2E9MA

Crystal structure of human cytosolic neutral beta-glycosylceramidase (klotho-related prote:klrp) complex with galactose and fatty acids
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
466
structure length
466
Chain Sequence
MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTLEDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAVWLEPADPNSVSDQEAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQKQGYPSSRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQENKKGELGILQDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYIKDTYNNPVIYITENGFPQSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytosolic beta-glucosidase
publication title Klotho-related protein is a novel cytosolic neutral beta-glycosylceramidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 189
structure length 466
sequence length 466
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2e9mA00
1GQLA 3ZQ9A 3M07A 3UG3A 2WMHA 3UG4A 2GJXB 3GM8A 2DSVA 3TTOA 3VGHA 3MUAA 1SR0A 1OGSA 2DT2A 4H8VA 4UOQA 2CBVA 3F5JA 3VTRA 5DFAA 1RD6A 1ODUA 3ARYA 4QCFA 2ZUUA 3VD3A 1UR1A 5A6BA 2E9MA 1GJUA 2XJ7A 1W9BM 2DT0A 4AZIA 4PMDA 1FP8A 4M8UA 5E0FA 4DM2A 3SCUA 3VMOA 4GXPA 2XFRA 2FH6A 1BG9A 2V3GA 1CWYA 2WNWA 5A2AA 3L4WA 3WQVA 2NT1A 1XC6A 2FHCA 1V3HA 2JIEA 4TVCA 1TCMA 5ABHA 4M24A 1BQCA 2WWCA 4QLJA 3CZ8A 5GNZA 3NDZA 3VUPA 4D6GA 1TA3B 5A2BA 1M53A 1MQQA 2BHYA 4W89A 3WEOA 2OLHA 2ZXBA 3SCSA 1V0LA 4NZCA 2IXVA 3BLKA 2D1ZA 3B9EA 2X8RA 1I1XA 3BAWA 3W28A 1E3XA 2EPOA 1W32A 2J7HA 1HX0A 1VFOA 2NW0A 4P7NA 3VKKA 1C7SA 2CYGA 3MSGA 4P8WA 1QNOA 2WK2A 4W8BA 4YN5A 1WZKA 3WNKA 4LX4A 4WK9A 1JF6A 4JFVA 3PTKA 4MTVA 1EQCA 5ABGA 4PMZA 1VAHA 3GTNA 5DO8A 5JBDA 1J10A 2G4FA 2CHOA 1FFRA 2DSZA 5I23A 2WVUA 3F4VA 5HOSA 4WSJA 3PZQA 2ZWZA 5JBFA 4CVUA 1ZBWA 2E9BA 1B0IA 3WELA 5CSYA 3GNRA 3BXWA 3OGRA 3BSHA 3K4DA 4DUVA 1MW0A 3MSDA 4JKLA 5FKYA 5AC4A 4D6HA 1UKTA 4D6JA 2Y5EA 3VINA 1E4LA 3T09A 2DIJA 3UEQA 4TTGA 1J18A 1GJWA 2WW5A 1DWHM 3PZTA 2WMIA 2DH3A 4BQ3A 2YL5A 3OLGA 4PCTA 1JZ7A 4V28A 1G9HA 1DHKA 1TE1A 2VNCA 2J79A 2XTKA 2WCAA 2OSWA 2PI6A 2D24A 3AZSA 2J8GA 3HU7A 1CECA 1JFHA 3AHXA 1E6PA 1E6QM 1J9YA 1R86A 2V5DA 3BCDA 1V0MA 3CMGA 4LYRA 1SYTA 5AC5A 4NF7A 5CXPA 1CLVA 4LXFA 5EMYA 1C8QA 3CUIA 4FLQA 5EFFA 4D71A 1QI3A 4Z2JA 3PZUA 3AROA 4AW7A 1PJ9A 3BMVA 4UFJA 4KWUA 3GH7A 3ARUA 4U2YA 1AQ0A 1HIZA 4KRUA 2JEQA 4S3JA 1JDCA 1HJQA 4CD8A 3AS1A 1IV8A 4EANA 2BY2A 3VIJA 3T0BA 