2E8PA

Solution structure of the n-terminal sam-domain of e74-like factor 3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELF3 protein
publication title Solution structure of the N-terminal SAM-domain of E74-like factor 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8pA01
3IDWA 2Y9TA 1WWUA 2Y9UA 1PK1B 5J8YA 2DKXA 2DL0A 4NL9A 1SXDA 3SEIA 3SENA 3BS7A 1SV0C 2KG5A 3TADC 2L5YA 5KNIA 2QB0A 3KKAA 1KW4A 2FE9A 4PZNA 3BS5A 2B6GA 1OW5A 2EAPA 4MHVA 2EANA 1JI7A 1DXSA 2EAMA 1SV4A 1LKYB 1SXEA 1UCVA 2D3DA 1RG6A 2KIVA 5F3XB 4RQMA 1WWVA 1B4FA 2D8CA 2KSOB 4RQNA 1PK1A 5JU5A 1SGGA 1X66A 1B0XA 2ESEA 1SV0A 2E8NA 2LPEA 1V38A 1COKA 1UQVA 4NJ8A 3TADA 2KSOA 2E8MA 2QARB 1X40A 3TACB 3HILA 1PK3A 2JV3A 2YTUA 5J8YC 5JTIA 2ES6A 2F8KA 1F0MA 2DKZA 2E8PA 3K1RB 2KE7A 1LKYA 4PZOA 2QB1A 1OXJA 2QB0B 3BQ7A 4IS7A 1V85A 5L1MA 3KKAC 3BS5B 2E8OA 5JRTA 2K60A 2F3NA 1Z1VA 2F44A 2GLEA 2QKQA 2K4PA 2LMRA 4NL9C 3H8MA 1X9XA 2EAOA 2QARA 2KMDA
chains in the Genus database with same CATH superfamily
2NYVA 5KFQA 4UB8U 1PK1B 5J8YA 3AEVA 8ICGA 1NK7A 3HX0A 5AKJA 2W9BA 3QZ7A 4ECSA 3MDCA 4I2EA 5J2CA 4C7YA 3TAPA 2BDPA 1NK5A 1QH9A 4PL2A 3L4PA 3SAHA 5KFAA 5CRXA 9ICRA 3VC8A 2AGQA 4CF3A 9ICHA 4PZNA 4O5KA 3BS5A 4F93B 2W3RA 4RPXA 3AN1A 1QTMA 1PZNA 5ALQA 2ZJ5A 1L8LA 1UCVA 4M9NA 1B43A 2H3IA 4P0PB 4Y2JA 4ECRA 7ICSA 2BZFA 3I28A 4IQUA 4UAWA 1FFUA 7ICNA 2HHTA 4UW9A 5EOZA 2XY5A 4OCZA 4I2IA 3MC1A 3SV4A 1X9WA 5AKIA 2FJ6A 2K4HA 4F2SA 1ZD4A 4O9MA 4UBCA 3UMGA 4UATA 4KMOB 1FEZA 4CDGA 7ICQA 4PHDA 4DS5A 3ICXA 2YY6A 4F92B 1U45A 5JTIA 1ZQMA 2VANA 1WCNA 3PMNA 3RJKA 5D4BA 1F0MA 1Y88A 4IQWA 1KEJA 4MFAA 7ICVA 5KT7A 2MAXA 4XQ8A 4CF4A 4M9JA 8ICFA 2PI5A 1ZQWA 1KQQA 3EPIA 3GU3A 5EWEA 2NRXA 1S77D 1PVPA 2K60A 2F3NA 5AK6A 2XC9A 2F44A 4I28A 2ZIWA 2W43A 1UT8A 4I2DA 1M6YA 5KG6A 1QQ6A 4NLKA 2NO4A 1S5LU 2KMDA 3RB0A 3HKZC 2B0CA 2P35A 4BXOB 1RQLA 2HBMA 3UQ0A 1IV8A 3NVYA 2KD1A 4RU9A 4JV2A 2KHVA 3QUQA 4TQSA 5KNIA 3WK9A 2HI0A 3H0LB 4OJPA 2AGOA 5AK5A 4C8LA 3K4GA 5KFMA 3FDSA 4DQQA 4YXMA 2EAPA 1TK8A 1SKSA 2BCVA 1DGJA 3A0HU 4K4GA 1T7PA 1D8YA 4Y2XA 3PX6A 2MRLA 3EZ5A 3RJIA 2Q4TA 4RQMA 2EZZA 3U26A 3AU6A 1D8LA 2JZBA 1L3SA 5B5EU 1QCKA 2E8NA 3PW5A 4PHAA 1BNPA 2A19A 1ZQGA 3RJGA 4KLFA 3WKEA 3QEBZ 4I2GA 1L3TA 5KFYA 3PW4A 1NK9A 4GC7A 3QXGA 5ALMA 2HHVA 3RAQA 2RQ5A 5J0TA 2H3VA 2HOIA 4NLCA 1JMSA 3WKBA 1PUZA 2KE7A 3THVA 5ALTA 5AKZA 3H4BA 4EENA 5AIBA 4IS7A 4QNLA 3QZ8A 2P6RA 3JPTA 3F5EA 2JEIA 3WU2U 4B6JA 3Q8KA 4O5CA 3A0BU 2W9BB 3E58A 5KFGA 1L6NA 3UM9A 1ZQIA 3FC4A 1COOA 3KOOA 1NJYA 4QJFB 4QW9A 3BS7A 2DPJA 3RH5A 4PGYA 1ZQRA 5J29A 3RFAA 4Y2TA 1TK0A 3QU9A 4QWAA 1DRGA 4F4ZA 4J9OA 5IILA 5FP0A 5ALGA 2BPFA 4CGZA 4CNQA 4J9LA 1VDVA 3WK8A 7ICGA 4Q8FA 1J97A 4QZIA 3WK5A 3RB6A 8ICAA 4EYHB 9ICIA 5KFCA 3UMCA 1KBUA 5KAIU 2H3FA 3T5JA 1NK6A 2MUTB 1IM4A 2JEGA 3V6KA 2M9NA 1AROP 2XCPA 4KLMA 3QE9Y 5HR7A 2AJQA 2N1RA 1X40A 1BPXA 3BJYA 1PK3A 2YTUA 5KFVA 4F71A 2ASJA 2AQ4A 1S8OA 9ICNA 1JXEA 5KFEA 9ICKA 4AP9A 3SQIA 2BR0A 4DLEA 3MDAA 5DKWA 2G08A 5AKKA 3Q8LA 2LI6A 1UHUA 1ZQZA 2EZYA 9ICCA 4C4TA 3ZDBA 4R65A 2BDUA 1NZPA 5EWFA 5AK4A 8ICYA 3I1YA 3HW8A 2A1JB 4JK1A 2DKXA 4R64A 2W9MA 2KNJA 3CYMA 4RQ2A 8ICQA 3TARA 2A1AA 3KZIU 5EE9A 3FAHA 2CXYA 1BGXT 5J2JA 1N63A 4R63A 3LWMA 2C2EA 4FBUA 1JI7A 2DUYA 4P0QA 5IIJA 4NV0A 5DLFA 2D3DA 4F3OA 5TZVA 4DF4A 2R18A 1XU4A 5EE0A 5AM5A 1PK1A 3ZDAA 5HMMA 3MR5A 3BZCA 3C2MA 4NJ8A 4Q44A 4JMUA 3M9OB 3C2LA 4UASA 2C22A 9ICAA 2RP5A 5J2EA 3IM1A 3T5LA 4US9A 1N5XA 1O03A 2UVWA 1P7DA 4ELTA 2FLPA 2ZIUB 4B9MA 2ZTEA 5KFRA 1SWVA 1ZQCA 2IHMA 4P0PA 3N7PD 2DF4B 5J2FA 4O3SA 2IMWP 1SZPA 1L7OA 2VKQA 5ALZA 5A0LA 2PFQA 4NM1A 4DFKA 4DFDA 2ZIXB 4Y2QA 4LVSA 5ALUA 1D8BA 3TQ1A 3I76A 3GDXA 4PJ0U 2Q0ZX 3N7RC 1XSPA 9ICUA 1N56A 5GTIU 1KFSA 1WWUA 2WFAA 5KFWA 5J0XA 5BPCA 1ZOLA 2Y0SC 1ZD2P 4DL5A 1NJZA 4KITB 2KEYA 4MFFA 4ELVA 1DK2A 4UAUA 3SAGA 1L5UA 2GO7A 1WCLA 3NUQA 2PMZF 2NRVA 4RNOA 3LK9A 3GV8B 1Q8KA 4NLZA 1ZQ1C 3IV6A 4DL3A 5J0UA 2WF7A 3JPRA 3F5AA 2OM6A 3M9MB 1QSLA 3PNCA 4C0ZA 1ZQXA 2D8CA 4OJOA 4BXOA 1K5OA 1Z4NA 4RQNA 