2E8PA

Solution structure of the n-terminal sam-domain of e74-like factor 3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GSSGSSGQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELF3 protein
publication title Solution structure of the N-terminal SAM-domain of E74-like factor 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8pA01
2GLEA 3TADC 1V38A 4NJ8A 1PK1B 3TACB 2D8CA 3H8MA 5J8YC 2E8PA 2F3NA 2ES6A 1RG6A 2Y9TA 1WWUA 2QARB 1F0MA 1PK1A 3BS7A 2B6GA 3TADA 2YTUA 3K1RB 1PK3A 2E8NA 2KG5A 5KNIA 1SGGA 2QARA 5J8YA 2K4PA 1WWVA 1LKYA 4MHVA 5F3XB 1UQVA 1SXDA 2KE7A 2QKQA 5JU5A 1X40A 2FE9A 1SV0C 2KSOB 3KKAA 1X66A 1Z1VA 2LMRA 4PZNA 1LKYB 2F44A 3SEIA 1X9XA 3IDWA 5JTIA 3BQ7A 2Y9UA 3KKAC 4PZOA 2KSOA 2LPEA 1SXEA 3BS5B 2DL0A 2EAMA 5JRTA 2F8KA 1SV0A 1SV4A 1UCVA 3SENA 2EAPA 4RQMA 1B0XA 2QB0B 2D3DA 1DXSA 3BS5A 2L5YA 1V85A 4NL9C 2KMDA 5L1MA 2JV3A 1OW5A 2DKXA 4IS7A 1OXJA 2EAOA 2DKZA 1COKA 2QB0A 1JI7A 2QB1A 2E8MA 2K60A 2EANA 4RQNA 2E8OA 3HILA 4NL9A 1B4FA 2KIVA 2ESEA 1KW4A
chains in the Genus database with same CATH superfamily
5KG1A 2GLEA 4GXIA 1XSNA 4GC6A 3L5KA 2F8LA 3ZD9A 4US9A 2CPRA 4ED2A 4B9UA 1PK1A 2ASLA 2OM6A 5ALJA 1SB3C 1NKEA 1WWVA 5J0PA 4IQTA 4G3IA 5BOLA 2B0CA 4DQQA 4DL3A 4QWDA 4F4KA 2ZIVA 3E0FA 2Z7JA 4DFPA 3M9NB 2R8JA 3HRDD 3NASA 3ETLA 7ICQA 4DSFA 1NJYA 2P35A 8ICXA 1HUZA 2MRLA 3LVWA 5GTIU 3QUBA 1QSLA 3CW2C 3AQFA 1U4BA 2F8KA 1X9SA 5KFAA 8ICPA 4HYKA 4BXOB 4NLCA 5ALMA 2EAPA 5KFDA 3UXPA 4RQMA 2W9CB 1UT5A 3EUB2 1U48A 3OSNA 5ALYA 1BPBA 2WAQF 2WF7A 2KZMA 1PVPA 1Q8KA 5HNKA 2QLTA 1PVQA 2IA6A 2JGAA 4M9GA 2KHQA 2C2RA 4ECSA 2FDRA 2K8BB 4F50A 4RQ2A 4PGYA 5CB1A 4RT3A 4NXZA 1XO0A 4NLGA 2BZFA 2NV3A 3LDAA 3KFUF 1BPZA 5CA7A 5EWEA 4F5RA 5G5HA 2AGQA 2KEYA 1KFSA 1JXLA 7ICLA 2VANA 4C7ZA 2DQNB 2IHNA 2W8KA 2FPLA 4KN7A 3T3FA 4DQIA 1N63A 1N5WA 3PSPA 3VCBA 5J0QA 2MA1A 2AQ4A 2ES6A 4C4SA 5DGBA 4FO6A 2UVUA 1V9PA 5J0SA 3K1RB 3NRWA 4P0QB 2C28A 5KG3A 4A8EA 7ICFA 2LYAA 2NRXA 3PW2A 4EEYA 2WF8A 5CWRA 1DRGA 2KJ8A 3OJSA 3QU7A 2QKQA 4P4MA 5BPCA 3AUOA 8ICYA 1TK8A 2KSOB 1BGXT 1TKDA 1KL9A 1TVAA 3TAQA 1X9XA 4CF5A 2XCAA 4UATA 2OCEA 7ICKA 3JPPA 5A0LA 2HBKA 2HHWA 1UPHA 1ZQOA 5KT3A 5AKHA 1L3VA 2N1RA 3C2LA 2JXJA 5AI9A 2YMLA 2W8LA 4RQ5A 2E5SA 4K4IA 5AK3A 2XVTA 2Y0SC 1V85A 3QNMA 1ZYQA 3HKZC 1VJ5A 1S5LU 4RZRA 2DKXA 2HBMA 2HMXA 1SZPA 4YN4A 3TI0A 3B0YA 3SI8A 3HX0A 4IRCA 3AN1A 1XNSA 4QWAA 3FAHA 8ICVA 3RR7A 4C4RA 4KTQA 4CRXA 2H3QA 4Y2SA 2BCUA 4QZDA 3TARA 5DB8A 3GIJA 1NK0A 5DKWA 3MBYA 3Q8KA 3FYHA 4PPXA 5KG6A 1XSLA 3M6KA 4ECUA 3H8MA 1DGJA 3JPNA 4X5VA 4PHPA 3GQCA 2A1JB 4AP9A 2BQ3A 5CJ7A 2G5IB 5CHGA 4AYBF 4O0IA 1QQ5A 4GC7A 4ECZA 4Z6EA 4U7CA 4B9MA 1HIWA 2NRVA 2IOFA 2ZIUB 1S0MA 1KFDA 4MFAA 5DG8A 3F2DA 2AXTU 2QARA 2EQYA 2LM1A 3JPTA 4M9HA 1ZQSA 4MHVA 4PH5A 4ED3A 2J6TA 2C2EA 5DLGA 4UBBA 3GIIA 3IM1A 2Q0ZX 3SR6A 2FPMA 1KDHA 4O3OA 7ICGA 1CRXA 3H0RB 2W3SA 4J9OA 4F4WA 4J9MA 4MF2A 4GXKA 5KT2A 3ZDBA 4TQSA 3CYMA 2KICA 3M6ZA 1K1SA 2JEGA 2ZUBA 2LI6A 5J0TA 1ZJMA 4O3SA 2WB1C 4YR2A 4C80A 3NUQA 1UA0A 3KTQA 3KD3A 4DWIA 3KZIU 5HHHA 2AH5A 1BPEA 8ICIA 1L7PA 2K8CB 4PHAA 4PJ0U 1ZQAA 2W04A 3GILA 5J0XA 4E0DA 2F1JA 2ZXHA 4LZDA 5DB7A 1QSYA 8ICOA 2W3RA 1RYSA 3OTQA 5AICA 1X42A 1OUQA 1NK6A 2JEJA 2MAXA 5DQIA 1L6NA 2D8CA 1KEJA 2PMZF 4UB4A 2PI5A 5ALDA 3PW0A 3H7IA 3ORYA 4BGDA 5J2CA 1ZD3A 1F0MA 4KLSA 3UXNA 7ICUA 5J0YA 2KOBA 4R63A 3CP8A 4I2IA 5B66U 1Z3EB 3AQEA 3IP4B 1L3UA 4Y2TA 5KFJA 1NK8A 4CE6A 2HHSA 2YX8A 2H5XA 3RAQA 1T8EA 1Z1VA 4BDPA 4UB8U 1QTMA 5JTIA 4DL7A 3SMVA 1B43A 4FBTA 2BR0A 3I76A 7ICJA 2LPEA 2W03A 3PW7A 4B9LA 3B0XA 4IR1A 4EZ9A 1N5XA 5IIKA 4YQWA 4Z6DA 5KFKA 5D46A 3K4GA 4OJOA 2V4RA 5ALFA 4EBDA 5J2HA 4PHDA 2H3ZA 4IRKA 5D49A 4QZGA 5H2FU 1L3SA 3BQ1A 2W9BB 2QB0A 3SYZA 4F5NA 4J9QA 4ECWA 3PO5A 3D2SA 4Y2PA 2ZTEA 2E8MA 4KN4A 5KFOA 8ICRA 4R65A 5KFQA 3HWTA 4I2EA 2KN7A 3FC4A 5L1LA 1N61A 3AL0B 4Y2XA 4ELUA 5HMMA 1N60A 4IR9A 4DQPA 1N48A 3U26A 5ALTA 4PGXA 3MFHA 4QIWC 5AI0A 2Q4TA 2Y0SF 2PI4A 3HKZF 8ICAA 3ISBA 3H8JA 5J8YC 4QWCA 4O5KA 3RBDA 4LZGA 1B22A 4RNMA 2BCSA 2ZIWB 5KFYA 