3CHFA 2J77A 1CXLA 3O6AA 3CIVA 5DT7A 4XV0A 2DSKA 3JUGA 1KQYA 1FA2A 2QMKA 2WWDA 3PBGA 4U33A 1D2KA 1TR1A 4CD7A 4OBSA 1NH6A 1E0WA 1EDQA 1KGXA 2E9LA 4HZ8A 1EH9A 1JD7A 4UQ9A 4AIOA 1MVYA 4W86A 1UWIA 4GIAA 2W67A 4D6FA 4MDPA 1CLXA 5DF0A 1V02E 2MANA 3L4UA 1Q6CA 5DMYA 1B3XA 1J0YA 1GVYA 1CENA 4FLOA 5GNXA 3TP4A 1E73M 2WB5A 3BH4A 3ZSSA 4YPJA 3FXYA 1G01A 4BCEA 3AXXA 2A3HA 1NWSA 2PWGA 3MANA 3WEMA 1V6XA 1MFVA 1R7AA 3NJ3A 3ZO9A 2YKKA 5M5DA 3W29A 2XVNA 1OT1A 4UFKA 1HN1A 3GDBA 4AD5A 4A4AA 4UZSA 1QHOA 4W5UA 5ABFB 2GFTA 3WN6A 2VX5A 1KQZA 5BXTA 2YLLA 1VEPA 3O9NA 4X9YA 4OJYA 2UY3A 3SEPA 1E6XM 1E43A 2DH2A 2ESCA 3VO0A 5AYBA 4D6IA 3CZJA 3ZR6A 3CZEA 1HJUA 1HP5A 4UNIA 3TTSA 2XG9A 2J7EA 3ZSTA 3WD3A 1WE5A 2CBIA 2OWCA 2E40A 4TVDA 1E4NA 3VNZA 4FMVA 3AIWA 2WCGA 1JIBA 2VJXA 1K9EA 1BSIA 1H5VA 4J3SA 1J0IA 1ZL1A 1EIBA 1XV8A 1HKIA 1GQJA 2BY1A 5M17A 3NYDA 3WDHA 4F66A 1K9DA 2RGMA 5JIPA 1PX8A 1CDGA 2WKLA 3ALFA 4U5KA 4AY1A 1JNEA 1J12A 3ZJ7A 3WMBA 3EMCA 1UKPA 1JXJA 2XVGA 2OWWA 1H3GA 5IDIA 1H09A 1ISXA 4PYSA 1GVIA 1W2VA 2WSKA 4GQQA 1AQMA 4V27A 1E1EA 1XH1A 3AIBA 4V2XA 3SIMA 1ODZA 4PMYA 4ZE5A 4UFLA 3RMEA 3VX0A 4ZEPA 1JI1A 1CIUA 2WYSA 4F8XA 1UH2A 3NSNA 5I2UA 4UFIA 3GXMA 3KWXA 5JUVA 1QBBA 3PZNA 3S2CA 1E5NA 2WZIA 4URIA 4AYSA 3L2LA 3PTMA 4BZYA 4CKQA 2WLYA 4GKLA 5IHRA 1UWQA 3WNNA 3PZMA 4MDOA 1E71M 2E3ZA 1GOIA 4RE3A 3WH8A 3K8KA 1V0KA 3IAQA 4Z2GA 4ZE4A 2XM1A 4CU8A 2BXYA 3AMLA 3RM4A 2XGIA 3WF1A 4GINA 2GDUA 1E9LA 3WDPP 1CGTA 1UZ1A 3QHNA 3SCRA 4WKAA 2VQTA 3VD7A 3SCVA 1BVNP 5D9OA 1GCYA 4H2CA 5A6MA 1CGXA 4HP5A 2XM2A 4PRWA 3WUFA 3VIFA 4QAWA 3WUBA 2DSWA 2YA2A 1GOMA 3EDEA 1QHPA 3MV01 4CN6A 2AAAA 1MQPA 1BYDA 4OZOA 2PF0A 4JL2A 3AIUA 2V38A 4PSPA 2J78A 3VGEA 1SFSA 1JAKA 2JE8A 4WJXA 1G5AA 5CPSA 1QBAA 1VBUA 1VBRA 3WF4A 4TUFA 5A1AA 1W9PA 4AD0A 2G41A 2IUZA 1JDDA 3CO4A 2Y8KA 4ATWA 1B30A 1LL6A 3PZIA 5D4YA 1BPLB 2WKGA 1FH9A 4Z2IA 5ABFA 1BAGA 3SUVA 1KXHA 2X09A 4WKFA 1UD5A 3VD5A 1XCWA 3WD4A 4UOJA 5HDRA 5LA1A 1CGVA 5I77A 3A3HA 3CLWA 1UR0A 2YBTA 1V3LA 3AICA 4AEFA 4KRTA 1MFUA 2QLYA 5FCZA 3A4WA 2Q8XA 1R87A 3ARSA 3VDCA 2ZWYA 1CXEA 4OOUA 1LLOA 2J8FA 4JHZA 3QHOA 4HOZA 1B3WA 3BCFA 3AMKA 3W82A 4ACZB 3WSUA 4JFWA 1JZ5A 1UHVA 1KWKA 1JXKA 4AD2A 4LGXA 1A47A 1Q6GA 1QPKA 3BAYA 4JZ5A 3L4ZA 1JYXA 2BVDA 2J7FA 5E6ZA 1XH2A 2EO7A 3CZKA 1EQPA 1E56A 4HZ6A 3VX1A 2DDXA 2OSXA 1QVBA 2DT3A 2AOSA 2F2HA 2G3JA 2QMJA 2ZX8A 4PMXA 3N15A 3AHYA 1X6NA 5E70A 2YA1A 3EMZA 2X1IA 4ML4A 1KR1A 