1ZQAA 5KFXA 4EEYA 1RDFA 7ICKA 3AL0B 3G6XA 1UQVA 1KTQA 4QIWF 2KSOA 2D6FC 2FMPA 5H2FU 2RRDA 2EQYA 3PSIA 3OJUA 1U49A 4U6PA 1Z00B 3IRUA 3OHAA 4NY8A 4DL7A 3EWAA 4KMUA 5L1IA 3GZFA 4KN7A 1SL2A 2FLNA 3UXOA 3PW0A 3RR8A 4LZGA 5DB7A 1YZ6A 1UT5A 4TUQA 8ICWA 2ZXHA 3UPQA 3BQ7A 2RDJA 3QX7A 4CRXA 2HBJA 2NRWA 2G09A 4AYBF 4B9SA 9ICQA 3MFIA 1Z4OA 2K4PA 4DCCA 3WK6A 4TUSA 1VLBA 2JH7A 4J9KA 8ICOA 2Y9UA 4ECVA 2WF5A 1SXDA 4DL2A 9ICJA 4F5OA 2RHFA 4DWIA 1UA1A 4RQ6A 4KX5A 9ICLA 2C2DA 3KHHA 3KD3A 4UB1A 4JV0A 1KSPA 1A0PA 1X9SA 3OTQA 1CUKA 3MR2A 3WKAA 1SXEA 5AM0A 4DSIA 3ISCA 2PFPA 2KIVA 4RPYA 3PR4A 4GXJA 4RQ3A 3UMBA 2HVHA 2NRZA 4F4XA 1X6JA 3RRHA 3PZPA 1JX4A 3QU2A 3ISBA 5IINA 2BQ3A 3PMLA 4NLNA 3H8SA 2FMSA 4EYIB 5KFDA 5KFOA 1DGSA 2EZXA 3G6YA 4R66A 1ZQNA 3HJEA 5J2BA 4UB5A 4PZOA 1L7MA 3PR5B 4IRKA 3V6HA 3GIIA 4ED8A 7ICFA 2IA6A 1WUDA 3MGVA 3IN5A 4F4YA 2G5HB 1ZRMA 2MUTA 5JRTA 4B9TA 3HWTA 3F2DA 1A77A 5DBCA 1Z1VA 1ZQTA 1MQ2A 4YP3A 4RQ5A 1RQNA 3FYHA 8ICKA 2XY7A 5ALFA 3RAXA 3TFRA 5KT4A 4NLGA 1N2XA 4DLGA 3CW2C 1JROA 5L1JA 1A76A 4C8OA 1QQ7A 2I6XA 8ICHA 5AKLA 4F5QA 1S0VA 7ICPA 5DDYA 4KLTA 4DQIA 4BWJA 3ONNA 2OYYA 8ICXA 5J2AA 1XNSA 3PV8A 2HBLA 2XICA 3LVVA 1QSYA 5KFKA 3V7JA 2FDRA 4B9VA 4XA5A 5DGBA 5KFLA 3AQFA 4Q43A 2KSOB 2A1JA 5CEHA 2DQNB 3H0RB 1X2IA 1WYGA 4X5VA 2BCSA 3ZD8A 4I2HA 2JXJA 1URJA 1U4BA 4DSJA 4F5NA 1BPYA 5AI8A 5DGAA 2ZIVB 5TISU 1BPBA 1NJWA 2ZJAA 9ICTA 1S10A 1NKEA 4ZH4A 4FZMA 1XSLA 4ED3A 5J0QA 2KKPA 5HNKA 2ISPA 4ED7A 2VJ5A 2AXTU 2OWOA 3NASA 4RUCA 4RNNA 3UXPA 3BQTA 1BVSA 4KLIA 3L3FX 2IOFA 4UB6U 2LBOA 4I2BA 2H5XA 4NXZA 4UBBA 4RNMA 3NS1A 4UAZA 2LMRA 4IQVA 2BKEA 3C1YA 4LZDA 2ATLA 4IL6U 1BPEA 4QZAA 2HHSA 1MQ3A 3RR7A 2ZIUA 1SV0C 5J0WA 3LVWA 3DV9A 1Q3UA 4WJ3B 1PVQA 4DSKA 3T5HA 4ELUA 3M6ZA 2JHDA 3TAQA 9ICFA 1RM6C 2B6GA 3BQ0A 2WF9A 5ALDA 4DQPA 2ZIXA 1K1QA 4DEZA 1DXSA 3PSPA 3ETLA 1KDHA 1IIPA 8ICUA 2LKYA 3QYPA 4Z6FA 5BOMA 1S76D 7ICIA 2BPCA 5F3XB 4Y2PA 5DBBA 3M8RA 4QZHA 2BGWA 1JXLA 2FMQA 1O08A 4CCHA 5AM4A 2P66A 4G9BA 1V38A 4RQ1A 4XRHA 4EZ6A 1NNLA 4G3IA 1ZQPA 8ICJA 2FPKA 5KFUA 3BQ2A 1Z1BA 3PY8A 4B9UA 2KK0A 4YN4A 2JEJA 4I29A 3GIJA 3MGHA 3TI0A 2R8KA 2V9WA 4YR0A 4XUSA 5T14A 2W9CB 4KLUA 3PW7A 4IRDA 1J2NA 5C0YA 3QU7A 4Q45A 1X42A 4US8A 5HP4A 2F2AB 3F53A 2WF6A 1RPLA 3LYSA 7ICRA 2E8OA 4FZNA 3OSNA 3Q8RB 2HBKA 4DS4A 4M9HA 2I5HA 5E79U 4ECYA 2GLEA 4YD1A 1L3VA 4C8NA 4QZFA 3H8MA 4KLHA 4RT3A 4A8EA 5KFNA 4M6WB 1TAUA 1Z00A 2LHTA 4M9LA 2YN4A 2G07A 2P6UA 2VJ4A 3OJSA 4Y2VA 2UVUA 1F5SA 1NKCA 2JR5A 5ALWA 3GFKB 1IG6A 5DG9A 4YD2A 9ICOA 1QQ5A 1KKXA 1OW5A 3ZDCA 2K8CB 2KICA 5KG1A 4J9RA 4P2HA 1H38A 4DFMA 1IXRA 3M7DA 3H40A 3GIKA 2ZTCA 4O3NA 4QW8A 1XO1A 3ZD9A 4CE6A 1XC9A 3Q8QB 4KLOA 1F44A 3R9KA 4QWBA 2I9GA 5AKYA 1B0XA 2ESEA 3GIMA 1SV0A 2W8KA 1COKA 4F2RA 1V9PA 4OD0A 4UB2A 2ALZA 5CP2A 5AKEA 4OO1J 1XSNA 7ICOA 2F77X 7ICUA 2F1JA 4I2AA 4KTQA 1JRPA 2QARB 2H3ZA 5GTHU 1KN5A 1U48A 1S0MA 3NRWA 1X6IA 4P4PA 4UQGA 4MFCA 2DKZA 1KLNA 2Y1IA 4B9LA 5CA7A 1NZBA 5KFPA 3QU4A 2HMXA 4B9NA 4U7CA 2YB4A 7ICEA 4IC9A 3JPQA 5KG2A 4YXJA 3UQ2A 4Y2YA 2K4EA 1U47A 8ICNA 5DQGA 3WK4A 3N97B 4BGDA 4MF8A 1RXVA 1QSSA 2RLTA 1S0OA 1C7YA 4HYKA 3KHRA 5C5JA 5D49A 3ED5A 4YVZA 2FLLA 1SZHA 3TANA 2NV3A 4KLDA 1TFRA 2DL0A 1ZQBA 3K75D 4QZ9A 2AGPA 2V4RA 1V97A 5AKGA 2HW3A 2NRTA 3TADC 4OJ6A 3PX0A 2VIXA 8ICBA 2HOQA 3SAFA 3RRGA 4FS2A 5EE1A 4IRCA 1KW4A 4LJXA 9ICGA 3NVWA 5ALIA 4YG2A 1ZQLA 2XGQA 4EBDA 2E5SA 5IIIA 4F5RA 8ICSA 2EAMA 5KT5A 1K1SA 4C80A 1LKYB 5ALJA 2BQUA 2VA2A 3NVZA 1WWVA 1ZQKA 1YT3A 4JWMA 3SYZA 3G6VA 2OEHA 2CN1A 4PPXA 4BUGA 4F4KA 2LPEA 1QLNA 2KP7A 2J6SA 1MC8A 5IIKA 2WAQF 2PKEA 1SIJA 2LM1A 5ALRA 4C4RA 8ICEA 4GC6A 4QZ8A 1HIWA 4ECQA 8ICRA 2PMZC 1SB3C 3KFUF 1NK4A 4BDPA 4FBTA 2JMGA 1FIQA 4M2YA 2FI1A 3MFHA 2WF8A 5ALNA 2MU2A 5DB8A 4UARA 4J9MA 3TFSA 2R8JA 2QB1A 1ECWA 5J0PA 4EX6A 2J6UA 3B9JA 4QZEA 4P4OA 2Y1JA 4QZDA 1KFTA 5DG8A 1C20A 3TKAA 4Z6CA 3T79A 3SD7A 5KT3A 3GV7B 2R8HA 3AMZA 4C8MA 3N7SC 2XIDA 2ZIVA 4RT2A 4KLQA 2Y9TA 4DOAA 3H0MB 3HRDD 2BQRA 1NK8A 3EYZA 5KFSA 2EDUA 2K89A 5ALYA 1ZXIA 1KL9A 3D2SA 