2E8PA

Solution structure of the n-terminal sam-domain of e74-like factor 3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GSSGSSGQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELF3 protein
publication title Solution structure of the N-terminal SAM-domain of E74-like factor 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8pA01
5F3XB 2D3DA 2QB1A 1WWUA 2LPEA 2ES6A 4PZNA 3BS5B 3TACB 2QB0B 2YTUA 2EANA 2KIVA 2F8KA 1B4FA 2F3NA 2EAPA 2F44A 4NL9A 2Y9UA 1SXDA 1OXJA 2QARA 3SENA 2E8OA 4RQMA 2JV3A 2E8MA 3BQ7A 3KKAA 1COKA 2KSOA 1X9XA 2B6GA 2QARB 1SGGA 2EAMA 3TADA 2ESEA 2Y9TA 3KKAC 1X66A 5KNIA 4MHVA 2DKXA 1JI7A 5J8YA 5JTIA 2KSOB 2QKQA 2EAOA 1KW4A 1SV4A 1RG6A 5J8YC 2L5YA 1SV0A 2DKZA 1UCVA 4NL9C 1UQVA 3H8MA 1SV0C 1SXEA 2E8PA 3K1RB 1OW5A 2D8CA 5JU5A 2LMRA 2KE7A 1Z1VA 2K4PA 3TADC 2KG5A 2QB0A 2DL0A 4RQNA 3SEIA 2E8NA 5JRTA 1PK3A 1F0MA 1PK1A 2GLEA 1LKYA 1B0XA 2KMDA 4NJ8A 4PZOA 3HILA 3IDWA 5L1MA 1V38A 3BS7A 1X40A 1PK1B 1DXSA 1LKYB 4IS7A 1WWVA 3BS5A 2K60A 2FE9A 1V85A
chains in the Genus database with same CATH superfamily
1ZQBA 3KTQA 1LVHA 5J0XA 4XUSA 3PW4A 3PNCA 1BPYA 3ZDDA 2BCSA 3KHHA 2UVRA 4DEZA 5L9XA 4TUQA 5KFQA 3Q8KA 4NLGA 1ZRNA 8ICOA 5DBAA 5ALHA 2JXJA 3AEVA 5ALKA 1XNSA 5J2IA 4C8MA 4DWIA 2K4EA 5ALQA 3QNMA 4KITB 2QARA 2R8IA 1T94A 2KIWA 4IQVA 1D8LA 3M6ZA 4HYKA 4MEXA 4M9HA 3KKAA 2WFAA 5DDYA 1UHUA 5AKIA 4F4WA 2ASDA 5DG8A 1H38A 5DQGA 4F93B 3EUB2 1J2MA 4QZFA 5KFIA 8ICGA 4EENA 3F5EA 4DF8A 1SV0A 1XSPA 5HNKA 3SMVA 1NJZA 4DSLA 2W8LA 2E1EA 2ISPA 4UB6U 4CNQA 1Q46A 4I2BA 5AM1A 3SV3A 4DQPA 4EYIB 3WU2U 2FPLA 5AKXA 2G5IB 2QB0A 3O0FA 4M9LA 4KLSA 1PK1A 3PV8A 1NJWA 3OSPA 5GTHU 2LYBA 4DSEA 7ICQA 3ED5A 3HILA 1TK5A 4ECSA 1D9FA 1NKCA 4PHAA 2LM4A 3QZ7A 4KLTA 3PR4A 3ETRA 3D2SA 4M04A 1F5SA 1KLNA 2ZIXA 2ZIUB 3JPQA 2KVCA 1TAMA 5AI8A 4F5PA 3DEEA 2R8GA 1SZPA 3F5AA 2P6UA 1BPBA 3BQ2A 5AK3A 5KG7A 4Q43A 1S0NA 1A77A 2AJQA 3WK8A 3H7IA 1U48A 4KLOA 1ZQ1C 5ALRA 5AM4A 4DFJA 5DGBA 4EBDA 5HMLA 2RLTA 4B9SA 1ZQRA 4RQ4A 2NRWA 3OJSA 5AKYA 4TQSA 2B6GA 4B9LA 2AGPA 1ZQKA 4NV0A 4IQWA 3ONNA 3HJEA 2WF9A 4UB3A 4QZEA 1ZD2P 1B43A 5CHGA 5KFGA 3CP8A 1ZOLA 4ECRA 2F1HA 2R18A 2BQUA 2K8AA 2HVHA 1KW4A 9ICXA 2FMPA 9ICNA 3SZ2A 4DQRA 2HHSA 1CI4A 2PI5A 4ECWA 5J2GA 3ISCA 3GIIA 1RXWA 4ECVA 5T14A 4KTQA 4R66A 4ED0A 4C4TA 2VA3A 2ZIVA 3V6KA 5J0YA 2BPCA 4GFJA 2DL0A 5DB8A 1OUQA 5ALOA 5CP2A 1DRGA 5BOMA 9ICCA 4M9GA 4KLHA 2Q4TA 1DXSA 5DQIA 2P66A 4JV1A 1V97A 5J2CA 2V4QA 1S0MA 2CPRA 3MGIA 5EE9A 2LBOA 2K8BB 5KFRA 9ICFA 1SZHA 1XU4A 2KKVA 9ICOA 3QU4A 4B9VA 4PGXA 4UAVA 4YXMA 2I1QA 5DBBA 3QUTA 3AMZA 1ZQAA 4RQ0A 1PUZA 2F1JA 4M2YA 5KT3A 4DFKA 4QWDA 2NO5A 4RU9A 2A1AA 4KMOB 1QLNA 8ICTA 1TV9A 1NZBA 1WCLA 3PSPA 1K1SA 4P4PA 5EE0A 4Y2JA 3F2DA 4Y2QA 2QARB 1QCKA 3F2BA 3R9KA 2DWQA 5ALVA 3TANA 4ECXA 1JXLA 1JUDA 4NLCA 5J8YC 1Q3VA 4R64A 5J0SA 2HVIA 4IC9A 1ZQIA 5KFOA 1LB2B 1ZRMA 2RDJA 8ICSA 7ICUA 5AIBA 1C20A 1JROA 1QSYA 5KFSA 3N7PD 3NGDA 1IV8A 4M9NA 3PO4A 8ICQA 3NASA 1L3TA 5ALPA 3SEIA 1MA7A 4ELUA 3UXNA 3RF9A 4NLNA 2FLPA 4C8LA 1RM6C 2ZIWB 2FJ6A 5KL1B 5KFFA 3VCBA 1FFVA 4Q45A 1PK1B 4F91B 2PMZF 4QZGA 7ICKA 2BDPA 2BCRA 4OO1J 3Q8RB 3BS5A 4ED1A 9ICQA 4CDGA 1L7NA 5J0RA 1Y88A 1QQ7A 2WB1C 2KVSA 4UATA 2JGAA 1FFUA 2ZIXB 1FEZA 2DUYA 2J6SA 2KJ9A 4RQ5A 5KFZA 2OHFA 1TVAA 2P6RA 1KEJA 2IOFA 5AM5A 2NRTA 4KN7A 5HR6A 3OJUA 1X9SA 1XO1A 3LWLA 1L6NA 3JPPA 2KHQA 1CRXA 1COOA 5D4BA 5ALXA 3N7SC 3Q8SB 4F4YA 3OHAA 3TFSA 4PHDA 3ISBA 5DDMA 1RYRA 1SGGA 4O3SA 5KFKA 4PPXA 2KD1A 4R63A 4F8RA 1JI7A 1RZTA 3M8RA 3H0RB 2JRZA 2NRXA 4R65A 4ECUA 3RB0A 4J9QA 1ZQHA 2L5YA 1HUZA 3HW8A 2V4RA 5ALGA 5AK6A 4K4GA 1N61A 5EOZA 2GH1A 1U47A 2BCQA 1DK3A 3WKCA 3ZDAA 4B9NA 1JX4A 2EZZA 4PGQA 1IIPA 3SI8A 5JU5A 4J9OA 3NRZA 2F76X 4QWCA 4RNOA 3PZPA 3UMCA 5J0PA 4ED8A 2G09A 9ICWA 3N97B 3M7DA 3CW2C 2WAQC 2ZIVB 1ZQOA 2KZZA 3TI0A 1M6YA 1L3VA 2G07A 3JPTA 1WG8A 1ZQLA 5AK5A 5KT5A 3PW5A 2KK0A 4DL5A 1XSNA 4TUSA 2K60A 1Z1BA 4ACOA 2Q0ZX 3KHRA 4UBBA 4GXJA 3TAPA 2PXIA 1SL1A 4KLJA 2YMMA 4ZH4A 2W7PA 1K5OA 2BPFA 4B9TA 4QZIA 3FYHA 3KFUF 5IIKA 3RJIA 