3BZCA 3C2KA 1ZETA 3OHAA 4IQUA 7ICHA 3MR5A 3MGIA 1L8LA 3ISCA 4OJPA 2CRXA 4KITB 4I2DA 4UQGA 1RPLA 2YQEA 5F3XB 1D9DA 3RRGA 3N97B 5KG5A 4P2HA 2ATLA 5HR6A 2HHQA 1RM6C 1KFTA 3HPOA 4QWEA 4QNLA 5KFGA 2FMQA 1YZ7A 2W54A 3V7LA 4ICAA 1ZQZA 2HCFA 3Q8PB 2YB4A 2GO7A 3UPQA 4CF3A 5J2GA 2ZIXA 4QZBA 4RUAA 4XA5A 3BS5B 4OD0A 1SL0A 8ICKA 1U47A 4JV1A 1ZQMA 5KFUA 4C0ZA 2R18A 2PFPA 2HOIA 2CN1A 2WF5A 5DDYA 5ALPA 8ICWA 1ZQNA 5KFFA 1Q3UA 2NO4A 2KMDA 4TUQA 1UA1A 1WCNA 2K4HA 8ICNA 4ELVA 2P6RA 4ECTA 4ED6A 4BJQA 2GWSA 4ECQA 1QCKA 4PL1A 3EPGA 4DOCA 9ICHA 8ICUA 5CEHA 3QEBZ 5C5JA 3GIMA 2XO7A 1XO1A 3KOOA 3SV4A 4DQSA 5KT4A 5KFVA 3IN5A 1SWWA 2RDIA 3V72A 3PR4A 4EZ6A 4UAUA 1KN5A 1NK7A 2WB1F 5KFIA 5KG7A 4TUPA 4B9VA 4KLIA 4MEXA 3JPSA 3RTVA 1AQ6A 5AM4A 4J9KA 5KG2A 3H40A 3MDAA 4O3NA 4QZHA 3BQTA 1PK3A 2E8NA 2BKEA 1FFUA 2HW3A 1RYRA 1GO3F 4USAA 3KHRA 4Y2YA 3IHQB 3L4PA 2KE7A 3NVYA 5T14A 3PV8A 4ED8A 2FJ6A 4CCHA 1RQNA 1K5OA 3MC1A 2KKPA 4DS4A 5KFCA 4K4HA 4QZAA 2DFLA 1Q3VA 4PZNA 4DL2A 5J2EA 2JZBA 4Y2RA 3RF9A 1EXNA 1D9FA 3QU5A 4CF4A 2PFNA 4M6WA 4Z6CA 5EWGA 3N4MB 3KHGA 4UARA 3T5HA 2BCRA 1U45A 3EWAA 4DFMA 2BGWA 3QE9Y 2KTQA 5AKXA 1HUOA 3ZI4A 2KZZA 2VKQA 1WYGA 1COKA 3TQ1A 3UQ2A 2VA8A 1KRPA 1Z1BA 1SL1A 3BJYA 2ZJ5A 5L1KA 4IC9A 7ICIA 2HHVA 1N62A 1T94A 1ZD5A 1MQ3A 4Y2QA 5ALXA 4Y2JA 5TISU 4DO9A 1ZQDA 1JXEA 4F2SA 4FE3A 2RRDA 3LK9A 4RQ8A 3RJGA 4XQ8A 2J6SA 2MSNA 3OGUA 4M47A 4DL6A 5ALZA 5KAFU 2NO5A 5ALKA 2Y1JA 5CP2A 1S0OA 4ECXA 3T5JA 4EX6A 2MUTB 2C22A 1RXVA 5KFLA 3IRUA 4NY8A 3RFAA 2I6XA 5F9LA 2V4QA 1J97A 1T7PA 9ICPA 2KG5A 4F4XA 5AKEA 3FDSA 4C8MA 2PFOA 3NVWA 1Z4OA 3LWLA 4O3MA 5J8YA 4DL4A 2K4PA 1DK2A 4Q43A 3Q8SB 1NZBA 3QU4A 1UQVA 3RH6A 1TAMA 4B9NA 4IQVA 4DEZA 4ZH4A 4QIWF 4I2BA 1LKYB 3SEIA 4UB2A 4FZNA 4RU9A 1ZQIA 1NK5A 5ALNA 3AU6A 3V6HA 1VLBA 4DL5A 1Y88A 2EZYA 2DF4B 4Q8EA 3Q8RB 2ASJA 3H0LB 4Y2VA 1PVRA 1ZQ1C 2DBYA 4GFJA 4LJXA 1S97A 2IOFK 2EZXA 3K75D 1S77D 5DQGA 4O3PA 4NLBA 1UT8A 1QQ6A 5CR0A 5IIMA 4G9BA 5AKJA 4NLKA 3UM9A 2K60A 2XCPA 2G07A 4DFJA 4RQNA 3PNCA 3RH5A 4PL2A 2GOLA 4F3OA 2K89A 5EE9A 2KZ3A 2NRZA 4OCZA 4YG2A 3RAXA 3GDXA 2I9GA 2ZTCA 4OJ5A 2NRWA 8ICCA 3BQ2A 1PK1B 4O5CA 1XC9A 7ICPA 5AI8A 4RQ1A 3UQ0A 5ALIA 3PSTA 1TK0A 1PUZA 1WWUA 4F5QA 1RZTA 4YCXA 3BS7A 3SAGA 4NLZA 5AIBA 3OSPA 1V97A 2K4IA 3MGVA 2ZIVB 9ICOA 5FP0A 1T3QA 4YVZA 4M9LA 1C20A 4NM1A 4RPXA 1KBUA 2PXIA 4UAWA 3TANA 2BQRA 1XU4A 1QQ7A 2EDUA 2LM4A 3T5LA 1FO4A 4ECVA 4GLXA 2FMSA 3RJFA 2YY6A 5KG0A 1TK5A 1JROA 7ICVA 4F8RA 2KFZA 4UAZA 2LYHA 4PZOA 2E3TA 5AM1A 1ZQBA 4JB3A 4F92B 2EAMA 2AGOA 1U49A 4MEYA 2G06A 2ZTDA 1SKWA 9ICKA 3ZD8A 2RHFA 1N56A 1DXSA 2HOQA 2E1FA 4KLMA 4DF8A 4RPYA 1HEKA 1IG6A 2A1AA 2BPCA 4NM2A 2BPFA 5J2IA 5AKGA 8ICQA 2FLNA 4RQ4A 3WKAA 4KLDA 1NNLA 1TAUA 2ZUCA 3F2CA 1MA7A 1IM4A 5J2KA 4DS5A 2H3VA 2M9NA 2VJ4A 2PKEA 5IIJA 4QW9A 2JEFA 9ICLA 5GTHU 3ZDDA 3PSFA 1S8OA 1KKXA 3C21A 4WJ3B 4YMNA 1L7NA 5HP4A 4O5EA 2WF6A 1X6IA 2H3IA 4I2CA 4EBEA 2KV2A 5D4BA 4UAVA 4RQ6A 3KZXA 5J2JA 3RRHA 3EYZA 1ZQKA 5KNIA 2F77X 1L5UA 2LHTA 3D2NA 1SKSA 1XWLA 1SXDA 1KQQA 4R8UA 4OJ6A 4C8NA 3G6VA 9ICFA 1L7MA 2MU2A 2HVHA 1X40A 3ONNA 1SV0C 4Q8FA 3OJUA 1NJZA 4C8KA 1T4GA 3RJKA 2XICA 4J03A 2ZJ8A 4QZEA 5DB6A 4YFKA 3KBBA 4QW8A 3GZFA 7ICTA 3SD7A 3WK9A 3RB3A 3R9KA 2BCQA 2YMPA 3ALRA 8ICMA 2BPGA 3ZDCA 1ZQVA 4YMOA 4BUGA 5KFNA 1PZNA 2DKZA 5JUMA 3D6JA 3HW8A 9ICGA 1WUDA 3RJJA 2EANA 2M0NA 2HHTA 4EX7A 5AKLA 3I28A 5AI6A 5J2BA 2OH2A 2F1IA 2KIVA 4P0PA 5KTQA 4DSLA 9ICSA 4DQRA 5BOMA 4ED7A 8ICEA 4NJ8A 2PFQA 1L7OA 4C8OA 1XS9D 1Z00A 8ICSA 1NZPA 3E58A 3PX0A 4BWMA 4DOAA 2QARB 4UBCA 2HHXA 3UXOA 2RDJA 3J81j 2HHUA 2XC9A 3AEVA 4J9SA 2KKVA 3QX7A 3EW9A 4JUZA 4UB1A 1KSPA 2A3VA 1FFVA 4F71A 5KAIU 3LWMA 3AM9A 3PZPA 4KLOA 4F4YA 2FE9A 4KLLA 1NI3A 1X66A 2F44A 3M7DA 4DFKA 3T5KA 3BQ7A 9ICXA 3EPIA 2Y9UA 4YD2A 3JPQA 5J0OA 1ZQEA 3HJEA 4DFDA 1RYUA 3RBEA 3HT3A 3H4DA 8ICLA 1FIQA 4F5PA 3PMLA 3GFKB 4B6JA 1X2IA 3WU2U 3N7PD 5F9NA 4NL9C 4XRHA 4UW9A 2XI9A 3ISDA 4BXOA 1YT3A 4GXJA 1ZQRA 5L1IA 4EEKA 5KFMA 2W9CA 2WTFA 3M9OB 3PX6A 9ICMA 2W7PA 5AI5A 5DLFA 2AQ0A 3V6JA 2WF9A 1ZQQA 