1GHRA 3J7HA 2BY3A 2V3DA 5I3DA 2GK1B 3K8MA 4JKMA 2ZUVA 3WMSA 4M56A 4UCFA 5CQ1A 3AIQA 5A8OA 3E1F1 2C8NA 4TTUA 5A8NA 2X05A 5E9AA 1HVQA 2WCSA 3U7VA 1V0NA 3WDIA 1KGWA 2VCBA 3T0DA 2Y4SA 2VCAA 4LQ1A 4H41A 2JALA 1WZAA 1LF1A 1PIFA 1EDGA 4P8UA 4DM1A 1CZ1A 1Q4NX 2XGBA 4NRRA 1A3HA 2UY2A 4HU0A 3OG2A 1MWOA 3N11A 4HOWA 4HTYA 3VOCA 5IFTA 4UQAA 2WVVB 3UG5A 3W6MA 2ZX6A 5D8ZA 4AD1A 4KMQA 3WD0A 1NOFA 5BXRA 3ZJ6A 2J7GA 4ACYA 3RO8A 4LYQA 2QPSA 1OD0A 1RP8A 4E8CA 5DT5A 3VILA 3WNMA 4C7FA 3L4YA 1GOOA 2ZICA 2ZUMA 3CUGA 5AY7A 2OYLA 1QNRA 1V02A 2Y24A 2D22A 1UH3A 1QOXA 4H8HA 1RPKA 4B9ZA 1EOKA 1PEZA 3SCQA 2Z1SA 4PSRA 4HMCA 4TX8A 1OIFA 2BFGA 4MB4A 2WHMA 4WF7A 2BHUA 1WDSA 4B3KA 3W25A 1UKQA 3NSMA 3ARVA 4D6DA 1LWHA 4JFUA 1NQ6A 2ZE0A 3RM8A 5D9PA 1GHSA 3EDJA 2XVPA 2EPNA 2W61A 1UQZA 1DWFM 2VT0A 2WAGA 2CXGA 5I6SA 1W3HA 1R7OA 3VIMA 2FH8A 1UR9A 1P6WA 3SUUA 4AIUA 1WDRA 3ZT7A 4PMVA 4AZ5A 4WSKA 4N0RA 1KBBA 5KEZA 1XGZA 3WDQA 2WZHA 3N04A 2J74A 5EBAA 3WMCA 3T2QA 5A6SA 3A6OA 3SCWA 3M46A 4NI3A 2OYMA 4AISA 3ZOAA 2VRJA 4R27A 3KL0A 1UYQA 3VGFA 5HPOA 1E70M 1GZJA 1VJSA 5I78A 2CKRA 1LG1A 3N13A 4H04A 3IJ9A 4MNMA 2WVSA 5A69A 1KB3A 1W91A 4ACZA 2UY4A 3WF2A 4MB1A 4X0VA 3UR8A 4WLCA 2C7FA 3VDBA 4B9YA 1NARA 2CIPA 4TOQA 2VURA 2YJQA 2WMFA 5A2CA 1ITXA 5IHSA 3CH9A 2WSPA 5BROA 3WQWA 3AXHA 4QDMA 4W85A 4XZBA 2WMJA 5I0DA 2VI0A 1ISVA 2EEXA 3OZOA 2FDMA 4AXNA 1BVZA 2GK1A 4BQ4A 1FH8A 1US2A 4FLRA 2PBGA 3S6TA 4EK7A 2ZXDA 2PWEA 3FHQA 4IPNB 4EAMA 1W3JA 1ZB5A 1E40A 3LPPA 2YA0A 4BA0A 1NP2A 3FW6A 4UTFA 1H49A 1VJZA 4S3KA 3G6MA 4M81A 1XSKA 2FHBA 2VO5A 1H0GA 5CPQA 3VMPA 2WVVA 4BQ2A 3AQUA 1GQKA 4C7DA 2Y8VA 1CBGA 1XYFA 3WEZA 3WQ8A 4HA1A 1NWRA 1U33A 2GJXA 4HA3A 2VRQA 1WPCA 4BS0A 3FHAA 1W9VA 1J0HA 5BCAA 1AMYA 4CD4A 1H0IA 2TAAA 1J11A 2WLZA 3FN9A 3OA5A 3QGVA 5TD4A 1KCLA 3GXFA 2D0HA 5A6AA 2DEPA 2W63A 2BV9A 4W7VA 2V3FA 3VPLA 2XSBA 1OD8A 1DWJM 4IISA 4MJ2A 1EXPA 5E0CA 4UFHA 1M7XA 3EYPA 4YHEA 3PZ9A 4GI9A 1L8NA 4J3WA 2WC4A 1MW1A 7A3HA 1OSEA 4AZ7A 3VIGA 1LJYA 3WH9A 4U31A 4PBGA 2FGLA 4UFMA 1MXGA 1VFFA 2FGZA 1RH9A 4QLKA 3VMNA 2JIWA 2YLAA 2O9OA 3HJEA 2CETA 1GUVA 1JZ8A 2PWDA 1B3VA 3WD2A 2YL6A 4PMNA 4U3AA 3THCA 3POHA 1CYGA 3ARTA 4JCLA 4CUCA 1C8YA 2WVTA 3WFZA 1LL7A 5BYWA 4JHOA 4Q7NA 2G3IA 4DWSD 2DGAA 2UY5A 1TA3A 1XYZA 3DC0A 1W2PA 1WO2A 5D9NA 1D3CA 1LWJA 3FY1A 1E15A 4HU8A 1TVPA 4F79A 3PZGA 3VIOA 3VDAA 4GPNA 4J3VA 3GBEA 3MUZ1 2CPUA 4PMOA 1XD0A 3MKKA 2UWFA 5BRPA 1HF6A 1GOKA 3POCA 4FLSA 