3WKAA 3MGHA 3AM9A 4IRKA 1ZD4A 8ICRA 4YMOA 5KFAA 4C8NA 5J2KA 3SYZA 4CF4A 2A1JA 1N62A 3ETLA 2ODGA 1PZNA 3OTQA 3WK4A 4DL3A 3M9NB 1COKA 2JEJA 3GILA 1L5UA 3IHQB 4ECZA 4MHVA 3AUOA 4Y2PA 4EX6A 2QKQA 1BPXA 3MDAA 4ED7A 2EQYA 2UVUA 5KFUA 2GWSA 1T3NA 3CRXA 3C2MA 4M6WB 1SKWA 4P4MA 3H8MA 1ZXIA 4DL7A 1KSPA 4F5OA 5ALLA 2LHTA 3K1RB 3MFIA 4RQ3A 3PR5B 4JMUA 5DQHA 7ICGA 5AK4A 9ICJA 3SAFA 1KL9A 1NK5A 2YB4A 3RJJA 4UB2A 2I6XA 3E0FA 2W7OA 1UA1A 2BHNA 3UPQA 1UT5A 3BS7A 9ICVA 1SWVA 3LVWA 3LK9A 9ICSA 1ZQCA 1N56A 3RBEA 5KFWA 4KX5A 5CJ7A 2FI1A 4I2EA 1TKDA 4ED6A 2VA2A 1KQQA 2PI4A 2A19A 5L1IA 3V7KA 3BS5B 4QW9A 8ICAA 3KHLA 2E5SA 1BVSA 3QZ8A 3SD7A 3N4MB 4O0IA 5KFBA 4QW8A 4WJ3B 2F8LA 2M0NA 5KFXA 2ZJAA 4QZCA 4DCCA 4NM2A 5KFPA 3JPNA 5F9LA 2MRLA 4FZNA 2NRZA 2W55A 3BQ1A 3FM9A 4GXIA 4DFPA 2EAMA 2HCFA 2XVTA 3WKBA 4UW9A 3AL0B 1PVPA 4Y2RA 4J9SA 1S97A 4FE3A 2EZYA 1A6SA 2MUTA 2DKZA 3IG5A 1ED1A 9ICHA 1NOMA 2ZXHA 2KJ5A 3MR2A 5ALWA 3CYMA 2BGWA 2J6TA 4OJ5A 8ICMA 3H8SA 3NVZA 2KE7A 2RDIA 4O3NA 5AKGA 4YFKA 3TADC 2V9WA 9ICRA 5IIJA 4RQNA 3BDPA 2E8NA 3H4BA 1ZJMA 3G6YA 4KN4A 1NK9A 1MSWD 3A0BU 5KG1A 7ICVA 7ICNA 4UAWA 3ICXA 3BZKA 3HWTA 2BCUA 8ICZA 9ICGA 5F3XB 4J9PA 4CGZA 1N48A 5J2HA 4RQ8A 2MU2A 4PZNA 2W9MA 1MN8A 4I2HA 4KLMA 1O08A 5KG3A 2YTUA 5EWFA 2HOQA 2UVVA 3TQ1A 2HW3A 3MABA 3U26A 1PVQA 4J9NA 5HMMA 1QTMA 2JH7A 1A0PA 2KFNA 1J2NA 3Q8LA 3TARA 3LDAA 1ZQTA 4RQ1A 3HT3A 4F50A 3IM1A 2KSOA 2F1IA 3WKDA 5KG4A 4ELVA 2KEYA 3UQ0A 5ALNA 1QH9A 4NY8A 5DB6A 3KKAC 8ICFA 1QQ5A 3AN1A 4GC7A 4U7CA 2HBMA 4C4RA 1FIQA 3T5KA 1ZQGA 1RG6A 3MR5A 9ICMA 4XQ8A 9ICUA 5AKLA 3RR8A 3G6VA 3I1YA 1UQVA 1SV0C 3BZCA 4F92B 3PY8A 1KBUA 7ICJA 2RHFA 5AI5A 2I9GA 2ZUBA 4MEYA 4JUZA 2KZMA 4PGYA 1T7PA 9ICTA 3ZD8A 5AICA 5AI4A 5JRTA 1Q8KA 3PX6A 1BNOA 4IL6U 4R8UB 3RJGA 4LVSA 1T3QA 1SIJA 5KT4A 2C22A 4DLEA 4FZLA 3TAQA 1NI3A 4PZOA 2NYVA 3RJKA 1SKSA 3BQTA 2KTQA 5KFEA 4O3OA 2YN4A 3T5HA 1EXNA 1Q3UA 2FE9A 2UVWA 4DL4A 3D6JA 3QE9Y 9ICLA 4UAZA 4EZ6A 7ICHA 2AQ0A 5DG7A 2ZG6A 4Y2YA 1HUOA 4UB5A 4P2HA 4JV2A 2B21A 1ZQMA 2HHXA 4NWIA 1ZJNA 5JUMA 2EAPA 4A8EA 4Z6CA 4C80A 3UQ2A 2JH1A 2OXOA 3SENA 4XRHA 4Z6EA 8ICEA 3MFHA 3M1YA 3M6KA 4CCHA 1X66A 2ZUDA 3PMLA 2JR5A 2E3TA 4YG2A 4RPZA 5DBCA 3QU7A 3HX0A 1J97A 4OD0A 3L3FX 8ICKA 2RP5A 1D8BA 1AROP 1YZ6A 1N5WA 4DS5A 4Y2UA 2MUTB 4MF2A 2FPMA 4KLUA 4YP3A 2FMSA 2D8CA 1BPEA 3HKZF 3B0YA 5KFLA 3ZDBA 3C2LA 5B66U 2FLLA 5AI9A 1BGXT 2LKYA 2DPIA 2JZBA 4O3QA 3LVVA 1XWLA 1NJYA 1D8YA 4BXOA 3ZDCA 3KZIU 1ZQZA 5J2AA 2VA8A 4YMNA 1ZYQA 5HHHA 3QEAZ 3C29A 4F3OA 2KP7A 4BX9C 4F2SA 3EPGA 1D9DA 1X6JA 2I5HA 3QUQA 4ECTA 4JWNA 1WWVA 4DSFA 4KMUA 3GIJA 1SKRA 4KLIA 2H3FA 2VANA 1VDVA 2W04A 2IMWP 2LM1A 4JV0A 7ICMA 3M9OB 3B0XA 1B22A 1ZQEA 4M9JA 2C2DA 5AKEA 4GC6A 1NZPA 2QB0B 4CF3A 3RB3A 2W9AA 4JB3A 5KAIU 3SV4A 2DF4B 4QZAA 2KJ8A 3NUQA 2BDUA 4J9LA 5KFJA 2PFNA 1N63A 4P0QA 8ICNA 3OPXA 5AI0A 4GLXA 3T3FA 4QIWF 3PVXA 4YQWA 2Y1IA 1AQ6A 4IR9A 3PSIA 4G9BA 3AU6A 2YMLA 5F9NA 2DKXA 2JEGA 4CE6A 5HP4A 3ORYA 1ZQNA 2KSOB 1L3UA 4QZ8A 2K4IA 3GZFA 4YCXA 4RZRA 2BQ3A 3HP6A 2P35A 3AQEA 5AM2A 3Q8PB 1WUDA 3RB6A 1CUKA 3K75D 1L7OA 5ALUA 5DKWA 1NK6A 4RNNA 2AU0A 3IV6A 5EWEA 4LJXA 3RH5A 2HBKA 2K8CB 3EZ5A 3T79A 2JMGA 2VJ5A 3DDHA 2W9CA 4QWAA 1SWWA 2RQ5A 1S77D 1KKXA 4Z6FA 2W3RA 4F72A 4LZGA 2GLEA 5CB1A 1LKYA 2G08A 4UB1A 1S10A 7ICRA 4RUAA 2Y0SF 4C7ZA 4DFMA 3IDWA 3PSTA 3Q8QB 2HHTA 4RT3A 3V6HA 3FC4A 8ICCA 1N5XA 4B6JA 1S8OA 3T5LA 5K4LA 5G5GA 3V72A 3N7RC 4QZ9A 1N2XA 2VJ4A 1ZQUA 3GV8B 1KFDA 1TFRA 1GO3F 5HR7A 1RQNA 4USAA 2PFPA 5J2JA 4IRDA 3QEBZ 2HHUA 1SL2A 8ICPA 5KG0A 2FMQA 3PW2A 2Y9UA 4F4ZA 1S0OA 3RTVA 5CWRA 3B9JA 8ICBA 1DGSA 2E8MA 9ICBA 5KAFU 5J0UA 5L1KA 5D46A 4I2DA 1ZQFA 3NTUA 4C8OA 2MSNA 3KZXA 4ED2A 3IP4B 4ZOHC 1F44A 1X6IA 4DQQA 3I76A 5JTIA 3GQCA 3RJFA 1S0VA 1TAUA 5AIAA 1NK7A 2NO4A 1RQLA 2EAOA 5ALMA 2C2EA 4JK1A 1VJ5A 1SV4A 5FP0A 2ALZA 2XO7A 2VKQA 4KLDA 2XI9A 5GTIU 5ALFA 2HHWA 4EELA 4M47A 9ICKA 2ASLA 5BPCA 2WF5A 2HI0A 2KICA 2W43A 4J9MA 1L7PA 3IN5A 2WF8A 3D2QA 4K4HA 4MFAA 1X2IA 2FPKA 5KFVA 4ELTA 2AQ4A 5TZVA 1JRPA 3PMNA 3H40A 2JZBB 1ZQPA 