7ICEA 3TAPA 3BDPA 2IOHA 1J2NA 4YD1A 5J0WA 1BPXA 3RR8A 1ZD2P 8ICJA 1A0PA 1MQ2A 2LKYA 2G08A 2KNJA 2F2AB 2E8PA 1O08A 5ALWA 5AIAA 2AJQA 1TV9A 4YR0A 4JWMA 2YTUA 2C2DA 5IILA 1IXRA 4TURA 9ICAA 5DBAA 3IG5A 3GIKA 4I2AA 3ETRA 2NYVA 4KX3A 3PX4A 1LKYA 2HBJA 5KFXA 4O9MA 2DWQA 3H4BA 4RUCA 9ICQA 3KHLA 4UB3A 1ZRNA 2JR5A 3PY8A 1ZQPA 4P0QA 5KFZA 4JV0A 4FBUA 4YMMA 2YMQA 5KFWA 2HDOA 1LV5A 2ZUDA 3SQIA 3ED5A 1BPYA 3RJIA 3PR5B 3TFRA 1X6JA 3QU9A 5L9XA 2FMPA 5J2DA 4Q45A 4RQ3A 4ED0A 2W9AA 4OJLA 2KSOA 2AGPA 3OPXA 1ZJNA 4M04A 1JIHA 5DQHA 3C5GA 2GH1A 1SV0A 2R8GA 5AK5A 4P4OA 1QSSA 2G5HB 3ZDEA 1TAQA 5K4LA 4DLGA 2QB0B 5ALGA 4KLJA 4C4TA 3MR6A 1NK9A 3TFSA 1RQLA 4BWJA 5ALQA 4RQ7A 1U9LA 4R66A 3WK8A 2G09A 3F5EA 2A19A 1D8LA 3GU3A 3H8WA 5C0YA 8ICHA 9ICIA 1JI7A 3M1YA 2XY5A 2OWOA 1JALA 4DF4A 2W7OA 5DBCA 3SAHA 4RQ0A 1JN3A 3MFIA 4RNOA 2W43A 4O3QA 4ECYA 1S10A 4KLQA 2XGQA 1S76D 4I2FA 1V38A 3C1YA 5HMLA 3TKAA 4BX9C 4KMUA 2ZXIA 3CRXA 1JUDA 2BCVA 2YN4A 2VA3A 2F1HA 1NJXA 3Q8QB 3F2BA 2VIXA 3G6XA 2B6GA 2K8AA 2OEHA 5L1JA 1ZQCA 4M9NA 4UB6U 2A1JA 1XSPA 2ZG6A 5AM0A 2BDPA 2W9MA 3WK5A 1NKBA 4NLNA 4RNNA 3UMCA 2W11A 2ZIUA 3PMNA 3QUCA 8ICBA 5ALSA 5AKIA 4J9NA 3PW4A 3ZDAA 2ZIXB 3KKAA 3MABA 4MFFA 4QZ9A 4M0AA 1ZQGA 3IDWA 4HAIA 4MFCA 1HJPA 1ZQHA 1QLNA 1WG8A 2PMZC 3N28A 3C23A 3WKBA 1DK3A 5HHIA 4F91B 2CXYA 9ICJA 1UCVA 2KIWA 4DCCA 3MDCA 5AI4A 3A0HU 3BQ0A 2OXOA 2OHFA 3B9JA 5ALHA 2YB1A 2JH1A 5IIIA 5AHXA 3RJEA 3RJHA 1FEZA 3QXGA 3QYPA 3NGDA 2E8OA 3HILA 4NL9A 4PGQA 4RT2A 1X9WA 1O03A 3LVVA 3F53A 4FS1A 1JMSA 3SV3A 4J9LA 1IV8A 2IMWP 5ALEA 1S9FA 4FFDA 1KW4A 1N2XA 3QZ7A 2BHNA 4M9JA 9ICBA 2ASDA 2Y9TA 1NOMA 3AU2A 2OYYA 3RB4A 3N7SC 5ALRA 4F5OA 5EWFA 4KLEA 5ALVA 2KK0A 1JRPA 2B21A 1M6YA 4XUSA 3PO4A 2FLLA 2VA2A 2JZBB 3T79A 2XY6A 7ICOA 1IIPA 3BZKA 3PW5A 4M6WB 4DSKA 2KD1A 3NRZA 5DGAA 1VDVA 1K1QA 2KHVA 4J9PA 1X9MA 1SL2A 4NWIA 4US8A 1CI4A 3C28A 2KJ5A 3DEEA 3SAFA 2FPKA 2DL0A 4QZCA 2RP5A 1SV4A 4EELA 2HOFA 4P4PA 4YP3A 3UMGA 8ICTA 1T3NA 3C1ZA 4UB5A 9ICCA 2D3DA 2HI0A 3C5FA 1LVHA 5J2AA 1LB2B 2JV3A 7ICRA 1NJWA 4O3RA 1OXJA 2P66A 4J9RA 2ISOA 2V9WA 1S0NA 3H0MB 1ZQJA 2JMGA 4F72A 2DPIA 1CUKA 2JEIA 1Z19A 2EZZA 4I29A 2W9BA 5G5GA 2J6UA 1ZQFA 2WFAA 2JRZA 1ZD4A 3H8SA 9ICWA 2NRTA 2RQ5A 1SKRA 4LVSA 3C2MA 2ESEA 3VC8A 2KP7A 9ICRA 3DDHA 2XY7A 3L3FX 4C7YA 1ZQLA 3TADC 3LYSA 3V6KA 2EH9A 5KFPA 4ECRA 3D2QA 1D8YA 1BVSA 2DUYA 4DOBA 3WK4A 4KX5A 4Z6FA 3JPOA 5KFEA 5AKZA 3WKDA 5AKYA 2K4EA 3RH4A 5KFHA 2BQUA 2DPJA 5KT5A 1CEZA 4EENA 1SGGA 5KFBA 2RLTA 2ZIWA 4ACOA 4CNQA 5AKKA 2JH7A 5AK6A 4DLEA 1SWVA 4IL6U 4CDGA 4JK1A 5KFSA 4F4ZA 3C29A 4I2JA 5KL1B 1URJA 4K4GA 4C8LA 5KFRA 1C7YA 4PHEA 3MGHA 4JMUA 2KVCA 1ECWA 5AM3A 2KJ9A 2G0AA 2XIDA 2IBKA 5HR7A 5EE0A 1SZHA 1BNOA 3WK6A 3QUQA 3GV7B 1COOA 1ZOLA 3MR3A 3BS5A 3WKEA 3M8RA 4TQRA 4KLGA 1A77A 1F5SA 5L1MA 8ICGA 4IS7A 1NK4A 1J2MA 3WKCA 2FLPA 1A6SA 1P7DA 2D6FC 3CNHA 1UHUA 2P6UA 8ICZA 1JX4A 3ICXA 2H3FA 4FS2A 3QZ8A 1ZQYA 3RB6A 3QUTA 3E2EA 1ZQWA 3QEAZ 2BDUA 1DOQA 3V7JA 3THVA 3EZ5A 3TACB 2R8HA 5ALLA 2YMMA 3I1YA 5IINA 2F3NA 3N7RC 1RG6A 1F44A 3F5AA 3NVVA 2DGZA 1L8OA 4KLTA 4U6PA 3JPRA 1BPDA 1BNPA 4EBCA 3MR2A 2ODGA 2ALZA 1Z4NA 5AM2A 4ED1A 4I28A 2ISPA 3UMBA 5J2FA 4MF8A 2WAQC 9ICUA 3M8SA 1ZQUA 9ICVA 5DG7A 5EE3A 5JU5A 5DB9A 3GV8B 2ZJAA 4KLFA 4B9TA 3KKAC 4YR3A 9ICEA 1MSWD 5AM5A 4EYHB 1SXEA 7ICMA 4DSIA 5AK4A 5B5EU 5JRTA 4ELTA 3SZ2A 3S6JA 4I2HA 3SENA 4JWNA 1B0XA 2L5YA 3M9MB 4R64A 4QZIA 2LBOA 5J0RA 4ZOHC 2IHMA 2UVRA 5KT7A 3NTUA 4IQWA 1Q46A 2KFNA 3DV9A 4IRDA 2JHDA 1ZXIA 3NVZA 2QB1A 4KLHA 5DBBA 3IG8A 3OHBA 5KFTA 4JV2A 4KMOB 8ICFA 3WK7A 3PVXA 3QU2A 5IIOA 3AMZA 1NKCA 4Q44A 1RDFA 3KHHA 4FZLA 2R8IA 2HSZA 3K1ZA 4OO1J 2AHOB 9ICNA 1YZ6A 4YXMA 1MN8A 5KL8B 4QZ8A 4M2YA 5EOZA 4NV0A 4YXJA 2KVSA 1QH9A 5ALUA 4F2RA 3TADA 1ED1A 4FZMA 4R8UB 5DG9A 5KG4A 4B9SA 4QZFA 2MUTA 5E79U 1AROP 1TFRA 4Y2UA 4F93B 3GV5B 1SIJA 4GIBA 1D8BA 1ZQTA 1ZQXA 2F76X 3A0BU 2HVIA 3HP6A 2LMRA 3FM9A 4EYIB 5J29A 2R8KA 3G6YA 2FI1A 1TE2A 3Q8MA 3RB0A 4QWBA 4CGZA 3IV6A 3PSIA 2Y1IA 1KTQA 2XGPA 4UAYA 2O6KA 3NS1A 1MC8A 2WHEA 1H38A 4RPZA 5CRXA 5J0UA 3O0FA 7ICNA 2E1EA 4KLUA 4UASA 1ZRMA 2UVWA 2LYBA 1OW5A 3Q8LA 5ALOA 5EE1A 1WCLA 4I27A 2EAOA 9ICTA 5DDMA 2I1QA 2UVVA 4AYBC 4QJFB 5KT6A 7ICSA 4P0PB 2HBLA 2AU0A 1DGSA 4DSEA 2W55A 4TUSA 2VJ5A 3V7KA 1L3TA 5TZVA 1S0VA 1RXWA 2I5HA 1KLNA 1B4FA 1A76A 1Z00B 4I2GA 4DSJA
