2E8PA

Solution structure of the n-terminal sam-domain of e74-like factor 3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GSSGSSGQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal SAM-domain of E74-like factor 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords ELF3 protein
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8pA01
2QARA 4PZOA 1OW5A 2LMRA 3BS5A 3BS5B 1WWVA 3TADC 2F3NA 2QKQA 1X9XA 2FE9A 2EAOA 1UCVA 2GLEA 1SV4A 4RQNA 4RQMA 2KMDA 2ESEA 2E8OA 4MHVA 2EAMA 2QB0A 1PK1A 1COKA 1X40A 1RG6A 5KNIA 1PK1B 2JV3A 4PZNA 2B6GA 3KKAA 2E8MA 1V38A 2KG5A 3SEIA 1X66A 1B0XA 1WWUA 1V85A 2KSOB 2E8PA 2D3DA 5J8YC 3H8MA 2QB0B 1SXEA 3TADA 5JU5A 4IS7A 2EANA 1KW4A 3TACB 5JTIA 5L1MA 2DL0A 2DKZA 2KIVA 3HILA 2K4PA 2KE7A 1SV0A 2Y9UA 2ES6A 1SV0C 5J8YA 4NL9A 1LKYA 1OXJA 4NL9C 1DXSA 3SENA 2QARB 2E8NA 2DKXA 1JI7A 2L5YA 1Z1VA 3BQ7A 2YTUA 2EAPA 1UQVA 2F44A 5F3XB 5JRTA 1LKYB 1SXDA 2LPEA 3IDWA 3KKAC 2KSOA 2D8CA 2F8KA 1F0MA 2K60A 4NJ8A 3BS7A 1PK3A 1SGGA 2Y9TA 1B4FA 2QB1A 3K1RB
chains in the Genus database with same CATH superfamily
4AP9A 4DL6A 1OUQA 3WU2U 3BZKA 1S97A 7ICEA 1N48A 4KLQA 4DL2A 1ZD5A 5D4BA 1UHUA 4YR2A 5J2DA 3QZ8A 4PHPA 3I1YA 3Q8MA 1CEZA 1YT3A 5KFSA 2E8OA 1XWLA 4KLFA 2KNJA 3GIMA 1L5UA 2RP5A 1RXWA 2LKYA 5BPCA 3PW7A 4IQWA 2OYYA 1CRXA 1PVQA 3KZIU 3E58A 3V6JA 3NS1A 5EWEA 3H4BA 4M04A 3HP6A 3GFKB 4YVZA 1QQ6A 4YD2A 4Y2VA 3HILA 1L3SA 4Q8EA 2KE7A 5EWGA 2XGQA 4C8KA 2ZTDA 4RT2A 2W3RA 1MC8A 2LM1A 4JUZA 4O5KA 5KAIU 4B9MA 2EDUA 4YMNA 5J2FA 4RT3A 3KFUF 2ZXIA 4IR1A 8ICBA 4C4SA 1TV9A 2NYVA 1ZQ1C 3B9JA 2G06A 2N1RA 1WUDA 2KZZA 1Z1VA 3CP8A 4CDGA 1COOA 4QZHA 3BZCA 3WKAA 1ZJMA 5AI9A 2PFQA 3QEBZ 1IG6A 3M9NB 1K1SA 2PMZC 3NVYA 9ICLA 2W9CA 5J0QA 5KT5A 4IQVA 1NJXA 1KLNA 5KFEA 1QH9A 4J9NA 1KQQA 3MR5A 3E0FA 1T94A 4AYBF 1UT5A 5CWRA 5J2HA 3NVWA 4ECRA 2DUYA 1BPBA 4XUSA 4JV1A 2Y1JA 3SQIA 5ALHA 4C7YA 4BJQA 5KFZA 9ICNA 4ED3A 2K4IA 2KHQA 3UMBA 2C22A 4FO6A 3PSPA 4GC6A 2EZZA 3C5GA 1ZD2P 3EW9A 3F2DA 3KHGA 3ISBA 5AM5A 4OO1J 2BZFA 3V7JA 5DB7A 3MABA 2G0AA 4B6JA 5KNIA 2BDUA 4IL6U 4PHEA 4DOCA 5AIAA 4DSLA 5DG8A 3JPQA 4C4TA 2DGZA 4M0AA 5EWFA 2HVHA 3SEIA 5KTQA 4EEKA 2ZTCA 3AL0B 4B9VA 4F8RA 1QSLA 4KLJA 4PGQA 1V85A 4I2AA 3PSFA 1D8LA 4TQRA 2G5HB 4HAIA 2NO4A 5BOMA 1ZQWA 2ZJ5A 4DSJA 2K4PA 3HT3A 3PY8A 7ICJA 3HRDD 7ICKA 2Y0SF 2GWSA 4ZH4A 1X9MA 3SENA 2WF9A 4GXJA 1D9DA 2WF7A 7ICTA 1HUZA 7ICOA 3T5JA 2OWOA 3V72A 5L1LA 4YXMA 4C8MA 5JUMA 5KT3A 2YMQA 1RQNA 4YP3A 2ZIUB 4QZIA 4IRDA 3TARA 4YCXA 2OEHA 1DK2A 2F77X 2MUTB 2K60A 4U7CA 3QX7A 3UMCA 1SGGA 2Y9TA 1NK0A 2JXJA 3AMZA 5KFPA 2H3FA 1FEZA 4UB3A 4RQ3A 2JEFA 3RH5A 3FM9A 2F1JA 4Y2YA 4F5OA 1KDHA 5AM3A 4BXOA 4IQUA 3C1ZA 3CNHA 4UASA 2JEJA 1EXNA 3PO4A 4CF5A 2ALZA 3ZD9A 3N28A 2R8IA 3DDHA 1DRGA 5T14A 5C0YA 4UB2A 2W9AA 2AU0A 9ICTA 3RAQA 9ICOA 5EE1A 5KG7A 3OHBA 4DFDA 4O5CA 1ZQMA 3TAQA 2IOFA 1ZQPA 1YZ6A 1S10A 1ZQUA 1B0XA 1WWUA 9ICGA 2UVVA 1UT8A 5DGAA 3RRGA 3ONNA 4F4XA 8ICLA 2Q4TA 5IIKA 1NK9A 3KHLA 1NJZA 1N63A 4TUPA 1TAMA 2NRVA 5ALLA 5CEHA 3PMNA 4JV2A 2NRWA 4RPZA 2BQRA 4UARA 1KRPA 5H2FU 3WKBA 5ALPA 2XCAA 2RRDA 5ALNA 4I2GA 5HR7A 8ICRA 9ICCA 1TE2A 4F93B 4M9NA 2KVSA 2E5SA 2KN7A 4F92B 8ICTA 4LZGA 2EAPA 2H3ZA 1MSWD 3V7LA 4I29A 3IDWA 3KKAC 4F71A 3F2BA 4BWMA 4DSKA 4PHDA 1IM4A 3IV6A 3K1RB 4OJLA 3AM9A 1ZQTA 5ALKA 2UVUA 5CA7A 2NO5A 1NI3A 5KFOA 2RQ5A 3AU6A 2KIWA 3BS5A 1H38A 3OSNA 3JPSA 3PO5A 2YMMA 2OHFA 4F2SA 3CYMA 4RU9A 4MFCA 2R8HA 1JALA 5J0SA 1QSSA 1ZQDA 3AQEA 3TI0A 2K89A 1Z00A 2ATLA 3OGUA 5J2JA 2OH2A 4KX5A 3MGIA 3T79A 3F2CA 1XNSA 1X40A 2IBKA 3QU7A 4TURA 2ISPA 4BUGA 5IIIA 4PL2A 3JPNA 5CR0A 5AK5A 3QU5A 4QIWC 2E8PA 5AKEA 5J8YC 4EYHB 1KBUA 2I1QA 2AGOA 5J2IA 3GIKA 2W9CB 3QU4A 3M6ZA 1IIPA 2WF5A 4ED8A 3TAPA 4EEYA 2DL0A 5J2GA 1MA7A 2IA6A 4DFPA 4C8NA 2R18A 5IIMA 3SZ2A 4MEXA 2PI5A 1FFVA 5BOLA 8ICIA 2A3VA 4PJ0U 1X42A 3C23A 5HR6A 4PHAA 2DKXA 1JI7A 3H0LB 1ED1A 4Y2XA 4DEZA 1S77D 5KL8B 4YXJA 1FO4A 4RZRA 3TFSA 4JK1A 1Z00B 4DFMA 2QB1A 1XO0A 4YMOA 4DQPA 2XI9A 4EBDA 4YN4A 1MQ3A 5CP2A 2VANA 5DKWA 4EBEA 3I76A 1ZXIA 3GDXA 5KFLA 