2E8BA

Crystal structure of the putative protein (aq1419) from aquifex aeolicus vf5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
185
structure length
185
Chain Sequence
FTWRKGSLSKVNTCYVLAGGKSKRFGEDKLLYEIKGKKVIERVYETAKSVFKEVYIVAKDREKFSFLNAPVVLDEFEESASIIGLYTALKHAKEENVFVLSGDLPLMKKETVLYVLENFKEPVSVAKTEKLHTLVGVYSKKLLEKIEERIKKGDYRIWALLKDVGYNEVEIPEELRYTLLNMNTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable molybdopterin-guanine dinucleotide biosynthesis pro
publication title Crystal structure of the putative protein (Aq1419) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Biosynthetic protein
total genus 59
structure length 185
sequence length 185
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2e8bA00
1WT1A 3Q4SA 3Q7UA 1GA8A 3I0JA 4HOCA 1WVCA 1GQ9A 3SXDA 4HO0A 4NAKA 1O7QA 2XWMA 1XHBA 2RJ4A 1PZTA 2AGDA 3CU0A 2I5EA 1H5TB 1HM8A 3CKVA 4B4GA 2D7RA 1VZXA 3V0PA 1ZJ1A 1R80A 1VH3A 3I0DA 3TZTA 1MP4A 1QG8A 3U2UA 1GX0A 2D7IA 4FCUA 1W57A 1YP3A 2YC5A 1ZI3A 4MNDA 3ZGGA 4BQHA 1Z90A 1QGSA 1NMMB 1R7TA 1FO8A 1H5SC 1FG5N 1R7UA 2JCKA 4Y6NA 1LZIA 3OH3A 1TW5A 2E8BA 4Y7GA 5BXCA 4FRHA 3IOHA 2JCLA 3SXBA 2GGQA 5IDSA 3OH2A 4LW3A 1G23A 1H4DA 4GBPA 1ZJ0A 4MYBA 3SX8A 3HL3A 5C1HA 3RMWA 1G3LA 1JV3A 1H5TA 5AJOA 4B3UA 3FWWA 2OEGA 3JUJA 5EJ1A 4KC2A 4B5BA 4D11A 2YQJA 1FGGA 2XWNA 4B42A 1JV1A 4ASYA 2O1HA 3U2TA 1NWGB 5FTSA 3K8EA 4KC4A 5I1FA 1VGUA 2VXLA 2AM4A 4LW6A 3TQDA 5DDTA 1YP4A 1S4OA 2Z86A 2P6WA 3OKRA 4FCEA 5C47A 2RIZA 5CMIA 1MP3A 1JYLA 1FWYA 2RJ9A 1VZUA 3JTJA 4CJBA 2AM3A 5CMHA 5C4BA 1ZCYA 2VSIA 2V0KA 5DDVA 1GX4A 5C8RA 1R7XA 4D0ZA 4KRVA 1VZTA 4B4MA 1H7QA 2X60A 4FRDA 1V82A 2BO8A 4HO5A 2RJ1A 3F1YA 3D98A 2D0JA 4EEGA 1XZ6A 4EE4A 2YCMA 3DJ4A 1TZFA 1G93A 4Y62A 4B2XA 1H4EA 2WVLA 2ICXA 1ON6A 5L6VA 4Y7FA 1H7EA 3SXCA 4KNRA 3E25A 4P02A 2W0VA 4L41C 2FFUA 3D8VA 4B2WA 1JYKA 3PNNA 3NGWA 3USRA 1WT2A 4HO6A 1LL3A 2WGZA 2MZBA 2AM5A 2VD4A 1YP2A 2QH5A 1H7TA 2FYBA 4XWIA 1WT0A 2P72A 3SXAA 4EEOA 4HO2A 2Y4KA 1GWVA 2OEFA 3ZLLA 4AYJA 1VM8A 4FRBA 4G3PA 2XWLA 2PGVA 3POLA 5C4EA 2BO4A 3V8ZA 5AJNA 1ZCUA 4KC1A 2Z87A 3OAMA 2RIYA 2P73A 2Y6PA 3PKPA 5CMJA 5C1GA 2VXMA 1R82A 1G9RA 1ON8A 4R7PA 3CKOA 3R2WA 4BMAA 3LW6A 2V0JA 1HJJA 1E5KA 3I0FA 1ZCVA 5C1LA 2VS3A 1NHEB 2VS4A 3V90A 5AJPA 3U0XA 3SPTA 4JD0A 4EEAA 1SS9A 3O3PA 1NKHB 1G0RA 2Y4LA 3V0OA 4ARWA 2FYDB 5C3BA 2AE7A 1S4PA 2WE9A 4Y7UA 3USQA 2RJ7A 1OMZA 2Y4JA 4FRPA 2OI6A 2OI7A 1QWJA 1WSZA 1LZ0A 4ASJA 5CMGX 1R81A 2PGYA 5C38A 2JCJA 4P00A 4M2AA 2AH9A 2RITA 3JUKA 1ZJPA 1G97A 4HO8A 4Y9XA 3ST8A 3I0CA 5FTVA 4DE7A 4KXOA 2YQHA 3U2XA 2BO6A 4KNXA 4AYLA 4HCQA 4CJCA 3FOQA 4HO3A 5J49A 4DDZA 1KWSA 2BO7A 4NANA 1PZYB 3PKQA 3RSBA 5CQMX 2NXVA 1ZI4A 1JVDA 3EE5A 2RJ5A 4ZDQA 1VGZA 2YQSA 4Y7VA 3OH4A 5CQOA 3CKJA 2RJ8A 5C4DA 4D11C 5C3DA 1ZJ3A 3I0EA 5CMFX 1LVWA 2V0LA 4M28A 1H3MA 5C4FA 3ZLKA 3K8DA 3E26A 1OQMB 2FFVA 1ZDGA 5CQPA 2ZU8A 4C2SA 1LL0A 4E1KA 3IOJA 2Y4MA 4FRLA 1H5SB 1EZIA 1FXJA 1G95A 1HM0A 1TVYA 2FYAA 1GWWA 4Y6UA 3KIAA 2DPWA 3V91A 1ZJOA 2WVKA 1H7HA 1O0RA 1HV9A 2PA4A 2YESA 5FU0A 3CKQA 5FU8A 2A8UA 1H5SD 1VH1A 4M2BA 4HO9A 1H7LA 1V83A 2VS5A 2FY7A 2QGIA 3T7NA 3OGZA 2E3DA 1INIA 3V8YA 1WT3A 4D48A 2GGOA 4KT7A 4HO4A 1H5RB 2RJ6A 4AAWA 4FRAA 1HM9A 3I0HA 3R3IA 1R7YA 5EIYA 5L6SA 1V84A 3SX7A 4NALA 3BRKX 4FRMA 2PX7A 5C48A 3OH1A 3D5NA 2VFZA 1FRWA 5EJZA 1K4VA 1LZJA 5C3AA 1FO9A 1W77A 1YROB 1H5SA 2V0IA 3I0KA 2XMEA 3RMVA 5IDTA 4FRQA 3IOIA 1ZCTA 2YC3A 1FR9A 2JCOA 1G1LA 2ICYA 3BCVA 4IRPA 1FGXA 2CU2A 4IRQA 5HS2A 3CGXA 5C36A 1INJA 4ECMA 2O1GA 5IFYA 1VPAA 2X5SA 1VGTA 4FQWA 1VICA 1GQCA 3I0GA 