4BXOB 2XCAA 1X40A 1JALA 2NV3A 1QSLA 4IS7A 3UMGA 1JN3A 5IIIA 2YQEA 5D49A 1KFSA 2CXYA 3A0HU 3SR6A 4AYBC 5AKHA 5J2EA 3MR3A 4O5EA 4DSIA 2JHDA 2XGQA 2YMQA 1U45A 4KLEA 2F3NA 2G06A 2F44A 4AP9A 3WK7A 5KG6A 4NLKA 4RQMA 5KFDA 4C4SA 2EDUA 4RQ2A 4Q8EA 1N60A 1BPZA 5IIMA 3M9MB 3QX7A 3D2NA 3C21A 2E1FA 3FDSA 4I2GA 4KLGA 4BUGA 5J29A 3TADA 4P0QB 9ICPA 5AKKA 1X9MA 3PO5A 1X9WA 1K1QA 4F4XA 5CEHA 7ICIA 3C28A 2C2RA 4C0ZA 4C8KA 2EZXA 3RJHA 2LYAA 3UM9A 7ICEA 3OSNA 4P0PA 4UASA 4RPXA 4F5QA 7ICOA 2Z7JA 3UMBA 4DSJA 2M9NA 3GV7B 4OJ6A 4NL9C 1XS9D 2Y1JA 2N1RA 2OYYA 3LYSA 5IIOA 1XSLA 2W54A 5CRXA 1RXVA 4I27A 2HBJA 4BGDA 2C28A 5J0OA 5KT2A 4RQ6A 4IQTA 2K4HA 4FO6A 2BZFA 2LYHA 2HBLA 5B5EU 2W9CB 2KOBA 1U49A 2BR0A 4RQ7A 4X5VA 4E0DA 3GIMA 1KTQA 2YY6A 5DLGA 2MA1A 1LKYB 1UT8A 4Q44A 4DOBA 4FBTA 3UXOA 3RRHA 3C1ZA 5KT7A 1S76D 1A76A 2A3VA 2ZTEA 1PVRA 1U9LA 7ICFA 2HHQA 5TISU 3QU2A 2ES6A 4YN4A 5KFNA 3AU2A 2FLNA 3HRDD 1P7DA 5EE1A 5IINA 1KFTA 3N28A 3RBDA 3T5JA 1SXDA 2ZUCA 5KFHA 3C1YA 2KFZA 1NJXA 4MFFA 4J9RA 3HPOA 3H0MB 4US8A 3BQ7A 3TFRA 3JPSA 2Y9TA 4NXZA 2XY6A 2W11A 2ZIWA 1NNLA 4FBUA 1RYSA 4O5KA 2AH5A 5DB7A 4O3PA 3MC1A 4O3RA 3ALRA 1TE2A 3GU3A 5H2FU 1KRPA 1FO4A 2A1JB 4UB8U 4QZBA 2H3IA 2H3QA 2WTFA 1ZQWA 3WKEA 5KFCA 1WCNA 3M8SA 2DBYA 4US9A 8ICXA 3Q8MA 4BDPA 2WF6A 5ALTA 1CEZA 4UB4A 5DB9A 4YR0A 4DOCA 1QSSA 4RT2A 4EZ9A 2H5XA 5E79U 3E2EA 5AHXA 4UBCA 3C5GA 1RPLA 3L4PA 2GOLA 2HOFA 4Z6DA 3SQIA 2ISOA 2D6FC 5G5HA 1V85A 4YR3A 3IRUA 2QB1A 3ISDA 1WWUA 4IRCA 7ICTA 5ALYA 1L7MA 3WK9A 2HSZA 5EWGA 8ICYA 2KHVA 4YXJA 5KL8B 1Z19A 1B4FA 1ZQYA 1NKEA 3MR6A 1JIHA 3MDCA 1Z3EB 2VIXA 1DOQA 1YZ7A 3QU5A 4FS1A 4K4IA 3S6JA 1T4GA 2E8OA 8ICJA 8ICVA 2WB1F 3EPIA 4KLFA 1X9XA 5L1JA 3RH4A 4QZDA 1ZD3A 2PFQA 1RDFA 2LI6A 3C5FA 5KFTA 5J8YA 3V7JA 4UAUA 2CRXA 3NVVA 4HAIA 1ZD5A 4F5NA 2XY5A 4ICAA 3RB4A 3WK5A 4G3IA 7ICPA 3H0LB 2AHOB 4PJ0U 4Y2XA 3GV5B 2E8PA 4P0PB 2W9BA 1NK4A 4U6PA 3RH6A 2IA6A 4Q8FA 2DQNB 4QWBA 4I2AA 2IHNA 2AXTU 4OCZA 8ICLA 3G6XA 1YT3A 1Z00A 1Z4OA 5ALJA 1X42A 4DL6A 4ECQA 1ECWA 4I29A 2DFLA 4QNLA 3CNHA 2KNJA 5L1MA 3RR7A 2HDOA 4LZDA 1NK0A 3RRGA 2HOIA 3NRWA 1BPDA 2FDRA 4TURA 1JMSA 5A0LA 3EW9A 4YVZA 3UXPA 5BOLA 2B0CA 1C7YA 5AM0A 3WK6A 4PHEA 5DGAA 2KKPA 3PX0A 5EE3A 4YD1A 5KG5A 4DSKA 4I2CA 4I2FA 1ZQDA 2WAQF 2KZ3A 2NRVA 2GO7A 4DS4A 2KIVA 2H3VA 3V6JA 2IOFK 8ICWA 3E58A 5J2DA 4M6WA 3C2KA 1ZQJA 3MGVA 4YMMA 4DF4A 1V9PA 3IG8A 2YMPA 1OXJA 1TK8A 2DGZA 4GXKA 2G0AA 5KFMA 2WF7A 2ZTDA 2K89A 4DL2A 2AGQA 4O5CA 1DGJA 5AI6A 4QZHA 4GIBA 3AQFA 5KNIA 2DPJA 1WYGA 4BJQA 1NKBA 4KLLA 3KOOA 3H4DA 3RFAA 3V7LA 1DK2A 2HMXA 5ALSA 1NK8A 3DV9A 8ICHA 4O9MA 4PHPA 4F2RA 5J0TA 4F4KA 2YX8A 1ZQQA 2YB1A 1SXEA 4DFDA 4UAYA 4DOAA 3H8JA 3VC8A 4FFDA 3GFKB 2XC9A 1XO0A 4TUPA 5ALIA 2HHVA 1Z1VA 5ALZA 4O3MA 8ICUA 4NLZA 4EBEA 1RYUA 2F77X 5KFYA 4B9MA 5DLFA 1TK0A 2BQRA 4NJ8A 3PW7A 5J0QA 7ICLA 1IG6A 1ZQXA 5CA7A 3RAXA 4BWJA 4F5RA 4ED3A 2BPGA 3K1ZA 1S5LU 2PKEA 3ZDEA 9ICEA 5ALEA 1IM4A 5KG2A 2LPEA 3F53A 3KD3A 8ICIA 5DG9A 3TACB 4EBCA 4MFCA 2AGOA 1KN5A 3I28A 2OEHA 2R8KA 4AYBF 2EANA 4YD2A 4PH5A 3ZD9A 1HEKA 2F8KA 3PSFA 1MC8A 1QQ6A 3K4GA 5KTQA 2XICA 3PX4A 1T8EA 2QLTA 3QUBA 2KV2A 2JV3A 3TKAA 2ASJA 2XGPA 2W8KA 4IR1A 2R8HA 4F71A 4I2JA 3HKZC 2JEFA 2ATLA 4EYHB 3NS1A 3QYPA 5CR0A 4J03A 4DO9A 5ALDA 1XC9A 2W03A 3H8WA 1TAQA 4DQSA 1UCVA 1MQ2A 5C0YA 3RAQA 4EEKA 4DLGA 2BKEA 1OW5A 1L8LA 1S9FA 4JWMA 2EH9A 2JEIA 2OWOA 1URJA 2LMRA 1JXEA 4DQIA 2O6KA 5KT6A 4OJOA 4QWEA 4I2IA 4RNMA 2PFOA 5AKZA 1ZQSA 2W9BB 3QU9A 5HHIA 4UQGA 1F0MA 3J81j 4EEYA 3L5KA 3F2CA 2IOHA 1B0XA 1SL0A 4KX3A 2PMZC 2ZIUA 5IILA 4I28A 1V38A 1Z00B 1O03A 1SB3C 4RUCA 1VLBA 1LV5A 3JPOA 1L8OA 2ZJ8A 4B9UA 3MBYA 3JPRA 3QUCA 1MQ3A 3PW0A 2OH2A 2CN1A 3SAHA 2XCPA 4FZMA 2D3DA 4QIWC 4KLQA 3QXGA 2H3ZA 3OGUA 3BQ0A 3ZI4A 2W3SA 2ZTCA 4OJPA 4QJFB 1Z4NA 4Y2VA 3NVWA 4Y2SA 2J6UA 2F2AB 3BJYA 4PL2A 5AKJA 4IQUA 4J9KA 2ZJ5A 5C5JA 5AM3A 3SAGA 5J0WA 4NL9A 2XY7A 1KDHA 3OHBA 1HJPA 4NM1A 2G5HB 3RJEA 3THVA 4PL1A 2RRDA 4CF5A 2OM6A 4M0AA 2IHMA 2ESEA 4R8UA 1UPHA 2WHEA 3EWAA 4XA5A 2R8JA 4FS2A 3FAHA 2MAXA 3GDXA 4BWMA 3EYZA 2Y0SC 7ICSA 3LWMA 1UA0A 2KN7A 5L1LA 4OJLA 2OCEA 1ZQVA 3KHGA 4RPYA 5J2FA 2BCVA 4Y2TA 3GIKA 4P4OA 4UARA 1IXRA 4MF8A 1U4BA 4ECYA 2K4PA 4EX7A 2KG5A 1ZETA 1PK3A 2XIDA 4TQRA 5J2BA 9ICIA 2KMDA 9ICAA 2ZXIA 3C23A 4C7YA 2IBKA 4NLBA 1BNPA 4CRXA 4YR2A 1HIWA 3NVYA 3KBBA 1L3SA