chains in the Genus database with same CATH topology
2GLEA 3TADC 1V38A 4NJ8A 1PK1B 3TACB 2D8CA 3H8MA 5J8YC 2E8PA 2F3NA 2ES6A 1RG6A 2Y9TA 1WWUA 2QARB 1F0MA 1PK1A 3BS7A 2B6GA 3TADA 2YTUA 3K1RB 1PK3A 2E8NA 2KG5A 5KNIA 1SGGA 2QARA 5J8YA 2K4PA 1WWVA 1LKYA 4MHVA 5F3XB 1UQVA 1SXDA 2KE7A 2QKQA 5JU5A 1X40A 2FE9A 1SV0C 2KSOB 3KKAA 1X66A 1Z1VA 2LMRA 4PZNA 1LKYB 2F44A 3SEIA 1X9XA 3IDWA 5JTIA 3BQ7A 2Y9UA 3KKAC 4PZOA 2KSOA 2LPEA 1SXEA 3BS5B 2DL0A 2EAMA 5JRTA 2F8KA 1SV0A 1SV4A 1UCVA 3SENA 2EAPA 4RQMA 1B0XA 2QB0B 2D3DA 1DXSA 3BS5A 2L5YA 1V85A 4NL9C 2KMDA 5L1MA 2JV3A 1OW5A 2DKXA 4IS7A 1OXJA 2EAOA 2DKZA 1COKA 2QB0A 1JI7A 2QB1A 2E8MA 2K60A 2EANA 4RQNA 2E8OA 3HILA 4NL9A 1B4FA 2KIVA 2ESEA 1KW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLE A;  3TAD C;  1V38 A;  4NJ8 A;  1PK1 B;  3TAC B;  2D8C A;  3H8M A;  5J8Y C;  2E8P A;  2F3N A;  2ES6 A;  1RG6 A;  2Y9T A;  1WWU A;  2QAR B;  1F0M A;  1PK1 A;  3BS7 A;  2B6G A;  3TAD A;  2YTU A;  3K1R B;  1PK3 A;  2E8N A;  2KG5 A;  5KNI A;  1SGG A;  2QAR A;  5J8Y A;  2K4P A;  1WWV A;  1LKY A;  4MHV A;  5F3X B;  1UQV A;  1SXD A;  2KE7 A;  2QKQ A;  5JU5 A;  1X40 A;  2FE9 A;  1SV0 C;  2KSO B;  3KKA A;  1X66 A;  1Z1V A;  2LMR A;  4PZN A;  1LKY B;  2F44 A;  3SEI A;  1X9X A;  3IDW A;  5JTI A;  3BQ7 A;  2Y9U A;  3KKA C;  4PZO A;  2KSO A;  2LPE A;  1SXE A;  3BS5 B;  2DL0 A;  2EAM A;  5JRT A;  2F8K A;  1SV0 A;  1SV4 A;  1UCV A;  3SEN A;  2EAP A;  4RQM A;  1B0X A;  2QB0 B;  2D3D A;  1DXS A;  3BS5 A;  2L5Y A;  1V85 A;  4NL9 C;  2KMD A;  5L1M A;  2JV3 A;  1OW5 A;  2DKX A;  4IS7 A;  1OXJ A;  2EAO A;  2DKZ A;  1COK A;  2QB0 A;  1JI7 A;  2QB1 A;  2E8M A;  2K60 A;  2EAN A;  4RQN A;  2E8O A;  3HIL A;  4NL9 A;  1B4F A;  2KIV A;  2ESE A;  1KW4 A; 
#chains in the Genus database with same CATH topology
 5KG1 A;  2GLE A;  4GXI A;  1XSN A;  4GC6 A;  3L5K A;  2F8L A;  3ZD9 A;  4US9 A;  2CPR A;  4ED2 A;  4B9U A;  1PK1 A;  2ASL A;  2OM6 A;  5ALJ A;  1SB3 C;  1NKE A;  1WWV A;  5J0P A;  4IQT A;  4G3I A;  5BOL A;  2B0C A;  4DQQ A;  4DL3 A;  4QWD A;  4F4K A;  2ZIV A;  3E0F A;  2Z7J A;  4DFP A;  3M9N B;  2R8J A;  3HRD D;  3NAS A;  3ETL A;  7ICQ A;  4DSF A;  1NJY A;  2P35 A;  8ICX A;  1HUZ A;  2MRL A;  3LVW A;  5GTI U;  3QUB A;  1QSL A;  3CW2 C;  3AQF A;  1U4B A;  2F8K A;  1X9S A;  5KFA A;  8ICP A;  4HYK A;  4BXO B;  4NLC A;  5ALM A;  2EAP A;  5KFD A;  3UXP A;  4RQM A;  2W9C B;  1UT5 A;  3EUB 2;  1U48 A;  3OSN A;  5ALY A;  1BPB A;  2WAQ F;  2WF7 A;  2KZM A;  1PVP A;  1Q8K A;  5HNK A;  2QLT A;  1PVQ A;  2IA6 A;  2JGA A;  4M9G A;  2KHQ A;  2C2R A;  4ECS A;  2FDR A;  2K8B B;  4F50 A;  4RQ2 A;  4PGY A;  5CB1 A;  4RT3 A;  4NXZ A;  1XO0 A;  4NLG A;  2BZF A;  2NV3 A;  3LDA A;  3KFU F;  1BPZ A;  5CA7 A;  5EWE A;  4F5R A;  5G5H A;  2AGQ A;  2KEY A;  1KFS A;  1JXL A;  7ICL A;  2VAN A;  4C7Z A;  2DQN B;  2IHN A;  2W8K A;  2FPL A;  4KN7 A;  3T3F A;  4DQI A;  1N63 A;  1N5W A;  3PSP A;  3VCB A;  5J0Q A;  2MA1 A;  2AQ4 A;  2ES6 A;  4C4S A;  5DGB A;  4FO6 A;  2UVU A;  1V9P A;  5J0S A;  3K1R B;  3NRW A;  4P0Q B;  2C28 A;  5KG3 A;  4A8E A;  7ICF A;  2LYA A;  2NRX A;  3PW2 A;  4EEY A;  2WF8 A;  5CWR A;  1DRG A;  2KJ8 A;  3OJS A;  3QU7 A;  2QKQ A;  4P4M A;  5BPC A;  3AUO A;  8ICY A;  1TK8 A;  2KSO B;  1BGX T;  1TKD A;  1KL9 A;  1TVA A;  3TAQ A;  1X9X A;  4CF5 A;  2XCA A;  4UAT A;  2OCE A;  7ICK A;  3JPP A;  5A0L A;  2HBK A;  2HHW A;  1UPH A;  1ZQO A;  5KT3 A;  5AKH A;  1L3V A;  2N1R A;  3C2L A;  2JXJ A;  5AI9 A;  2YML A;  2W8L A;  4RQ5 A;  2E5S A;  4K4I A;  5AK3 A;  2XVT A;  2Y0S C;  1V85 A;  3QNM A;  1ZYQ A;  3HKZ C;  1VJ5 A;  1S5L U;  4RZR A;  2DKX A;  2HBM A;  2HMX A;  1SZP A;  4YN4 A;  3TI0 A;  3B0Y A;  3SI8 A;  3HX0 A;  4IRC A;  