3U2VA 3DUVA 1NQIB 5C4CA 2X5ZA 4D0TA 4EE5A 1NF5B 1R7VA 2AECA 4HG6A 1H4CA 4AC3A 5JQQA 1H5RA 1IIMA 1ZHJA 3T7MA 3SXEA 3OH0A 1OMXA 4B4BA 4Y63A 4CVHA 1LL2A 3I0LA 1TW1A 3F1CA 4KPXA 3QVBA 4Y64A 5FUHA 1FOAA 3V0LA 1O23B 4G3SA 1ZJ2A 1EYRA 4UEGA 3GUEA 1VGWA 4G3QA 4NAIA 1JVGA 2WEEA 4EE3A 3CKNA 1I52A 2WAWA 1IINA 4FROA 1H7FA 2I5KA 2I7BA 1MP5A 2FYCB 1MC3A 1ZDFA 1FXOA 2O1FA 5CQLX 1G2VA 3U2WA 3ZGFA 3SX5A 2OI5A 3SXGA 1ZI5A 4JISA 3V0NA 2QKXA 4YS8A 1FR8A 4EEMA 2RIXA 2AESA 1H7GA 2Q4JA 4KPZA 3DK5A 2A8WA 4Y7TA 3V0QA 4G87A 3Q80A 4K6RA 4J18A 2APCA 1FZWA 2W0WA 3T7OA 4M4KA 2ZU7A 1O7OA 5C49A 1ZIZA 2VSHA 1LZ7A 1G8OA 4CJ8A 2UX8A 3ZF8A 5CQNX 5FYEA 1ZI1A 2ZU9A 3OC9A 3SX3A 2X65A 3V0MA 1W55A 2RJ0A 5FV9A 2YQCA 2WVMA 1HJLA 3I0IX 2V0HA 2XMHA 4FREA 1S4NA 3N9WA 4DECA 4EVWA 1QGQA 4KQLA 2Y7AA 3U0YA
chains in the Genus database with same CATH superfamily
1WT1A 3Q4SA 3Q7UA 1GA8A 3I0JA 4HOCA 1WVCA 1GQ9A 3SXDA 4HO0A 4NAKA 1O7QA 2XWMA 1XHBA 2RJ4A 1PZTA 2AGDA 3CU0A 2I5EA 1H5TB 1HM8A 3CKVA 4B4GA 2D7RA 1VZXA 3V0PA 1ZJ1A 1R80A 1VH3A 3I0DA 2C0NA 3TZTA 1MP4A 1QG8A 3U2UA 1GX0A 2D7IA 4FCUA 1W57A 1YP3A 2YC5A 1ZI3A 4MNDA 3ZGGA 4BQHA 1Z90A 1QGSA 1NMMB 1R7TA 1FO8A 1H5SC 1FG5N 1R7UA 2JCKA 4Y6NA 1LZIA 3OH3A 1TW5A 2E8BA 4Y7GA 5BXCA 4FRHA 3IOHA 2JCLA 3SXBA 2GGQA 5IDSA 3OH2A 4LW3A 1G23A 1H4DA 4GBPA 1ZJ0A 4MYBA 3SX8A 3HL3A 5C1HA 3RMWA 1G3LA 1JV3A 1H5TA 5AJOA 4B3UA 3FWWA 2OEGA 3JUJA 5EJ1A 4KC2A 4B5BA 4D11A 2YQJA 1FGGA 2XWNA 4B42A 1JV1A 4ASYA 2O1HA 3U2TA 1NWGB 5FTSA 3K8EA 4KC4A 5I1FA 1VGUA 2VXLA 2AM4A 4LW6A 3TQDA 5DDTA 1YP4A 1S4OA 2Z86A 2P6WA 3OKRA 4FCEA 5C47A 2RIZA 5CMIA 1MP3A 1JYLA 1FWYA 2RJ9A 1VZUA 3JTJA 4CJBA 2AM3A 5CMHA 5C4BA 1ZCYA 2VSIA 2V0KA 5DDVA 1GX4A 5C8RA 1R7XA 4D0ZA 4KRVA 1VZTA 4B4MA 1H7QA 2X60A 4FRDA 1V82A 2BO8A 4HO5A 2RJ1A 3F1YA 3D98A 2D0JA 2J0BA 4EEGA 1XZ6A 4EE4A 4O6MA 2YCMA 3DJ4A 1TZFA 1G93A 4Y62A 4B2XA 1H4EA 2WVLA 2ICXA 1ON6A 5L6VA 4Y7FA 1H7EA 3SXCA 4KNRA 3E25A 4P02A 2W0VA 4L41C 2FFUA 5D91A 3D8VA 4B2WA 1JYKA 3PNNA 3NGWA 3USRA 1WT2A 4HO6A 1LL3A 2WGZA 2MZBA 2AM5A 2VD4A 1YP2A 2QH5A 1H7TA 2FYBA 4XWIA 1WT0A 2P72A 3SXAA 4EEOA 4HO2A 2Y4KA 1GWVA 2OEFA 3ZLLA 4AYJA 1VM8A 4FRBA 4G3PA 2XWLA 2PGVA 3POLA 5C4EA 2BO4A 3V8ZA 5AJNA 1ZCUA 4KC1A 4O6NA 2Z87A 3OAMA 2RIYA 2P73A 2Y6PA 3PKPA 5CMJA 5C1GA 2VXMA 1R82A 1G9RA 1ON8A 4R7PA 3CKOA 3R2WA 4BMAA 3LW6A 2V0JA 1HJJA 1E5KA 3I0FA 1ZCVA 5C1LA 4Q7CA 2VS3A 1NHEB 2VS4A 3V90A 5AJPA 3U0XA 3SPTA 4JD0A 4EEAA 1SS9A 3O3PA 1NKHB 1G0RA 2Y4LA 3V0OA 4ARWA 2FYDB 5C3BA 2AE7A 1S4PA 2WE9A 4Y7UA 3USQA 2RJ7A 1OMZA 2Y4JA 4FRPA 2OI6A 2OI7A 1QWJA 1WSZA 1LZ0A 4ASJA 5CMGX 1R81A 2PGYA 5C38A 2JCJA 4P00A 4M2AA 2AH9A 2RITA 3JUKA 1ZJPA 1G97A 4HO8A 4Y9XA 3ST8A 3I0CA 5FTVA 4DE7A 4KXOA 2YQHA 3U2XA 2BO6A 4KNXA 4AYLA 4HCQA 4CJCA 3FOQA 4HO3A 5J49A 4DDZA 1KWSA 2BO7A 4NANA 1PZYB 3PKQA 3RSBA 5CQMX 2NXVA 1ZI4A 2VK9A 1JVDA 3EE5A 2RJ5A 4ZDQA 1VGZA 2YQSA 4Y7VA 3OH4A 5CQOA 3CKJA 2RJ8A 5C4DA 4D11C 5C3DA 1ZJ3A 3I0EA 5CMFX 1LVWA 2V0LA 4M28A 1H3MA 5C4FA 3ZLKA 3K8DA 3E26A 1OQMB 2FFVA 1ZDGA 5CQPA 2ZU8A 4C2SA 1LL0A 4E1KA 3IOJA 2Y4MA 4FRLA 1H5SB 1EZIA 1FXJA 1G95A 1HM0A 1TVYA 2FYAA 1GWWA 4Y6UA 3KIAA 2DPWA 3V91A 1ZJOA 2WVKA 1H7HA 1O0RA 1HV9A 2PA4A 2YESA 5FU0A 2J0AA 3CKQA 5FU8A 2A8UA 1H5SD 1VH1A 4M2BA 4HO9A 1H7LA 1V83A 2VS5A 2FY7A 2QGIA 3T7NA 3OGZA 2E3DA 1INIA 3V8YA 1WT3A 4D48A 2GGOA 4KT7A 4HO4A 1H5RB 2RJ6A 4AAWA 4FRAA 1HM9A 3I0HA 3R3IA 1R7YA 5EIYA 5L6SA 1V84A 3SX7A 4NALA 3BRKX 4FRMA 2PX7A 5C48A 3OH1A 3D5NA 2VFZA 1FRWA 5EJZA 1K4VA 1LZJA 5C3AA 1FO9A 1W77A 1YROB 1H5SA 2V0IA 3I0KA 2XMEA 3RMVA 5IDTA 4FRQA 3IOIA 1ZCTA 