chains in the Genus database with same CATH topology
5F3XB 2D3DA 2QB1A 1WWUA 2LPEA 2ES6A 4PZNA 3BS5B 3TACB 2QB0B 2YTUA 2EANA 2KIVA 2F8KA 1B4FA 2F3NA 2EAPA 2F44A 4NL9A 2Y9UA 1SXDA 1OXJA 2QARA 3SENA 2E8OA 4RQMA 2JV3A 2E8MA 3BQ7A 3KKAA 1COKA 2KSOA 1X9XA 2B6GA 2QARB 1SGGA 2EAMA 3TADA 2ESEA 2Y9TA 3KKAC 1X66A 5KNIA 4MHVA 2DKXA 1JI7A 5J8YA 5JTIA 2KSOB 2QKQA 2EAOA 1KW4A 1SV4A 1RG6A 5J8YC 2L5YA 1SV0A 2DKZA 1UCVA 4NL9C 1UQVA 3H8MA 1SV0C 1SXEA 2E8PA 3K1RB 1OW5A 2D8CA 5JU5A 2LMRA 2KE7A 1Z1VA 2K4PA 3TADC 2KG5A 2QB0A 2DL0A 4RQNA 3SEIA 2E8NA 5JRTA 1PK3A 1F0MA 1PK1A 2GLEA 1LKYA 1B0XA 2KMDA 4NJ8A 4PZOA 3HILA 3IDWA 5L1MA 1V38A 3BS7A 1X40A 1PK1B 1DXSA 1LKYB 4IS7A 1WWVA 3BS5A 2K60A 2FE9A 1V85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3X B;  2D3D A;  2QB1 A;  1WWU A;  2LPE A;  2ES6 A;  4PZN A;  3BS5 B;  3TAC B;  2QB0 B;  2YTU A;  2EAN A;  2KIV A;  2F8K A;  1B4F A;  2F3N A;  2EAP A;  2F44 A;  4NL9 A;  2Y9U A;  1SXD A;  1OXJ A;  2QAR A;  3SEN A;  2E8O A;  4RQM A;  2JV3 A;  2E8M A;  3BQ7 A;  3KKA A;  1COK A;  2KSO A;  1X9X A;  2B6G A;  2QAR B;  1SGG A;  2EAM A;  3TAD A;  2ESE A;  2Y9T A;  3KKA C;  1X66 A;  5KNI A;  4MHV A;  2DKX A;  1JI7 A;  5J8Y A;  5JTI A;  2KSO B;  2QKQ A;  2EAO A;  1KW4 A;  1SV4 A;  1RG6 A;  5J8Y C;  2L5Y A;  1SV0 A;  2DKZ A;  1UCV A;  4NL9 C;  1UQV A;  3H8M A;  1SV0 C;  1SXE A;  2E8P A;  3K1R B;  1OW5 A;  2D8C A;  5JU5 A;  2LMR A;  2KE7 A;  1Z1V A;  2K4P A;  3TAD C;  2KG5 A;  2QB0 A;  2DL0 A;  4RQN A;  3SEI A;  2E8N A;  5JRT A;  1PK3 A;  1F0M A;  1PK1 A;  2GLE A;  1LKY A;  1B0X A;  2KMD A;  4NJ8 A;  4PZO A;  3HIL A;  3IDW A;  5L1M A;  1V38 A;  3BS7 A;  1X40 A;  1PK1 B;  1DXS A;  1LKY B;  4IS7 A;  1WWV A;  3BS5 A;  2K60 A;  2FE9 A;  1V85 A; 
#chains in the Genus database with same CATH topology
 1ZQB A;  3KTQ A;  1LVH A;  5J0X A;  4XUS A;  3PW4 A;  3PNC A;  1BPY A;  3ZDD A;  2BCS A;  3KHH A;  2UVR A;  4DEZ A;  5L9X A;  4TUQ A;  5KFQ A;  3Q8K A;  4NLG A;  1ZRN A;  8ICO A;  5DBA A;  5ALH A;  2JXJ A;  3AEV A;  5ALK A;  1XNS A;  5J2I A;  4C8M A;  4DWI A;  2K4E A;  5ALQ A;  3QNM A;  4KIT B;  2QAR A;  2R8I A;  1T94 A;  2KIW A;  4IQV A;  1D8L A;  3M6Z A;  4HYK A;  4MEX A;  4M9H A;  3KKA A;  2WFA A;  5DDY A;  1UHU A;  5AKI A;  4F4W A;  2ASD A;  5DG8 A;  1H38 A;  5DQG A;  4F93 B;  3EUB 2;  1J2M A;  4QZF A;  5KFI A;  8ICG A;  4EEN A;  3F5E A;  4DF8 A;  1SV0 A;  1XSP A;  5HNK A;  3SMV A;  1NJZ A;  4DSL A;  2W8L A;  2E1E A;  2ISP A;  4UB6 U;  4CNQ A;  1Q46 A;  4I2B A;  5AM1 A;  3SV3 A;  4DQP A;  4EYI B;  3WU2 U;  2FPL A;  5AKX A;  2G5I B;  2QB0 A;  3O0F A;  4M9L A;  4KLS A;  1PK1 A;  3PV8 A;  1NJW A;  3OSP A;  5GTH U;  2LYB A;  4DSE A;  7ICQ A;  3ED5 A;  3HIL A;  1TK5 A;  4ECS A;  1D9F A;  1NKC A;  4PHA A;  2LM4 A;  3QZ7 A;  4KLT A;  3PR4 A;  3ETR A;  3D2S A;  4M04 A;  1F5S A;  1KLN A;  2ZIX A;  2ZIU B;  3JPQ A;  2KVC A;  1TAM A;  5AI8 A;  4F5P A;  3DEE A;  2R8G A;  1SZP A;  3F5A A;  2P6U A;  1BPB A;  3BQ2 A;  5AK3 A;  5KG7 A;  4Q43 A;  1S0N A;  1A77 A;  2AJQ A;  3WK8 A;  3H7I A;  1U48 A;  4KLO A;  1ZQ1 C;  5ALR A;  5AM4 A;  4DFJ A;  5DGB A;  4EBD A;  5HML A;  2RLT A;  4B9S A;  1ZQR A;  4RQ4 A;  2NRW A;  3OJS A;  5AKY A;  4TQS A;  2B6G A;  4B9L A;  2AGP A;  1ZQK A;  4NV0 A;  4IQW A;  3ONN A;  3HJE A;  2WF9 A;  4UB3 A;  4QZE A;  1ZD2 P;  1B43 A;  5CHG A;  5KFG A;  3CP8 A;  1ZOL A;  4ECR A;  2F1H A;  2R18 A;  2BQU A;  2K8A A;  2HVH A;  1KW4 A;  9ICX A;  2FMP A;  9ICN A;  3SZ2 A;  4DQR A;  2HHS A;  1CI4 A;  2PI5 A;  4ECW A;  5J2G A;  3ISC A;  3GII A;  1RXW A;  4ECV A;  5T14 A;  4KTQ A;  4R66 A;  4ED0 A;  4C4T A;  2VA3 A;  2ZIV A;  3V6K A;  5J0Y A;  2BPC A;  4GFJ A;  2DL0 A;  5DB8 A;  1OUQ A;  5ALO A;  5CP2 A;  