4ZFMA 1JI2A 1KXVA 2B31A 2VL4A 3WBEA 1JYWA 1BG4A 1NOUA 1UH4A 1KWGA 3WUGA 3TOPA 4B3LA 5CSUA 1H4PA 1OWQA 3DYOA 3RCNA 3BAJA 1KFWA 1QI2A 1UQYA 3ZM8A 1HXJA 3W81A 5CGMA 4OUEA 2EBNA 3WFLA 4XZWA 3RM9A 4HOXA 4W88A 1F4AA 3EBVA 1YQ2A 4MB3A 3GH5A 4TXEA 4PMRA 5A6LA 5EB8A 4W93A 3WH7A 4AC1X 4PTXA 1TZ7A 3OLEA 1JFXA 3UCQA 4M29A 4XX6A 1XSIA 1W9DM 5EFDA 4ATLA 1UKSA 1QNPA 3K1DA 4K68A 4RL3A 3WQ4A 1EHAA 4W84A 1J0JA 1OBAA 6A3HA 4X0NA 1Y7VA 3KL3A 2J25A 3CMJA 4JIEA 1VFUA 3SCTA 4D6EA 2DIEA 2A3CA 1BYBA 3U7BA 4CCCA 3A4AA 3U57A 2VZTA 3RJXA 1V3JA 4B16A 1WAWA 2ZUWA 4OBRA 3CHEA 3RILA 3BGAA 1QW8A 1JYNA 3CZLA 4H7VA 1HL9A 1LQ0A 1NWTA 3LPOA 5M03A 3BLPX 4QFUA 4PN2A 2VR5A 1NOWA 1GORA 3WBAA 2G8ZA 4B15A 4OKDA 3CUHA 1E5JA 3GXIA 3ZT6A 1FOBA 1E4MM 4WIWA 1PPIA 4W7WA 1TUXA 3SCPA 3D3AA 3AMCA 2A3EA 4AZ6A 4F9DA 4U5IA 4ZXOA 2VX4A 3VGGA 1HL8A 2VX7A 2PBOA 3MMWA 1E3ZA 1HVXA 3ZMRA 3ZJKA 2GVYA 3F5KA 4J3XA 4PTWA 1V3KA 1KXQA 1V6WA 4GO8A 1C91A 2VCCA 3MU7A 4BF7A 1UWTA 3CHCA 3AXIA 4J3TA 3OIHA 2D3NA 2D0GA 3K4AA 4MB5A 3WQ6A 2WPGA 1O6IA 1BHGA 1NM9A 4MPKA 1B2YA 4HMEA 4P7RA 1O7AA 3WDJA 2XFYA 3LPFA 4W7UA 2CBJA 2D0FA 4Z2KA 4D6CA 3I3DA 1K9TA 1ITCA 2EPLX 2Y2WA 3VDHA 4HZ7A 5KZ6A 2VTFA 3CTTA 4Y7EA 3QOMA 3SCNA 1ZS2A 2GUYA 3W6LA 3W53A 1WDQA 1U2YA 2GJRA 1GONA 3A47A 4E2OA 3WY1A 1UWUA 4IM4A 1H2JA 1EGZA 2XHYA 3RJYA 1WZLA 1FHDA 4LYPA 1JZ4A 2V3EA 4QCEA 3ARQA 2YDSA 1CEOA 1W1YA 5CG0A 2WMGA 1B90A 1D7FA 1HJVA 3KE0A 2OSYA 3W24A 1AVAA 1V6UA 2QHAA 2YOCA 4MNJA 1UR8A 2XWEA 5A3HA 2BY0A 1US3A 3PHAA 4DWSC 3NSXA 4HA4A 3AS2A 3N18A 2WC7A 3QR3A 4BQ5A 2XIBA 3VM5A 4L4PA 3VNYA 1RP9A 5C8BB 2D23A 1QI5A 1QW9A 3L4VA 1FHLA 2F61A 5A8QA 1AQHA 3ZIZA 3W4RA 3U5UA 2J75A 4NSBA 1E0XA 3HMCA 1UKOA 2HVMA 2EPMX 3B9DA 4M80A 5I24A 2PWHA 1NWUA 2CBUA 1SMDA 1C90A 3L4TA 3PZVA 1PX4A 3ARPA 1MXDA 3NIYA 4E4PA 1V08A 1ISYA 1YHTA 4Z2LA 3BAKA 4JFTA 4U2ZA 5CJ5A 1VIWA 3LMYA 1X1NA 1H1NA 1GNXA 2F8QA 1KXTA 1X6LA 1CNVA 1K9FA 3GNPA 3WH6A 2DSUA 4DUWA 4P7QA 1IZJA 1ESWA 3CBWA 4CU7A 1UD3A 1M04A 3RDKA 1BYAA 1W1PA 1JD9A 4GZJA 4A3HA 2EQDA 2VVSA 1OCQA 2VQUA 3OLDA 1ECEA 2CNCA 3BMWA 2A3AA 1B3YA 2WBGA 3AIRA 2V5CA 2D3LA 3AS0A 5A8MA 3DECA 3WF3A 2OYKA 1GOWA 2W66A 1B31A 2RGLA 5GPRA 4HPGA 1WCGA 4P8VA 4A3YA 1BGGA 3L4XA 4UQEA 3WIJA 2VZSA 3T08A 1LL4A 1V6VA 2WC3A 1WZMA 1E72M 2BNJA 4C7GA 4MADA 3AOFA 4WKHA 2ZUNA 4AEEA 3RIKA 3MUIA 3T2OA 2YIHA 5HPCA 2ZXAA 1I75A 4GZEA 1JZ3A 4UR9A 1V03A 3APGA 4CN4A 1J01A 1V3MA 4W8AA 2PC8A 3B8SA 3G6LA 