3JPPA 3Q8QB 2K8BB 4F91B 1L7PA 4RQNA 5DQGA 5EE0A 4C8LA 3RJEA 5KG1A 3ZD8A 4NM2A 3PVXA 1IV8A 4GIBA 4E0DA 3H7IA 9ICWA 4QZDA 3IN5A 4P0PA 1ZQVA 4PZNA 5DDMA 1U9LA 4R66A 3OHAA 5KFUA 5J0OA 2JH1A 2NRTA 2E8MA 4O3RA 4NY8A 3PSTA 1ZYQA 3B0YA 1ZQLA 1BPYA 3HW8A 4KLGA 4RQ2A 1ZOLA 4FZMA 1ZQFA 4UAWA 1N61A 1NJYA 2V4QA 5DB6A 9ICXA 2VA8A 3OJSA 3M1YA 4ED6A 4ELVA 3TACB 5ALOA 4QWCA 3HWTA 1Z19A 2FI1A 4J9KA 3MFIA 1SKRA 1KL9A 4NLZA 4TQSA 4DL4A 3L3FX 3PZPA 3GIIA 2DFLA 1CI4A 1RPLA 2HCFA 1N56A 2L5YA 4O3SA 5KFHA 2HBJA 4QZEA 4KLUA 1SXDA 2LYHA 4J9MA 2F8KA 4ICAA 4NLNA 3RJIA 3T5HA 4QZFA 4ECZA 2WAQF 2NV3A 1PUZA 8ICUA 1A76A 2IHMA 3UXNA 1B43A 1ZQBA 4DL5A 3MBYA 3V6HA 1WWVA 4KLMA 2Z7JA 5EOZA 4QZGA 2ZUCA 5AKZA 2W54A 3ZDAA 2ZUDA 3M8RA 2DPIA 5KT4A 4DLGA 3M6KA 3T5LA 1L8OA 2KJ5A 2JGAA 2KMDA 3QUBA 5IIOA 7ICRA 1RYRA 4QZAA 3ICXA 3IG8A 4J9OA 3D2QA 4JMUA 2HW3A 9ICFA 4CF3A 8ICNA 2LM4A 3LWMA 1IXRA 2F1IA 4B9LA 3WK4A 3LWLA 4Q8FA 4DSEA 5ALYA 2MA1A 4GFJA 3SR6A 2H3VA 2LHTA 1ZQQA 1ZQYA 2CRXA 5J29A 4KMOB 1VLBA 2YQEA 1NK7A 1SL1A 4ED2A 2BHNA 1SV0A 4XRHA 5EE9A 1S0OA 3JPTA 4R63A 3C29A 5AKJA 9ICSA 2W9MA 4BGDA 3F53A 4RQ4A 4F4ZA 3C2KA 4DL7A 3C1YA 2W9BB 1BPDA 1C7YA 1L3UA 2Y0SC 4JB3A 4O9MA 5AI5A 5HNKA 1TK8A 4NV0A 2IMWP 5ALMA 2C28A 3QXGA 5AM0A 1JIHA 1JX4A 3M9MB 1SKSA 2YMLA 3KHHA 1RYSA 4CGZA 3QUCA 1ZQCA 3JPRA 1HJPA 4PZOA 5J0YA 5J0RA 3U26A 1KFTA 3C2LA 4KN7A 1NZBA 1QCKA 3TFRA 5KFYA 1X9XA 2VJ4A 4QWBA 3QYPA 1B22A 3C28A 1X9SA 4RQMA 1NKCA 1ZQIA 3THVA 3G6VA 5KG6A 1XSNA 2HHVA 5KT2A 1COKA 3QNMA 3UQ2A 2FLLA 2RDIA 2BQUA 3Q8PB 3QZ7A 3MGHA 5F9LA 5J0WA 4DQRA 3DEEA 3WK9A 4I2EA 2XY5A 9ICUA 3H8MA 4PGXA 2J6TA 4ECWA 1X9WA 5JU5A 4ED7A 1NK8A 2EANA 3PX4A 1KW4A 2ZTEA 4KLEA 3L4PA 2K4EA 3AQFA 2HOQA 7ICUA 4QIWF 2KIVA 3SD7A 4ECXA 2KTQA 3GIJA 4B9SA 1NK5A 3N7PD 2GO7A 3NASA 1S9FA 4UB1A 1Q8KA 4GXIA 3QE9Y 7ICSA 5ALEA 4UQGA 1OXJA 3GU3A 4NL9C 1ZQSA 3HKZF 5J0PA 1ZQNA 2FMPA 1ZQKA 7ICPA 5AIBA 4KMUA 3PV8A 2E1FA 4YD1A 1L6NA 1L3TA 1SWWA 2P35A 4NLGA 1X2IA 2MUTA 1Z3EB 9ICEA 7ICFA 1ZQXA 4O3QA 4NLKA 2QARA 2KHVA 1KKXA 4KLLA 4ECSA 3ZDCA 1ZJNA 4CE6A 3ZDDA 5KG4A 3H4DA 3FC4A 4F5NA 4EZ6A 2QLTA 2C2RA 1L7NA 3PMLA 5K4LA 2EAMA 2QB0A 4LJXA 3SV4A 4J9SA 4BWJA 1RG6A 1PK1B 4LZDA 3UMGA 2JV3A 4RQ0A 3RJJA 3GZFA 3N4MB 2FMQA 5KFRA 3M9OB 2ZG6A 4DSIA 2ASDA 4M47A 1SXEA 2PKEA 3BQ1A 4MF2A 5IINA 2GOLA 4MF8A 2G08A 1L8LA 4UAYA 2P6UA 4Z6DA 5AKKA 4Y2UA 8ICMA 1QSYA 3BQ0A 3B0XA 3WKCA 3PR5B 4I28A 5KFXA 4M2YA 4GC7A 2P66A 3N7RC 4OCZA 1SWVA 2WF6A 2Y1IA 3EZ5A 5AI8A 1KFDA 2BPCA 2ZIVB 5AK3A 4M6WB 3HX0A 4F3OA 3QUQA 2EZYA 4Z6EA 3PSIA 4R8UB 4RNMA 3H8SA 1S8OA 1ZETA 3SAHA 3OJUA 2LPEA 3BQTA 3SI8A 2RLTA 3RJHA 1T8EA 4KLHA 3AN1A 3BS7A 3H8JA 8ICJA 8ICHA 2V9WA 2F1HA 4TUQA 5L1IA 1K1QA 2XY6A 4O3NA 1OW5A 5IILA 3BS5B 4R65A 1LB2B 4G9BA 4QZBA 4XA5A 7ICNA 2QKQA 3Q8LA 4CF4A 5KFWA 4C80A 5J0XA 1UCVA 3EYZA 3VC8A 2ZIWA 1PVPA 3Q8SB 1P7DA 2KJ9A 2KZMA 8ICKA 3ISCA 2H5XA 4F4YA 1TAUA 4PPXA 5FP0A 2IOHA 2E3TA 2A1AA 3GV7B 3SMVA 5CRXA 4C8OA 2H3QA 5KFJA 5AK4A 3NUQA 2B0CA 3MFHA 5F9NA 5AKLA 5AM1A 4DF4A 4I2HA 1ZQOA 8ICEA 4ECVA 4QZ8A 4IS7A 3RRHA 5KFGA 3RH4A 5DLFA 4NM1A 2WF8A 1C20A 1QTMA 1J2MA 4IC9A 3MGVA 2W8LA 2WFAA 5DLGA 2ZIWB 1V9PA 3NGDA 2J6UA 9ICMA 2MAXA 3EWAA 5ALUA 2R8JA 5KG0A 5TZVA 1A0PA 5KL1B 1X6JA 4PH5A 1PZNA 2F44A 2UVRA 1NK4A 4PGYA 4J9RA 1KFSA 3T3FA 3H0MB 2P6RA 4DL3A 3UPQA 2G09A 4O3MA 2G07A 1QLNA 3NVVA 5KFIA 4FZNA 4KN4A 2HSZA 3RTVA 4NLBA 2AJQA 1VJ5A 2K8AA 4Y2PA 5J2KA 4BXOB 4I2JA 5KG5A 4M9LA 5J2CA 8ICVA 4US8A 1Z1BA 3AU2A 3ISDA 4F5RA 2F76X 1AQ6A 4Q43A 2FPKA 3LVVA 2VJ5A 4P4PA 4K4IA 1K5OA 5J2EA 4YFKA 5DQIA 4EX7A 3OTQA 4US9A 2OM6A 1N2XA 4FS2A 5AI6A 4XQ8A 2KKPA 5KFMA 2RHFA 1TK0A 3NTUA 3HPOA 2ZIXA 1WYGA 4F4WA 1ZQGA 1XU4A 3HJEA 5ALTA 3Q8KA 1WCLA 5A0LA 3N7SC 2W55A 3QUTA 4RQ7A 4P0QB 2NRXA 2YB1A 3M8SA 1UPHA 3UM9A 4C7ZA 1NZPA 2W03A 4DWIA 5B66U 3S6JA 1DGSA 4P4OA 2AQ0A 5D49A 4DCCA 3EPIA 3RB6A 1NJWA 4UATA 2KVCA 2ZJ8A 3LK9A 1KTQA 5AKHA 3L5KA 4QJFB 5KFVA 3CW2C 1NKBA 2LMRA 1ZD3A 3LYSA 4DSFA 5GTIU 2GH1A 4UAVA 3WK8A 3TADC 3RJGA 2MRLA 2C2DA 2EAOA 4ECTA 1SV4A 9ICKA 5HMMA 