3AN1 A;  1XNS A;  4QWA A;  3FAH A;  8ICV A;  3RR7 A;  4C4R A;  4KTQ A;  4CRX A;  2H3Q A;  4Y2S A;  2BCU A;  4QZD A;  3TAR A;  5DB8 A;  3GIJ A;  1NK0 A;  5DKW A;  3MBY A;  3Q8K A;  3FYH A;  4PPX A;  5KG6 A;  1XSL A;  3M6K A;  4ECU A;  3H8M A;  1DGJ A;  3JPN A;  4X5V A;  4PHP A;  3GQC A;  2A1J B;  4AP9 A;  2BQ3 A;  5CJ7 A;  2G5I B;  5CHG A;  4AYB F;  4O0I A;  1QQ5 A;  4GC7 A;  4ECZ A;  4Z6E A;  4U7C A;  4B9M A;  1HIW A;  2NRV A;  2IOF A;  2ZIU B;  1S0M A;  1KFD A;  4MFA A;  5DG8 A;  3F2D A;  2AXT U;  2QAR A;  2EQY A;  2LM1 A;  3JPT A;  4M9H A;  1ZQS A;  4MHV A;  4PH5 A;  4ED3 A;  2J6T A;  2C2E A;  5DLG A;  4UBB A;  3GII A;  3IM1 A;  2Q0Z X;  3SR6 A;  2FPM A;  1KDH A;  4O3O A;  7ICG A;  1CRX A;  3H0R B;  2W3S A;  4J9O A;  4F4W A;  4J9M A;  4MF2 A;  4GXK A;  5KT2 A;  3ZDB A;  4TQS A;  3CYM A;  2KIC A;  3M6Z A;  1K1S A;  2JEG A;  2ZUB A;  2LI6 A;  5J0T A;  1ZJM A;  4O3S A;  2WB1 C;  4YR2 A;  4C80 A;  3NUQ A;  1UA0 A;  3KTQ A;  3KD3 A;  4DWI A;  3KZI U;  5HHH A;  2AH5 A;  1BPE A;  8ICI A;  1L7P A;  2K8C B;  4PHA A;  4PJ0 U;  1ZQA A;  2W04 A;  3GIL A;  5J0X A;  4E0D A;  2F1J A;  2ZXH A;  4LZD A;  5DB7 A;  1QSY A;  8ICO A;  2W3R A;  1RYS A;  3OTQ A;  5AIC A;  1X42 A;  1OUQ A;  1NK6 A;  2JEJ A;  2MAX A;  5DQI A;  1L6N A;  2D8C A;  1KEJ A;  2PMZ F;  4UB4 A;  2PI5 A;  5ALD A;  3PW0 A;  3H7I A;  3ORY A;  4BGD A;  5J2C A;  1ZD3 A;  1F0M A;  4KLS A;  3UXN A;  7ICU A;  5J0Y A;  2KOB A;  4R63 A;  3CP8 A;  4I2I A;  5B66 U;  1Z3E B;  3AQE A;  3IP4 B;  1L3U A;  4Y2T A;  5KFJ A;  1NK8 A;  4CE6 A;  2HHS A;  2YX8 A;  2H5X A;  3RAQ A;  1T8E A;  1Z1V A;  4BDP A;  4UB8 U;  1QTM A;  5JTI A;  4DL7 A;  3SMV A;  1B43 A;  4FBT A;  2BR0 A;  3I76 A;  7ICJ A;  2LPE A;  2W03 A;  3PW7 A;  4B9L A;  3B0X A;  4IR1 A;  4EZ9 A;  1N5X A;  5IIK A;  4YQW A;  4Z6D A;  5KFK A;  5D46 A;  3K4G A;  4OJO A;  2V4R A;  5ALF A;  4EBD A;  5J2H A;  4PHD A;  2H3Z A;  4IRK A;  5D49 A;  4QZG A;  5H2F U;  1L3S A;  3BQ1 A;  2W9B B;  2QB0 A;  3SYZ A;  4F5N A;  4J9Q A;  4ECW A;  3PO5 A;  3D2S A;  4Y2P A;  2ZTE A;  2E8M A;  4KN4 A;  5KFO A;  8ICR A;  4R65 A;  5KFQ A;  3HWT A;  4I2E A;  2KN7 A;  3FC4 A;  5L1L A;  1N61 A;  3AL0 B;  4Y2X A;  4ELU A;  5HMM A;  1N60 A;  4IR9 A;  4DQP A;  1N48 A;  3U26 A;  5ALT A;  4PGX A;  3MFH A;  4QIW C;  5AI0 A;  2Q4T A;  2Y0S F;  2PI4 A;  3HKZ F;  8ICA A;  3ISB A;  3H8J A;  5J8Y C;  4QWC A;  4O5K A;  3RBD A;  4LZG A;  1B22 A;  4RNM A;  2BCS A;  2ZIW B;  5KFY A;  3BZC A;  3C2K A;  1ZET A;  3OHA A;  4IQU A;  7ICH A;  3MR5 A;  3MGI A;  1L8L A;  3ISC A;  4OJP A;  2CRX A;  4KIT B;  4I2D A;  4UQG A;  1RPL A;  2YQE A;  5F3X B;  1D9D A;  3RRG A;  3N97 B;  5KG5 A;  4P2H A;  2ATL A;  5HR6 A;  2HHQ A;  1RM6 C;  1KFT A;  3HPO A;  4QWE A;  4QNL A;  5KFG A;  2FMQ A;  1YZ7 A;  2W54 A;  3V7L A;  4ICA A;  1ZQZ A;  2HCF A;  3Q8P B;  2YB4 A;  2GO7 A;  3UPQ A;  4CF3 A;  5J2G A;  2ZIX A;  4QZB A;  4RUA A;  4XA5 A;  3BS5 B;  4OD0 A;  1SL0 A;  8ICK A;  1U47 A;  4JV1 A;  1ZQM A;  5KFU A;  4C0Z A;  2R18 A;  2PFP A;  2HOI A;  2CN1 A;  2WF5 A;  5DDY A;  5ALP A;  8ICW A;  1ZQN A;  5KFF A;  1Q3U A;  2NO4 A;  2KMD A;  4TUQ A;  1UA1 A;  1WCN A;  2K4H A;  8ICN A;  4ELV A;  2P6R A;  4ECT A;  4ED6 A;  4BJQ A;  2GWS A;  4ECQ A;  1QCK A;  4PL1 A;  3EPG A;  4DOC A;  9ICH A;  8ICU A;  5CEH A;  3QEB Z;  5C5J A;  3GIM A;  2XO7 A;  1XO1 A;  3KOO A;  3SV4 A;  4DQS A;  5KT4 A;  5KFV A;  3IN5 A;  1SWW A;  2RDI A;  3V72 A;  3PR4 A;  4EZ6 A;  4UAU A;  1KN5 A;  1NK7 A;  2WB1 F;  5KFI A;  5KG7 A;  4TUP A;  4B9V A;  4KLI A;  4MEX A;  3JPS A;  3RTV A;  1AQ6 A;  5AM4 A;  4J9K A;  5KG2 A;  3H40 A;  3MDA A;  4O3N A;  4QZH A;  3BQT A;  1PK3 A;  2E8N A;  2BKE A;  1FFU A;  2HW3 A;  1RYR A;  1GO3 F;  4USA A;  3KHR A;  4Y2Y A;  3IHQ B;  3L4P A;  2KE7 A;  3NVY A;  5T14 A;  3PV8 A;  4ED8 A;  2FJ6 A;  4CCH A;  1RQN A;  1K5O A;  3MC1 A;  2KKP A;  4DS4 A;  5KFC A;  4K4H A;  4QZA A;  2DFL A;  1Q3V A;  4PZN A;  4DL2 A;  5J2E A;  2JZB A;  4Y2R A;  3RF9 A;  1EXN A;  