2YC3A 1FR9A 2JCOA 1G1LA 2ICYA 3BCVA 4IRPA 1FGXA 2CU2A 4IRQA 5HS2A 3CGXA 5C36A 1INJA 4ECMA 2O1GA 5IFYA 1VPAA 5D92A 2X5SA 1VGTA 4FQWA 1VICA 1GQCA 3I0GA 3U2VA 3DUVA 1NQIB 5C4CA 2X5ZA 4D0TA 4EE5A 1NF5B 1R7VA 2AECA 4HG6A 1H4CA 4AC3A 5JQQA 4FIYA 1H5RA 1IIMA 1ZHJA 3T7MA 3SXEA 4MIXA 3OH0A 1OMXA 4B4BA 4Y63A 4CVHA 1LL2A 3I0LA 1TW1A 3F1CA 4KPXA 3QVBA 4Y64A 5FUHA 1FOAA 3V0LA 1O23B 4G3SA 1ZJ2A 1EYRA 4UEGA 3GUEA 1VGWA 4G3QA 4NAIA 1JVGA 2WEEA 4EE3A 3CKNA 1I52A 2WAWA 1IINA 4FROA 1H7FA 2I5KA 2I7BA 1MP5A 2FYCB 1MC3A 1ZDFA 1FXOA 2O1FA 5CQLX 1G2VA 3U2WA 3ZGFA 3SX5A 2OI5A 3SXGA 1ZI5A 4JISA 3V0NA 2QKXA 4YS8A 1FR8A 4EEMA 2RIXA 2AESA 1H7GA 2Q4JA 4KPZA 3DK5A 2A8WA 4Y7TA 3V0QA 4FIXA 3Q80A 4G87A 4K6RA 4J18A 2APCA 1FZWA 2W0WA 3T7OA 4M4KA 2ZU7A 1O7OA 5C49A 1ZIZA 2VSHA 1LZ7A 1G8OA 4CJ8A 2UX8A 3ZF8A 5CQNX 5FYEA 1ZI1A 2ZU9A 3OC9A 3SX3A 2X65A 3V0MA 1W55A 2RJ0A 5FV9A 2YQCA 2WVMA 1HJLA 3I0IX 2V0HA 2XMHA 4FREA 1S4NA 3N9WA 4DECA 4EVWA 1QGQA 4KQLA 2Y7AA 3U0YA
chains in the Genus database with same CATH topology
1WT1A 3Q4SA 3Q7UA 1GA8A 3I0JA 4HOCA 1WVCA 1GQ9A 3SXDA 4HO0A 4NAKA 1O7QA 2XWMA 1XHBA 2RJ4A 1PZTA 2AGDA 3CU0A 2I5EA 1H5TB 1HM8A 3CKVA 4B4GA 2D7RA 1VZXA 3V0PA 1ZJ1A 1R80A 1VH3A 3I0DA 2C0NA 3TZTA 1MP4A 1QG8A 3U2UA 1GX0A 2D7IA 4FCUA 1W57A 1YP3A 2YC5A 1ZI3A 4MNDA 3ZGGA 4BQHA 1Z90A 1QGSA 1NMMB 1R7TA 1FO8A 1H5SC 1FG5N 1R7UA 2JCKA 4Y6NA 1LZIA 3OH3A 1TW5A 2E8BA 4Y7GA 5BXCA 4FRHA 3IOHA 2JCLA 3SXBA 2GGQA 5IDSA 3OH2A 4LW3A 1G23A 1H4DA 4GBPA 1ZJ0A 4MYBA 3SX8A 3HL3A 5C1HA 3RMWA 1G3LA 1JV3A 1H5TA 5AJOA 4B3UA 3FWWA 2OEGA 3JUJA 5EJ1A 4KC2A 4B5BA 4D11A 2YQJA 1FGGA 2XWNA 4B42A 1JV1A 4ASYA 2O1HA 3U2TA 1NWGB 5FTSA 3K8EA 4KC4A 5I1FA 1VGUA 2VXLA 2AM4A 4LW6A 3TQDA 5DDTA 1YP4A 1S4OA 2Z86A 2P6WA 3OKRA 4FCEA 5C47A 2RIZA 5CMIA 1MP3A 1JYLA 1FWYA 2RJ9A 1VZUA 3JTJA 4CJBA 2AM3A 5CMHA 5C4BA 1ZCYA 2VSIA 2V0KA 5DDVA 1GX4A 5C8RA 1R7XA 4D0ZA 4KRVA 1VZTA 4B4MA 1H7QA 2X60A 4FRDA 1V82A 2BO8A 4HO5A 2RJ1A 3F1YA 3D98A 2D0JA 2J0BA 4EEGA 1XZ6A 4EE4A 4O6MA 2YCMA 3DJ4A 1TZFA 1G93A 4Y62A 4B2XA 1H4EA 2WVLA 2ICXA 1ON6A 5L6VA 4Y7FA 1H7EA 3SXCA 4KNRA 3E25A 4P02A 2W0VA 4L41C 2FFUA 5D91A 3D8VA 4B2WA 1JYKA 3PNNA 3NGWA 3USRA 1WT2A 4HO6A 1LL3A 2WGZA 2MZBA 2AM5A 2VD4A 1YP2A 2QH5A 1H7TA 2FYBA 4XWIA 1WT0A 2P72A 3SXAA 4EEOA 4HO2A 2Y4KA 1GWVA 2OEFA 3ZLLA 4AYJA 1VM8A 4FRBA 4G3PA 2XWLA 2PGVA 3POLA 5C4EA 2BO4A 3V8ZA 5AJNA 1ZCUA 4KC1A 4O6NA 2Z87A 3OAMA 2RIYA 2P73A 2Y6PA 3PKPA 5CMJA 5C1GA 2VXMA 1R82A 1G9RA 1ON8A 4R7PA 3CKOA 3R2WA 4BMAA 3LW6A 2V0JA 1HJJA 1E5KA 3I0FA 1ZCVA 5C1LA 4Q7CA 2VS3A 1NHEB 2VS4A 3V90A 5AJPA 3U0XA 3SPTA 4JD0A 4EEAA 1SS9A 3O3PA 1NKHB 1G0RA 2Y4LA 3V0OA 4ARWA 2FYDB 5C3BA 2AE7A 1S4PA 2WE9A 4Y7UA 3USQA 2RJ7A 1OMZA 2Y4JA 4FRPA 2OI6A 2OI7A 1QWJA 1WSZA 1LZ0A 4ASJA 5CMGX 1R81A 2PGYA 5C38A 2JCJA 4P00A 4M2AA 2AH9A 2RITA 3JUKA 1ZJPA 1G97A 4HO8A 4Y9XA 3ST8A 3I0CA 5FTVA 4DE7A 4KXOA 2YQHA 3U2XA 2BO6A 4KNXA 4AYLA 4HCQA 4CJCA 3FOQA 4HO3A 5J49A 4DDZA 1KWSA 2BO7A 4NANA 1PZYB 3PKQA 3RSBA 5CQMX 2NXVA 1ZI4A 2VK9A 1JVDA 3EE5A 2RJ5A 4ZDQA 1VGZA 2YQSA 4Y7VA 3OH4A 5CQOA 3CKJA 2RJ8A 5C4DA 4D11C 5C3DA 1ZJ3A 3I0EA 5CMFX 1LVWA 2V0LA 4M28A 1H3MA 5C4FA 3ZLKA 3K8DA 3E26A 1OQMB 2FFVA 1ZDGA 5CQPA 2ZU8A 4C2SA 1LL0A 4E1KA 3IOJA 2Y4MA 4FRLA 1H5SB 1EZIA 1FXJA 1G95A 1HM0A 1TVYA 2FYAA 1GWWA 4Y6UA 3KIAA 2DPWA 3V91A 1ZJOA 2WVKA 1H7HA 1O0RA 1HV9A 2PA4A 2YESA 5FU0A 2J0AA 3CKQA 5FU8A 2A8UA 1H5SD 1VH1A 4M2BA 4HO9A 1H7LA 1V83A 2VS5A 2FY7A 2QGIA 3T7NA 3OGZA 2E3DA 1INIA 3V8YA 1WT3A 4D48A 2GGOA 4KT7A 4HO4A 1H5RB 2RJ6A 4AAWA 4FRAA 1HM9A 3I0HA 3R3IA 1R7YA 5EIYA 5L6SA 