1ZQRA 5J2AA 3N97B 4K4HA 2PFOA 4DFKA 4IRCA 5ALZA 4NXZA 5ALVA 2W7OA 1N5WA 2MU2A 3IP4B 2HVIA 3GILA 2HBMA 1L3VA 1ECWA 2KG5A 1V38A 8ICSA 3RB0A 1U4BA 2PMZF 2WHEA 4Q44A 3BQ2A 5AKGA 5E79U 3BDPA 2D3DA 1DOQA 5KG2A 4F2RA 4M9GA 3FYHA 2HHXA 1ZQJA 9ICBA 1TK5A 4QNLA 2HHSA 1ZQAA 3MC1A 2ZIVA 1JXEA 3D2NA 4UB4A 2HHTA 2XCPA 2WB1C 2HOIA 4Y2QA 1S0NA 1SB3C 4J9PA 2JH7A 3PW5A 5KT6A 1QQ5A 1O03A 2M0NA 3VCBA 5ALRA 2KZ3A 2JEIA 3C2MA 1LV5A 1KSPA 3AEVA 5J0UA 4J9QA 3PW2A 2PFPA 5DDYA 1SL2A 1SZPA 4JWMA 2YTUA 1FIQA 4OJPA 1GO3F 1LKYB 1WCNA 3NVZA 2HDOA 3V7KA 1WG8A 4RQ5A 2M9NA 5AM4A 1B4FA 2DF4B 3GQCA 4FFDA 2A19A 4DLEA 4K4GA 2KFZA 3ETLA 8ICPA 3WKEA 4QWAA 2JHDA 4ELTA 5L1JA 8ICFA 4R8UA 3K75D 2FE9A 2AGPA 4EENA 2KV2A 4OJOA 4I2CA 2HHQA 4I2IA 2ESEA 5HHIA 4GXKA 4DFJA 7ICQA 2CXYA 2IHNA 3IG5A 1ZQHA 3RR7A 4B9TA 2NRZA 4QZCA 2J6SA 8ICWA 1L7MA 1NKEA 3WK5A 4ACOA 1MQ2A 2BPGA 2W7PA 2HOFA 1ZQEA 2KFNA 3ORYA 1HUOA 2E1EA 3O0FA 2QB0B 4DS5A 2AHOB 1U47A 3TKAA 4O0IA 4I27A 1CUKA 1TVAA 2HBLA 3KTQA 3KBBA 4Z6FA 2AQ4A 1RM6C 8ICQA 2K4HA 2Y9UA 9ICJA 4J03A 2ES6A 2I6XA 3C5FA 4I2BA 4A8EA 1DK3A 2JR5A 3JPOA 1Z4OA 2BCQA 4IRKA 1RQLA 2LI6A 3DV9A 4NLCA 2W3SA 2W9BA 2PXIA 3TANA 1TAQA 5IIJA 1BNPA 5ALWA 4KLIA 2XC9A 2BQ3A 2HHUA 2EZXA 5EE3A 3ED5A 1BGXT 1UA0A 2DBYA 2KSOA 1S0MA 2XY7A 3IM1A 4GLXA 5DG9A 2ZJAA 3H40A 1ZRNA 1RZTA 3RB3A 1YZ7A 4KLSA 1U49A 2DQNB 1RYUA 1Z4NA 3NRZA 4ECYA 2ZIUA 4ZOHC 1NK6A 5DQHA 3G6XA 2G5IB 3PX6A 4B9NA 1UA1A 4KTQA 4KLOA 1VDVA 4KX3A 2FLPA 5ALXA 4P0QA 5KAFU 2ZIXB 1V97A 4MHVA 5ALIA 3FAHA 3KHRA 2KEYA 4USAA 1XSPA 1JRPA 3QU9A 1SZHA 4RPXA 4F4KA 1J97A 1S5LU 3F5AA 4NWIA 2R8GA 5KFAA 1JXLA 3KZXA 3UXOA 4TUSA 1KN5A 1AROP 4BX9C 4DOBA 4P2HA 3TADA 5KFDA 3UQ0A 4Q45A 3PW4A 1D8YA 4X5VA 5D46A 5ALFA 3MDCA 3MR6A 9ICRA 2JZBA 3WK6A 5J8YA 7ICMA 5AI4A 3SV3A 7ICVA 4OD0A 2KICA 1D8BA 2PI4A 2HBKA 2OCEA 4FZLA 3AUOA 3H8WA 5AI0A 3KOOA 1ZD4A 2AH5A 2I5HA 3WKDA 3HKZC 1UQVA 5AKYA 1LVHA 2EH9A 2HI0A 7ICHA 5CHGA 3A0HU 1T7PA 3SAGA 8ICAA 4NJ8A 1BPZA 4AYBC 1Q3UA 2VA2A 2FMSA 2XICA 3ETRA 2XO7A 4ED1A 1JUDA 9ICHA 1J2NA 5DB8A 4DQQA 2CN1A 5ALGA 4UBCA 4Z6CA 4ED0A 5DG7A 4DOAA 4F50A 4O5EA 4O3OA 2BCSA 4DS4A 3K4GA 9ICQA 4M9JA 1JMSA 4FE3A 1XS9D 4QZ9A 2BCUA 1HIWA 4RPYA 4ECUA 3RR8A 2FPLA 2BR0A 4R64A 2YMPA 5L1KA 4FS1A 5KFBA 4RNOA 3KKAA 2PFNA 4B9UA 3Q8RB 7ICGA 3OPXA 1MN8A 1X66A 1S0VA 4UAZA 4Y2RA 2V4RA 2DWQA 2OXOA 1XC9A 2JZBB 4JV0A 2MSNA 9ICAA 1RXVA 4FBTA 2ASJA 4UB5A 2DKZA 5KFCA 1FFUA 4OJ5A 5L9XA 3R9KA 1TFRA 3V6KA 1SV0C 2CPRA 2LYBA 3D6JA 2VA3A 4Y2TA 2DPJA 1XSLA 1NNLA 3ZI4A 2XGPA 4DQSA 2BGWA 4I2FA 4CRXA 3A0BU 4RNNA 2O6KA 5TISU 5HMLA 3T5KA 5J0TA 3GV5B 2ISOA 3GV8B 1S76D 3QU2A 1U48A 3E2EA 1N62A 1PK3A 3UXPA 3RBEA 1U45A 4MEYA 2LBOA 2BKEA 1Q46A 4UW9A 4EBCA 3J81j 2BCVA 1A6SA 4UB8U 3KD3A 2FJ6A 1PVRA 2F2AB 3OSPA 2F3NA 4F5QA 8ICGA 4F72A 3FDSA 2JRZA 2AXTU 2F8LA 2KKVA 2YB4A 4QW8A 2FDRA 1HEKA 3RFAA 3RB4A 7ICIA 5HHHA 1F44A 1BPXA 1T3QA 2ZUBA 3I28A 4IR9A 4EELA 2AGQA 2YY6A 5GTHU 9ICIA 2W43A 5KT7A 4IQTA 1ZQZA 2VIXA 4QWEA 1RDFA 1T4GA 2YN4A 2FLNA 4QWDA 2KD1A 1SKWA 5KFTA 5DBCA 2JMGA 2YX8A 1DGJA 3G6YA 1BPEA 2KSOB 4UBBA 5G5HA 4WJ3B 2KK0A 4YQWA 5AHXA 5KG3A 4EX6A 2W04A 5AICA 5JTIA 5DB9A 2BPFA 4HYKA 3H0RB 5KFKA 2R8KA 4PL1A 4CCHA 3MDAA 3EUB2 2A1JB 4G3IA 2H3IA 4U6PA 4NL9A 1D9FA 1SL0A 4RQ8A 4KLTA 5DBAA 1BVSA 5ALQA 2E8NA 3ZDEA 4O3PA 4DQIA 5HP4A 5ALSA 3RH6A 5AK6A 4F5PA 4P0PB 5C5JA 1N60A 3F5EA 3BQ7A 3MR2A 2JEGA 4I2DA 2KP7A 4C0ZA 2W8KA 4UAUA 3QEAZ 1T3NA 5F3XB 3RJFA 5JRTA 4EZ9A 1X6IA 4DF8A 1JROA 5B5EU 4RQ1A 2D8CA 4C4RA 1F0MA 2IOFK 2WAQC 4QW9A 2HHWA 2ASLA 5DGBA 2B21A 4DO9A 1O08A 5DBBA 2EQYA 5AM2A 1URJA 1Y88A 2W11A 2I9GA 3PW0A 8ICYA 8ICZA 5J2BA 1N5XA 8ICCA 2KJ8A 4ECQA 1XO1A 1L7OA 4FBUA 5CJ7A 3ALRA 3SYZA 2GLEA 5KFQA 3IHQB 4M9HA 5ALJA 3SAFA 4YR3A 4CNQA 1F5SA 2WTFA 2ZXHA 4KLDA 1PK1A 4J9LA 5AKXA 4M6WA 4YG2A 4LVSA 2D6FC 4BDPA 1SIJA 3TQ1A 2B6GA 3RJKA 3LDAA 9ICPA 4YR0A 1TKDA 4ELUA 8ICXA 5G5GA 3RBDA 4MFFA 5KFNA 2WB1F 1A77A 8ICOA 2ODGA 1BNOA 5AKIA 1QQ7A 2XVTA 1Q3VA 4RQ6A 4KITB 2C2EA 2LYAA 3K1ZA 3LVWA 3PX0A 1NOMA 2VKQA 4MFAA 2FPMA 3PNCA 3MR3A 5L1MA 2K8CB 9ICVA 3NRWA 2XIDA 2HMXA 4UB6U 5KFFA 1ZRMA 1JN3A 4JWNA 3RAXA 2KOBA 1LKYA 1DXSA 3RF9A 2QARB 5CB1A 4P4MA 3D2SA 5ALDA 7ICLA 4Y2JA 3CRXA 4YMMA 2UVWA 2BCRA 2RDJA 3PR4A 4RUAA 3M7DA 2A1JA 3ZDBA 2BDPA 4EYIB 3C21A 2Q0ZX 3IRUA 4OJ6A 4Y2SA 3BJYA 3WK7A 3EPGA 1KEJA 1M6YA 4RUCA