4QWEA 5ALXA 5DBAA 2KFNA 4M0AA 4PHPA 5J2DA 4DFJA 1ZQUA 4AYBC 5J0YA 1HEKA 2PXIA 4O5EA 2FPLA 3D2NA 4GXIA 2W54A 2IHNA 2WB1C 3V6JA 4RQ7A 5J2GA 2HHQA 1SGGA 4CF5A 1GO3F 2KJ8A 2YQEA 3PW2A 5HR6A 1EXNA 3FM9A 5AI4A 1YZ7A 3TADA 3RBEA 8ICVA 1ZQOA 1MA7A 2UVRA 1BNOA 3ZDEA 4BWMA 3ALRA 2DWQA 5KAFU 3NVVA 4PGXA 1UPHA 3HILA 2DBYA 5J0RA 2XO7A 4ECUA 1ZD3A 3DEEA 4DFPA 4YFKA 2E8PA 3WKDA 5ALKA 3SR6A 4RPZA 5L1LA 1PVRA 2JEFA 1JUDA 5IIOA 2WTFA 4RQ0A 5D46A 3H7IA 2HHXA 5F9NA 3C5GA 4KLSA 3PX4A 5G5GA 2ISOA 1ZRNA 4Z6EA 4YR3A 4MF2A 3MR6A 1DK3A 3RB3A 2ZUCA 5KFFA 4F4WA 5DDMA 4DL6A 2OXOA 2MSNA 5AM1A 3K1ZA 3RJFA 1N62A 1NKBA 3ETRA 4O3PA 4IR1A 9ICEA 4Y2UA 1XWLA 2G06A 2LM4A 3BQ1A 4NL9A 3Q8PB 3T5KA 4TUPA 2KG5A 4P4MA 1DOQA 2W9CA 5G5HA 3F2CA 5CHGA 3M8SA 2KN7A 8ICMA 5KFBA 2VA8A 3GILA 3CNHA 2BHNA 4MHVA 9ICSA 4PHEA 5KTQA 5EWGA 1XS9D 4J9NA 1J2MA 1TK5A 3EUB2 2EH9A 1RG6A 5KG0A 3RF9A 1WG8A 9ICPA 2KVSA 4EEKA 4M6WA 4USAA 1T94A 4J9QA 4KLEA 8ICPA 3AQEA 3MBYA 3PVXA 5HMLA 3IG8A 3ZDDA 4FE3A 4JV1A 1KFDA 1T3QA 3HKZF 3PO5A 1T8EA 3NRZA 2HCFA 2GWSA 1TV9A 3F2BA 1ZQJA 2G0AA 4HAIA 2HHUA 4J9SA 2K8AA 4EBCA 3RJJA 2C28A 4O3RA 3QUTA 4C7ZA 3K1RB 4ZOHC 4R8UB 5AKHA 1RXWA 4IQTA 1OUQA 3O0FA 2QB0B 8ICZA 5J2HA 1ZJMA 1V85A 4TQRA 5KG5A 4C4SA 3KKAC 4GIBA 3NGDA 4ED0A 2HOFA 1TAQA 2M0NA 4M9GA 3NTUA 1MSWD 4KN4A 3RTVA 3RJHA 1UA0A 5KFTA 4DOCA 3M1YA 4F5PA 3KTQA 2QARA 3Q8SB 4OJ5A 1U9LA 4Q8EA 5AI5A 2R8GA 4ECZA 2FPMA 2AH5A 3SEIA 1NJXA 4DO9A 4OJLA 2ZUBA 5DLGA 1TKDA 4KLLA 3HT3A 2ZG6A 3KHLA 2XY6A 1S97A 2OH2A 2CPRA 3OPXA 3SZ2A 2KHQA 3H8JA 5KG7A 4GLXA 4UB4A 1N5WA 2KZ3A 4EZ9A 2BCQA 3B0YA 4O3MA 1SV4A 3JPPA 4PL1A 1Q3VA 5AI9A 1S0NA 4PH5A 7ICTA 4QWCA 5CB1A 4I27A 3AU2A 1S9FA 4FS1A 5ALOA 5F9LA 2LYBA 4K4IA 3J81j 1NK0A 1ZJNA 5DG7A 2YB1A 4YQWA 1MN8A 1BPDA 1SWWA 4QWDA 2W7OA 5KFIA 2KIWA 2ZTDA 4UAYA 2MA1A 4DQSA 1FO4A 1L8OA 3E0FA 2KZZA 4FZLA 3DDHA 1Z3EB 1ZQQA 4NLBA 5CWRA 2ES6A 2PFNA 2IOFK 5ALSA 2DGZA 1LKYA 4I2FA 2HDOA 1OXJA 5DB9A 3H4DA 4DSEA 4YMOA 3SV3A 1LVHA 2AHOB 4ECWA 3BS5B 2DPIA 3ORYA 5AI0A 3KHGA 2BCUA 2XI9A 5EE3A 3N28A 3PO4A 2K4IA 2KJ5A 5CR0A 2KJ9A 4JUZA 5AM3A 2B21A 1X9XA 3QU5A 1A6SA 4EBEA 2ODGA 3IDWA 1ZD5A 4JB3A 3OHBA 2YMMA 4DSFA 3MABA 1FFVA 1T3NA 2ZUDA 3RB4A 2W55A 3SENA 2WHEA 1Q46A 4YMNA 5KT2A 3WKCA 3IHQB 1RZTA 1L3UA 2CRXA 2L5YA 2KOBA 2KV2A 4C8KA 2HHWA 3KKAA 9ICVA 2KTQA 1ZQDA 3PSFA 4YR2A 2NO5A 4ED1A 2OCEA 1SKWA 4I2CA 2KVCA 8ICTA 4J9PA 3RH6A 4DOBA 5AKXA 3Q8MA 4QZGA 3MGIA 3LWLA 8ICIA 1TE2A 4ACOA 3EPGA 2ASLA 4DSLA 2W9AA 3HPOA 2XCAA 2AQ0A 3CRXA 1XO0A 3C2KA 5DQIA 4YCXA 3JPNA 2VA3A 4EX7A 1VJ5A 3C23A 2IBKA 3GQCA 3RBDA 2ZIWB 1TVAA 1ZQSA 3C28A 2O6KA 2XGPA 9ICMA 3GV5B 3H8WA 2IOHA 4F91B 5ALLA 7ICLA 1SL0A 3S6JA 1L7PA 5ALVA 3M9NB 2JV3A 1NI3A 4F50A 4EELA 1LB2B 2A3VA 2F8KA 4ICAA 5AIAA 4KLJA 2LYAA 4KX3A 2JGAA 2OHFA 2K8BB 2HVIA 3C5FA 3BZKA 2Z7JA 4FFDA 5AK3A 2F76X 1ZYQA 5J2KA 3V7KA 1CI4A 3IP4B 5KG4A 5ALHA 1RYRA 1ZQVA 2JH1A 1HJPA 1N48A 3HP6A 3ISDA 3T3FA 2YX8A 2JZBB 5KFJA 4RUAA 4Z6DA 5L1KA 3C29A 2RDIA 5KG3A 5AI6A 3D2QA 1ED1A 4JWNA 2DFLA 1SL1A 4TURA 3RH4A 3AUOA 2ZJ8A 4F8RA 1L7NA 4RQ8A 1JALA 4I2JA 3QEAZ 2PFOA 8ICLA 3QUCA 3OSPA 5ALPA 2XVTA 3MR3A 3LDAA 2W8LA 2YMQA 4FO6A 4O3QA 5AM2A 4KLGA 1ZETA 2KFZA 2GH1A 5JU5A 1BPZA 2KZMA 5JUMA 1X66A 2E1FA 3QUBA 3L5KA 3ZI4A 2E3TA 3V7LA 4E0DA 4K4HA 1ZQHA 3OGUA 3VCBA 7ICJA 2G5IB 5KT6A 1CEZA 1AQ6A 3SI8A 5KFHA 2Y0SF 5KL1B 2ZXIA 3TACB 3IG5A 5IIMA 2PI4A 2BPGA 5J8YC 2W04A 4RQ4A 3D6JA 2J6TA 1HUZA 3QNMA 4NM2A 5L1MA 4YMMA 5DB6A 4ED6A 5J0SA 3C1ZA 1LV5A 3E2EA 4O3OA 1HUOA 4UB3A 1N61A 2KKVA 3C21A 2QKQA 5KL8B 2W7PA 1D9DA 7ICHA 9ICXA 4NL9C 3WK7A 2EAOA 5J2IA 5B66U 3B0XA 2W11A 2WAQC 2ASDA 4MEXA 2HSZA 2AU0A 3RJEA 5HHHA 1N60A 2H3QA 3EW9A 4UAVA 4R8UA 1ZQFA 2R8IA 1JIHA 2F8LA 2JRZA 3UXNA 2V4QA 3JPOA 4ECXA 2QB0A 4F72A 1SKRA 4QIWC 2FE9A 1B22A 4BX9C 1D9FA 9ICWA 4PGQA 3V72A 4M47A 1CRXA 2EANA 4Y2RA 2E1EA 1X9MA 4DF8A 1TAMA 3M6KA 3CP8A 1JN3A 1ZQYA 2W3SA 4GXKA 4QZCA 1RYSA 5L9XA 1B4FA 5KFZA 2F1IA 2QLTA 5AICA 3PSTA 3SMVA 2LYHA 4BJQA 3AM9A 7ICMA 4MEYA 9ICBA 4IR9A 2YMLA 4RZRA 2C2RA 2BCRA 1NOMA 3KBBA 2F1HA 2E8MA 5BOLA 4DL4A 1T4GA 3BDPA 2YMPA 2I1QA 4M04A 4J03A 2WB1F 4QZBA 3KZXA 4NWIA 4ECTA 5CJ7A 2UVVA 5AHXA 5DQHA 4Y2SA 3N4MB 1RYUA 4O0IA 1ZQEA 4ED2A 8ICCA 3JPSA 2GOLA 4P0QB 2W03A 5ALEA 4GFJA 5K4LA 5HHIA 1KRPA 4DQRA 1Z19A 5J0OA