1DRG A;  5BOM A;  9ICC A;  4M9G A;  4KLH A;  2Q4T A;  1DXS A;  5DQI A;  2P66 A;  4JV1 A;  1V97 A;  5J2C A;  2V4Q A;  1S0M A;  2CPR A;  3MGI A;  5EE9 A;  2LBO A;  2K8B B;  5KFR A;  9ICF A;  1SZH A;  1XU4 A;  2KKV A;  9ICO A;  3QU4 A;  4B9V A;  4PGX A;  4UAV A;  4YXM A;  2I1Q A;  5DBB A;  3QUT A;  3AMZ A;  1ZQA A;  4RQ0 A;  1PUZ A;  2F1J A;  4M2Y A;  5KT3 A;  4DFK A;  4QWD A;  2NO5 A;  4RU9 A;  2A1A A;  4KMO B;  1QLN A;  8ICT A;  1TV9 A;  1NZB A;  1WCL A;  3PSP A;  1K1S A;  4P4P A;  5EE0 A;  4Y2J A;  3F2D A;  4Y2Q A;  2QAR B;  1QCK A;  3F2B A;  3R9K A;  2DWQ A;  5ALV A;  3TAN A;  4ECX A;  1JXL A;  1JUD A;  4NLC A;  5J8Y C;  1Q3V A;  4R64 A;  5J0S A;  2HVI A;  4IC9 A;  1ZQI A;  5KFO A;  1LB2 B;  1ZRM A;  2RDJ A;  8ICS A;  7ICU A;  5AIB A;  1C20 A;  1JRO A;  1QSY A;  5KFS A;  3N7P D;  3NGD A;  1IV8 A;  4M9N A;  3PO4 A;  8ICQ A;  3NAS A;  1L3T A;  5ALP A;  3SEI A;  1MA7 A;  4ELU A;  3UXN A;  3RF9 A;  4NLN A;  2FLP A;  4C8L A;  1RM6 C;  2ZIW B;  2FJ6 A;  5KL1 B;  5KFF A;  3VCB A;  1FFV A;  4Q45 A;  1PK1 B;  4F91 B;  2PMZ F;  4QZG A;  7ICK A;  2BDP A;  2BCR A;  4OO1 J;  3Q8R B;  3BS5 A;  4ED1 A;  9ICQ A;  4CDG A;  1L7N A;  5J0R A;  1Y88 A;  1QQ7 A;  2WB1 C;  2KVS A;  4UAT A;  2JGA A;  1FFU A;  2ZIX B;  1FEZ A;  2DUY A;  2J6S A;  2KJ9 A;  4RQ5 A;  5KFZ A;  2OHF A;  1TVA A;  2P6R A;  1KEJ A;  2IOF A;  5AM5 A;  2NRT A;  4KN7 A;  5HR6 A;  3OJU A;  1X9S A;  1XO1 A;  3LWL A;  1L6N A;  3JPP A;  2KHQ A;  1CRX A;  1COO A;  5D4B A;  5ALX A;  3N7S C;  3Q8S B;  4F4Y A;  3OHA A;  3TFS A;  4PHD A;  3ISB A;  5DDM A;  1RYR A;  1SGG A;  4O3S A;  5KFK A;  4PPX A;  2KD1 A;  4R63 A;  4F8R A;  1JI7 A;  1RZT A;  3M8R A;  3H0R B;  2JRZ A;  2NRX A;  4R65 A;  4ECU A;  3RB0 A;  4J9Q A;  1ZQH A;  2L5Y A;  1HUZ A;  3HW8 A;  2V4R A;  5ALG A;  5AK6 A;  4K4G A;  1N61 A;  5EOZ A;  2GH1 A;  1U47 A;  2BCQ A;  1DK3 A;  3WKC A;  3ZDA A;  4B9N A;  1JX4 A;  2EZZ A;  4PGQ A;  1IIP A;  3SI8 A;  5JU5 A;  4J9O A;  3NRZ A;  2F76 X;  4QWC A;  4RNO A;  3PZP A;  3UMC A;  5J0P A;  4ED8 A;  2G09 A;  9ICW A;  3N97 B;  3M7D A;  3CW2 C;  2WAQ C;  2ZIV B;  1ZQO A;  2KZZ A;  3TI0 A;  1M6Y A;  1L3V A;  2G07 A;  3JPT A;  1WG8 A;  1ZQL A;  5AK5 A;  5KT5 A;  3PW5 A;  2KK0 A;  4DL5 A;  1XSN A;  4TUS A;  2K60 A;  1Z1B A;  4ACO A;  2Q0Z X;  3KHR A;  4UBB A;  4GXJ A;  3TAP A;  2PXI A;  1SL1 A;  4KLJ A;  2YMM A;  4ZH4 A;  2W7P A;  1K5O A;  2BPF A;  4B9T A;  4QZI A;  3FYH A;  3KFU F;  5IIK A;  3RJI A;  3WKA A;  3MGH A;  3AM9 A;  4IRK A;  1ZD4 A;  8ICR A;  4YMO A;  5KFA A;  4C8N A;  5J2K A;  3SYZ A;  4CF4 A;  2A1J A;  1N62 A;  3ETL A;  2ODG A;  1PZN A;  3OTQ A;  3WK4 A;  4DL3 A;  3M9N B;  1COK A;  2JEJ A;  3GIL A;  1L5U A;  3IHQ B;  4ECZ A;  4MHV A;  3AUO A;  4Y2P A;  4EX6 A;  2QKQ A;  1BPX A;  3MDA A;  4ED7 A;  2EQY A;  2UVU A;  5KFU A;  2GWS A;  1T3N A;  3CRX A;  3C2M A;  4M6W B;  1SKW A;  4P4M A;  3H8M A;  1ZXI A;  4DL7 A;  1KSP A;  4F5O A;  5ALL A;  2LHT A;  3K1R B;  3MFI A;  4RQ3 A;  3PR5 B;  4JMU A;  5DQH A;  7ICG A;  5AK4 A;  9ICJ A;  3SAF A;  1KL9 A;  1NK5 A;  2YB4 A;  3RJJ A;  4UB2 A;  2I6X A;  3E0F A;  2W7O A;  1UA1 A;  2BHN A;  3UPQ A;  1UT5 A;  3BS7 A;  9ICV A;  1SWV A;  3LVW A;  3LK9 A;  9ICS A;  1ZQC A;  1N56 A;  3RBE A;  5KFW A;  4KX5 A;  5CJ7 A;  2FI1 A;  4I2E A;  1TKD A;  4ED6 A;  2VA2 A;  1KQQ A;  2PI4 A;  2A19 A;  5L1I A;  3V7K A;  3BS5 B;  4QW9 A;  8ICA A;  3KHL A;  2E5S A;  1BVS A;  3QZ8 A;  3SD7 A;  3N4M B;  4O0I A;  5KFB A;  4QW8 A;  4WJ3 B;  2F8L A;  2M0N A;  5KFX A;  2ZJA A;  4QZC A;  4DCC A;  4NM2 A;  5KFP A;  3JPN A;  5F9L A;  2MRL A;  4FZN A;  2NRZ A;  2W55 A;  3BQ1 A;  3FM9 A;  4GXI A;  4DFP A;  2EAM A;  2HCF A;  2XVT A;  3WKB A;  4UW9 A;  3AL0 B;  1PVP A;  4Y2R A;  4J9S A;  1S97 A;  4FE3 A;  2EZY A;  1A6S A;  2MUT A;  2DKZ A;  3IG5 A;  1ED1 A;  9ICH A;  1NOM A;  2ZXH A;  2KJ5 A;  3MR2 A;  5ALW A;  3CYM A;  2BGW A;  2J6T A;  4OJ5 A;  8ICM A;  3H8S A;  3NVZ A;  2KE7 A;  2RDI A;  4O3N A;  5AKG A;  4YFK A;  3TAD C;  