1V84A 3SX7A 4NALA 3BRKX 4FRMA 2PX7A 5C48A 3OH1A 3D5NA 2VFZA 1FRWA 5EJZA 1K4VA 1LZJA 5C3AA 1FO9A 1W77A 1YROB 1H5SA 2V0IA 3I0KA 2XMEA 3RMVA 5IDTA 4FRQA 3IOIA 1ZCTA 2YC3A 1FR9A 2JCOA 1G1LA 2ICYA 3BCVA 4IRPA 1FGXA 2CU2A 4IRQA 5HS2A 3CGXA 5C36A 1INJA 4ECMA 2O1GA 5IFYA 1VPAA 5D92A 2X5SA 1VGTA 4FQWA 1VICA 1GQCA 3I0GA 3U2VA 3DUVA 1NQIB 5C4CA 2X5ZA 4D0TA 4EE5A 1NF5B 1R7VA 2AECA 4HG6A 1H4CA 4AC3A 5JQQA 4FIYA 1H5RA 1IIMA 1ZHJA 3T7MA 3SXEA 4MIXA 3OH0A 1OMXA 4B4BA 4Y63A 4CVHA 1LL2A 3I0LA 1TW1A 3F1CA 4KPXA 3QVBA 4Y64A 5FUHA 1FOAA 3V0LA 1O23B 4G3SA 1ZJ2A 1EYRA 4UEGA 3GUEA 1VGWA 4G3QA 4NAIA 1JVGA 2WEEA 4EE3A 3CKNA 1I52A 2WAWA 1IINA 4FROA 1H7FA 2I5KA 2I7BA 1MP5A 2FYCB 1MC3A 1ZDFA 1FXOA 2O1FA 5CQLX 1G2VA 3U2WA 3ZGFA 3SX5A 2OI5A 3SXGA 1ZI5A 4JISA 3V0NA 2QKXA 4YS8A 1FR8A 4EEMA 2RIXA 2AESA 1H7GA 2Q4JA 4KPZA 3DK5A 2A8WA 4Y7TA 3V0QA 4FIXA 3Q80A 4G87A 4K6RA 4J18A 2APCA 1FZWA 2W0WA 3T7OA 4M4KA 2ZU7A 1O7OA 5C49A 1ZIZA 2VSHA 1LZ7A 1G8OA 4CJ8A 2UX8A 3ZF8A 5CQNX 5FYEA 1ZI1A 2ZU9A 3OC9A 3SX3A 2X65A 3V0MA 1W55A 2RJ0A 5FV9A 2YQCA 2WVMA 1HJLA 3I0IX 2V0HA 2XMHA 4FREA 1S4NA 3N9WA 4DECA 4EVWA 1QGQA 4KQLA 2Y7AA 3U0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT1 A;  3Q4S A;  3Q7U A;  1GA8 A;  3I0J A;  4HOC A;  1WVC A;  1GQ9 A;  3SXD A;  4HO0 A;  4NAK A;  1O7Q A;  2XWM A;  1XHB A;  2RJ4 A;  1PZT A;  2AGD A;  3CU0 A;  2I5E A;  1H5T B;  1HM8 A;  3CKV A;  4B4G A;  2D7R A;  1VZX A;  3V0P A;  1ZJ1 A;  1R80 A;  1VH3 A;  3I0D A;  3TZT A;  1MP4 A;  1QG8 A;  3U2U A;  1GX0 A;  2D7I A;  4FCU A;  1W57 A;  1YP3 A;  2YC5 A;  1ZI3 A;  4MND A;  3ZGG A;  4BQH A;  1Z90 A;  1QGS A;  1NMM B;  1R7T A;  1FO8 A;  1H5S C;  1FG5 N;  1R7U A;  2JCK A;  4Y6N A;  1LZI A;  3OH3 A;  1TW5 A;  2E8B A;  4Y7G A;  5BXC A;  4FRH A;  3IOH A;  2JCL A;  3SXB A;  2GGQ A;  5IDS A;  3OH2 A;  4LW3 A;  1G23 A;  1H4D A;  4GBP A;  1ZJ0 A;  4MYB A;  3SX8 A;  3HL3 A;  5C1H A;  3RMW A;  1G3L A;  1JV3 A;  1H5T A;  5AJO A;  4B3U A;  3FWW A;  2OEG A;  3JUJ A;  5EJ1 A;  4KC2 A;  4B5B A;  4D11 A;  2YQJ A;  1FGG A;  2XWN A;  4B42 A;  1JV1 A;  4ASY A;  2O1H A;  3U2T A;  1NWG B;  5FTS A;  3K8E A;  4KC4 A;  5I1F A;  1VGU A;  2VXL A;  2AM4 A;  4LW6 A;  3TQD A;  5DDT A;  1YP4 A;  1S4O A;  2Z86 A;  2P6W A;  3OKR A;  4FCE A;  5C47 A;  2RIZ A;  5CMI A;  1MP3 A;  1JYL A;  1FWY A;  2RJ9 A;  1VZU A;  3JTJ A;  4CJB A;  2AM3 A;  5CMH A;  5C4B A;  1ZCY A;  2VSI A;  2V0K A;  5DDV A;  1GX4 A;  5C8R A;  1R7X A;  4D0Z A;  4KRV A;  1VZT A;  4B4M A;  1H7Q A;  2X60 A;  4FRD A;  1V82 A;  2BO8 A;  4HO5 A;  2RJ1 A;  3F1Y A;  3D98 A;  2D0J A;  4EEG A;  1XZ6 A;  4EE4 A;  2YCM A;  3DJ4 A;  1TZF A;  1G93 A;  4Y62 A;  4B2X A;  1H4E A;  2WVL A;  2ICX A;  1ON6 A;  5L6V A;  4Y7F A;  1H7E A;  3SXC A;  4KNR A;  3E25 A;  4P02 A;  2W0V A;  4L41 C;  2FFU A;  3D8V A;  4B2W A;  1JYK A;  3PNN A;  3NGW A;  3USR A;  1WT2 A;  4HO6 A;  1LL3 A;  2WGZ A;  2MZB A;  2AM5 A;  2VD4 A;  1YP2 A;  2QH5 A;  1H7T A;  2FYB A;  4XWI A;  1WT0 A;  2P72 A;  3SXA A;  4EEO A;  4HO2 A;  2Y4K A;  1GWV A;  2OEF A;  3ZLL A;  4AYJ A;  1VM8 A;  4FRB A;  4G3P A;  2XWL A;  2PGV A;  3POL A;  5C4E A;  2BO4 A;  3V8Z A;  5AJN A;  1ZCU A;  4KC1 A;  2Z87 A;  3OAM A;  2RIY A;  2P73 A;  2Y6P A;  3PKP A;  5CMJ A;  5C1G A;  2VXM A;  1R82 A;  1G9R A;  1ON8 A;  4R7P A;  3CKO A;  3R2W A;  4BMA A;  3LW6 A;  2V0J A;  1HJJ A;  1E5K A;  3I0F A;  1ZCV A;  5C1L A;  2VS3 A;  1NHE B;  2VS4 A;  3V90 A;  5AJP A;  3U0X A;  3SPT A;  4JD0 A;  4EEA A;  1SS9 A;  3O3P A;  1NKH B;  1G0R A;  2Y4L A;  3V0O A;  4ARW A;  