chains in the Genus database with same CATH topology
2QARA 4PZOA 1OW5A 2LMRA 3BS5A 3BS5B 1WWVA 3TADC 2F3NA 2QKQA 1X9XA 2FE9A 2EAOA 1UCVA 2GLEA 1SV4A 4RQNA 4RQMA 2KMDA 2ESEA 2E8OA 4MHVA 2EAMA 2QB0A 1PK1A 1COKA 1X40A 1RG6A 5KNIA 1PK1B 2JV3A 4PZNA 2B6GA 3KKAA 2E8MA 1V38A 2KG5A 3SEIA 1X66A 1B0XA 1WWUA 1V85A 2KSOB 2E8PA 2D3DA 5J8YC 3H8MA 2QB0B 1SXEA 3TADA 5JU5A 4IS7A 2EANA 1KW4A 3TACB 5JTIA 5L1MA 2DL0A 2DKZA 2KIVA 3HILA 2K4PA 2KE7A 1SV0A 2Y9UA 2ES6A 1SV0C 5J8YA 4NL9A 1LKYA 1OXJA 4NL9C 1DXSA 3SENA 2QARB 2E8NA 2DKXA 1JI7A 2L5YA 1Z1VA 3BQ7A 2YTUA 2EAPA 1UQVA 2F44A 5F3XB 5JRTA 1LKYB 1SXDA 2LPEA 3IDWA 3KKAC 2KSOA 2D8CA 2F8KA 1F0MA 2K60A 4NJ8A 3BS7A 1PK3A 1SGGA 2Y9TA 1B4FA 2QB1A 3K1RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR A;  4PZO A;  1OW5 A;  2LMR A;  3BS5 A;  3BS5 B;  1WWV A;  3TAD C;  2F3N A;  2QKQ A;  1X9X A;  2FE9 A;  2EAO A;  1UCV A;  2GLE A;  1SV4 A;  4RQN A;  4RQM A;  2KMD A;  2ESE A;  2E8O A;  4MHV A;  2EAM A;  2QB0 A;  1PK1 A;  1COK A;  1X40 A;  1RG6 A;  5KNI A;  1PK1 B;  2JV3 A;  4PZN A;  2B6G A;  3KKA A;  2E8M A;  1V38 A;  2KG5 A;  3SEI A;  1X66 A;  1B0X A;  1WWU A;  1V85 A;  2KSO B;  2E8P A;  2D3D A;  5J8Y C;  3H8M A;  2QB0 B;  1SXE A;  3TAD A;  5JU5 A;  4IS7 A;  2EAN A;  1KW4 A;  3TAC B;  5JTI A;  5L1M A;  2DL0 A;  2DKZ A;  2KIV A;  3HIL A;  2K4P A;  2KE7 A;  1SV0 A;  2Y9U A;  2ES6 A;  1SV0 C;  5J8Y A;  4NL9 A;  1LKY A;  1OXJ A;  4NL9 C;  1DXS A;  3SEN A;  2QAR B;  2E8N A;  2DKX A;  1JI7 A;  2L5Y A;  1Z1V A;  3BQ7 A;  2YTU A;  2EAP A;  1UQV A;  2F44 A;  5F3X B;  5JRT A;  1LKY B;  1SXD A;  2LPE A;  3IDW A;  3KKA C;  2KSO A;  2D8C A;  2F8K A;  1F0M A;  2K60 A;  4NJ8 A;  3BS7 A;  1PK3 A;  1SGG A;  2Y9T A;  1B4F A;  2QB1 A;  3K1R B; 
#chains in the Genus database with same CATH topology
 4AP9 A;  4DL6 A;  1OUQ A;  3WU2 U;  3BZK A;  1S97 A;  7ICE A;  1N48 A;  4KLQ A;  4DL2 A;  1ZD5 A;  5D4B A;  1UHU A;  4YR2 A;  5J2D A;  3QZ8 A;  4PHP A;  3I1Y A;  3Q8M A;  1CEZ A;  1YT3 A;  5KFS A;  2E8O A;  1XWL A;  4KLF A;  2KNJ A;  3GIM A;  1L5U A;  2RP5 A;  1RXW A;  2LKY A;  5BPC A;  3PW7 A;  4IQW A;  2OYY A;  1CRX A;  1PVQ A;  3KZI U;  3E58 A;  3V6J A;  3NS1 A;  5EWE A;  3H4B A;  4M04 A;  3HP6 A;  3GFK B;  4YVZ A;  1QQ6 A;  4YD2 A;  4Y2V A;  3HIL A;  1L3S A;  4Q8E A;  2KE7 A;  5EWG A;  2XGQ A;  4C8K A;  2ZTD A;  4RT2 A;  2W3R A;  1MC8 A;  2LM1 A;  4JUZ A;  4O5K A;  5KAI U;  4B9M A;  2EDU A;  4YMN A;  5J2F A;  4RT3 A;  3KFU F;  2ZXI A;  4IR1 A;  8ICB A;  4C4S A;  1TV9 A;  2NYV A;  1ZQ1 C;  3B9J A;  2G06 A;  2N1R A;  1WUD A;  2KZZ A;  1Z1V A;  3CP8 A;  4CDG A;  1COO A;  4QZH A;  3BZC A;  3WKA A;  1ZJM A;  5AI9 A;  2PFQ A;  3QEB Z;  1IG6 A;  3M9N B;  1K1S A;  2PMZ C;  3NVY A;  9ICL A;  2W9C A;  5J0Q A;  5KT5 A;  4IQV A;  1NJX A;  1KLN A;  5KFE A;  1QH9 A;  4J9N A;  1KQQ A;  3MR5 A;  3E0F A;  1T94 A;  4AYB F;  1UT5 A;  5CWR A;  5J2H A;  3NVW A;  4ECR A;  2DUY A;  1BPB A;  4XUS A;  4JV1 A;  2Y1J A;  3SQI A;  5ALH A;  4C7Y A;  4BJQ A;  5KFZ A;  9ICN A;  4ED3 A;  2K4I A;  2KHQ A;  3UMB A;  2C22 A;  4FO6 A;  3PSP A;  4GC6 A;  2EZZ A;  3C5G A;  1ZD2 P;  3EW9 A;  3F2D A;  3KHG A;  3ISB A;  5AM5 A;  4OO1 J;  2BZF A;  3V7J A;  5DB7 A;  3MAB A;  2G0A A;  4B6J A;  5KNI A;  2BDU A;  4IL6 U;  4PHE A;  4DOC A;  5AIA A;  4DSL A;  5DG8 A;  3JPQ A;  4C4T A;  2DGZ A;  4M0A A;  5EWF A;  2HVH A;  3SEI A;  5KTQ A;  4EEK A;  2ZTC A;  3AL0 B;  4B9V A;  4F8R A;  1QSL A;  4KLJ A;  4PGQ A;  1V85 A;  4I2A A;  3PSF A;  1D8L A;  4TQR A;  2G5H B;  4HAI A;  2NO4 A;  5BOM A;  1ZQW A;  2ZJ5 A;  4DSJ A;  2K4P A;  3HT3 A;  3PY8 A;  7ICJ A;  3HRD D;  7ICK A;  2Y0S F;  2GWS A;  4ZH4 A;  1X9M A;  3SEN A;  2WF9 A;  4GXJ A;  1D9D A;  2WF7 