2V9W A;  9ICR A;  5IIJ A;  4RQN A;  3BDP A;  2E8N A;  3H4B A;  1ZJM A;  3G6Y A;  4KN4 A;  1NK9 A;  1MSW D;  3A0B U;  5KG1 A;  7ICV A;  7ICN A;  4UAW A;  3ICX A;  3BZK A;  3HWT A;  2BCU A;  8ICZ A;  9ICG A;  5F3X B;  4J9P A;  4CGZ A;  1N48 A;  5J2H A;  4RQ8 A;  2MU2 A;  4PZN A;  2W9M A;  1MN8 A;  4I2H A;  4KLM A;  1O08 A;  5KG3 A;  2YTU A;  5EWF A;  2HOQ A;  2UVV A;  3TQ1 A;  2HW3 A;  3MAB A;  3U26 A;  1PVQ A;  4J9N A;  5HMM A;  1QTM A;  2JH7 A;  1A0P A;  2KFN A;  1J2N A;  3Q8L A;  3TAR A;  3LDA A;  1ZQT A;  4RQ1 A;  3HT3 A;  4F50 A;  3IM1 A;  2KSO A;  2F1I A;  3WKD A;  5KG4 A;  4ELV A;  2KEY A;  3UQ0 A;  5ALN A;  1QH9 A;  4NY8 A;  5DB6 A;  3KKA C;  8ICF A;  1QQ5 A;  3AN1 A;  4GC7 A;  4U7C A;  2HBM A;  4C4R A;  1FIQ A;  3T5K A;  1ZQG A;  1RG6 A;  3MR5 A;  9ICM A;  4XQ8 A;  9ICU A;  5AKL A;  3RR8 A;  3G6V A;  3I1Y A;  1UQV A;  1SV0 C;  3BZC A;  4F92 B;  3PY8 A;  1KBU A;  7ICJ A;  2RHF A;  5AI5 A;  2I9G A;  2ZUB A;  4MEY A;  4JUZ A;  2KZM A;  4PGY A;  1T7P A;  9ICT A;  3ZD8 A;  5AIC A;  5AI4 A;  5JRT A;  1Q8K A;  3PX6 A;  1BNO A;  4IL6 U;  4R8U B;  3RJG A;  4LVS A;  1T3Q A;  1SIJ A;  5KT4 A;  2C22 A;  4DLE A;  4FZL A;  3TAQ A;  1NI3 A;  4PZO A;  2NYV A;  3RJK A;  1SKS A;  3BQT A;  2KTQ A;  5KFE A;  4O3O A;  2YN4 A;  3T5H A;  1EXN A;  1Q3U A;  2FE9 A;  2UVW A;  4DL4 A;  3D6J A;  3QE9 Y;  9ICL A;  4UAZ A;  4EZ6 A;  7ICH A;  2AQ0 A;  5DG7 A;  2ZG6 A;  4Y2Y A;  1HUO A;  4UB5 A;  4P2H A;  4JV2 A;  2B21 A;  1ZQM A;  2HHX A;  4NWI A;  1ZJN A;  5JUM A;  2EAP A;  4A8E A;  4Z6C A;  4C80 A;  3UQ2 A;  2JH1 A;  2OXO A;  3SEN A;  4XRH A;  4Z6E A;  8ICE A;  3MFH A;  3M1Y A;  3M6K A;  4CCH A;  1X66 A;  2ZUD A;  3PML A;  2JR5 A;  2E3T A;  4YG2 A;  4RPZ A;  5DBC A;  3QU7 A;  3HX0 A;  1J97 A;  4OD0 A;  3L3F X;  8ICK A;  2RP5 A;  1D8B A;  1ARO P;  1YZ6 A;  1N5W A;  4DS5 A;  4Y2U A;  2MUT B;  4MF2 A;  2FPM A;  4KLU A;  4YP3 A;  2FMS A;  2D8C A;  1BPE A;  3HKZ F;  3B0Y A;  5KFL A;  3ZDB A;  3C2L A;  5B66 U;  2FLL A;  5AI9 A;  1BGX T;  2LKY A;  2DPI A;  2JZB A;  4O3Q A;  3LVV A;  1XWL A;  1NJY A;  1D8Y A;  4BXO A;  3ZDC A;  3KZI U;  1ZQZ A;  5J2A A;  2VA8 A;  4YMN A;  1ZYQ A;  5HHH A;  3QEA Z;  3C29 A;  4F3O A;  2KP7 A;  4BX9 C;  4F2S A;  3EPG A;  1D9D A;  1X6J A;  2I5H A;  3QUQ A;  4ECT A;  4JWN A;  1WWV A;  4DSF A;  4KMU A;  3GIJ A;  1SKR A;  4KLI A;  2H3F A;  2VAN A;  1VDV A;  2W04 A;  2IMW P;  2LM1 A;  4JV0 A;  7ICM A;  3M9O B;  3B0X A;  1B22 A;  1ZQE A;  4M9J A;  2C2D A;  5AKE A;  4GC6 A;  1NZP A;  2QB0 B;  4CF3 A;  3RB3 A;  2W9A A;  4JB3 A;  5KAI U;  3SV4 A;  2DF4 B;  4QZA A;  2KJ8 A;  3NUQ A;  2BDU A;  4J9L A;  5KFJ A;  2PFN A;  1N63 A;  4P0Q A;  8ICN A;  3OPX A;  5AI0 A;  4GLX A;  3T3F A;  4QIW F;  3PVX A;  4YQW A;  2Y1I A;  1AQ6 A;  4IR9 A;  3PSI A;  4G9B A;  3AU6 A;  2YML A;  5F9N A;  2DKX A;  2JEG A;  4CE6 A;  5HP4 A;  3ORY A;  1ZQN A;  2KSO B;  1L3U A;  4QZ8 A;  2K4I A;  3GZF A;  4YCX A;  4RZR A;  2BQ3 A;  3HP6 A;  2P35 A;  3AQE A;  5AM2 A;  3Q8P B;  1WUD A;  3RB6 A;  1CUK A;  3K75 D;  1L7O A;  5ALU A;  5DKW A;  1NK6 A;  4RNN A;  2AU0 A;  3IV6 A;  5EWE A;  4LJX A;  3RH5 A;  2HBK A;  2K8C B;  3EZ5 A;  3T79 A;  2JMG A;  2VJ5 A;  3DDH A;  2W9C A;  4QWA A;  1SWW A;  2RQ5 A;  1S77 D;  1KKX A;  4Z6F A;  2W3R A;  4F72 A;  4LZG A;  2GLE A;  5CB1 A;  1LKY A;  2G08 A;  4UB1 A;  1S10 A;  7ICR A;  4RUA A;  2Y0S F;  4C7Z A;  4DFM A;  3IDW A;  3PST A;  3Q8Q B;  2HHT A;  4RT3 A;  3V6H A;  3FC4 A;  8ICC A;  1N5X A;  4B6J A;  1S8O A;  3T5L A;  5K4L A;  5G5G A;  3V72 A;  3N7R C;  4QZ9 A;  1N2X A;  2VJ4 A;  1ZQU A;  3GV8 B;  1KFD A;  1TFR A;  1GO3 F;  5HR7 A;  1RQN A;  4USA A;  2PFP A;  5J2J A;  4IRD A;  3QEB Z;  2HHU A;  1SL2 A;  8ICP A;  5KG0 A;  2FMQ A;  3PW2 A;  2Y9U A;  4F4Z A;  1S0O A;  3RTV A;  5CWR A;  3B9J A;  8ICB A;  1DGS A;  2E8M A;  9ICB A;  5KAF U;  5J0U A;  5L1K A;  5D46 A;  4I2D A;  1ZQF A;  3NTU A;  4C8O A;  2MSN A;  3KZX A;  4ED2 A;  3IP4 B;  4ZOH C;  1F44 A;  1X6I A;  4DQQ A;  3I76 A;  