 A;  4U7C A;  3HX9 A;  1JLC A;  2D7S A;  2FZC B;  2O66 A;  2HHX A;  4CO3 A;  4P2F A;  2QX0 A;  4AYB D;  3DFE A;  3MXH P;  2H5J B;  2FJB B;  1QAY A;  2V9K A;  4X65 F;  2Z2M A;  2R4F A;  2QA2 A;  3BBC A;  3UD5 A;  2FVP A;  1WEY A;  4XPE A;  3JSY A;  5IV3 A;  4N5S A;  4IKA A;  4NLQ A;  4OV1 A;  4CLS A;  5M2P A;  5HRO B;  1IQT A;  2HWH A;  3T19 A;  3JAM Y;  4M5J A;  4GKJ F;  3TEH B;  3G6V A;  3THT A;  3PY8 A;  4A8M P;  2V69 A;  3HSD A;  1Q8B A;  1X4F A;  2J6S A;  2UP1 A;  3UDC A;  2DIS A;  3P96 A;  3UD3 P;  4K2X A;  2OFH X;  1LWF B;  4AXJ A;  1SC1 B;  2PN6 A;  1S6P A;  1S1T B;  1BQN B;  2NYH A;  2QIF A;  4R5P A;  3SCL E;  3QBC A;  3MUV P;  4GC7 A;  1RT3 A;  1W25 A;  4MK9 A;  2WAQ D;  3GCW P;  1ZPV A;  1REV A;  4OZ1 A;  4USV A;  3OTE A;  3R9L A;  4EWT A;  5CD4 A;  3AXM A;  4NI2 A;  4LF5 F;  3EGN A;  1HNW J;  1W2B R;  1E6Y B;  2NXC A;  2MXY A;  4B3T J;  2V2Q A;  4M5D B;  4CP5 A;  1TKX A;  2VQE F;  3HK2 A;  2V63 A;  3G6X A;  1JXL A;  1GXU A;  3MMB A;  2XQC A;  1N33 J;  2DNH A;  2ZBP A;  4NLD A;  1A6L A;  1UEV A;  3GJQ B;  5F8I A;  2B43 A;  2BAC A;  5GAH I;  3KLG B;  3MM9 B;  2IDL A;  3HFV A;  3QJP A;  4M95 A;  2YKP A;  2W24 A;  3MM5 A;  1HW9 A;  1K44 A;  2R7X A;  4EBE A;  1NRK A;  1XBW A;  3ICL A;  3TAQ A;  3QGI A;  4LFC F;  2QA4 S;  3MAA B;  2OPR B;  4YME A;  4B3S F;  2EI5 A;  3UQS A;  4LRF A;  4U6P A;  2W1B A;  4A4J A;  1RTD B;  1HMV A;  2VJV A;  3MMC A;  2D3O 1;  3HLU A;  1RZM A;  2J9C A;  4ES2 A;  2B9Y A;  4KRW A;  4LF6 F;  5KFE A;  3TW0 A;  3ZFV A;  2AZ3 A;  2ZZN A;  2DVI A;  3QIP A;  2WSE C;  2YWH A;  4NL5 A;  3CNQ P;  3GFY A;  5K5M A;  4C97 A;  2XM3 A;  3MGJ A;  2VPZ B;  3H2V E;  1XK8 A;  2HHW A;  4JI7 F;  5AXM A;  1JXV A;  4WP8 A;  2DGQ A;  3T5L A;  4NI2 B;  2XNQ A;  3Q8S B;  2GIR A;  1DAX A;  2ZKU A;  4JI6 F;  2FLO A;  1BWE A;  5GME A;  3DHX A;  4ZN3 A;  3RG6 A;  5LMU F;  3PRV A;  1I1G A;  5L1L A;  1VS3 A;  1VR6 A;  2GA7 A;  2JH3 A;  2YKM A;  3PIO Q;  4OLO A;  1BQX A;  3V6J A;  3ET6 A;  2E1A A;  2EPI A;  2LQB A;  2DNQ A;  3HT0 A;  3OD2 A;  4G1I A;  2DKO B;  1U45 A;  1AFJ A;  1TKD A;  3IBC B;  4KKO B;  4I6W A;  3LH2 S;  2NCK L;  4DV4 J;  3MOJ B;  4GKK J;  2GIQ A;  4OI0 A;  4ED0 A;  5C2G A;  3FCV A;  4PXC A;  2XYH B;  2FZG B;  4I56 A;  1OO0 B;  5CYJ A;  1TU0 B;  2XO6 A;  1B4S A;  2FJX A;  2R8J A;  4L3N A;  3LO3 A;  2L9D A;  3ENW A;  2MZ1 A;  1B64 A;  2WB1 D;  2PDA A;  1P1L A;  3E51 A;  3JQM A;  4PG5 A;  4DHV A;  4NLS A;  4V1A k;  2CQC A;  5ETP A;  2YQ0 A;  2NSC A;  4K5R A;  4X64 J;  1RAH B;  4FYY B;  5CYQ B;  1N34 J;  1OSD A;  1TTH B;  1FRJ A;  2YXL A;  5E3P A;  4EBC A;  4ZPB A;  1PIL A;  2Z30 B;  3QIP B;  4KFB A;  4Z7Y A;  1VHI A;  1SJQ A;  3KJV A;  2CPZ A;  2IAJ B;  3MEC B;  4C6A A;  2UU9 J;  5D3G A;  3EM1 A;  1FD2 A;  3K17 A;  5F3T A;  5KFA A;  3CMQ A;  2BOP A;  4OJH A;  1HBN B;  