A;  7ICT A;  1HUZ A;  7ICO A;  3T5J A;  2OWO A;  3V72 A;  5L1L A;  4YXM A;  4C8M A;  5JUM A;  5KT3 A;  2YMQ A;  1RQN A;  4YP3 A;  2ZIU B;  4QZI A;  4IRD A;  3TAR A;  4YCX A;  2OEH A;  1DK2 A;  2F77 X;  2MUT B;  2K60 A;  4U7C A;  3QX7 A;  3UMC A;  1SGG A;  2Y9T A;  1NK0 A;  2JXJ A;  3AMZ A;  5KFP A;  2H3F A;  1FEZ A;  4UB3 A;  4RQ3 A;  2JEF A;  3RH5 A;  3FM9 A;  2F1J A;  4Y2Y A;  4F5O A;  1KDH A;  5AM3 A;  4BXO A;  4IQU A;  3C1Z A;  3CNH A;  4UAS A;  2JEJ A;  1EXN A;  3PO4 A;  4CF5 A;  2ALZ A;  3ZD9 A;  3N28 A;  2R8I A;  3DDH A;  1DRG A;  5T14 A;  5C0Y A;  4UB2 A;  2W9A A;  2AU0 A;  9ICT A;  3RAQ A;  9ICO A;  5EE1 A;  5KG7 A;  3OHB A;  4DFD A;  4O5C A;  1ZQM A;  3TAQ A;  2IOF A;  1ZQP A;  1YZ6 A;  1S10 A;  1ZQU A;  1B0X A;  1WWU A;  9ICG A;  2UVV A;  1UT8 A;  5DGA A;  3RRG A;  3ONN A;  4F4X A;  8ICL A;  2Q4T A;  5IIK A;  1NK9 A;  3KHL A;  1NJZ A;  1N63 A;  4TUP A;  1TAM A;  2NRV A;  5ALL A;  5CEH A;  3PMN A;  4JV2 A;  2NRW A;  4RPZ A;  2BQR A;  4UAR A;  1KRP A;  5H2F U;  3WKB A;  5ALP A;  2XCA A;  2RRD A;  5ALN A;  4I2G A;  5HR7 A;  8ICR A;  9ICC A;  1TE2 A;  4F93 B;  4M9N A;  2KVS A;  2E5S A;  2KN7 A;  4F92 B;  8ICT A;  4LZG A;  2EAP A;  2H3Z A;  1MSW D;  3V7L A;  4I29 A;  3IDW A;  3KKA C;  4F71 A;  3F2B A;  4BWM A;  4DSK A;  4PHD A;  1IM4 A;  3IV6 A;  3K1R B;  4OJL A;  3AM9 A;  1ZQT A;  5ALK A;  2UVU A;  5CA7 A;  2NO5 A;  1NI3 A;  5KFO A;  2RQ5 A;  3AU6 A;  2KIW A;  3BS5 A;  1H38 A;  3OSN A;  3JPS A;  3PO5 A;  2YMM A;  2OHF A;  4F2S A;  3CYM A;  4RU9 A;  4MFC A;  2R8H A;  1JAL A;  5J0S A;  1QSS A;  1ZQD A;  3AQE A;  3TI0 A;  2K89 A;  1Z00 A;  2ATL A;  3OGU A;  5J2J A;  2OH2 A;  4KX5 A;  3MGI A;  3T79 A;  3F2C A;  1XNS A;  1X40 A;  2IBK A;  3QU7 A;  4TUR A;  2ISP A;  4BUG A;  5III A;  4PL2 A;  3JPN A;  5CR0 A;  5AK5 A;  3QU5 A;  4QIW C;  2E8P A;  5AKE A;  5J8Y C;  4EYH B;  1KBU A;  2I1Q A;  2AGO A;  5J2I A;  3GIK A;  2W9C B;  3QU4 A;  3M6Z A;  1IIP A;  2WF5 A;  4ED8 A;  3TAP A;  4EEY A;  2DL0 A;  5J2G A;  1MA7 A;  2IA6 A;  4DFP A;  4C8N A;  2R18 A;  5IIM A;  3SZ2 A;  4MEX A;  2PI5 A;  1FFV A;  5BOL A;  8ICI A;  2A3V A;  4PJ0 U;  1X42 A;  3C23 A;  5HR6 A;  4PHA A;  2DKX A;  1JI7 A;  3H0L B;  1ED1 A;  4Y2X A;  4DEZ A;  1S77 D;  5KL8 B;  4YXJ A;  1FO4 A;  4RZR A;  3TFS A;  4JK1 A;  1Z00 B;  4DFM A;  2QB1 A;  1XO0 A;  4YMO A;  4DQP A;  2XI9 A;  4EBD A;  4YN4 A;  1MQ3 A;  5CP2 A;  2VAN A;  5DKW A;  4EBE A;  3I76 A;  1ZXI A;  3GDX A;  5KFL A;  3JPP A;  3Q8Q B;  2K8B B;  4F91 B;  1L7P A;  4RQN A;  5DQG A;  5EE0 A;  4C8L A;  3RJE A;  5KG1 A;  3ZD8 A;  4NM2 A;  3PVX A;  1IV8 A;  4GIB A;  4E0D A;  3H7I A;  9ICW A;  4QZD A;  3IN5 A;  4P0P A;  1ZQV A;  4PZN A;  5DDM A;  1U9L A;  4R66 A;  3OHA A;  5KFU A;  5J0O A;  2JH1 A;  2NRT A;  2E8M A;  4O3R A;  4NY8 A;  3PST A;  1ZYQ A;  3B0Y A;  1ZQL A;  1BPY A;  3HW8 A;  4KLG A;  4RQ2 A;  1ZOL A;  4FZM A;  1ZQF A;  4UAW A;  1N61 A;  1NJY A;  2V4Q A;  5DB6 A;  9ICX A;  2VA8 A;  3OJS A;  3M1Y A;  4ED6 A;  4ELV A;  3TAC B;  5ALO A;  4QWC A;  3HWT A;  1Z19 A;  2FI1 A;  4J9K A;  3MFI A;  1SKR A;  1KL9 A;  4NLZ A;  4TQS A;  4DL4 A;  3L3F X;  3PZP A;  3GII A;  2DFL A;  1CI4 A;  1RPL A;  2HCF A;  1N56 A;  2L5Y A;  4O3S A;  5KFH A;  2HBJ A;  4QZE A;  4KLU A;  1SXD A;  2LYH A;  4J9M A;  2F8K A;  4ICA A;  4NLN A;  3RJI A;  3T5H A;  4QZF A;  4ECZ A;  2WAQ F;  2NV3 A;  1PUZ A;  8ICU A;  1A76 A;  2IHM A;  3UXN A;  1B43 A;  1ZQB A;  4DL5 A;  3MBY A;  3V6H A;  1WWV A;  4KLM A;  2Z7J A;  5EOZ A;  4QZG A;  2ZUC A;  5AKZ A;  2W54 A;  3ZDA A;  2ZUD A;  3M8R A;  2DPI A;  5KT4 A;  4DLG A;  3M6K A;  3T5L A;  1L8O A;  2KJ5 A;  2JGA A;  2KMD A;  3QUB A;  5IIO A;  7ICR A;  1RYR A;  4QZA A;  3ICX A;  3IG8 A;  4J9O A;  3D2Q A;  4JMU A;  2HW3 A;  9ICF A;  4CF3 A;  8ICN A;  2LM4 A;  3LWM A;  1IXR A;  2F1I A;  4B9L A;  3WK4 A;  3LWL A;  4Q8F A;  4DSE A;  5ALY A;  2MA1 A;  4GFJ A;  3SR6 A;  2H3V A;  2LHT A;  1ZQQ A;  1ZQY A;  2CRX A;  5J29 A;  4KMO B;  1VLB A;  2YQE A;  1NK7 