chains in the Genus database with same CATH topology
3IDWA 2Y9TA 1WWUA 2Y9UA 1PK1B 5J8YA 2DKXA 2DL0A 4NL9A 1SXDA 3SEIA 3SENA 3BS7A 1SV0C 2KG5A 3TADC 2L5YA 5KNIA 2QB0A 3KKAA 1KW4A 2FE9A 4PZNA 3BS5A 2B6GA 1OW5A 2EAPA 4MHVA 2EANA 1JI7A 1DXSA 2EAMA 1SV4A 1LKYB 1SXEA 1UCVA 2D3DA 1RG6A 2KIVA 5F3XB 4RQMA 1WWVA 1B4FA 2D8CA 2KSOB 4RQNA 1PK1A 5JU5A 1SGGA 1X66A 1B0XA 2ESEA 1SV0A 2E8NA 2LPEA 1V38A 1COKA 1UQVA 4NJ8A 3TADA 2KSOA 2E8MA 2QARB 1X40A 3TACB 3HILA 1PK3A 2JV3A 2YTUA 5J8YC 5JTIA 2ES6A 2F8KA 1F0MA 2DKZA 2E8PA 3K1RB 2KE7A 1LKYA 4PZOA 2QB1A 1OXJA 2QB0B 3BQ7A 4IS7A 1V85A 5L1MA 3KKAC 3BS5B 2E8OA 5JRTA 2K60A 2F3NA 1Z1VA 2F44A 2GLEA 2QKQA 2K4PA 2LMRA 4NL9C 3H8MA 1X9XA 2EAOA 2QARA 2KMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  2Y9T A;  1WWU A;  2Y9U A;  1PK1 B;  5J8Y A;  2DKX A;  2DL0 A;  4NL9 A;  1SXD A;  3SEI A;  3SEN A;  3BS7 A;  1SV0 C;  2KG5 A;  3TAD C;  2L5Y A;  5KNI A;  2QB0 A;  3KKA A;  1KW4 A;  2FE9 A;  4PZN A;  3BS5 A;  2B6G A;  1OW5 A;  2EAP A;  4MHV A;  2EAN A;  1JI7 A;  1DXS A;  2EAM A;  1SV4 A;  1LKY B;  1SXE A;  1UCV A;  2D3D A;  1RG6 A;  2KIV A;  5F3X B;  4RQM A;  1WWV A;  1B4F A;  2D8C A;  2KSO B;  4RQN A;  1PK1 A;  5JU5 A;  1SGG A;  1X66 A;  1B0X A;  2ESE A;  1SV0 A;  2E8N A;  2LPE A;  1V38 A;  1COK A;  1UQV A;  4NJ8 A;  3TAD A;  2KSO A;  2E8M A;  2QAR B;  1X40 A;  3TAC B;  3HIL A;  1PK3 A;  2JV3 A;  2YTU A;  5J8Y C;  5JTI A;  2ES6 A;  2F8K A;  1F0M A;  2DKZ A;  2E8P A;  3K1R B;  2KE7 A;  1LKY A;  4PZO A;  2QB1 A;  1OXJ A;  2QB0 B;  3BQ7 A;  4IS7 A;  1V85 A;  5L1M A;  3KKA C;  3BS5 B;  2E8O A;  5JRT A;  2K60 A;  2F3N A;  1Z1V A;  2F44 A;  2GLE A;  2QKQ A;  2K4P A;  2LMR A;  4NL9 C;  3H8M A;  1X9X A;  2EAO A;  2QAR A;  2KMD A; 
#chains in the Genus database with same CATH topology
 2NYV A;  5KFQ A;  4UB8 U;  1PK1 B;  5J8Y A;  3AEV A;  8ICG A;  1NK7 A;  3HX0 A;  5AKJ A;  2W9B A;  3QZ7 A;  4ECS A;  3MDC A;  4I2E A;  5J2C A;  4C7Y A;  3TAP A;  2BDP A;  1NK5 A;  1QH9 A;  4PL2 A;  3L4P A;  3SAH A;  5KFA A;  5CRX A;  9ICR A;  3VC8 A;  2AGQ A;  4CF3 A;  9ICH A;  4PZN A;  4O5K A;  3BS5 A;  4F93 B;  2W3R A;  4RPX A;  3AN1 A;  1QTM A;  1PZN A;  5ALQ A;  2ZJ5 A;  1L8L A;  1UCV A;  4M9N A;  1B43 A;  2H3I A;  4P0P B;  4Y2J A;  4ECR A;  7ICS A;  2BZF A;  3I28 A;  4IQU A;  4UAW A;  1FFU A;  7ICN A;  2HHT A;  4UW9 A;  5EOZ A;  2XY5 A;  4OCZ A;  4I2I A;  3MC1 A;  3SV4 A;  1X9W A;  5AKI A;  2FJ6 A;  2K4H A;  4F2S A;  1ZD4 A;  4O9M A;  4UBC A;  3UMG A;  4UAT A;  4KMO B;  1FEZ A;  4CDG A;  7ICQ A;  4PHD A;  4DS5 A;  3ICX A;  2YY6 A;  4F92 B;  1U45 A;  5JTI A;  1ZQM A;  2VAN A;  1WCN A;  3PMN A;  3RJK A;  5D4B A;  1F0M A;  1Y88 A;  4IQW A;  1KEJ A;  4MFA A;  7ICV A;  5KT7 A;  2MAX A;  4XQ8 A;  4CF4 A;  4M9J A;  8ICF A;  2PI5 A;  1ZQW A;  1KQQ A;  3EPI A;  3GU3 A;  5EWE A;  2NRX A;  1S77 D;  1PVP A;  2K60 A;  2F3N A;  5AK6 A;  2XC9 A;  2F44 A;  4I28 A;  2ZIW A;  2W43 A;  1UT8 A;  4I2D A;  1M6Y A;  5KG6 A;  1QQ6 A;  4NLK A;  2NO4 A;  1S5L U;  2KMD A;  3RB0 A;  3HKZ C;  2B0C A;  2P35 A;  4BXO B;  1RQL A;  2HBM A;  3UQ0 A;  1IV8 A;  3NVY A;  2KD1 A;  4RU9 A;  4JV2 A;  2KHV A;  3QUQ A;  4TQS A;  5KNI A;  3WK9 A;  2HI0 A;  3H0L B;  4OJP A;  2AGO A;  5AK5 A;  4C8L A;  3K4G A;  5KFM A;  3FDS A;  4DQQ A;  4YXM A;  2EAP A;  1TK8 A;  1SKS A;  2BCV A;  1DGJ A;  3A0H U;  4K4G A;  1T7P A;  1D8Y A;  4Y2X A;  3PX6 A;  2MRL A;  3EZ5 A;  3RJI A;  2Q4T A;  4RQM A;  2EZZ A;  3U26 A;  3AU6 A;  1D8L A;  2JZB A;  1L3S A;  5B5E U;  1QCK A;  2E8N A;  3PW5 A;  4PHA A;  1BNP A;  2A19 A;  1ZQG A;  3RJG A;  4KLF A;  3WKE A;  3QEB Z;  4I2G A;  1L3T A;  5KFY A;  3PW4 A;  1NK9 A;  4GC7 A;  3QXG A;  5ALM A;  2HHV A;  3RAQ A;  2RQ5 A;  5J0T A;  2H3V A;  2HOI A;  4NLC