3ECQA 4AWEA 1W1TA 3ZJ8A 2CHNA 4Q22A 1OINA 3SUWA 2XPKA 3KEHA 2QPUA 1ZBKA 3CGTA 3NUKA 4NRSA 1H11A 3WNOA 3GYCA 3ARRA 4P7OA 2J47A 1XRVA 3W38A 2O9RA 3SUSA 1FFQA 4KGJA 4D72A 3MS8A 3OBAA 3EDKA 5BRQA 3LPGA 4D1IA 4ATDA 3FAXA 2O9PA 5FL0A 3WF0A 2CESA 3O2LA 3N12A 1ZU8A 2J7DA 1DEDA 5C71A 4DWSB 4P7LA 1UR4A 3AIVA 5HXMA 3THDA 2YL8A 1B9ZA 1KGUA 1IZKA 4JFSA 5BXPA 2JF6A 1CXFA 1EDTA 4W8LA 1UA7A 2G3NA 3GZAA 2OWXA 4H8UA 3VIIA 1TMQA 1DWGM 2XWDA 1PBGA 3QHMA 1EOMA 1ZBCA 4UQCA 3NDYA 1JAEA 1UD8A 1XD1A 2E8YA 1HKKA 2WBKA 5M3WA 6TAAA 2FHFA 3W0KA 3WENA 4UZUA 1BF2A 5CPTA 1R85A 3PZOA 3MUY1 2CITA 3AHZA 4JCMA 1UWRA 3TA9A 2BXZA 2J4GA 4MAZA 1BYCA 1WNOA 5F7UA 2GJPA 2VZOA 3CZGA 2WXDM 4J3UA 4W5ZA 4PUDA 1L0PA 1XCXA 1JZ2A 3BC9A 1CXIA 1J0KA 4DUXA 1UA3A 5BWFA 2XSAA 3A4XA 5I79A 1UD6A 2W62A 2CEQA 1VEMA 2DPEA 4AMCA 2XFFA 3EDFA 1Q6FA 1PX3A 1XSJA 3OGSA 4OOZA 2QF8A 1JYVA 2XYLA 3AJ7A 2BHZA 3N1AA 4D1JA 4MNKA 3BSGA 8CGTA 3CHDA 1Q6DA 2XVLA 1C8XA 4YHGA 1I1WA 1M03A 2X2YA 5JBEA 3GXDA 1U30A 3U5YA 1MW3A 3IJ7A 3AHTA 3WDRA 3ZT5A 1PIGA 2AMGA 2VUYA 4AZCB 4EKJA 4UQBA 3AYSA 2ZUTA 1MQRA 4TVUA 4L4OA 1UG6A 4J28A 4UOZA 3WL1A 4AIEA 5HBFA 3VIPA 5IXEA 1CGYA 4IPLA 2YDRA 2W92A 4J27A 2EJ1A 2J62A 3OGVA 1JDAA 1JGIA 1K6AA 4P8XA 2YDQA 5BXSA 3F5LA 1H41A 1VFMA 5LA0A 2ZX7A 1EO7A 3ZR5A 1UZ4A 4RE4A 2E0PA 1WDPA 2VC9A 4F9JA 3WQ5A 3CUJA 2WMKA 1VF8A 1Q6EA 2IXUA 1N82A 2WM0A 3GNOA 1EO5A 1HKMA 4AZBA 5I5RA 1GQIA 4HMDA 1PZ3A 4EE9A 4CCDA 3UERA 4QLLA 3CPUA 1ISZA 1C93A 1OB0A 5A6KA 1DWIM 1CGUA 2VMFA 2VVNA 5C70A 2Z1KA 3OB8A 4XB3A 1M01A 3GBDA 2CCRA 3VGDA 1VRXA 1V6YA 1F4HA 1KBKA 4PCSA 2NSXA 1EA9C 3KZSA 3VIKA 4DWSA 3TONA 1CXKA 3M7SA 1E6NA 1W1VA 3PN8A 1W3KA 4XUYA 5E09A 2YBUA 1UOKA 1G1YA 1JNDA 6CGTA 2ZOXA 4FK9A 1MYRA 2W4XA 3DYMA 2CERA 3N17A 4KGLA 2XUCA 3DHPA 1QI4A 5FD0A 5A94A 1CPUA 3AISA 3ARZA 5FOOA 1BGAA 5CLWA 3IJ8A 3SCOA 1HKJA 1UWSA 1WP6A 5A6JA 1KR0A 1UUQA 4CN1A 2VR4A 2ZIDA 3L2MA 5JIWA 1G94A 1ZJBA 2JFEX 3PTQA 1B1YA 1PAMA 5A8PA 7TAAA 1ISWA 1XH0A 3FAWA 1JL8A 5E6YA 2D2OA 1E55A 3AHVA 3OZPA 3W27A 3WNPA 1W9XA 1QNQA 5IFPA 1OM0A 1GPFA 3I3EA 5GQBA 3QOKA 2VZVA 3IAPA 1DTUA 4JKKA 1SMAA 4AZHA 2EXOA 1OIMA 2D20A 1TG7A 3WKZA 1UD2A 3W26A 3WD1A 1UR2A 1E6SM 2WANA 3UR7A 4OIFA 2JF7A 3BAXA 4PMUA 4TX6A 4U3CA 9CGTA 1PZ2A 1UD4A 4ZENA 3SURA 2EPKX 1R8LA 3VIHA 3I3BA 2VRKA 1ZBVA 5D8WA 2WZEA 3SUTA 3UETA 3VVGA 1VB9A 3VGBA 1QI0A 1CTNA 4Z2HA 2J7BA 3MMUA 1NP0A 1HJWA 5CZKA 1E1FA 8A3HA 4QP0A 3D5HA 1J0ZA 5CGTA 3TTQA 