1D9F A;  3QU5 A;  4CF4 A;  2PFN A;  4M6W A;  4Z6C A;  5EWG A;  3N4M B;  3KHG A;  4UAR A;  3T5H A;  2BCR A;  1U45 A;  3EWA A;  4DFM A;  2BGW A;  3QE9 Y;  2KTQ A;  5AKX A;  1HUO A;  3ZI4 A;  2KZZ A;  2VKQ A;  1WYG A;  1COK A;  3TQ1 A;  3UQ2 A;  2VA8 A;  1KRP A;  1Z1B A;  1SL1 A;  3BJY A;  2ZJ5 A;  5L1K A;  4IC9 A;  7ICI A;  2HHV A;  1N62 A;  1T94 A;  1ZD5 A;  1MQ3 A;  4Y2Q A;  5ALX A;  4Y2J A;  5TIS U;  4DO9 A;  1ZQD A;  1JXE A;  4F2S A;  4FE3 A;  2RRD A;  3LK9 A;  4RQ8 A;  3RJG A;  4XQ8 A;  2J6S A;  2MSN A;  3OGU A;  4M47 A;  4DL6 A;  5ALZ A;  5KAF U;  2NO5 A;  5ALK A;  2Y1J A;  5CP2 A;  1S0O A;  4ECX A;  3T5J A;  4EX6 A;  2MUT B;  2C22 A;  1RXV A;  5KFL A;  3IRU A;  4NY8 A;  3RFA A;  2I6X A;  5F9L A;  2V4Q A;  1J97 A;  1T7P A;  9ICP A;  2KG5 A;  4F4X A;  5AKE A;  3FDS A;  4C8M A;  2PFO A;  3NVW A;  1Z4O A;  3LWL A;  4O3M A;  5J8Y A;  4DL4 A;  2K4P A;  1DK2 A;  4Q43 A;  3Q8S B;  1NZB A;  3QU4 A;  1UQV A;  3RH6 A;  1TAM A;  4B9N A;  4IQV A;  4DEZ A;  4ZH4 A;  4QIW F;  4I2B A;  1LKY B;  3SEI A;  4UB2 A;  4FZN A;  4RU9 A;  1ZQI A;  1NK5 A;  5ALN A;  3AU6 A;  3V6H A;  1VLB A;  4DL5 A;  1Y88 A;  2EZY A;  2DF4 B;  4Q8E A;  3Q8R B;  2ASJ A;  3H0L B;  4Y2V A;  1PVR A;  1ZQ1 C;  2DBY A;  4GFJ A;  4LJX A;  1S97 A;  2IOF K;  2EZX A;  3K75 D;  1S77 D;  5DQG A;  4O3P A;  4NLB A;  1UT8 A;  1QQ6 A;  5CR0 A;  5IIM A;  4G9B A;  5AKJ A;  4NLK A;  3UM9 A;  2K60 A;  2XCP A;  2G07 A;  4DFJ A;  4RQN A;  3PNC A;  3RH5 A;  4PL2 A;  2GOL A;  4F3O A;  2K89 A;  5EE9 A;  2KZ3 A;  2NRZ A;  4OCZ A;  4YG2 A;  3RAX A;  3GDX A;  2I9G A;  2ZTC A;  4OJ5 A;  2NRW A;  8ICC A;  3BQ2 A;  1PK1 B;  4O5C A;  1XC9 A;  7ICP A;  5AI8 A;  4RQ1 A;  3UQ0 A;  5ALI A;  3PST A;  1TK0 A;  1PUZ A;  1WWU A;  4F5Q A;  1RZT A;  4YCX A;  3BS7 A;  3SAG A;  4NLZ A;  5AIB A;  3OSP A;  1V97 A;  2K4I A;  3MGV A;  2ZIV B;  9ICO A;  5FP0 A;  1T3Q A;  4YVZ A;  4M9L A;  1C20 A;  4NM1 A;  4RPX A;  1KBU A;  2PXI A;  4UAW A;  3TAN A;  2BQR A;  1XU4 A;  1QQ7 A;  2EDU A;  2LM4 A;  3T5L A;  1FO4 A;  4ECV A;  4GLX A;  2FMS A;  3RJF A;  2YY6 A;  5KG0 A;  1TK5 A;  1JRO A;  7ICV A;  4F8R A;  2KFZ A;  4UAZ A;  2LYH A;  4PZO A;  2E3T A;  5AM1 A;  1ZQB A;  4JB3 A;  4F92 B;  2EAM A;  2AGO A;  1U49 A;  4MEY A;  2G06 A;  2ZTD A;  1SKW A;  9ICK A;  3ZD8 A;  2RHF A;  1N56 A;  1DXS A;  2HOQ A;  2E1F A;  4KLM A;  4DF8 A;  4RPY A;  1HEK A;  1IG6 A;  2A1A A;  2BPC A;  4NM2 A;  2BPF A;  5J2I A;  5AKG A;  8ICQ A;  2FLN A;  4RQ4 A;  3WKA A;  4KLD A;  1NNL A;  1TAU A;  2ZUC A;  3F2C A;  1MA7 A;  1IM4 A;  5J2K A;  4DS5 A;  2H3V A;  2M9N A;  2VJ4 A;  2PKE A;  5IIJ A;  4QW9 A;  2JEF A;  9ICL A;  5GTH U;  3ZDD A;  3PSF A;  1S8O A;  1KKX A;  3C21 A;  4WJ3 B;  4YMN A;  1L7N A;  5HP4 A;  4O5E A;  2WF6 A;  1X6I A;  2H3I A;  4I2C A;  4EBE A;  2KV2 A;  5D4B A;  4UAV A;  4RQ6 A;  3KZX A;  5J2J A;  3RRH A;  3EYZ A;  1ZQK A;  5KNI A;  2F77 X;  1L5U A;  2LHT A;  3D2N A;  1SKS A;  1XWL A;  1SXD A;  1KQQ A;  4R8U A;  4OJ6 A;  4C8N A;  3G6V A;  9ICF A;  1L7M A;  2MU2 A;  2HVH A;  1X40 A;  3ONN A;  1SV0 C;  4Q8F A;  3OJU A;  1NJZ A;  4C8K A;  1T4G A;  3RJK A;  2XIC A;  4J03 A;  2ZJ8 A;  4QZE A;  5DB6 A;  4YFK A;  3KBB A;  4QW8 A;  3GZF A;  7ICT A;  3SD7 A;  3WK9 A;  3RB3 A;  3R9K A;  2BCQ A;  2YMP A;  3ALR A;  8ICM A;  2BPG A;  3ZDC A;  1ZQV A;  4YMO A;  4BUG A;  5KFN A;  1PZN A;  2DKZ A;  5JUM A;  3D6J A;  3HW8 A;  9ICG A;  1WUD A;  3RJJ A;  2EAN A;  2M0N A;  2HHT A;  4EX7 A;  5AKL A;  3I28 A;  5AI6 A;  5J2B A;  2OH2 A;  2F1I A;  2KIV A;  4P0P A;  5KTQ A;  4DSL A;  9ICS A;  4DQR A;  5BOM A;  4ED7 A;  8ICE A;  4NJ8 A;  2PFQ A;  1L7O A;  4C8O A;  1XS9 D;  1Z00 A;  8ICS A;  1NZP A;  3E58 A;  3PX0 A;  4BWM A;  4DOA A;  2QAR B;  4UBC A;  2HHX A;  3UXO A;  2RDJ A;  3J81 j;  2HHU A;  2XC9 A;  3AEV A;  4J9S A;  2KKV A;  3QX7 A;  3EW9 A;  4JUZ A;  4UB1 A;  1KSP A;  2A3V A;  1FFV A;  4F71 A;  5KAI U;  3LWM A;  3AM9 A;  3PZP A;  4KLO A;  4F4Y A;  2FE9 A;  4KLL A;  1NI3 A;  1X66 A;  2F44 A;  