A;  1JMS A;  3WKB A;  1PUZ A;  2KE7 A;  3THV A;  5ALT A;  5AKZ A;  3H4B A;  4EEN A;  5AIB A;  4IS7 A;  4QNL A;  3QZ8 A;  2P6R A;  3JPT A;  3F5E A;  2JEI A;  3WU2 U;  4B6J A;  3Q8K A;  4O5C A;  3A0B U;  2W9B B;  3E58 A;  5KFG A;  1L6N A;  3UM9 A;  1ZQI A;  3FC4 A;  1COO A;  3KOO A;  1NJY A;  4QJF B;  4QW9 A;  3BS7 A;  2DPJ A;  3RH5 A;  4PGY A;  1ZQR A;  5J29 A;  3RFA A;  4Y2T A;  1TK0 A;  3QU9 A;  4QWA A;  1DRG A;  4F4Z A;  4J9O A;  5IIL A;  5FP0 A;  5ALG A;  2BPF A;  4CGZ A;  4CNQ A;  4J9L A;  1VDV A;  3WK8 A;  7ICG A;  4Q8F A;  1J97 A;  4QZI A;  3WK5 A;  3RB6 A;  8ICA A;  4EYH B;  9ICI A;  5KFC A;  3UMC A;  1KBU A;  5KAI U;  2H3F A;  3T5J A;  1NK6 A;  2MUT B;  1IM4 A;  2JEG A;  3V6K A;  2M9N A;  1ARO P;  2XCP A;  4KLM A;  3QE9 Y;  5HR7 A;  2AJQ A;  2N1R A;  1X40 A;  1BPX A;  3BJY A;  1PK3 A;  2YTU A;  5KFV A;  4F71 A;  2ASJ A;  2AQ4 A;  1S8O A;  9ICN A;  1JXE A;  5KFE A;  9ICK A;  4AP9 A;  3SQI A;  2BR0 A;  4DLE A;  3MDA A;  5DKW A;  2G08 A;  5AKK A;  3Q8L A;  2LI6 A;  1UHU A;  1ZQZ A;  2EZY A;  9ICC A;  4C4T A;  3ZDB A;  4R65 A;  2BDU A;  1NZP A;  5EWF A;  5AK4 A;  8ICY A;  3I1Y A;  3HW8 A;  2A1J B;  4JK1 A;  2DKX A;  4R64 A;  2W9M A;  2KNJ A;  3CYM A;  4RQ2 A;  8ICQ A;  3TAR A;  2A1A A;  3KZI U;  5EE9 A;  3FAH A;  2CXY A;  1BGX T;  5J2J A;  1N63 A;  4R63 A;  3LWM A;  2C2E A;  4FBU A;  1JI7 A;  2DUY A;  4P0Q A;  5IIJ A;  4NV0 A;  5DLF A;  2D3D A;  4F3O A;  5TZV A;  4DF4 A;  2R18 A;  1XU4 A;  5EE0 A;  5AM5 A;  1PK1 A;  3ZDA A;  5HMM A;  3MR5 A;  3BZC A;  3C2M A;  4NJ8 A;  4Q44 A;  4JMU A;  3M9O B;  3C2L A;  4UAS A;  2C22 A;  9ICA A;  2RP5 A;  5J2E A;  3IM1 A;  3T5L A;  4US9 A;  1N5X A;  1O03 A;  2UVW A;  1P7D A;  4ELT A;  2FLP A;  2ZIU B;  4B9M A;  2ZTE A;  5KFR A;  1SWV A;  1ZQC A;  2IHM A;  4P0P A;  3N7P D;  2DF4 B;  5J2F A;  4O3S A;  2IMW P;  1SZP A;  1L7O A;  2VKQ A;  5ALZ A;  5A0L A;  2PFQ A;  4NM1 A;  4DFK A;  4DFD A;  2ZIX B;  4Y2Q A;  4LVS A;  5ALU A;  1D8B A;  3TQ1 A;  3I76 A;  3GDX A;  4PJ0 U;  2Q0Z X;  3N7R C;  1XSP A;  9ICU A;  1N56 A;  5GTI U;  1KFS A;  1WWU A;  2WFA A;  5KFW A;  5J0X A;  5BPC A;  1ZOL A;  2Y0S C;  1ZD2 P;  4DL5 A;  1NJZ A;  4KIT B;  2KEY A;  4MFF A;  4ELV A;  1DK2 A;  4UAU A;  3SAG A;  1L5U A;  2GO7 A;  1WCL A;  3NUQ A;  2PMZ F;  2NRV A;  4RNO A;  3LK9 A;  3GV8 B;  1Q8K A;  4NLZ A;  1ZQ1 C;  3IV6 A;  4DL3 A;  5J0U A;  2WF7 A;  3JPR A;  3F5A A;  2OM6 A;  3M9M B;  1QSL A;  3PNC A;  4C0Z A;  1ZQX A;  2D8C A;  4OJO A;  4BXO A;  1K5O A;  1Z4N A;  4RQN A;  1ZQA A;  5KFX A;  4EEY A;  1RDF A;  7ICK A;  3AL0 B;  3G6X A;  1UQV A;  1KTQ A;  4QIW F;  2KSO A;  2D6F C;  2FMP A;  5H2F U;  2RRD A;  2EQY A;  3PSI A;  3OJU A;  1U49 A;  4U6P A;  1Z00 B;  3IRU A;  3OHA A;  4NY8 A;  4DL7 A;  3EWA A;  4KMU A;  5L1I A;  3GZF A;  4KN7 A;  1SL2 A;  2FLN A;  3UXO A;  3PW0 A;  3RR8 A;  4LZG A;  5DB7 A;  1YZ6 A;  1UT5 A;  4TUQ A;  8ICW A;  2ZXH A;  3UPQ A;  3BQ7 A;  2RDJ A;  3QX7 A;  4CRX A;  2HBJ A;  2NRW A;  2G09 A;  4AYB F;  4B9S A;  9ICQ A;  3MFI A;  1Z4O A;  2K4P A;  4DCC A;  3WK6 A;  4TUS A;  1VLB A;  2JH7 A;  4J9K A;  8ICO A;  2Y9U A;  4ECV A;  2WF5 A;  1SXD A;  4DL2 A;  9ICJ A;  4F5O A;  2RHF A;  4DWI A;  1UA1 A;  4RQ6 A;  4KX5 A;  9ICL A;  2C2D A;  3KHH A;  3KD3 A;  4UB1 A;  4JV0 A;  1KSP A;  1A0P A;  1X9S A;  3OTQ A;  1CUK A;  3MR2 A;  3WKA A;  1SXE A;  5AM0 A;  4DSI A;  3ISC A;  2PFP A;  2KIV A;  4RPY A;  3PR4 A;  4GXJ A;  4RQ3 A;  3UMB A;  2HVH A;  2NRZ A;  4F4X A;  1X6J A;  3RRH A;  3PZP A;  1JX4 A;  3QU2 A;  3ISB A;  5IIN A;  2BQ3 A;  3PML A;  4NLN A;  3H8S A;  2FMS A;  4EYI B;  5KFD A;  5KFO A;  1DGS A;  2EZX A;  3G6Y A;  4R66 A;  1ZQN A;  3HJE A;  5J2B A;  4UB5 A;  4PZO A;  1L7M A;  3PR5 B;  4IRK A;  3V6H A;  3GII A;  4ED8 A;  7ICF A;  2IA6 A;  1WUD A;  3MGV A;  3IN5 A;  4F4Y A;  2G5H B;  1ZRM A;  2MUT A;  5JRT A;  4B9T A;  3HWT A;  3F2D A;  1A77 A;  5DBC A;  1Z1V A;  1ZQT A;  1MQ2 A;  4YP3 A;  4RQ5 A;  1RQN A;  3FYH A;  8ICK A;  2XY7 A;  5ALF