4CD5A 4CGTA 2GDVA 2QV4A 2BVTA 2GSJA 3IK2A 1DWAM 4AD4A 1C3FA 5A95A 1FP9A 4MNLA 1WB0A 4AZCA 5CLTA 3MMDA 3WNLA 2CKSA 3WL0A 1QHZA 3WUEA 4KH2A 1TVNA 4PTVA 2O9TA 3RPMA 2X0HA 4GZIA 1HJSA 4CU6A 1MW2A 2G3MA 2W5FA 2XIIA 2PWFA 3AI0A 3MO4A 4J7RA 3DYPA 1G0CA 3K8LA 1V3IA 2PB1A 1CXHA 1OGBA 2J7CA 5DEZA 1E0VA 3K46A 2VOTA 1GW1A 1EHNA 2NT0A 3FNDA 1FH7A 3CUFA 3AFBA 1C92A 3NCOA 3DHUA 4CVWA 5AYIA 1B3ZA 3T2PA 1Z32X 4ZXLA 2ZX9A 4IUGA 2ZUSA 5HNNA 1S46A 1VENA 3AYRA 2DT1A 4RE2A 2X0YA 3ARXA 3AZTA 5LA2A 4AD3A 4R5EA 5ECUA 3GH4A 1OT2A 4JAWA 2WHJA 1E6ZA 5FIPA 3WH5A 5ABEA 3VM7A 3B9AA 5LYRA 4M1RA 1BFNA 1W3LA 5D9MA 3VU2A 1GOQA 2JEPA 2DQXA 5GNYA 2BS9A 1HNYA 1QNSA 2VZUA 3BAIA 4UQDA 3ARWA 4GQRA 1E6RA 4LPCA 5FL1A 2E4TA 4W87A 1BTCA 4N42A 2WHKA 3TTYA 1OGGA 1ZJAA 3AMGA 2WHLA 2WMIB 2W91A 3AZRA 3AS3A 3AMDA 4PTMA 2YL9A 1JZ6A 4FF5A 4PMQA 2E8ZA 4CD6A 4GO9A 7CGTA 3AIEA 4PEEA 4JL1A 4MJ4A 3EDDA 1IT0A 1HT6A 3N9KA 3II1A 1C7TA 1VEOA 3IANA 1E4IA 4GI6A 3ALGA 1XHGA 1WKYA 4CCEA 3OLIA 2O92A 5A6BD 4MAVA 4GI8A 2BVYA 1CGWA 3UESA 4E8DA 1BLIA 1TFVA 3HN3A 2ZX5A 3EMQA 3M6DA 1HJXA 1KCKA 4PUEA 3KL5A 1HP4A 3T0AA 3VD4A 4HPHA 2XVKA 1W9UA 3VD9A 2ZXQA 2A3BA 1JG9A 1DP0A 3MV11 2VX6A 4M82A 1LG2A 4AZGA 2C0HA 1JF5A 3W37A 2HISA
chains in the Genus database with same CATH superfamily
1GQLA 1A5AA 3M07A 3GM8A 1NIUA 4C6CA 3VGHA 3QYQA 3KW3A 2HSAA 4LAOA 5JU6A 2DT2A 4H8VA 4UOQA 4DAIA 3W9ZA 3F5JA 1E51A 1FWHC 2Z25A 3KBNA 4KWVA 2XJ7A 1W9BM 1THFD 2NUYA 4AZIA 1XIJA 2VDGA 3DFSA 5E0FA 1PHWA 3T4CA 1SUXA 3UWYA 1SSDA 3ISIX 1BG9A 2V3GA 3VNJA 1CWYA 2FVMA 4S3DA 2CLFA 3BG9A 4DVOA 2NQZA 3D6NA 3ZWSA 5C54A 4GQGA 5K2ZA 5CSRA 5D2WA 4I90A 3CZ8A 4HPXA 1JULA 4H6KA 3VUPA 1O5KA 1TA3B 5A2BA 4C6FA 1IF2A 4UIOA 4RZ6A 1K3UA 3VCNA 1OG0A 4H7ZA 2OLHA 2ZXBA 4JTIA 1I0BA 1UP2A 3W1UA 3BLKA 2C1IA 2D1ZA 2FZ9A 1I1XA 5IM51 1K6WA 3F03K 5FF2A 2G95A 5FA5A 1HX0A 1O94A 3E3HA 4P7NA 2CYGA 3MSGA 4DI8A 1GZGA 4W8BA 4MVAA 3WNKA 4LX4A 3VKBA 4WJEA 1VAHA 2Z7KA 3GTNA 5FEPA 1J10A 5KZMA 2DSZA 2WVUA 4WDUA 4FS9A 3F4VA 2GOKA 2X7WA 3UJRA 2E9BA 1B0IA 3WELA 4F4RA 3OQ8A 3GNRA 4GVFA 3MY9A 3V4BA 1I2QA 3LERA 2XIOA 4EWJA 2Y5EA 2EG8A 2PRLA 1K7XA 3T09A 1GJWA 2WW5A 4HKPA 3PZTA 2O4QA 3HQNA 4BQ3A 1P6CA 1W1ZA 1XBXA 3GWQA 3P74A 4XBJA 3GE7A 4PCTA 5L9FA 1G9HA 2QS8A 1WOAA 3QV6A 1BVWA 4ZGYA 3GVWA 3QW4B 2WCAA 3LGGA 3AZSA 1I8JA 1H62A 1X39A 4EP8C 1CECA 5FEZA 1QMLA 1J9YA 4HNNA 3LHWA 3M0JA 3PB0A 1RK6A 1V0MA 3CMGA 2OT1A 1FWRA 5CXPA 1E9YB 1EUNA 