5JTI A;  3GQC A;  3RJF A;  1S0V A;  1TAU A;  5AIA A;  1NK7 A;  2NO4 A;  1RQL A;  2EAO A;  5ALM A;  2C2E A;  4JK1 A;  1VJ5 A;  1SV4 A;  5FP0 A;  2ALZ A;  2XO7 A;  2VKQ A;  4KLD A;  2XI9 A;  5GTI U;  5ALF A;  2HHW A;  4EEL A;  4M47 A;  9ICK A;  2ASL A;  5BPC A;  2WF5 A;  2HI0 A;  2KIC A;  2W43 A;  4J9M A;  1L7P A;  3IN5 A;  2WF8 A;  3D2Q A;  4K4H A;  4MFA A;  1X2I A;  2FPK A;  5KFV A;  4ELT A;  2AQ4 A;  5TZV A;  1JRP A;  3PMN A;  3H40 A;  2JZB B;  1ZQP A;  4BXO B;  2XCA A;  1X40 A;  1JAL A;  2NV3 A;  1QSL A;  4IS7 A;  3UMG A;  1JN3 A;  5III A;  2YQE A;  5D49 A;  1KFS A;  2CXY A;  3A0H U;  3SR6 A;  4AYB C;  5AKH A;  5J2E A;  3MR3 A;  4O5E A;  4DSI A;  2JHD A;  2XGQ A;  2YMQ A;  1U45 A;  4KLE A;  2F3N A;  2G06 A;  2F44 A;  4AP9 A;  3WK7 A;  5KG6 A;  4NLK A;  4RQM A;  5KFD A;  4C4S A;  2EDU A;  4RQ2 A;  4Q8E A;  1N60 A;  1BPZ A;  5IIM A;  3M9M B;  3QX7 A;  3D2N A;  3C21 A;  2E1F A;  3FDS A;  4I2G A;  4KLG A;  4BUG A;  5J29 A;  3TAD A;  4P0Q B;  9ICP A;  5AKK A;  1X9M A;  3PO5 A;  1X9W A;  1K1Q A;  4F4X A;  5CEH A;  7ICI A;  3C28 A;  2C2R A;  4C0Z A;  4C8K A;  2EZX A;  3RJH A;  2LYA A;  3UM9 A;  7ICE A;  3OSN A;  4P0P A;  4UAS A;  4RPX A;  4F5Q A;  7ICO A;  2Z7J A;  3UMB A;  4DSJ A;  2M9N A;  3GV7 B;  4OJ6 A;  4NL9 C;  1XS9 D;  2Y1J A;  2N1R A;  2OYY A;  3LYS A;  5IIO A;  1XSL A;  2W54 A;  5CRX A;  1RXV A;  4I27 A;  2HBJ A;  4BGD A;  2C28 A;  5J0O A;  5KT2 A;  4RQ6 A;  4IQT A;  2K4H A;  4FO6 A;  2BZF A;  2LYH A;  2HBL A;  5B5E U;  2W9C B;  2KOB A;  1U49 A;  2BR0 A;  4RQ7 A;  4X5V A;  4E0D A;  3GIM A;  1KTQ A;  2YY6 A;  5DLG A;  2MA1 A;  1LKY B;  1UT8 A;  4Q44 A;  4DOB A;  4FBT A;  3UXO A;  3RRH A;  3C1Z A;  5KT7 A;  1S76 D;  1A76 A;  2A3V A;  2ZTE A;  1PVR A;  1U9L A;  7ICF A;  2HHQ A;  5TIS U;  3QU2 A;  2ES6 A;  4YN4 A;  5KFN A;  3AU2 A;  2FLN A;  3HRD D;  1P7D A;  5EE1 A;  5IIN A;  1KFT A;  3N28 A;  3RBD A;  3T5J A;  1SXD A;  2ZUC A;  5KFH A;  3C1Y A;  2KFZ A;  1NJX A;  4MFF A;  4J9R A;  3HPO A;  3H0M B;  4US8 A;  3BQ7 A;  3TFR A;  3JPS A;  2Y9T A;  4NXZ A;  2XY6 A;  2W11 A;  2ZIW A;  1NNL A;  4FBU A;  1RYS A;  4O5K A;  2AH5 A;  5DB7 A;  4O3P A;  3MC1 A;  4O3R A;  3ALR A;  1TE2 A;  3GU3 A;  5H2F U;  1KRP A;  1FO4 A;  2A1J B;  4UB8 U;  4QZB A;  2H3I A;  2H3Q A;  2WTF A;  1ZQW A;  3WKE A;  5KFC A;  1WCN A;  3M8S A;  2DBY A;  4US9 A;  8ICX A;  3Q8M A;  4BDP A;  2WF6 A;  5ALT A;  1CEZ A;  4UB4 A;  5DB9 A;  4YR0 A;  4DOC A;  1QSS A;  4RT2 A;  4EZ9 A;  2H5X A;  5E79 U;  3E2E A;  5AHX A;  4UBC A;  3C5G A;  1RPL A;  3L4P A;  2GOL A;  2HOF A;  4Z6D A;  3SQI A;  2ISO A;  2D6F C;  5G5H A;  1V85 A;  4YR3 A;  3IRU A;  2QB1 A;  3ISD A;  1WWU A;  4IRC A;  7ICT A;  5ALY A;  1L7M A;  3WK9 A;  2HSZ A;  5EWG A;  8ICY A;  2KHV A;  4YXJ A;  5KL8 B;  1Z19 A;  1B4F A;  1ZQY A;  1NKE A;  3MR6 A;  1JIH A;  3MDC A;  1Z3E B;  2VIX A;  1DOQ A;  1YZ7 A;  3QU5 A;  4FS1 A;  4K4I A;  3S6J A;  1T4G A;  2E8O A;  8ICJ A;  8ICV A;  2WB1 F;  3EPI A;  4KLF A;  1X9X A;  5L1J A;  3RH4 A;  4QZD A;  1ZD3 A;  2PFQ A;  1RDF A;  2LI6 A;  3C5F A;  5KFT A;  5J8Y A;  3V7J A;  4UAU A;  2CRX A;  3NVV A;  4HAI A;  1ZD5 A;  4F5N A;  2XY5 A;  4ICA A;  3RB4 A;  3WK5 A;  4G3I A;  7ICP A;  3H0L B;  2AHO B;  4PJ0 U;  4Y2X A;  3GV5 B;  2E8P A;  4P0P B;  2W9B A;  1NK4 A;  4U6P A;  3RH6 A;  2IA6 A;  4Q8F A;  2DQN B;  4QWB A;  4I2A A;  2IHN A;  2AXT U;  4OCZ A;  8ICL A;  3G6X A;  1YT3 A;  1Z00 A;  1Z4O A;  5ALJ A;  1X42 A;  4DL6 A;  4ECQ A;  1ECW A;  4I29 A;  2DFL A;  4QNL A;  3CNH A;  2KNJ A;  5L1M A;  3RR7 A;  2HDO A;  4LZD A;  1NK0 A;  3RRG A;  2HOI A;  3NRW A;  1BPD A;  2FDR A;  4TUR A;  1JMS A;  5A0L A;  3EW9 A;  4YVZ A;  3UXP A;  5BOL A;  2B0C A;  1C7Y A;  5AM0 A;  3WK6 A;  4PHE A;  5DGA A;  2KKP A;  3PX0 A;  5EE3 A;  4YD1 A;  5KG5 A;  4DSK A;  4I2C A;  4I2F A;  1ZQD A;  2WAQ F;  2KZ3 A;  2NRV A;  2GO7 A;  4DS4 A;  2KIV A;  2H3V A;  3V6J A;  2IOF K;  8ICW A;  3E58 A;  5J2D A;  4M6W A;  3C2K A;  1ZQJ A;  3MGV A;  4YMM A;  4DF4 A;  