A;  1SL1 A;  4ED2 A;  2BHN A;  1SV0 A;  4XRH A;  5EE9 A;  1S0O A;  3JPT A;  4R63 A;  3C29 A;  5AKJ A;  9ICS A;  2W9M A;  4BGD A;  3F53 A;  4RQ4 A;  4F4Z A;  3C2K A;  4DL7 A;  3C1Y A;  2W9B B;  1BPD A;  1C7Y A;  1L3U A;  2Y0S C;  4JB3 A;  4O9M A;  5AI5 A;  5HNK A;  1TK8 A;  4NV0 A;  2IMW P;  5ALM A;  2C28 A;  3QXG A;  5AM0 A;  1JIH A;  1JX4 A;  3M9M B;  1SKS A;  2YML A;  3KHH A;  1RYS A;  4CGZ A;  3QUC A;  1ZQC A;  3JPR A;  1HJP A;  4PZO A;  5J0Y A;  5J0R A;  3U26 A;  1KFT A;  3C2L A;  4KN7 A;  1NZB A;  1QCK A;  3TFR A;  5KFY A;  1X9X A;  2VJ4 A;  4QWB A;  3QYP A;  1B22 A;  3C28 A;  1X9S A;  4RQM A;  1NKC A;  1ZQI A;  3THV A;  3G6V A;  5KG6 A;  1XSN A;  2HHV A;  5KT2 A;  1COK A;  3QNM A;  3UQ2 A;  2FLL A;  2RDI A;  2BQU A;  3Q8P B;  3QZ7 A;  3MGH A;  5F9L A;  5J0W A;  4DQR A;  3DEE A;  3WK9 A;  4I2E A;  2XY5 A;  9ICU A;  3H8M A;  4PGX A;  2J6T A;  4ECW A;  1X9W A;  5JU5 A;  4ED7 A;  1NK8 A;  2EAN A;  3PX4 A;  1KW4 A;  2ZTE A;  4KLE A;  3L4P A;  2K4E A;  3AQF A;  2HOQ A;  7ICU A;  4QIW F;  2KIV A;  3SD7 A;  4ECX A;  2KTQ A;  3GIJ A;  4B9S A;  1NK5 A;  3N7P D;  2GO7 A;  3NAS A;  1S9F A;  4UB1 A;  1Q8K A;  4GXI A;  3QE9 Y;  7ICS A;  5ALE A;  4UQG A;  1OXJ A;  3GU3 A;  4NL9 C;  1ZQS A;  3HKZ F;  5J0P A;  1ZQN A;  2FMP A;  1ZQK A;  7ICP A;  5AIB A;  4KMU A;  3PV8 A;  2E1F A;  4YD1 A;  1L6N A;  1L3T A;  1SWW A;  2P35 A;  4NLG A;  1X2I A;  2MUT A;  1Z3E B;  9ICE A;  7ICF A;  1ZQX A;  4O3Q A;  4NLK A;  2QAR A;  2KHV A;  1KKX A;  4KLL A;  4ECS A;  3ZDC A;  1ZJN A;  4CE6 A;  3ZDD A;  5KG4 A;  3H4D A;  3FC4 A;  4F5N A;  4EZ6 A;  2QLT A;  2C2R A;  1L7N A;  3PML A;  5K4L A;  2EAM A;  2QB0 A;  4LJX A;  3SV4 A;  4J9S A;  4BWJ A;  1RG6 A;  1PK1 B;  4LZD A;  3UMG A;  2JV3 A;  4RQ0 A;  3RJJ A;  3GZF A;  3N4M B;  2FMQ A;  5KFR A;  3M9O B;  2ZG6 A;  4DSI A;  2ASD A;  4M47 A;  1SXE A;  2PKE A;  3BQ1 A;  4MF2 A;  5IIN A;  2GOL A;  4MF8 A;  2G08 A;  1L8L A;  4UAY A;  2P6U A;  4Z6D A;  5AKK A;  4Y2U A;  8ICM A;  1QSY A;  3BQ0 A;  3B0X A;  3WKC A;  3PR5 B;  4I28 A;  5KFX A;  4M2Y A;  4GC7 A;  2P66 A;  3N7R C;  4OCZ A;  1SWV A;  2WF6 A;  2Y1I A;  3EZ5 A;  5AI8 A;  1KFD A;  2BPC A;  2ZIV B;  5AK3 A;  4M6W B;  3HX0 A;  4F3O A;  3QUQ A;  2EZY A;  4Z6E A;  3PSI A;  4R8U B;  4RNM A;  3H8S A;  1S8O A;  1ZET A;  3SAH A;  3OJU A;  2LPE A;  3BQT A;  3SI8 A;  2RLT A;  3RJH A;  1T8E A;  4KLH A;  3AN1 A;  3BS7 A;  3H8J A;  8ICJ A;  8ICH A;  2V9W A;  2F1H A;  4TUQ A;  5L1I A;  1K1Q A;  2XY6 A;  4O3N A;  1OW5 A;  5IIL A;  3BS5 B;  4R65 A;  1LB2 B;  4G9B A;  4QZB A;  4XA5 A;  7ICN A;  2QKQ A;  3Q8L A;  4CF4 A;  5KFW A;  4C80 A;  5J0X A;  1UCV A;  3EYZ A;  3VC8 A;  2ZIW A;  1PVP A;  3Q8S B;  1P7D A;  2KJ9 A;  2KZM A;  8ICK A;  3ISC A;  2H5X A;  4F4Y A;  1TAU A;  4PPX A;  5FP0 A;  2IOH A;  2E3T A;  2A1A A;  3GV7 B;  3SMV A;  5CRX A;  4C8O A;  2H3Q A;  5KFJ A;  5AK4 A;  3NUQ A;  2B0C A;  3MFH A;  5F9N A;  5AKL A;  5AM1 A;  4DF4 A;  4I2H A;  1ZQO A;  8ICE A;  4ECV A;  4QZ8 A;  4IS7 A;  3RRH A;  5KFG A;  3RH4 A;  5DLF A;  4NM1 A;  2WF8 A;  1C20 A;  1QTM A;  1J2M A;  4IC9 A;  3MGV A;  2W8L A;  2WFA A;  5DLG A;  2ZIW B;  1V9P A;  3NGD A;  2J6U A;  9ICM A;  2MAX A;  3EWA A;  5ALU A;  2R8J A;  5KG0 A;  5TZV A;  1A0P A;  5KL1 B;  1X6J A;  4PH5 A;  1PZN A;  2F44 A;  2UVR A;  1NK4 A;  4PGY A;  4J9R A;  1KFS A;  3T3F A;  3H0M B;  2P6R A;  4DL3 A;  3UPQ A;  2G09 A;  4O3M A;  2G07 A;  1QLN A;  3NVV A;  5KFI A;  4FZN A;  4KN4 A;  2HSZ A;  3RTV A;  4NLB A;  2AJQ A;  1VJ5 A;  2K8A A;  4Y2P A;  5J2K A;  4BXO B;  4I2J A;  5KG5 A;  4M9L A;  5J2C A;  8ICV A;  4US8 A;  1Z1B A;  3AU2 A;  3ISD A;  4F5R A;  2F76 X;  1AQ6 A;  4Q43 A;  2FPK A;  3LVV A;  2VJ5 A;  4P4P A;  4K4I A;  1K5O A;  5J2E A;  4YFK A;  5DQI A;  4EX7 A;  3OTQ A;  4US9 A;  2OM6 A;  1N2X A;  4FS2 A;  5AI6 A;  4XQ8 A;  2KKP A;  5KFM A;  2RHF A;  1TK0 A;  3NTU A;  3HPO A;  2ZIX A;  1WYG A;  4F4W A;  1ZQG A;  1XU4 A;  3HJE A;  5ALT A;  3Q8K A;  1WCL A;  5A0L A;  3N7S C;  2W55 