3M7D A;  4DFK A;  3T5K A;  3BQ7 A;  9ICX A;  3EPI A;  2Y9U A;  4YD2 A;  3JPQ A;  5J0O A;  1ZQE A;  3HJE A;  4DFD A;  1RYU A;  3RBE A;  3HT3 A;  3H4D A;  8ICL A;  1FIQ A;  4F5P A;  3PML A;  3GFK B;  4B6J A;  1X2I A;  3WU2 U;  3N7P D;  5F9N A;  4NL9 C;  4XRH A;  4UW9 A;  2XI9 A;  3ISD A;  4BXO A;  1YT3 A;  4GXJ A;  1ZQR A;  5L1I A;  4EEK A;  5KFM A;  2W9C A;  2WTF A;  3M9O B;  3PX6 A;  9ICM A;  2W7P A;  5AI5 A;  5DLF A;  2AQ0 A;  3V6J A;  2WF9 A;  1ZQQ A;  7ICE A;  3TAP A;  3BDP A;  2IOH A;  1J2N A;  4YD1 A;  5J0W A;  1BPX A;  3RR8 A;  1ZD2 P;  8ICJ A;  1A0P A;  1MQ2 A;  2LKY A;  2G08 A;  2KNJ A;  2F2A B;  2E8P A;  1O08 A;  5ALW A;  5AIA A;  2AJQ A;  1TV9 A;  4YR0 A;  4JWM A;  2YTU A;  2C2D A;  5IIL A;  1IXR A;  4TUR A;  9ICA A;  5DBA A;  3IG5 A;  3GIK A;  4I2A A;  3ETR A;  2NYV A;  4KX3 A;  3PX4 A;  1LKY A;  2HBJ A;  5KFX A;  4O9M A;  2DWQ A;  3H4B A;  4RUC A;  9ICQ A;  3KHL A;  4UB3 A;  1ZRN A;  2JR5 A;  3PY8 A;  1ZQP A;  4P0Q A;  5KFZ A;  4JV0 A;  4FBU A;  4YMM A;  2YMQ A;  5KFW A;  2HDO A;  1LV5 A;  2ZUD A;  3SQI A;  3ED5 A;  1BPY A;  3RJI A;  3PR5 B;  3TFR A;  1X6J A;  3QU9 A;  5L9X A;  2FMP A;  5J2D A;  4Q45 A;  4RQ3 A;  4ED0 A;  2W9A A;  4OJL A;  2KSO A;  2AGP A;  3OPX A;  1ZJN A;  4M04 A;  1JIH A;  5DQH A;  3C5G A;  2GH1 A;  1SV0 A;  2R8G A;  5AK5 A;  4P4O A;  1QSS A;  2G5H B;  3ZDE A;  1TAQ A;  5K4L A;  4DLG A;  2QB0 B;  5ALG A;  4KLJ A;  4C4T A;  3MR6 A;  1NK9 A;  3TFS A;  1RQL A;  4BWJ A;  5ALQ A;  4RQ7 A;  1U9L A;  4R66 A;  3WK8 A;  2G09 A;  3F5E A;  2A19 A;  1D8L A;  3GU3 A;  3H8W A;  5C0Y A;  8ICH A;  9ICI A;  1JI7 A;  3M1Y A;  2XY5 A;  2OWO A;  1JAL A;  4DF4 A;  2W7O A;  5DBC A;  3SAH A;  4RQ0 A;  1JN3 A;  3MFI A;  4RNO A;  2W43 A;  4O3Q A;  4ECY A;  1S10 A;  4KLQ A;  2XGQ A;  1S76 D;  4I2F A;  1V38 A;  3C1Y A;  5HML A;  3TKA A;  4BX9 C;  4KMU A;  2ZXI A;  3CRX A;  1JUD A;  2BCV A;  2YN4 A;  2VA3 A;  2F1H A;  1NJX A;  3Q8Q B;  3F2B A;  2VIX A;  3G6X A;  2B6G A;  2K8A A;  2OEH A;  5L1J A;  1ZQC A;  4M9N A;  4UB6 U;  2A1J A;  1XSP A;  2ZG6 A;  5AM0 A;  2BDP A;  2W9M A;  3WK5 A;  1NKB A;  4NLN A;  4RNN A;  3UMC A;  2W11 A;  2ZIU A;  3PMN A;  3QUC A;  8ICB A;  5ALS A;  5AKI A;  4J9N A;  3PW4 A;  3ZDA A;  2ZIX B;  3KKA A;  3MAB A;  4MFF A;  4QZ9 A;  4M0A A;  1ZQG A;  3IDW A;  4HAI A;  4MFC A;  1HJP A;  1ZQH A;  1QLN A;  1WG8 A;  2PMZ C;  3N28 A;  3C23 A;  3WKB A;  1DK3 A;  5HHI A;  4F91 B;  2CXY A;  9ICJ A;  1UCV A;  2KIW A;  4DCC A;  3MDC A;  5AI4 A;  3A0H U;  3BQ0 A;  2OXO A;  2OHF A;  3B9J A;  5ALH A;  2YB1 A;  2JH1 A;  5III A;  5AHX A;  3RJE A;  3RJH A;  1FEZ A;  3QXG A;  3QYP A;  3NGD A;  2E8O A;  3HIL A;  4NL9 A;  4PGQ A;  4RT2 A;  1X9W A;  1O03 A;  3LVV A;  3F53 A;  4FS1 A;  1JMS A;  3SV3 A;  4J9L A;  1IV8 A;  2IMW P;  5ALE A;  1S9F A;  4FFD A;  1KW4 A;  1N2X A;  3QZ7 A;  2BHN A;  4M9J A;  9ICB A;  2ASD A;  2Y9T A;  1NOM A;  3AU2 A;  2OYY A;  3RB4 A;  3N7S C;  5ALR A;  4F5O A;  5EWF A;  4KLE A;  5ALV A;  2KK0 A;  1JRP A;  2B21 A;  1M6Y A;  4XUS A;  3PO4 A;  2FLL A;  2VA2 A;  2JZB B;  3T79 A;  2XY6 A;  7ICO A;  1IIP A;  3BZK A;  3PW5 A;  4M6W B;  4DSK A;  2KD1 A;  3NRZ A;  5DGA A;  1VDV A;  1K1Q A;  2KHV A;  4J9P A;  1X9M A;  1SL2 A;  4NWI A;  4US8 A;  1CI4 A;  3C28 A;  2KJ5 A;  3DEE A;  3SAF A;  2FPK A;  2DL0 A;  4QZC A;  2RP5 A;  1SV4 A;  4EEL A;  2HOF A;  4P4P A;  4YP3 A;  3UMG A;  8ICT A;  1T3N A;  3C1Z A;  4UB5 A;  9ICC A;  2D3D A;  2HI0 A;  3C5F A;  1LVH A;  5J2A A;  1LB2 B;  2JV3 A;  7ICR A;  1NJW A;  4O3R A;  1OXJ A;  2P66 A;  4J9R A;  2ISO A;  2V9W A;  1S0N A;  3H0M B;  1ZQJ A;  2JMG A;  4F72 A;  2DPI A;  1CUK A;  2JEI A;  1Z19 A;  2EZZ A;  4I29 A;  2W9B A;  5G5G A;  2J6U A;  1ZQF A;  2WFA A;  2JRZ A;  1ZD4 A;  3H8S A;  9ICW A;  2NRT A;  2RQ5 A;  1SKR A;  4LVS A;  3C2M A;  2ESE A;  3VC8 A;  2KP7 A;  9ICR A;  3DDH A;  2XY7 A;  3L3F X;  4C7Y A;  1ZQL A;  3TAD C;  3LYS A;  3V6K A;  2EH9 A;  5KFP A;  4ECR A;  3D2Q A;  1D8Y A;  1BVS A;  2DUY A;  4DOB