2FYD B;  5C3B A;  2AE7 A;  1S4P A;  2WE9 A;  4Y7U A;  3USQ A;  2RJ7 A;  1OMZ A;  2Y4J A;  4FRP A;  2OI6 A;  2OI7 A;  1QWJ A;  1WSZ A;  1LZ0 A;  4ASJ A;  5CMG X;  1R81 A;  2PGY A;  5C38 A;  2JCJ A;  4P00 A;  4M2A A;  2AH9 A;  2RIT A;  3JUK A;  1ZJP A;  1G97 A;  4HO8 A;  4Y9X A;  3ST8 A;  3I0C A;  5FTV A;  4DE7 A;  4KXO A;  2YQH A;  3U2X A;  2BO6 A;  4KNX A;  4AYL A;  4HCQ A;  4CJC A;  3FOQ A;  4HO3 A;  5J49 A;  4DDZ A;  1KWS A;  2BO7 A;  4NAN A;  1PZY B;  3PKQ A;  3RSB A;  5CQM X;  2NXV A;  1ZI4 A;  1JVD A;  3EE5 A;  2RJ5 A;  4ZDQ A;  1VGZ A;  2YQS A;  4Y7V A;  3OH4 A;  5CQO A;  3CKJ A;  2RJ8 A;  5C4D A;  4D11 C;  5C3D A;  1ZJ3 A;  3I0E A;  5CMF X;  1LVW A;  2V0L A;  4M28 A;  1H3M A;  5C4F A;  3ZLK A;  3K8D A;  3E26 A;  1OQM B;  2FFV A;  1ZDG A;  5CQP A;  2ZU8 A;  4C2S A;  1LL0 A;  4E1K A;  3IOJ A;  2Y4M A;  4FRL A;  1H5S B;  1EZI A;  1FXJ A;  1G95 A;  1HM0 A;  1TVY A;  2FYA A;  1GWW A;  4Y6U A;  3KIA A;  2DPW A;  3V91 A;  1ZJO A;  2WVK A;  1H7H A;  1O0R A;  1HV9 A;  2PA4 A;  2YES A;  5FU0 A;  3CKQ A;  5FU8 A;  2A8U A;  1H5S D;  1VH1 A;  4M2B A;  4HO9 A;  1H7L A;  1V83 A;  2VS5 A;  2FY7 A;  2QGI A;  3T7N A;  3OGZ A;  2E3D A;  1INI A;  3V8Y A;  1WT3 A;  4D48 A;  2GGO A;  4KT7 A;  4HO4 A;  1H5R B;  2RJ6 A;  4AAW A;  4FRA A;  1HM9 A;  3I0H A;  3R3I A;  1R7Y A;  5EIY A;  5L6S A;  1V84 A;  3SX7 A;  4NAL A;  3BRK X;  4FRM A;  2PX7 A;  5C48 A;  3OH1 A;  3D5N A;  2VFZ A;  1FRW A;  5EJZ A;  1K4V A;  1LZJ A;  5C3A A;  1FO9 A;  1W77 A;  1YRO B;  1H5S A;  2V0I A;  3I0K A;  2XME A;  3RMV A;  5IDT A;  4FRQ A;  3IOI A;  1ZCT A;  2YC3 A;  1FR9 A;  2JCO A;  1G1L A;  2ICY A;  3BCV A;  4IRP A;  1FGX A;  2CU2 A;  4IRQ A;  5HS2 A;  3CGX A;  5C36 A;  1INJ A;  4ECM A;  2O1G A;  5IFY A;  1VPA A;  2X5S A;  1VGT A;  4FQW A;  1VIC A;  1GQC A;  3I0G A;  3U2V A;  3DUV A;  1NQI B;  5C4C A;  2X5Z A;  4D0T A;  4EE5 A;  1NF5 B;  1R7V A;  2AEC A;  4HG6 A;  1H4C A;  4AC3 A;  5JQQ A;  1H5R A;  1IIM A;  1ZHJ A;  3T7M A;  3SXE A;  3OH0 A;  1OMX A;  4B4B A;  4Y63 A;  4CVH A;  1LL2 A;  3I0L A;  1TW1 A;  3F1C A;  4KPX A;  3QVB A;  4Y64 A;  5FUH A;  1FOA A;  3V0L A;  1O23 B;  4G3S A;  1ZJ2 A;  1EYR A;  4UEG A;  3GUE A;  1VGW A;  4G3Q A;  4NAI A;  1JVG A;  2WEE A;  4EE3 A;  3CKN A;  1I52 A;  2WAW A;  1IIN A;  4FRO A;  1H7F A;  2I5K A;  2I7B A;  1MP5 A;  2FYC B;  1MC3 A;  1ZDF A;  1FXO A;  2O1F A;  5CQL X;  1G2V A;  3U2W A;  3ZGF A;  3SX5 A;  2OI5 A;  3SXG A;  1ZI5 A;  4JIS A;  3V0N A;  2QKX A;  4YS8 A;  1FR8 A;  4EEM A;  2RIX A;  2AES A;  1H7G A;  2Q4J A;  4KPZ A;  3DK5 A;  2A8W A;  4Y7T A;  3V0Q A;  4G87 A;  3Q80 A;  4K6R A;  4J18 A;  2APC A;  1FZW A;  2W0W A;  3T7O A;  4M4K A;  2ZU7 A;  1O7O A;  5C49 A;  1ZIZ A;  2VSH A;  1LZ7 A;  1G8O A;  4CJ8 A;  2UX8 A;  3ZF8 A;  5CQN X;  5FYE A;  1ZI1 A;  2ZU9 A;  3OC9 A;  3SX3 A;  2X65 A;  3V0M A;  1W55 A;  2RJ0 A;  5FV9 A;  2YQC A;  2WVM A;  1HJL A;  3I0I X;  2V0H A;  2XMH A;  4FRE A;  1S4N A;  3N9W A;  4DEC A;  4EVW A;  1QGQ A;  4KQL A;  2Y7A A;  3U0Y A; 
#chains in the Genus database with same CATH topology