A;  3RAX A;  3TFR A;  5KT4 A;  4NLG A;  1N2X A;  4DLG A;  3CW2 C;  1JRO A;  5L1J A;  1A76 A;  4C8O A;  1QQ7 A;  2I6X A;  8ICH A;  5AKL A;  4F5Q A;  1S0V A;  7ICP A;  5DDY A;  4KLT A;  4DQI A;  4BWJ A;  3ONN A;  2OYY A;  8ICX A;  5J2A A;  1XNS A;  3PV8 A;  2HBL A;  2XIC A;  3LVV A;  1QSY A;  5KFK A;  3V7J A;  2FDR A;  4B9V A;  4XA5 A;  5DGB A;  5KFL A;  3AQF A;  4Q43 A;  2KSO B;  2A1J A;  5CEH A;  2DQN B;  3H0R B;  1X2I A;  1WYG A;  4X5V A;  2BCS A;  3ZD8 A;  4I2H A;  2JXJ A;  1URJ A;  1U4B A;  4DSJ A;  4F5N A;  1BPY A;  5AI8 A;  5DGA A;  2ZIV B;  5TIS U;  1BPB A;  1NJW A;  2ZJA A;  9ICT A;  1S10 A;  1NKE A;  4ZH4 A;  4FZM A;  1XSL A;  4ED3 A;  5J0Q A;  2KKP A;  5HNK A;  2ISP A;  4ED7 A;  2VJ5 A;  2AXT U;  2OWO A;  3NAS A;  4RUC A;  4RNN A;  3UXP A;  3BQT A;  1BVS A;  4KLI A;  3L3F X;  2IOF A;  4UB6 U;  2LBO A;  4I2B A;  2H5X A;  4NXZ A;  4UBB A;  4RNM A;  3NS1 A;  4UAZ A;  2LMR A;  4IQV A;  2BKE A;  3C1Y A;  4LZD A;  2ATL A;  4IL6 U;  1BPE A;  4QZA A;  2HHS A;  1MQ3 A;  3RR7 A;  2ZIU A;  1SV0 C;  5J0W A;  3LVW A;  3DV9 A;  1Q3U A;  4WJ3 B;  1PVQ A;  4DSK A;  3T5H A;  4ELU A;  3M6Z A;  2JHD A;  3TAQ A;  9ICF A;  1RM6 C;  2B6G A;  3BQ0 A;  2WF9 A;  5ALD A;  4DQP A;  2ZIX A;  1K1Q A;  4DEZ A;  1DXS A;  3PSP A;  3ETL A;  1KDH A;  1IIP A;  8ICU A;  2LKY A;  3QYP A;  4Z6F A;  5BOM A;  1S76 D;  7ICI A;  2BPC A;  5F3X B;  4Y2P A;  5DBB A;  3M8R A;  4QZH A;  2BGW A;  1JXL A;  2FMQ A;  1O08 A;  4CCH A;  5AM4 A;  2P66 A;  4G9B A;  1V38 A;  4RQ1 A;  4XRH A;  4EZ6 A;  1NNL A;  4G3I A;  1ZQP A;  8ICJ A;  2FPK A;  5KFU A;  3BQ2 A;  1Z1B A;  3PY8 A;  4B9U A;  2KK0 A;  4YN4 A;  2JEJ A;  4I29 A;  3GIJ A;  3MGH A;  3TI0 A;  2R8K A;  2V9W A;  4YR0 A;  4XUS A;  5T14 A;  2W9C B;  4KLU A;  3PW7 A;  4IRD A;  1J2N A;  5C0Y A;  3QU7 A;  4Q45 A;  1X42 A;  4US8 A;  5HP4 A;  2F2A B;  3F53 A;  2WF6 A;  1RPL A;  3LYS A;  7ICR A;  2E8O A;  4FZN A;  3OSN A;  3Q8R B;  2HBK A;  4DS4 A;  4M9H A;  2I5H A;  5E79 U;  4ECY A;  2GLE A;  4YD1 A;  1L3V A;  4C8N A;  4QZF A;  3H8M A;  4KLH A;  4RT3 A;  4A8E A;  5KFN A;  4M6W B;  1TAU A;  1Z00 A;  2LHT A;  4M9L A;  2YN4 A;  2G07 A;  2P6U A;  2VJ4 A;  3OJS A;  4Y2V A;  2UVU A;  1F5S A;  1NKC A;  2JR5 A;  5ALW A;  3GFK B;  1IG6 A;  5DG9 A;  4YD2 A;  9ICO A;  1QQ5 A;  1KKX A;  1OW5 A;  3ZDC A;  2K8C B;  2KIC A;  5KG1 A;  4J9R A;  4P2H A;  1H38 A;  4DFM A;  1IXR A;  3M7D A;  3H40 A;  3GIK A;  2ZTC A;  4O3N A;  4QW8 A;  1XO1 A;  3ZD9 A;  4CE6 A;  1XC9 A;  3Q8Q B;  4KLO A;  1F44 A;  3R9K A;  4QWB A;  2I9G A;  5AKY A;  1B0X A;  2ESE A;  3GIM A;  1SV0 A;  2W8K A;  1COK A;  4F2R A;  1V9P A;  4OD0 A;  4UB2 A;  2ALZ A;  5CP2 A;  5AKE A;  4OO1 J;  1XSN A;  7ICO A;  2F77 X;  7ICU A;  2F1J A;  4I2A A;  4KTQ A;  1JRP A;  2QAR B;  2H3Z A;  5GTH U;  1KN5 A;  1U48 A;  1S0M A;  3NRW A;  1X6I A;  4P4P A;  4UQG A;  4MFC A;  2DKZ A;  1KLN A;  2Y1I A;  4B9L A;  5CA7 A;  1NZB A;  5KFP A;  3QU4 A;  2HMX A;  4B9N A;  4U7C A;  2YB4 A;  7ICE A;  4IC9 A;  3JPQ A;  5KG2 A;  4YXJ A;  3UQ2 A;  4Y2Y A;  2K4E A;  1U47 A;  8ICN A;  5DQG A;  3WK4 A;  3N97 B;  4BGD A;  4MF8 A;  1RXV A;  1QSS A;  2RLT A;  1S0O A;  1C7Y A;  4HYK A;  3KHR A;  5C5J A;  5D49 A;  3ED5 A;  4YVZ A;  2FLL A;  1SZH A;  3TAN A;  2NV3 A;  4KLD A;  1TFR A;  2DL0 A;  1ZQB A;  3K75 D;  4QZ9 A;  2AGP A;  2V4R A;  1V97 A;  5AKG A;  2HW3 A;  2NRT A;  3TAD C;  4OJ6 A;  3PX0 A;  2VIX A;  8ICB A;  2HOQ A;  3SAF A;  3RRG A;  4FS2 A;  5EE1 A;  4IRC A;  1KW4 A;  4LJX A;  9ICG A;  3NVW A;  5ALI A;  4YG2 A;  1ZQL A;  2XGQ A;  4EBD A;  2E5S A;  5III A;  4F5R A;  8ICS A;  2EAM A;  5KT5 A;  1K1S A;  4C80 A;  1LKY B;  5ALJ A;  2BQU A;  2VA2 A;  3NVZ A;  1WWV A;  1ZQK A;  1YT3 A;  4JWM A;  3SYZ A;  3G6V A;  2OEH A;  2CN1 A;  4PPX A;  4BUG A;  4F4K A;  2LPE A;  1QLN A;  2KP7 A;  2J6S A;  1MC8 A;  5IIK A;  2WAQ F;  2PKE A;  1SIJ A;  2LM1 A;  5ALR A;  4C4R A;  8ICE A;  4GC6 A;  4QZ8 A;  1HIW A;  4ECQ A;  8ICR A;  2PMZ C;  1SB3 C;  3KFU F;  1NK4 