A;  3WK4 A;  4KX5 A;  4Z6F A;  3JPO A;  5KFE A;  5AKZ A;  3WKD A;  5AKY A;  2K4E A;  3RH4 A;  5KFH A;  2BQU A;  2DPJ A;  5KT5 A;  1CEZ A;  4EEN A;  1SGG A;  5KFB A;  2RLT A;  2ZIW A;  4ACO A;  4CNQ A;  5AKK A;  2JH7 A;  5AK6 A;  4DLE A;  1SWV A;  4IL6 U;  4CDG A;  4JK1 A;  5KFS A;  4F4Z A;  3C29 A;  4I2J A;  5KL1 B;  1URJ A;  4K4G A;  4C8L A;  5KFR A;  1C7Y A;  4PHE A;  3MGH A;  4JMU A;  2KVC A;  1ECW A;  5AM3 A;  2KJ9 A;  2G0A A;  2XID A;  2IBK A;  5HR7 A;  5EE0 A;  1SZH A;  1BNO A;  3WK6 A;  3QUQ A;  3GV7 B;  1COO A;  1ZOL A;  3MR3 A;  3BS5 A;  3WKE A;  3M8R A;  4TQR A;  4KLG A;  1A77 A;  1F5S A;  5L1M A;  8ICG A;  4IS7 A;  1NK4 A;  1J2M A;  3WKC A;  2FLP A;  1A6S A;  1P7D A;  2D6F C;  3CNH A;  1UHU A;  2P6U A;  8ICZ A;  1JX4 A;  3ICX A;  2H3F A;  4FS2 A;  3QZ8 A;  1ZQY A;  3RB6 A;  3QUT A;  3E2E A;  1ZQW A;  3QEA Z;  2BDU A;  1DOQ A;  3V7J A;  3THV A;  3EZ5 A;  3TAC B;  2R8H A;  5ALL A;  2YMM A;  3I1Y A;  5IIN A;  2F3N A;  3N7R C;  1RG6 A;  1F44 A;  3F5A A;  3NVV A;  2DGZ A;  1L8O A;  4KLT A;  4U6P A;  3JPR A;  1BPD A;  1BNP A;  4EBC A;  3MR2 A;  2ODG A;  2ALZ A;  1Z4N A;  5AM2 A;  4ED1 A;  4I28 A;  2ISP A;  3UMB A;  5J2F A;  4MF8 A;  2WAQ C;  9ICU A;  3M8S A;  1ZQU A;  9ICV A;  5DG7 A;  5EE3 A;  5JU5 A;  5DB9 A;  3GV8 B;  2ZJA A;  4KLF A;  4B9T A;  3KKA C;  4YR3 A;  9ICE A;  1MSW D;  5AM5 A;  4EYH B;  1SXE A;  7ICM A;  4DSI A;  5AK4 A;  5B5E U;  5JRT A;  4ELT A;  3SZ2 A;  3S6J A;  4I2H A;  3SEN A;  4JWN A;  1B0X A;  2L5Y A;  3M9M B;  4R64 A;  4QZI A;  2LBO A;  5J0R A;  4ZOH C;  2IHM A;  2UVR A;  5KT7 A;  3NTU A;  4IQW A;  1Q46 A;  2KFN A;  3DV9 A;  4IRD A;  2JHD A;  1ZXI A;  3NVZ A;  2QB1 A;  4KLH A;  5DBB A;  3IG8 A;  3OHB A;  5KFT A;  4JV2 A;  4KMO B;  8ICF A;  3WK7 A;  3PVX A;  3QU2 A;  5IIO A;  3AMZ A;  1NKC A;  4Q44 A;  1RDF A;  3KHH A;  4FZL A;  2R8I A;  2HSZ A;  3K1Z A;  4OO1 J;  2AHO B;  9ICN A;  1YZ6 A;  4YXM A;  1MN8 A;  5KL8 B;  4QZ8 A;  4M2Y A;  5EOZ A;  4NV0 A;  4YXJ A;  2KVS A;  1QH9 A;  5ALU A;  4F2R A;  3TAD A;  1ED1 A;  4FZM A;  4R8U B;  5DG9 A;  5KG4 A;  4B9S A;  4QZF A;  2MUT A;  5E79 U;  1ARO P;  1TFR A;  4Y2U A;  4F93 B;  3GV5 B;  1SIJ A;  4GIB A;  1D8B A;  1ZQT A;  1ZQX A;  2F76 X;  3A0B U;  2HVI A;  3HP6 A;  2LMR A;  3FM9 A;  4EYI B;  5J29 A;  2R8K A;  3G6Y A;  2FI1 A;  1TE2 A;  3Q8M A;  3RB0 A;  4QWB A;  4CGZ A;  3IV6 A;  3PSI A;  2Y1I A;  1KTQ A;  2XGP A;  4UAY A;  2O6K A;  3NS1 A;  1MC8 A;  2WHE A;  1H38 A;  4RPZ A;  5CRX A;  5J0U A;  3O0F A;  7ICN A;  2E1E A;  4KLU A;  4UAS A;  1ZRM A;  2UVW A;  2LYB A;  1OW5 A;  3Q8L A;  5ALO A;  5EE1 A;  1WCL A;  4I27 A;  2EAO A;  9ICT A;  5DDM A;  2I1Q A;  2UVV A;  4AYB C;  4QJF B;  5KT6 A;  7ICS A;  4P0P B;  2HBL A;  2AU0 A;  1DGS A;  4DSE A;  2W55 A;  4TUS A;  2VJ5 A;  3V7K A;  1L3T A;  5TZV A;  1S0V A;  1RXW A;  2I5H A;  1KLN A;  1B4F A;  1A76 A;  1Z00 B;  4I2G A;  4DSJ A; 
#chains in the Genus database with same CATH homology
 2GLE A;  3TAD C;  1V38 A;  4NJ8 A;  1PK1 B;  3TAC B;  2D8C A;  3H8M A;  5J8Y C;  2E8P A;  2F3N A;  2ES6 A;  1RG6 A;  2Y9T A;  1WWU A;  2QAR B;  1F0M A;  1PK1 A;  3BS7 A;  2B6G A;  3TAD A;  2YTU A;  3K1R B;  1PK3 A;  2E8N A;  2KG5 A;  5KNI A;  1SGG A;  2QAR A;  5J8Y A;  2K4P A;  1WWV A;  1LKY A;  4MHV A;  5F3X B;  1UQV A;  1SXD A;  2KE7 A;  2QKQ A;  5JU5 A;  1X40 A;  2FE9 A;  1SV0 C;  2KSO B;  3KKA A;  1X66 A;  1Z1V A;  2LMR A;  4PZN A;  1LKY B;  2F44 A;  3SEI A;  1X9X A;  3IDW A;  5JTI A;  3BQ7 A;  2Y9U A;  3KKA C;  4PZO A;  2KSO A;  2LPE A;  1SXE A;  3BS5 B;  2DL0 A;  2EAM A;  5JRT A;  2F8K A;  1SV0 A;  1SV4 A;  1UCV A;  3SEN A;  2EAP A;  4RQM A;  1B0X A;  2QB0 B;  2D3D A;  1DXS A;  3BS5 A;  2L5Y A;  1V85 A;  4NL9 C;  2KMD A;  5L1M A;  2JV3 A;  1OW5 A;  2DKX A;  4IS7 A;  1OXJ A;  2EAO A;  2DKZ A;  1COK A;  2QB0 A;  1JI7 A;  2QB1 A;  2E8M A;  2K60 A;  2EAN A;  4RQN A;  2E8O A;  3HIL A;  4NL9 A;  1B4F A;  2KIV A;  2ESE A;  1KW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...