A;  3QUT A;  4RQ7 A;  4P0Q B;  2NRX A;  2YB1 A;  3M8S A;  1UPH A;  3UM9 A;  4C7Z A;  1NZP A;  2W03 A;  4DWI A;  5B66 U;  3S6J A;  1DGS A;  4P4O A;  2AQ0 A;  5D49 A;  4DCC A;  3EPI A;  3RB6 A;  1NJW A;  4UAT A;  2KVC A;  2ZJ8 A;  3LK9 A;  1KTQ A;  5AKH A;  3L5K A;  4QJF B;  5KFV A;  3CW2 C;  1NKB A;  2LMR A;  1ZD3 A;  3LYS A;  4DSF A;  5GTI U;  2GH1 A;  4UAV A;  3WK8 A;  3TAD C;  3RJG A;  2MRL A;  2C2D A;  2EAO A;  4ECT A;  1SV4 A;  9ICK A;  5HMM A;  1ZQR A;  5J2A A;  3N97 B;  4K4H A;  2PFO A;  4DFK A;  4IRC A;  5ALZ A;  4NXZ A;  5ALV A;  2W7O A;  1N5W A;  2MU2 A;  3IP4 B;  2HVI A;  3GIL A;  2HBM A;  1L3V A;  1ECW A;  2KG5 A;  1V38 A;  8ICS A;  3RB0 A;  1U4B A;  2PMZ F;  2WHE A;  4Q44 A;  3BQ2 A;  5AKG A;  5E79 U;  3BDP A;  2D3D A;  1DOQ A;  5KG2 A;  4F2R A;  4M9G A;  3FYH A;  2HHX A;  1ZQJ A;  9ICB A;  1TK5 A;  4QNL A;  2HHS A;  1ZQA A;  3MC1 A;  2ZIV A;  1JXE A;  3D2N A;  4UB4 A;  2HHT A;  2XCP A;  2WB1 C;  2HOI A;  4Y2Q A;  1S0N A;  1SB3 C;  4J9P A;  2JH7 A;  3PW5 A;  5KT6 A;  1QQ5 A;  1O03 A;  2M0N A;  3VCB A;  5ALR A;  2KZ3 A;  2JEI A;  3C2M A;  1LV5 A;  1KSP A;  3AEV A;  5J0U A;  4J9Q A;  3PW2 A;  2PFP A;  5DDY A;  1SL2 A;  1SZP A;  4JWM A;  2YTU A;  1FIQ A;  4OJP A;  1GO3 F;  1LKY B;  1WCN A;  3NVZ A;  2HDO A;  3V7K A;  1WG8 A;  4RQ5 A;  2M9N A;  5AM4 A;  1B4F A;  2DF4 B;  3GQC A;  4FFD A;  2A19 A;  4DLE A;  4K4G A;  2KFZ A;  3ETL A;  8ICP A;  3WKE A;  4QWA A;  2JHD A;  4ELT A;  5L1J A;  8ICF A;  4R8U A;  3K75 D;  2FE9 A;  2AGP A;  4EEN A;  2KV2 A;  4OJO A;  4I2C A;  2HHQ A;  4I2I A;  2ESE A;  5HHI A;  4GXK A;  4DFJ A;  7ICQ A;  2CXY A;  2IHN A;  3IG5 A;  1ZQH A;  3RR7 A;  4B9T A;  2NRZ A;  4QZC A;  2J6S A;  8ICW A;  1L7M A;  1NKE A;  3WK5 A;  4ACO A;  1MQ2 A;  2BPG A;  2W7P A;  2HOF A;  1ZQE A;  2KFN A;  3ORY A;  1HUO A;  2E1E A;  3O0F A;  2QB0 B;  4DS5 A;  2AHO B;  1U47 A;  3TKA A;  4O0I A;  4I27 A;  1CUK A;  1TVA A;  2HBL A;  3KTQ A;  3KBB A;  4Z6F A;  2AQ4 A;  1RM6 C;  8ICQ A;  2K4H A;  2Y9U A;  9ICJ A;  4J03 A;  2ES6 A;  2I6X A;  3C5F A;  4I2B A;  4A8E A;  1DK3 A;  2JR5 A;  3JPO A;  1Z4O A;  2BCQ A;  4IRK A;  1RQL A;  2LI6 A;  3DV9 A;  4NLC A;  2W3S A;  2W9B A;  2PXI A;  3TAN A;  1TAQ A;  5IIJ A;  1BNP A;  5ALW A;  4KLI A;  2XC9 A;  2BQ3 A;  2HHU A;  2EZX A;  5EE3 A;  3ED5 A;  1BGX T;  1UA0 A;  2DBY A;  2KSO A;  1S0M A;  2XY7 A;  3IM1 A;  4GLX A;  5DG9 A;  2ZJA A;  3H40 A;  1ZRN A;  1RZT A;  3RB3 A;  1YZ7 A;  4KLS A;  1U49 A;  2DQN B;  1RYU A;  1Z4N A;  3NRZ A;  4ECY A;  2ZIU A;  4ZOH C;  1NK6 A;  5DQH A;  3G6X A;  2G5I B;  3PX6 A;  4B9N A;  1UA1 A;  4KTQ A;  4KLO A;  1VDV A;  4KX3 A;  2FLP A;  5ALX A;  4P0Q A;  5KAF U;  2ZIX B;  1V97 A;  4MHV A;  5ALI A;  3FAH A;  3KHR A;  2KEY A;  4USA A;  1XSP A;  1JRP A;  3QU9 A;  1SZH A;  4RPX A;  4F4K A;  1J97 A;  1S5L U;  3F5A A;  4NWI A;  2R8G A;  5KFA A;  1JXL A;  3KZX A;  3UXO A;  4TUS A;  1KN5 A;  1ARO P;  4BX9 C;  4DOB A;  4P2H A;  3TAD A;  5KFD A;  3UQ0 A;  4Q45 A;  3PW4 A;  1D8Y A;  4X5V A;  5D46 A;  5ALF A;  3MDC A;  3MR6 A;  9ICR A;  2JZB A;  3WK6 A;  5J8Y A;  7ICM A;  5AI4 A;  3SV3 A;  7ICV A;  4OD0 A;  2KIC A;  1D8B A;  2PI4 A;  2HBK A;  2OCE A;  4FZL A;  3AUO A;  3H8W A;  5AI0 A;  3KOO A;  1ZD4 A;  2AH5 A;  2I5H A;  3WKD A;  3HKZ C;  1UQV A;  5AKY A;  1LVH A;  2EH9 A;  2HI0 A;  7ICH A;  5CHG A;  3A0H U;  1T7P A;  3SAG A;  8ICA A;  4NJ8 A;  1BPZ A;  4AYB C;  1Q3U A;  2VA2 A;  2FMS A;  2XIC A;  3ETR A;  2XO7 A;  4ED1 A;  1JUD A;  9ICH A;  1J2N A;  5DB8 A;  4DQQ A;  2CN1 A;  5ALG A;  4UBC A;  4Z6C A;  4ED0 A;  5DG7 A;  4DOA A;  4F50 A;  4O5E A;  4O3O A;  2BCS A;  4DS4 A;  3K4G A;  9ICQ A;  4M9J A;  1JMS A;  4FE3 A;  1XS9 D;  4QZ9 A;  2BCU A;  1HIW A;  4RPY A;  4ECU A;  3RR8 A;  2FPL A;  2BR0 A;  4R64 A;  2YMP A;  5L1K A;  4FS1 A;  5KFB A;  4RNO A;  3KKA A;  2PFN A;  4B9U A;  3Q8R B;  7ICG A;  3OPX A;  1MN8 A;  1X66 A;  1S0V A;  4UAZ A;  4Y2R A;  2V4R A;  2DWQ A;  2OXO A;  1XC9 A;  2JZB B;  4JV0 A;  2MSN A;  9ICA