 1WT1 A;  3Q4S A;  3Q7U A;  1GA8 A;  3I0J A;  4HOC A;  1WVC A;  1GQ9 A;  3SXD A;  4HO0 A;  4NAK A;  1O7Q A;  2XWM A;  1XHB A;  2RJ4 A;  1PZT A;  2AGD A;  3CU0 A;  2I5E A;  1H5T B;  1HM8 A;  3CKV A;  4B4G A;  2D7R A;  1VZX A;  3V0P A;  1ZJ1 A;  1R80 A;  1VH3 A;  3I0D A;  2C0N A;  3TZT A;  1MP4 A;  1QG8 A;  3U2U A;  1GX0 A;  2D7I A;  4FCU A;  1W57 A;  1YP3 A;  2YC5 A;  1ZI3 A;  4MND A;  3ZGG A;  4BQH A;  1Z90 A;  1QGS A;  1NMM B;  1R7T A;  1FO8 A;  1H5S C;  1FG5 N;  1R7U A;  2JCK A;  4Y6N A;  1LZI A;  3OH3 A;  1TW5 A;  2E8B A;  4Y7G A;  5BXC A;  4FRH A;  3IOH A;  2JCL A;  3SXB A;  2GGQ A;  5IDS A;  3OH2 A;  4LW3 A;  1G23 A;  1H4D A;  4GBP A;  1ZJ0 A;  4MYB A;  3SX8 A;  3HL3 A;  5C1H A;  3RMW A;  1G3L A;  1JV3 A;  1H5T A;  5AJO A;  4B3U A;  3FWW A;  2OEG A;  3JUJ A;  5EJ1 A;  4KC2 A;  4B5B A;  4D11 A;  2YQJ A;  1FGG A;  2XWN A;  4B42 A;  1JV1 A;  4ASY A;  2O1H A;  3U2T A;  1NWG B;  5FTS A;  3K8E A;  4KC4 A;  5I1F A;  1VGU A;  2VXL A;  2AM4 A;  4LW6 A;  3TQD A;  5DDT A;  1YP4 A;  1S4O A;  2Z86 A;  2P6W A;  3OKR A;  4FCE A;  5C47 A;  2RIZ A;  5CMI A;  1MP3 A;  1JYL A;  1FWY A;  2RJ9 A;  1VZU A;  3JTJ A;  4CJB A;  2AM3 A;  5CMH A;  5C4B A;  1ZCY A;  2VSI A;  2V0K A;  5DDV A;  1GX4 A;  5C8R A;  1R7X A;  4D0Z A;  4KRV A;  1VZT A;  4B4M A;  1H7Q A;  2X60 A;  4FRD A;  1V82 A;  2BO8 A;  4HO5 A;  2RJ1 A;  3F1Y A;  3D98 A;  2D0J A;  2J0B A;  4EEG A;  1XZ6 A;  4EE4 A;  4O6M A;  2YCM A;  3DJ4 A;  1TZF A;  1G93 A;  4Y62 A;  4B2X A;  1H4E A;  2WVL A;  2ICX A;  1ON6 A;  5L6V A;  4Y7F A;  1H7E A;  3SXC A;  4KNR A;  3E25 A;  4P02 A;  2W0V A;  4L41 C;  2FFU A;  5D91 A;  3D8V A;  4B2W A;  1JYK A;  3PNN A;  3NGW A;  3USR A;  1WT2 A;  4HO6 A;  1LL3 A;  2WGZ A;  2MZB A;  2AM5 A;  2VD4 A;  1YP2 A;  2QH5 A;  1H7T A;  2FYB A;  4XWI A;  1WT0 A;  2P72 A;  3SXA A;  4EEO A;  4HO2 A;  2Y4K A;  1GWV A;  2OEF A;  3ZLL A;  4AYJ A;  1VM8 A;  4FRB A;  4G3P A;  2XWL A;  2PGV A;  3POL A;  5C4E A;  2BO4 A;  3V8Z A;  5AJN A;  1ZCU A;  4KC1 A;  4O6N A;  2Z87 A;  3OAM A;  2RIY A;  2P73 A;  2Y6P A;  3PKP A;  5CMJ A;  5C1G A;  2VXM A;  1R82 A;  1G9R A;  1ON8 A;  4R7P A;  3CKO A;  3R2W A;  4BMA A;  3LW6 A;  2V0J A;  1HJJ A;  1E5K A;  3I0F A;  1ZCV A;  5C1L A;  4Q7C A;  2VS3 A;  1NHE B;  2VS4 A;  3V90 A;  5AJP A;  3U0X A;  3SPT A;  4JD0 A;  4EEA A;  1SS9 A;  3O3P A;  1NKH B;  1G0R A;  2Y4L A;  3V0O A;  4ARW A;  2FYD B;  5C3B A;  2AE7 A;  1S4P A;  2WE9 A;  4Y7U A;  3USQ A;  2RJ7 A;  1OMZ A;  2Y4J A;  4FRP A;  2OI6 A;  2OI7 A;  1QWJ A;  1WSZ A;  1LZ0 A;  4ASJ A;  5CMG X;  1R81 A;  2PGY A;  5C38 A;  2JCJ A;  4P00 A;  4M2A A;  2AH9 A;  2RIT A;  3JUK A;  1ZJP A;  1G97 A;  4HO8 A;  4Y9X A;  3ST8 A;  3I0C A;  5FTV A;  4DE7 A;  4KXO A;  2YQH A;  3U2X A;  2BO6 A;  4KNX A;  4AYL A;  4HCQ A;  4CJC A;  3FOQ A;  4HO3 A;  5J49 A;  4DDZ A;  1KWS A;  2BO7 A;  4NAN A;  1PZY B;  3PKQ A;  3RSB A;  5CQM X;  2NXV A;  1ZI4 A;  2VK9 A;  1JVD A;  3EE5 A;  2RJ5 A;  4ZDQ A;  1VGZ A;  2YQS A;  4Y7V A;  3OH4 A;  5CQO A;  3CKJ A;  2RJ8 A;  5C4D A;  4D11 C;  5C3D A;  1ZJ3 A;  3I0E A;  5CMF X;  1LVW A;  2V0L A;  4M28 A;  1H3M A;  5C4F A;  3ZLK A;  3K8D A;  3E26 A;  1OQM B;  2FFV A;  1ZDG A;  5CQP A;  2ZU8 A;  4C2S A;  1LL0 A;  4E1K A;  3IOJ A;  2Y4M A;  4FRL A;  1H5S B;  1EZI A;  1FXJ A;  1G95 A;  1HM0 A;  1TVY A;  2FYA A;  1GWW A;  4Y6U A;  3KIA A;  2DPW A;  3V91 A;  1ZJO A;  2WVK A;  1H7H A;  1O0R A;  1HV9 A;  2PA4 A;  2YES A;  5FU0 A;  2J0A A;  3CKQ A;  5FU8 A;  2A8U A;  1H5S D;  1VH1 A;  4M2B A;  4HO9 A;  1H7L A;  1V83 A;  2VS5 A;  2FY7 A;  2QGI A;  3T7N A;  3OGZ A;  2E3D A;  1INI A;  3V8Y A;  1WT3 A;  4D48 A;  2GGO A;  4KT7 A;  4HO4 A;  1H5R B;  2RJ6 A;  4AAW A;  4FRA A;  1HM9 A;  3I0H A;  3R3I A;  1R7Y A;  5EIY A;  5L6S A;  1V84 A;  3SX7 A;  4NAL A;  3BRK X;  4FRM A;  2PX7 A;  5C48 A;  3OH1 A;  3D5N A;  2VFZ A;  1FRW A;  5EJZ A;  1K4V A;  1LZJ A;  5C3A A;  1FO9 A;  1W77 A;  1YRO B;  1H5S A;  2V0I A;  3I0K A;  2XME A;  3RMV A;  5IDT A;  4FRQ A;  3IOI A;  1ZCT A;  2YC3 A;  1FR9 A;  2JCO A;  1G1L A;  2ICY A;  3BCV A;  4IRP A;  1FGX A;  2CU2 A;  4IRQ A;  5HS2 A;  3CGX A;  5C36 A;  1INJ A;  4ECM A;  2O1G A;  5IFY A;  1VPA A;  5D92 A;  2X5S A;  1VGT A;  4FQW A;  1VIC A;  1GQC A;  3I0G A;  3U2V A;  3DUV A;  1NQI B;  5C4C A;  2X5Z A;  4D0T A;  4EE5 A;  1NF5 B;  1R7V A;  2AEC A;  4HG6 A;  1H4C A;  4AC3 A;  5JQQ A;  4FIY A;  1H5R A;  1IIM A;  1ZHJ A;  3T7M A;  3SXE A;  4MIX A;  3OH0 A;  1OMX A;  4B4B A;  4Y63 A;  4CVH A;  1LL2 A;  3I0L A;  1TW1 A;  3F1C A;  4KPX A;  3QVB A;  4Y64 A;  5FUH A;  1FOA A;  3V0L A;  1O23 B;  4G3S A;  1ZJ2 A;  1EYR A;  4UEG A;  3GUE A;  1VGW A;  4G3Q A;  4NAI A;  1JVG A;  2WEE A;  4EE3 A;  3CKN A;  1I52 A;  2WAW A;  1IIN A;  4FRO A;  1H7F A;  2I5K A;  2I7B A;  1MP5 A;  2FYC B;  1MC3 A;  1ZDF A;  1FXO A;  2O1F A;  5CQL X;  1G2V A;  3U2W A;  3ZGF A;  3SX5 A;  2OI5 A;  3SXG A;  1ZI5 A;  4JIS A;  3V0N A;  2QKX A;  4YS8 A;  1FR8 A;  4EEM A;  2RIX A;  2AES A;  1H7G A;  2Q4J A;  4KPZ A;  3DK5 A;  2A8W A;  4Y7T A;  3V0Q A;  4FIX A;  3Q80 A;  4G87 A;  4K6R A;  4J18 A;  2APC A;  1FZW A;  2W0W A;  3T7O A;  4M4K A;  2ZU7 A;  1O7O A;  5C49 A;  1ZIZ A;  2VSH A;  1LZ7 A;  1G8O A;  4CJ8 A;  2UX8 A;  3ZF8 A;  5CQN X;  5FYE A;  1ZI1 A;  2ZU9 A;  3OC9 A;  3SX3 A;  2X65 A;  3V0M A;  1W55 A;  2RJ0 A;  5FV9 A;  2YQC A;  2WVM A;  1HJL A;  3I0I X;  2V0H A;  2XMH A;  4FRE A;  1S4N A;  3N9W A;  4DEC A;  4EVW A;  1QGQ A;  4KQL A;  2Y7A A;  3U0Y A; 
#chains in the Genus database with same CATH homology
 1WT1 A;  3Q4S A;  3Q7U A;  1GA8 A;  3I0J A;  4HOC A;  1WVC A;  1GQ9 A;  3SXD A;  4HO0 A;  4NAK A;  1O7Q A;  2XWM A;  1XHB A;  2RJ4 A;  1PZT A;  2AGD A;  3CU0 A;  2I5E A;  1H5T B;  1HM8 A;  3CKV A;  4B4G A;  2D7R A;  1VZX A;  3V0P A;  1ZJ1 A;  1R80 A;  1VH3 A;  3I0D A;  2C0N A;  3TZT A;  1MP4 A;  1QG8 A;  3U2U A;  1GX0 A;  2D7I A;  4FCU A;  1W57 A;  1YP3 A;  2YC5 A;  1ZI3 A;  4MND A;  3ZGG A;  4BQH A;  1Z90 A;  1QGS A;  1NMM B;  1R7T A;  1FO8 A;  1H5S C;  1FG5 N;  1R7U A;  2JCK A;  4Y6N A;  1LZI A;  3OH3 A;  1TW5 A;  2E8B A;  4Y7G A;  5BXC A;  4FRH A;  3IOH A;  2JCL A;  3SXB A;  2GGQ A;  5IDS A;  3OH2 A;  4LW3 A;  1G23 A;  1H4D A;  4GBP A;  1ZJ0 A;  4MYB A;  3SX8 A;  3HL3 A;  5C1H A;  3RMW A;  1G3L A;  1JV3 A;  1H5T A;  5AJO A;  4B3U A;  3FWW A;  2OEG A;  3JUJ A;  5EJ1 A;  4KC2 A;  4B5B A;  4D11 A;  2YQJ A;  1FGG A;  2XWN A;  4B42 A;  1JV1 A;  4ASY A;  2O1H A;  3U2T A;  1NWG B;  5FTS A;  3K8E A;  4KC4 A;  5I1F A;  1VGU A;  2VXL A;  2AM4 A;  4LW6 A;  3TQD A;  5DDT A;  1YP4 A;  1S4O A;  2Z86 A;  2P6W A;  3OKR A;  4FCE A;  5C47 A;  2RIZ A;  5CMI A;  1MP3 A;  1JYL A;  1FWY A;  2RJ9 A;  1VZU A;  3JTJ A;  4CJB A;  2AM3 A;  5CMH A;  5C4B A;  1ZCY A;  2VSI A;  2V0K A;  5DDV A;  1GX4 A;  5C8R A;  1R7X A;  4D0Z A;  4KRV A;  1VZT A;  4B4M A;  1H7Q A;  2X60 A;  4FRD A;  1V82 A;  2BO8 A;  4HO5 A;  2RJ1 A;  3F1Y A;  3D98 A;  2D0J A;  2J0B A;  4EEG A;  1XZ6 A;  4EE4 A;  4O6M A;  2YCM A;  3DJ4 A;  1TZF A;  1G93 A;  4Y62 A;  4B2X A;  1H4E A;  2WVL A;  2ICX A;  1ON6 A;  5L6V A;  4Y7F A;  1H7E A;  3SXC A;  4KNR A;  3E25 A;  4P02 A;  2W0V A;  4L41 C;  2FFU A;  5D91 A;  3D8V A;  4B2W A;  1JYK A;  3PNN A;  3NGW A;  3USR A;  1WT2 A;  4HO6 A;  1LL3 A;  2WGZ A;  2MZB A;  2AM5 A;  2VD4 A;  1YP2 A;  2QH5 A;  1H7T A;  2FYB A;  4XWI A;  1WT0 A;  2P72 A;  3SXA A;  4EEO A;  4HO2 A;  2Y4K A;  1GWV A;  2OEF A;  3ZLL A;  4AYJ A;  1VM8 A;  4FRB A;  4G3P A;  2XWL A;  2PGV A;  3POL A;  5C4E A;  2BO4 A;  3V8Z A;  5AJN A;  