1G7UA 4FLQA 4PUJA 4Z2JA 1TPEA 4PTNA 4AW7A 1SJAA 2VD8A 1G4EA 3GH7A 2FYMA 1AQ0A 4O14A 3KDOA 5F4WA 1HJQA 3P5YA 5REQB 3GHRA 4EANA 1TWDA 1VHCA 5FSEC 5K9DA 2R14A 2J77A 1GT8A 5C5YA 1XDJA 3O6AA 3CIVA 1YPXA 3G1YA 3MSYA 3RYSA 3P82A 1H7WA 3JUGA 4L6HA 2QMKA 5HMEA 4OBSA 1E0WA 2E9LA 1YNQA 2XZ9A 4W86A 3M4HA 1QPRA 4Q6XA 3SBFA 3V75A 3S2LA 1CLXA 2ODOA 4DF1A 3L4UA 5DMYA 1B3XA 1J0YA 1TV5A 3EWZA 3W7CA 4P61A 1GG1A 1E73M 4LW7A 3ZSSA 4HQVA 2DY3A 1G01A 4PA8A 4O11A 2PWGA 3MANA 5D37A 2JGQA 5G2HA 2Y7EA 4Z08A 3TC6A 3WK3A 3LZ3A 1QFEA 3GFZA 4X61A 5HMDA 3NJ3A 2ISVA 2YKKA 4I7UA 1WUEA 2XVNA 1OT1A 4R9XA 5J5DA 1HN1A 2PEVA 1PKLA 2PE4A 4W5UA 2GFTA 1T6MA 3LQGA 3RMJA 4GUIA 1Q6LA 2YLLA 3GVVA 4OJYA 4DZAA 3IJLA 4FOJA 3CL7A 1LQAA 2XDFA 3H2NA 5AYBA 3H7RA 3WZ0E 3ONBA 4NVTA 2CXEA 2OU4A 3VXGA 1TR9A 4D6IA 3GUWA 3C56A 4M7SA 4DELA 4UNIA 2VC7A 2J7EA 3SSZA 3ZSTA 1XIIA 3H6OA 2OWCA 1YTEA 3VNZA 1E4NA 4X22A 2HVOA 3G22A 1JIBA 5TAOA 4LUJA 1I2PA 2VJXA 3U4AA 4KEZA 1BSIA 3FYYA 1J0IA 1M6JA 4Q4SA 3S8HA 4G9PA 4MFEA 1EC7A 3N14A 1HKIA 1LYXA 4HIBA 2RUSA 1GQJA 3FA3A 5M17A 3WDHA 2RGMA 4LVFA 1AJ2A 1DJQA 4XBKA 2WKLA 4U5KA 1VYRA 3IJQA 1AH3A 2ASHA 2POTA 2X1TA 1H09A 4H4IA 3G8RA 2J24A 4H2HA 2OQYA 2OLSA 2WSKA 1H60A 4V27A 3C6CA 3AIBA 2DW6A 3H4XA 1QRQA 4X9SA 3V0TA 4O12A 3BLDA 4OBTA 1BRLB 2WNNA 4Y8EA 3H2CA 1E5NA 3S2CA 3IJ6A 4URIA 3FKKA 4WZHA 3L2LA 4LAZA 4ZQOA 1M3UA 4HPNA 2ACUA 4MDOA 1E71M 1GOIA 3K8KA 1V0KA 3OZYA 1ME9A 4ZE4A 4GVIA 3QBUA 4US5A 3RM4A 1L6WA 4S3FA 3UD6A 2XGIA 1VLWA 4GINA 3VAVA 1E9LA 5DRIA 3QHNA 1OFAA 3FIGA 3W7GA 3QV9A 1X1OA 1EYWA 3MI2A 3VIFA 4QAWA 3WUBA 1B54A 3QV8A 2DSWA 3EA2A 1F7BA 2YA2A 1GOMA 1QHPA 3MV01 1WV2A 5EGRA 4JL2A 2Z2BA 4PSPA 2BXVA 3DDMA 1SFSA 4WJXA 3TN5A 2CLMA 2VGGA 1PTGA 4EF9A 3S9IA 4RPQA 1YIXA 4AD0A 3OVRA 3M0XA 4RZ5A 1RLCL 1FWWA 2YFOA 2Y8KA 4TU1A 1TSIA 1XYMA 1B30A 1DXIA 5C2XA 3LV5A 1BPLB 5ABFA 1FH9A 3C0JA 3SUVA 3KS6A 3S9ZA 4IXXA 3VD5A 1XCWA 2HRWA 4UOJA 5XIAA 5LA1A 1F76A 1BXNA 2RDWA 4L6OA 5FCZA 1E0TA 1XIGA 2OR2A 2OEJA 1UZHA 2QUMA 3ARSA 1EC9A 3LM7A 2CZDA 2BG5A 4OOUA 5HUOA 3S46A 4RW5A 5L6UA 1B57A 5HUPA 1B3WA 4JIPA 3LCFA 4ACZB 4JFWA 4N6EA 2BLEA 1JXKA 4LGXA 1AD1A 5ENLA 1TX0A 2HXTA 4F40A 1KM0A 2CZVA 5E6ZA 1YE6A 1R3YA 3CZKA 4IGHA 5I3HA 5CSSA 2RAGA 2AOSA 5KZDA 2INEA 2WSRA 1UP3A 1YDYA 4CQAA 1IIHA 1OF6A 5E70A 5H91A 1EPVA 4A8LA 3MA8A 1XLMA 1P7TA 2ZUVA 4M56A 4UCFA 4B91A 3LNPA 1VRDA 2W6RA 4HK7A 3U7VA 1V0NA 1OYCA 1KGWA 3VNLA 1L6YA 4QAIA 1TV2A 