A;  4BDP A;  4FBT A;  2JMG A;  1FIQ A;  4M2Y A;  2FI1 A;  3MFH A;  2WF8 A;  5ALN A;  2MU2 A;  5DB8 A;  4UAR A;  4J9M A;  3TFS A;  2R8J A;  2QB1 A;  1ECW A;  5J0P A;  4EX6 A;  2J6U A;  3B9J A;  4QZE A;  4P4O A;  2Y1J A;  4QZD A;  1KFT A;  5DG8 A;  1C20 A;  3TKA A;  4Z6C A;  3T79 A;  3SD7 A;  5KT3 A;  3GV7 B;  2R8H A;  3AMZ A;  4C8M A;  3N7S C;  2XID A;  2ZIV A;  4RT2 A;  4KLQ A;  2Y9T A;  4DOA A;  3H0M B;  3HRD D;  2BQR A;  1NK8 A;  3EYZ A;  5KFS A;  2EDU A;  2K89 A;  5ALY A;  1ZXI A;  1KL9 A;  3D2S A;  4QWE A;  5ALX A;  5DBA A;  2KFN A;  4M0A A;  4PHP A;  5J2D A;  4DFJ A;  1ZQU A;  4AYB C;  5J0Y A;  1HEK A;  2PXI A;  4O5E A;  2FPL A;  3D2N A;  4GXI A;  2W54 A;  2IHN A;  2WB1 C;  3V6J A;  4RQ7 A;  5J2G A;  2HHQ A;  1SGG A;  4CF5 A;  1GO3 F;  2KJ8 A;  2YQE A;  3PW2 A;  5HR6 A;  1EXN A;  3FM9 A;  5AI4 A;  1YZ7 A;  3TAD A;  3RBE A;  8ICV A;  1ZQO A;  1MA7 A;  2UVR A;  1BNO A;  3ZDE A;  4BWM A;  3ALR A;  2DWQ A;  5KAF U;  3NVV A;  4PGX A;  1UPH A;  3HIL A;  2DBY A;  5J0R A;  2XO7 A;  4ECU A;  1ZD3 A;  3DEE A;  4DFP A;  4YFK A;  2E8P A;  3WKD A;  5ALK A;  3SR6 A;  4RPZ A;  5L1L A;  1PVR A;  2JEF A;  1JUD A;  5IIO A;  2WTF A;  4RQ0 A;  5D46 A;  3H7I A;  2HHX A;  5F9N A;  3C5G A;  4KLS A;  3PX4 A;  5G5G A;  2ISO A;  1ZRN A;  4Z6E A;  4YR3 A;  4MF2 A;  3MR6 A;  1DK3 A;  3RB3 A;  2ZUC A;  5KFF A;  4F4W A;  5DDM A;  4DL6 A;  2OXO A;  2MSN A;  5AM1 A;  3K1Z A;  3RJF A;  1N62 A;  1NKB A;  3ETR A;  4O3P A;  4IR1 A;  9ICE A;  4Y2U A;  1XWL A;  2G06 A;  2LM4 A;  3BQ1 A;  4NL9 A;  3Q8P B;  3T5K A;  4TUP A;  2KG5 A;  4P4M A;  1DOQ A;  2W9C A;  5G5H A;  3F2C A;  5CHG A;  3M8S A;  2KN7 A;  8ICM A;  5KFB A;  2VA8 A;  3GIL A;  3CNH A;  2BHN A;  4MHV A;  9ICS A;  4PHE A;  5KTQ A;  5EWG A;  1XS9 D;  4J9N A;  1J2M A;  1TK5 A;  3EUB 2;  2EH9 A;  1RG6 A;  5KG0 A;  3RF9 A;  1WG8 A;  9ICP A;  2KVS A;  4EEK A;  4M6W A;  4USA A;  1T94 A;  4J9Q A;  4KLE A;  8ICP A;  3AQE A;  3MBY A;  3PVX A;  5HML A;  3IG8 A;  3ZDD A;  4FE3 A;  4JV1 A;  1KFD A;  1T3Q A;  3HKZ F;  3PO5 A;  1T8E A;  3NRZ A;  2HCF A;  2GWS A;  1TV9 A;  3F2B A;  1ZQJ A;  2G0A A;  4HAI A;  2HHU A;  4J9S A;  2K8A A;  4EBC A;  3RJJ A;  2C28 A;  4O3R A;  3QUT A;  4C7Z A;  3K1R B;  4ZOH C;  4R8U B;  5AKH A;  1RXW A;  4IQT A;  1OUQ A;  3O0F A;  2QB0 B;  8ICZ A;  5J2H A;  1ZJM A;  1V85 A;  4TQR A;  5KG5 A;  4C4S A;  3KKA C;  4GIB A;  3NGD A;  4ED0 A;  2HOF A;  1TAQ A;  2M0N A;  4M9G A;  3NTU A;  1MSW D;  4KN4 A;  3RTV A;  3RJH A;  1UA0 A;  5KFT A;  4DOC A;  3M1Y A;  4F5P A;  3KTQ A;  2QAR A;  3Q8S B;  4OJ5 A;  1U9L A;  4Q8E A;  5AI5 A;  2R8G A;  4ECZ A;  2FPM A;  2AH5 A;  3SEI A;  1NJX A;  4DO9 A;  4OJL A;  2ZUB A;  5DLG A;  1TKD A;  4KLL A;  3HT3 A;  2ZG6 A;  3KHL A;  2XY6 A;  1S97 A;  2OH2 A;  2CPR A;  3OPX A;  3SZ2 A;  2KHQ A;  3H8J A;  5KG7 A;  4GLX A;  4UB4 A;  1N5W A;  2KZ3 A;  4EZ9 A;  2BCQ A;  3B0Y A;  4O3M A;  1SV4 A;  3JPP A;  4PL1 A;  1Q3V A;  5AI9 A;  1S0N A;  4PH5 A;  7ICT A;  4QWC A;  5CB1 A;  4I27 A;  3AU2 A;  1S9F A;  4FS1 A;  5ALO A;  5F9L A;  2LYB A;  4K4I A;  3J81 j;  1NK0 A;  1ZJN A;  5DG7 A;  2YB1 A;  4YQW A;  1MN8 A;  1BPD A;  1SWW A;  4QWD A;  2W7O A;  5KFI A;  2KIW A;  2ZTD A;  4UAY A;  2MA1 A;  4DQS A;  1FO4 A;  1L8O A;  3E0F A;  2KZZ A;  4FZL A;  3DDH A;  1Z3E B;  1ZQQ A;  4NLB A;  5CWR A;  2ES6 A;  2PFN A;  2IOF K;  5ALS A;  2DGZ A;  1LKY A;  4I2F A;  2HDO A;  1OXJ A;  5DB9 A;  3H4D A;  4DSE A;  4YMO A;  3SV3 A;  1LVH A;  2AHO B;  4ECW A;  3BS5 B;  2DPI A;  3ORY A;  5AI0 A;  3KHG A;  2BCU A;  2XI9 A;  5EE3 A;  3N28 A;  3PO4 A;  2K4I A;  2KJ5 A;  5CR0 A;  2KJ9 A;  4JUZ A;  5AM3 A;  2B21 A;  1X9X A;  3QU5 A;  1A6S A;  4EBE A;  2ODG A;  3IDW A;  1ZD5 A;  4JB3 A;  3OHB A;  2YMM A;  4DSF A;  3MAB A;  1FFV A;  1T3N A;  2ZUD A;  3RB4 A;  2W55 A;  3SEN A;  2WHE A;  1Q46 A;  4YMN A;  5KT2 A;  3WKC A;  3IHQ B;  1RZT A;  1L3U A;  2CRX A;  2L5Y A;  2KOB A;  2KV2 A;  4C8K A;  2HHW A;  3KKA A;  9ICV A;  2KTQ A;  1ZQD A;  3PSF A;  4YR2 A;  2NO5 A;  4ED1 A;  2OCE A;  1SKW A;  4I2C A;  2KVC A;  8ICT A;  4J9P A;  3RH6 A;  4DOB A;  5AKX A;  3Q8M A;  4QZG A;  3MGI A;  3LWL A;  8ICI A;  1TE2 A;  4ACO A;  3EPG A;  2ASL A;  4DSL A;  2W9A A;  3HPO A;  2XCA A;  2AQ0 A;  3CRX A;  1XO0 A;  3C2K A;  5DQI A;  4YCX A;  3JPN A;  2VA3 A;  4EX7 A;  1VJ5 A;  3C23 A;  2IBK A;  3GQC A;  3RBD A;  2ZIW B;  1TVA A;  1ZQS A;  3C28 A;  2O6K A;  2XGP A;  9ICM A;  3GV5 B;  3H8W A;  2IOH A;  4F91 B;  5ALL A;  7ICL A;  1SL0 A;  3S6J A;  1L7P A;  5ALV A;  3M9N B;  2JV3 A;  1NI3 A;  4F50 A;  4EEL A;  1LB2 B;  2A3V A;  2F8K A;  4ICA A;  5AIA A;  4KLJ A;  2LYA A;  4KX3 A;  2JGA A;  2OHF A;  2K8B B;  2HVI A;  3C5F A;  3BZK A;  2Z7J A;  4FFD A;  5AK3 A;  2F76 X;  1ZYQ A;  5J2K A;  3V7K A;  1CI4 A;  3IP4 B;  5KG4 A;  5ALH A;  1RYR A;  1ZQV A;  2JH1 A;  1HJP A;  1N48 A;  3HP6 A;  3ISD A;  3T3F A;  2YX8 A;  2JZB B;  5KFJ A;  4RUA A;  4Z6D A;  5L1K A;  3C29 A;  2RDI A;  5KG3 A;  5AI6 A;  3D2Q A;  1ED1 A;  4JWN A;  2DFL A;  1SL1 A;  4TUR A;  3RH4 A;  3AUO A;  2ZJ8 A;  4F8R A;  1L7N A;  4RQ8 A;  1JAL A;  4I2J A;  3QEA Z;  2PFO A;  8ICL A;  3QUC A;  3OSP A;  5ALP A;  2XVT A;  3MR3 A;  3LDA A;  2W8L A;  2YMQ A;  4FO6 A;  4O3Q A;  5AM2 A;  4KLG A;  1ZET A;  2KFZ A;  2GH1 A;  5JU5 A;  1BPZ A;  2KZM A;  5JUM A;  1X66 A;  2E1F A;  3QUB A;  3L5K A;  3ZI4 A;  2E3T A;  3V7L A;  4E0D A;  4K4H A;  1ZQH A;  3OGU A;  3VCB A;  7ICJ A;  2G5I B;  5KT6 A;  1CEZ A;  1AQ6 A;  3SI8 A;  5KFH A;  2Y0S F;  5KL1 B;  2ZXI A;  3TAC B;  3IG5 A;  5IIM A;  2PI4 A;  2BPG A;  5J8Y C;  2W04 A;  4RQ4 A;  3D6J A;  2J6T A;  1HUZ A;  3QNM A;  4NM2 A;  5L1M A;  4YMM A;  5DB6 A;  4ED6 A;  5J0S A;  3C1Z A;  1LV5 A;  3E2E A;  4O3O A;  1HUO A;  4UB3 A;  1N61 A;  2KKV A;  3C21 A;  2QKQ A;  5KL8 B;  2W7P A;  1D9D A;  7ICH A;  9ICX A;  4NL9 C;  3WK7 A;  2EAO A;  5J2I A;  5B66 U;  3B0X A;  2W11 A;  2WAQ C;  2ASD A;  4MEX A;  2HSZ A;  2AU0 A;  3RJE A;  5HHH A;  1N60 A;  2H3Q A;  3EW9 A;  4UAV A;  4R8U A;  1ZQF A;  2R8I A;  1JIH A;  2F8L A;  2JRZ A;  3UXN A;  2V4Q A;  3JPO A;  4ECX A;  2QB0 A;  4F72 A;  1SKR A;  4QIW C;  2FE9 A;  1B22 A;  4BX9 C;  1D9F A;  9ICW A;  4PGQ A;  3V72 A;  4M47 A;  1CRX A;  2EAN A;  4Y2R A;  2E1E A;  1X9M A;  4DF8 A;  1TAM A;  3M6K A;  3CP8 A;  1JN3 A;  1ZQY A;  2W3S A;  4GXK A;  4QZC A;  1RYS A;  5L9X A;  1B4F A;  5KFZ A;  2F1I A;  2QLT A;  5AIC A;  3PST A;  3SMV A;  2LYH A;  4BJQ A;  3AM9 A;  7ICM A;  4MEY A;  9ICB A;  4IR9 A;  2YML A;  4RZR A;  2C2R A;  2BCR A;  1NOM A;  3KBB A;  2F1H A;  2E8M A;  5BOL A;  4DL4 A;  1T4G A;  3BDP A;  2YMP A;  2I1Q A;  4M04 A;  4J03 A;  2WB1 F;  4QZB A;  3KZX A;  4NWI A;  4ECT A;  5CJ7 A;  2UVV A;  5AHX A;  5DQH A;  4Y2S A;  3N4M B;  1RYU A;  4O0I A;  1ZQE A;  4ED2 A;  8ICC A;  3JPS A;  2GOL A;  4P0Q B;  2W03 A;  5ALE A;  4GFJ A;  5K4L A;  5HHI A;  1KRP A;  4DQR A;  1Z19 A;  5J0O A; 
#chains in the Genus database with same CATH homology
 3IDW A;  2Y9T A;  1WWU A;  2Y9U A;  1PK1 B;  5J8Y A;  2DKX A;  2DL0 A;  4NL9 A;  1SXD A;  3SEI A;  3SEN A;  3BS7 A;  1SV0 C;  2KG5 A;  3TAD C;  2L5Y A;  5KNI A;  2QB0 A;  3KKA A;  1KW4 A;  2FE9 A;  4PZN A;  3BS5 A;  2B6G A;  1OW5 A;  2EAP A;  4MHV A;  2EAN A;  1JI7 A;  1DXS A;  2EAM A;  1SV4 A;  1LKY B;  1SXE A;  1UCV A;  2D3D A;  1RG6 A;  2KIV A;  5F3X B;  4RQM A;  1WWV A;  1B4F A;  2D8C A;  2KSO B;  4RQN A;  1PK1 A;  5JU5 A;  1SGG A;  1X66 A;  1B0X A;  2ESE A;  1SV0 A;  2E8N A;  2LPE A;  1V38 A;  1COK A;  1UQV A;  4NJ8 A;  3TAD A;  2KSO A;  2E8M A;  2QAR B;  1X40 A;  3TAC B;  3HIL A;  1PK3 A;  2JV3 A;  2YTU A;  5J8Y C;  5JTI A;  2ES6 A;  2F8K A;  1F0M A;  2DKZ A;  2E8P A;  3K1R B;  2KE7 A;  1LKY A;  4PZO A;  2QB1 A;  1OXJ A;  2QB0 B;  3BQ7 A;  4IS7 A;  1V85 A;  5L1M A;  3KKA C;  3BS5 B;  2E8O A;  5JRT A;  2K60 A;  2F3N A;  1Z1V A;  2F44 A;  2GLE A;  2QKQ A;  2K4P A;  2LMR A;  4NL9 C;  3H8M A;  1X9X A;  2EAO A;  2QAR A;  2KMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...