1ZCU A;  4KC1 A;  4O6N A;  2Z87 A;  3OAM A;  2RIY A;  2P73 A;  2Y6P A;  3PKP A;  5CMJ A;  5C1G A;  2VXM A;  1R82 A;  1G9R A;  1ON8 A;  4R7P A;  3CKO A;  3R2W A;  4BMA A;  3LW6 A;  2V0J A;  1HJJ A;  1E5K A;  3I0F A;  1ZCV A;  5C1L A;  4Q7C A;  2VS3 A;  1NHE B;  2VS4 A;  3V90 A;  5AJP A;  3U0X A;  3SPT A;  4JD0 A;  4EEA A;  1SS9 A;  3O3P A;  1NKH B;  1G0R A;  2Y4L A;  3V0O A;  4ARW A;  2FYD B;  5C3B A;  2AE7 A;  1S4P A;  2WE9 A;  4Y7U A;  3USQ A;  2RJ7 A;  1OMZ A;  2Y4J A;  4FRP A;  2OI6 A;  2OI7 A;  1QWJ A;  1WSZ A;  1LZ0 A;  4ASJ A;  5CMG X;  1R81 A;  2PGY A;  5C38 A;  2JCJ A;  4P00 A;  4M2A A;  2AH9 A;  2RIT A;  3JUK A;  1ZJP A;  1G97 A;  4HO8 A;  4Y9X A;  3ST8 A;  3I0C A;  5FTV A;  4DE7 A;  4KXO A;  2YQH A;  3U2X A;  2BO6 A;  4KNX A;  4AYL A;  4HCQ A;  4CJC A;  3FOQ A;  4HO3 A;  5J49 A;  4DDZ A;  1KWS A;  2BO7 A;  4NAN A;  1PZY B;  3PKQ A;  3RSB A;  5CQM X;  2NXV A;  1ZI4 A;  2VK9 A;  1JVD A;  3EE5 A;  2RJ5 A;  4ZDQ A;  1VGZ A;  2YQS A;  4Y7V A;  3OH4 A;  5CQO A;  3CKJ A;  2RJ8 A;  5C4D A;  4D11 C;  5C3D A;  1ZJ3 A;  3I0E A;  5CMF X;  1LVW A;  2V0L A;  4M28 A;  1H3M A;  5C4F A;  3ZLK A;  3K8D A;  3E26 A;  1OQM B;  2FFV A;  1ZDG A;  5CQP A;  2ZU8 A;  4C2S A;  1LL0 A;  4E1K A;  3IOJ A;  2Y4M A;  4FRL A;  1H5S B;  1EZI A;  1FXJ A;  1G95 A;  1HM0 A;  1TVY A;  2FYA A;  1GWW A;  4Y6U A;  3KIA A;  2DPW A;  3V91 A;  1ZJO A;  2WVK A;  1H7H A;  1O0R A;  1HV9 A;  2PA4 A;  2YES A;  5FU0 A;  2J0A A;  3CKQ A;  5FU8 A;  2A8U A;  1H5S D;  1VH1 A;  4M2B A;  4HO9 A;  1H7L A;  1V83 A;  2VS5 A;  2FY7 A;  2QGI A;  3T7N A;  3OGZ A;  2E3D A;  1INI A;  3V8Y A;  1WT3 A;  4D48 A;  2GGO A;  4KT7 A;  4HO4 A;  1H5R B;  2RJ6 A;  4AAW A;  4FRA A;  1HM9 A;  3I0H A;  3R3I A;  1R7Y A;  5EIY A;  5L6S A;  1V84 A;  3SX7 A;  4NAL A;  3BRK X;  4FRM A;  2PX7 A;  5C48 A;  3OH1 A;  3D5N A;  2VFZ A;  1FRW A;  5EJZ A;  1K4V A;  1LZJ A;  5C3A A;  1FO9 A;  1W77 A;  1YRO B;  1H5S A;  2V0I A;  3I0K A;  2XME A;  3RMV A;  5IDT A;  4FRQ A;  3IOI A;  1ZCT A;  2YC3 A;  1FR9 A;  2JCO A;  1G1L A;  2ICY A;  3BCV A;  4IRP A;  1FGX A;  2CU2 A;  4IRQ A;  5HS2 A;  3CGX A;  5C36 A;  1INJ A;  4ECM A;  2O1G A;  5IFY A;  1VPA A;  5D92 A;  2X5S A;  1VGT A;  4FQW A;  1VIC A;  1GQC A;  3I0G A;  3U2V A;  3DUV A;  1NQI B;  5C4C A;  2X5Z A;  4D0T A;  4EE5 A;  1NF5 B;  1R7V A;  2AEC A;  4HG6 A;  1H4C A;  4AC3 A;  5JQQ A;  4FIY A;  1H5R A;  1IIM A;  1ZHJ A;  3T7M A;  3SXE A;  4MIX A;  3OH0 A;  1OMX A;  4B4B A;  4Y63 A;  4CVH A;  1LL2 A;  3I0L A;  1TW1 A;  3F1C A;  4KPX A;  3QVB A;  4Y64 A;  5FUH A;  1FOA A;  3V0L A;  1O23 B;  4G3S A;  1ZJ2 A;  1EYR A;  4UEG A;  3GUE A;  1VGW A;  4G3Q A;  4NAI A;  1JVG A;  2WEE A;  4EE3 A;  3CKN A;  1I52 A;  2WAW A;  1IIN A;  4FRO A;  1H7F A;  2I5K A;  2I7B A;  1MP5 A;  2FYC B;  1MC3 A;  1ZDF A;  1FXO A;  2O1F A;  5CQL X;  1G2V A;  3U2W A;  3ZGF A;  3SX5 A;  2OI5 A;  3SXG A;  1ZI5 A;  4JIS A;  3V0N A;  2QKX A;  4YS8 A;  1FR8 A;  4EEM A;  2RIX A;  2AES A;  1H7G A;  2Q4J A;  4KPZ A;  3DK5 A;  2A8W A;  4Y7T A;  3V0Q A;  4FIX A;  3Q80 A;  4G87 A;  4K6R A;  4J18 A;  2APC A;  1FZW A;  2W0W A;  3T7O A;  4M4K A;  2ZU7 A;  1O7O A;  5C49 A;  1ZIZ A;  2VSH A;  1LZ7 A;  1G8O A;  4CJ8 A;  2UX8 A;  3ZF8 A;  5CQN X;  5FYE A;  1ZI1 A;  2ZU9 A;  3OC9 A;  3SX3 A;  2X65 A;  3V0M A;  1W55 A;  2RJ0 A;  5FV9 A;  2YQC A;  2WVM A;  1HJL A;  3I0I X;  2V0H A;  2XMH A;  4FRE A;  1S4N A;  3N9W A;  4DEC A;  4EVW A;  1QGQ A;  4KQL A;  2Y7A A;  3U0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...