1V9P A;  3IG8 A;  2YMP A;  1OXJ A;  1TK8 A;  2DGZ A;  4GXK A;  2G0A A;  5KFM A;  2WF7 A;  2ZTD A;  2K89 A;  4DL2 A;  2AGQ A;  4O5C A;  1DGJ A;  5AI6 A;  4QZH A;  4GIB A;  3AQF A;  5KNI A;  2DPJ A;  1WYG A;  4BJQ A;  1NKB A;  4KLL A;  3KOO A;  3H4D A;  3RFA A;  3V7L A;  1DK2 A;  2HMX A;  5ALS A;  1NK8 A;  3DV9 A;  8ICH A;  4O9M A;  4PHP A;  4F2R A;  5J0T A;  4F4K A;  2YX8 A;  1ZQQ A;  2YB1 A;  1SXE A;  4DFD A;  4UAY A;  4DOA A;  3H8J A;  3VC8 A;  4FFD A;  3GFK B;  2XC9 A;  1XO0 A;  4TUP A;  5ALI A;  2HHV A;  1Z1V A;  5ALZ A;  4O3M A;  8ICU A;  4NLZ A;  4EBE A;  1RYU A;  2F77 X;  5KFY A;  4B9M A;  5DLF A;  1TK0 A;  2BQR A;  4NJ8 A;  3PW7 A;  5J0Q A;  7ICL A;  1IG6 A;  1ZQX A;  5CA7 A;  3RAX A;  4BWJ A;  4F5R A;  4ED3 A;  2BPG A;  3K1Z A;  1S5L U;  2PKE A;  3ZDE A;  9ICE A;  5ALE A;  1IM4 A;  5KG2 A;  2LPE A;  3F53 A;  3KD3 A;  8ICI A;  5DG9 A;  3TAC B;  4EBC A;  4MFC A;  2AGO A;  1KN5 A;  3I28 A;  2OEH A;  2R8K A;  4AYB F;  2EAN A;  4YD2 A;  4PH5 A;  3ZD9 A;  1HEK A;  2F8K A;  3PSF A;  1MC8 A;  1QQ6 A;  3K4G A;  5KTQ A;  2XIC A;  3PX4 A;  1T8E A;  2QLT A;  3QUB A;  2KV2 A;  2JV3 A;  3TKA A;  2ASJ A;  2XGP A;  2W8K A;  4IR1 A;  2R8H A;  4F71 A;  4I2J A;  3HKZ C;  2JEF A;  2ATL A;  4EYH B;  3NS1 A;  3QYP A;  5CR0 A;  4J03 A;  4DO9 A;  5ALD A;  1XC9 A;  2W03 A;  3H8W A;  1TAQ A;  4DQS A;  1UCV A;  1MQ2 A;  5C0Y A;  3RAQ A;  4EEK A;  4DLG A;  2BKE A;  1OW5 A;  1L8L A;  1S9F A;  4JWM A;  2EH9 A;  2JEI A;  2OWO A;  1URJ A;  2LMR A;  1JXE A;  4DQI A;  2O6K A;  5KT6 A;  4OJO A;  4QWE A;  4I2I A;  4RNM A;  2PFO A;  5AKZ A;  1ZQS A;  2W9B B;  3QU9 A;  5HHI A;  4UQG A;  1F0M A;  3J81 j;  4EEY A;  3L5K A;  3F2C A;  2IOH A;  1B0X A;  1SL0 A;  4KX3 A;  2PMZ C;  2ZIU A;  5IIL A;  4I28 A;  1V38 A;  1Z00 B;  1O03 A;  1SB3 C;  4RUC A;  1VLB A;  1LV5 A;  3JPO A;  1L8O A;  2ZJ8 A;  4B9U A;  3MBY A;  3JPR A;  3QUC A;  1MQ3 A;  3PW0 A;  2OH2 A;  2CN1 A;  3SAH A;  2XCP A;  4FZM A;  2D3D A;  4QIW C;  4KLQ A;  3QXG A;  2H3Z A;  3OGU A;  3BQ0 A;  3ZI4 A;  2W3S A;  2ZTC A;  4OJP A;  4QJF B;  1Z4N A;  4Y2V A;  3NVW A;  4Y2S A;  2J6U A;  2F2A B;  3BJY A;  4PL2 A;  5AKJ A;  4IQU A;  4J9K A;  2ZJ5 A;  5C5J A;  5AM3 A;  3SAG A;  5J0W A;  4NL9 A;  2XY7 A;  1KDH A;  3OHB A;  1HJP A;  4NM1 A;  2G5H B;  3RJE A;  3THV A;  4PL1 A;  2RRD A;  4CF5 A;  2OM6 A;  4M0A A;  2IHM A;  2ESE A;  4R8U A;  1UPH A;  2WHE A;  3EWA A;  4XA5 A;  2R8J A;  4FS2 A;  3FAH A;  2MAX A;  3GDX A;  4BWM A;  3EYZ A;  2Y0S C;  7ICS A;  3LWM A;  1UA0 A;  2KN7 A;  5L1L A;  4OJL A;  2OCE A;  1ZQV A;  3KHG A;  4RPY A;  5J2F A;  2BCV A;  4Y2T A;  3GIK A;  4P4O A;  4UAR A;  1IXR A;  4MF8 A;  1U4B A;  4ECY A;  2K4P A;  4EX7 A;  2KG5 A;  1ZET A;  1PK3 A;  2XID A;  4TQR A;  5J2B A;  9ICI A;  2KMD A;  9ICA A;  2ZXI A;  3C23 A;  4C7Y A;  2IBK A;  4NLB A;  1BNP A;  4CRX A;  4YR2 A;  1HIW A;  3NVY A;  3KBB A;  1L3S A; 
#chains in the Genus database with same CATH homology
 5F3X B;  2D3D A;  2QB1 A;  1WWU A;  2LPE A;  2ES6 A;  4PZN A;  3BS5 B;  3TAC B;  2QB0 B;  2YTU A;  2EAN A;  2KIV A;  2F8K A;  1B4F A;  2F3N A;  2EAP A;  2F44 A;  4NL9 A;  2Y9U A;  1SXD A;  1OXJ A;  2QAR A;  3SEN A;  2E8O A;  4RQM A;  2JV3 A;  2E8M A;  3BQ7 A;  3KKA A;  1COK A;  2KSO A;  1X9X A;  2B6G A;  2QAR B;  1SGG A;  2EAM A;  3TAD A;  2ESE A;  2Y9T A;  3KKA C;  1X66 A;  5KNI A;  4MHV A;  2DKX A;  1JI7 A;  5J8Y A;  5JTI A;  2KSO B;  2QKQ A;  2EAO A;  1KW4 A;  1SV4 A;  1RG6 A;  5J8Y C;  2L5Y A;  1SV0 A;  2DKZ A;  1UCV A;  4NL9 C;  1UQV A;  3H8M A;  1SV0 C;  1SXE A;  2E8P A;  3K1R B;  1OW5 A;  2D8C A;  5JU5 A;  2LMR A;  2KE7 A;  1Z1V A;  2K4P A;  3TAD C;  2KG5 A;  2QB0 A;  2DL0 A;  4RQN A;  3SEI A;  2E8N A;  5JRT A;  1PK3 A;  1F0M A;  1PK1 A;  2GLE A;  1LKY A;  1B0X A;  2KMD A;  4NJ8 A;  4PZO A;  3HIL A;  3IDW A;  5L1M A;  1V38 A;  3BS7 A;  1X40 A;  1PK1 B;  1DXS A;  1LKY B;  4IS7 A;  1WWV A;  3BS5 A;  2K60 A;  2FE9 A;  1V85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...