1RTJ A;  1FRH A;  3L7O A;  3MPV A;  1HQE A;  4HDH A;  5CA5 A;  4CLT A;  2HGM A;  5KFF A;  3CW2 C;  3DLH A;  4DMZ A;  5DJB A;  3NEK A;  3MM6 B;  2VU5 A;  3MEG A;  1KR4 A;  4IFY A;  1J5E J;  1ZH5 A;  2B3T B;  1N5S A;  2GML A;  3PRD A;  4H4O B;  2DYA A;  2KTQ A;  3PFO A;  5EX0 A;  3CCS S;  2DJW A;  3BDE A;  5F41 A;  4KHM A;  1NKB A;  1LWE B;  2HVD A;  4RNN A;  2V34 A;  4LRB A;  5DDO C;  3TAP A;  5KT3 A;  2H5I B;  3C6T B;  4RLE A;  3DLE A;  1FK9 A;  1PYT A;  1HLW A;  4OZJ A;  1IKW B;  5IFM A;  4G1Q A;  4H4M A;  1RJJ A;  3VWS A;  1CUL A;  4FKX A;  3FSI A;  2PSZ A;  1RLC L;  2ACM A;  4RW4 A;  1P27 B;  4A8S A;  3RW6 A;  1F2H A;  4CTA B;  2RDD A;  4LF9 J;  4MKY A;  1KKH A;  4F7V A;  1YKW A;  4WWS A;  3KLF B;  2M3D A;  1T9V A;  2QLX A;  4NLU A;  2QC3 A;  3OR1 A;  3K0J A;  3BBB A;  3OUY A;  2QZ8 A;  4RW7 A;  2EKN A;  3HVW A;  2MYF A;  3JTO A;  2ZIT A;  4G1Q B;  2ATC B;  4MK8 A;  2ZJQ Q;  1S9E B;  2RT3 A;  2VPW B;  3VVT A;  2BJ9 A;  5KFP A;  4RU2 A;  1Z2L A;  2MHE A;  2OPQ B;  1J2V A;  3MEG B;  1Q16 B;  4Y2A A;  5JJB A;  3FSX A;  4NA2 A;  2KZM A;  3UN5 A;  2GIF A;  2G2O A;  1RT4 A;  2GVD A;  4UUW A;  2C2E A;  1VRQ C;  2RRN A;  2IVY A;  1KQK A;  3KG1 A;  4EK2 A;  3OUY B;  1BC6 A;  3IWL A;  3OR2 B;  2MJU A;  2VG7 B;  3NS5 A;  3Q8V A;  3B8H A;  4EFA C;  3HVT B;  3GTY X;  4HLB A;  4QWC A;  1HHT P;  1X4C A;  2H3E B;  5KT6 A;  1TKX B;  3GZ7 A;  5D0H A;  2WBR A;  4OI1 A;  4F3M A;  5CCL A;  1U1R A;  2BE2 A;  1F6T A;  1ZTW A;  1WDD A;  2LP4 A;  4ZP8 A;  1WSV A;  1WG5 A;  1XMB A;  2C2O B;  4FYW B;  4V19 J;  2KFZ A;  3HSJ A;  5J1E B;  3VV2 B;  5E2Q A;  1HA1 A;  1MML A;  2JNJ A;  3TVZ A;  1M5P C;  4WK1 A;  1D9F A;  2GMJ A;  2C2M B;  1EET B;  2FQQ B;  3VAI A;  5C25 B;  4Q2M A;  3TRG A;  4LF5 J;  2AX0 A;  2E5L J;  3TX0 A;  4ECZ A;  2UVU A;  1K0V A;  2KN4 A;  1RHR B;  1U2R A;  4DV5 J;  2QTW A;  2AJ2 A;  1Y5I B;  3ZZO A;  9ATC B;  1IBK J;  2FC9 A;  3MOZ A;  4CLU A;  3M2R A;  2BKN A;  2L48 A;  4JUZ A;  2H48 B;  4DOZ A;  3AJ1 A;  1Z4U A;  2FGC A;  1X4H A;  3J81 Y;  3KK3 A;  1UW9 A;  1HWJ A;  1QJH A;  3DLK A;  2VKZ G;  1Q8K A;  3GWC A;  4OLP A;  3RBZ A;  4KBI A;  1KVK A;  1B7F A;  1QY7 A;  2KXH A;  1C1B B;  5DDP C;  2X1G A;  2KFN A;  1VJQ A;  2DD8 S;  4TN2 A;  1DHM A;  1IBM J;  2F63 A;  3NGU A;  2F4V J;  4WFB Q;  1S9G B;  3QID A;  5KFN A;  4JV5 J;  4ZIT A;  4FF1 A;  1HD0 A;  1PJ6 A;  1FWL A;  2FJA B;  2LCW A;  3TX8 A;  1SUQ A;  3HHD A;  5KT4 A;  3K59 A;  5B0A A;  2AMC B;  1U6F A;  1N36 J;  1NSA A;  4LBH A;  4DL7 A;  2CRL A;  4F4W A;  4MH8 A;  3IRW P;  4K4Y A;  3TAR A;  3OVB A;  5J2P A;  4QQB A;  3LP2 B;  5L9X A;  1RXO B;  4M5I A;  1VDH A;  2ZBC A;  1Y00 A;  1WOR A;  5BR8 J;  1UFK A; 
#chains in the Genus database with same CATH homology
 2E7V A;  1IVZ A;  2ACM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...