A;  1RXV A;  4FBT A;  2ASJ A;  4UB5 A;  2DKZ A;  5KFC A;  1FFU A;  4OJ5 A;  5L9X A;  3R9K A;  1TFR A;  3V6K A;  1SV0 C;  2CPR A;  2LYB A;  3D6J A;  2VA3 A;  4Y2T A;  2DPJ A;  1XSL A;  1NNL A;  3ZI4 A;  2XGP A;  4DQS A;  2BGW A;  4I2F A;  4CRX A;  3A0B U;  4RNN A;  2O6K A;  5TIS U;  5HML A;  3T5K A;  5J0T A;  3GV5 B;  2ISO A;  3GV8 B;  1S76 D;  3QU2 A;  1U48 A;  3E2E A;  1N62 A;  1PK3 A;  3UXP A;  3RBE A;  1U45 A;  4MEY A;  2LBO A;  2BKE A;  1Q46 A;  4UW9 A;  4EBC A;  3J81 j;  2BCV A;  1A6S A;  4UB8 U;  3KD3 A;  2FJ6 A;  1PVR A;  2F2A B;  3OSP A;  2F3N A;  4F5Q A;  8ICG A;  4F72 A;  3FDS A;  2JRZ A;  2AXT U;  2F8L A;  2KKV A;  2YB4 A;  4QW8 A;  2FDR A;  1HEK A;  3RFA A;  3RB4 A;  7ICI A;  5HHH A;  1F44 A;  1BPX A;  1T3Q A;  2ZUB A;  3I28 A;  4IR9 A;  4EEL A;  2AGQ A;  2YY6 A;  5GTH U;  9ICI A;  2W43 A;  5KT7 A;  4IQT A;  1ZQZ A;  2VIX A;  4QWE A;  1RDF A;  1T4G A;  2YN4 A;  2FLN A;  4QWD A;  2KD1 A;  1SKW A;  5KFT A;  5DBC A;  2JMG A;  2YX8 A;  1DGJ A;  3G6Y A;  1BPE A;  2KSO B;  4UBB A;  5G5H A;  4WJ3 B;  2KK0 A;  4YQW A;  5AHX A;  5KG3 A;  4EX6 A;  2W04 A;  5AIC A;  5JTI A;  5DB9 A;  2BPF A;  4HYK A;  3H0R B;  5KFK A;  2R8K A;  4PL1 A;  4CCH A;  3MDA A;  3EUB 2;  2A1J B;  4G3I A;  2H3I A;  4U6P A;  4NL9 A;  1D9F A;  1SL0 A;  4RQ8 A;  4KLT A;  5DBA A;  1BVS A;  5ALQ A;  2E8N A;  3ZDE A;  4O3P A;  4DQI A;  5HP4 A;  5ALS A;  3RH6 A;  5AK6 A;  4F5P A;  4P0P B;  5C5J A;  1N60 A;  3F5E A;  3BQ7 A;  3MR2 A;  2JEG A;  4I2D A;  2KP7 A;  4C0Z A;  2W8K A;  4UAU A;  3QEA Z;  1T3N A;  5F3X B;  3RJF A;  5JRT A;  4EZ9 A;  1X6I A;  4DF8 A;  1JRO A;  5B5E U;  4RQ1 A;  2D8C A;  4C4R A;  1F0M A;  2IOF K;  2WAQ C;  4QW9 A;  2HHW A;  2ASL A;  5DGB A;  2B21 A;  4DO9 A;  1O08 A;  5DBB A;  2EQY A;  5AM2 A;  1URJ A;  1Y88 A;  2W11 A;  2I9G A;  3PW0 A;  8ICY A;  8ICZ A;  5J2B A;  1N5X A;  8ICC A;  2KJ8 A;  4ECQ A;  1XO1 A;  1L7O A;  4FBU A;  5CJ7 A;  3ALR A;  3SYZ A;  2GLE A;  5KFQ A;  3IHQ B;  4M9H A;  5ALJ A;  3SAF A;  4YR3 A;  4CNQ A;  1F5S A;  2WTF A;  2ZXH A;  4KLD A;  1PK1 A;  4J9L A;  5AKX A;  4M6W A;  4YG2 A;  4LVS A;  2D6F C;  4BDP A;  1SIJ A;  3TQ1 A;  2B6G A;  3RJK A;  3LDA A;  9ICP A;  4YR0 A;  1TKD A;  4ELU A;  8ICX A;  5G5G A;  3RBD A;  4MFF A;  5KFN A;  2WB1 F;  1A77 A;  8ICO A;  2ODG A;  1BNO A;  5AKI A;  1QQ7 A;  2XVT A;  1Q3V A;  4RQ6 A;  4KIT B;  2C2E A;  2LYA A;  3K1Z A;  3LVW A;  3PX0 A;  1NOM A;  2VKQ A;  4MFA A;  2FPM A;  3PNC A;  3MR3 A;  5L1M A;  2K8C B;  9ICV A;  3NRW A;  2XID A;  2HMX A;  4UB6 U;  5KFF A;  1ZRM A;  1JN3 A;  4JWN A;  3RAX A;  2KOB A;  1LKY A;  1DXS A;  3RF9 A;  2QAR B;  5CB1 A;  4P4M A;  3D2S A;  5ALD A;  7ICL A;  4Y2J A;  3CRX A;  4YMM A;  2UVW A;  2BCR A;  2RDJ A;  3PR4 A;  4RUA A;  3M7D A;  2A1J A;  3ZDB A;  2BDP A;  4EYI B;  3C21 A;  2Q0Z X;  3IRU A;  4OJ6 A;  4Y2S A;  3BJY A;  3WK7 A;  3EPG A;  1KEJ A;  1M6Y A;  4RUC A; 
#chains in the Genus database with same CATH homology
 2QAR A;  4PZO A;  1OW5 A;  2LMR A;  3BS5 A;  3BS5 B;  1WWV A;  3TAD C;  2F3N A;  2QKQ A;  1X9X A;  2FE9 A;  2EAO A;  1UCV A;  2GLE A;  1SV4 A;  4RQN A;  4RQM A;  2KMD A;  2ESE A;  2E8O A;  4MHV A;  2EAM A;  2QB0 A;  1PK1 A;  1COK A;  1X40 A;  1RG6 A;  5KNI A;  1PK1 B;  2JV3 A;  4PZN A;  2B6G A;  3KKA A;  2E8M A;  1V38 A;  2KG5 A;  3SEI A;  1X66 A;  1B0X A;  1WWU A;  1V85 A;  2KSO B;  2E8P A;  2D3D A;  5J8Y C;  3H8M A;  2QB0 B;  1SXE A;  3TAD A;  5JU5 A;  4IS7 A;  2EAN A;  1KW4 A;  3TAC B;  5JTI A;  5L1M A;  2DL0 A;  2DKZ A;  2KIV A;  3HIL A;  2K4P A;  2KE7 A;  1SV0 A;  2Y9U A;  2ES6 A;  1SV0 C;  5J8Y A;  4NL9 A;  1LKY A;  1OXJ A;  4NL9 C;  1DXS A;  3SEN A;  2QAR B;  2E8N A;  2DKX A;  1JI7 A;  2L5Y A;  1Z1V A;  3BQ7 A;  2YTU A;  2EAP A;  1UQV A;  2F44 A;  5F3X B;  5JRT A;  1LKY B;  1SXD A;  2LPE A;  3IDW A;  3KKA C;  2KSO A;  2D8C A;  2F8K A;  1F0M A;  2K60 A;  4NJ8 A;  3BS7 A;  1PK3 A;  1SGG A;  2Y9T A;  1B4F A;  2QB1 A;  3K1R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...