3UPMA 4DRSA 4K3ZA 1CZ1A 1A5NC 4MY8A 2UY2A 3OG2A 3N11A 3BLOA 3CV1A 3MBDA 4HOWA 3B8IA 1DJYA 2WVVB 2ZC8A 3AC0A 5F1UA 3ZVIA 3N4EA 4QJ1A 4FR1A 4KMQA 3P2VA 3KZPA 2H8ZA 4LBRA 1WX0A 3RO8A 3L12A 2OT0A 3CL6A 3COTA 4QSFA 3TA6A 1REQA 4BEUA 3L4YA 2ZUMA 3UFYA 1QNRA 1JDFA 3DN5A 2D22A 3AWOA 4FOKA 4DNMA 1QDSA 4O16A 1VD6A 2V6AA 1EOKA 3HMJG 3VOGA 1CLKA 1JRBA 3HB9A 2XN2A 2FFIA 1M5WA 4HMCA 1O1HA 2BGSA 1OIFA 4MB4A 1DE5A 4WF7A 4NNAA 1WDSA 4B3KA 4F2BA 3KHJA 3FLUA 3SN0A 3W25A 3NSMA 4D6DA 4N6FA 2Q8ZA 1A3XA 4I7WA 4PUKA 1OZQA 4MJMA 3EDJA 2EPNA 2W61A 3BG5A 3IUHA 3USZA 2FH8A 1UR9A 3SUUA 4AIUA 2UBPC 3W01A 2H9AB 3W1XA 3S2MA 5LGXA 2HJPA 3WDQA 5CZTA 5B80A 1GPWA 1UMLA 4NYYA 1YTKA 5A6SA 3A6OA 4NI3A 2VGBA 4ERAA 4R27A 3KL0A 2J88A 3PG9A 4LF2A 1R0MA 1ZLPA 5CZJA 2ZCGA 3NZRA 5HPOA 1FWSA 3KCOA 1XQLA 3IJ9A 4ZFCA 2Y70A 2I57A 3HO8A 1AZ2A 1W91A 4QE4A 3VE7A 3MYPA 2YCLB 3SQMA 4JEQA 4WLCA 4DX3A 4DF2A 2ZZ5A 1IQ8A 4YTSA 3ITTA 4IMEA 4JTSA 2VURA 3AU2A 4I5UA 4Z17A 3USBA 5IHSA 1Q2SA 4HGXA 3AXHA 2FDSA 4W85A 2VI0A 1RQBA 1ISVA 3NL2A 4AXNA 1BVZA 2GK1A 1OC6A 1SW3A 1QPQA 4MWAE 4EK7A 4ORMA 2ZXDA 1W17A 3ZVHA 3LMZA 2OG9A 2YA0A 5F4SA 4BA0A 3FW6A 3TYAA 1A3WA 2BZNA 3CAKA 1VFTA 2V68A 2FHBA 4BQ2A 3RXZA 4PEKA 5EMUA 1GQKA 4LNCA 2VWSA 4C6KA 2WJDA 4MY9A 3SRHA 4HCHA 1LUCA 2I17A 3PTDA 3FHAA 1J0HA 4E2VA 4CD4A 2FFCA 3URNA 1DKWA 4Z1CA 3LI1A 3FN9A 3N2XA 4X3ZA 5TD4A 5HANA 1FDZA 1WBJA 5A6AA 3WQDA 1O95A 1ONEA 4W7VA 2XSBA 1KNWA 4XUGA 5I7GA 4J3ZA 1FQ0A 3VIGA 3CTLA 2EPHA 4PBGA 3UZWA 1RH9A 2F84A 3BQ6A 3SJ3A 2OXNA 3HJEA 2CETA 2YFNA 2PWDA 2YL6A 4PMNA 4U3AA 1FX6A 3POHA 1EJUC 2VFDA 1KKOA 3G1SA 3WK0A 4ZSTA 2G3IA 2DGAA 1RA0A 1VQTA 2V5LA 4YTRA 3L9CA 3QGAC 2QAFA 3E6EA 3EA1A 4HU8A 4F79A 3TMLA 1JRCA 3RLHA 1HF6A 1GOKA 2ZC1A 4OQVA 1JI2A 1KXVA 3WBEA 1VCVA 3VKJA 1DJIA 3ZS4A 1U5VA 3NEVA 5CSUA 4REQB 4F0KA 3RCNA 4IICA 3BAJA 3A13A 1F2JA 4OUEA 1WDDA 1YKWA 3P3BA 3PK7A 3PAOA 4HOXA 4W88A 1TYGA 4FP1A 4N4QA 1F4AA 4XD4A 3M0YA 3T8LA 1LZOA 2PLMA 5BRBA 1MMFA 3E2VA 3CHVA 3OYXA 3WH7A 4PTXA 1TZ7A 4RZBA 4RNJA 4M29A 3ENLA 1RCOB 4DF0A 3L68A 4MWAB 1JUEA 4K68A 2QT3A 1EHAA 4W84A 3PBMA 4JNYA 1W37A 3TWAA 3MBFA 4DZHA 3B0UX 4PB3A 3TYEA 2ISFA 3TFCA 3A4AA 4IF2A 1V3JA 2Y62A 3UNTA 4B16A 2ZUWA 1W0MA 3BGAA 3PG8A 3E5PA 3F2DA 3OODA 1LQ0A 3Q65A 1IXNA 5M03A 2RJGA 3NO1A 1GORA 3A23A 3NQFA 3W1TA 2RJHA 3QMRA 1RY0A 4OKDA 1E5JA 3ZT6A 3ATZA 4QDPA 4WIWA 4O8RA 4O53A 1PPIA 1IGSA 3ZLGA 4W7WA 1TUXA 2QUUA 4N9BA 3D3AA 1KA9F 3DERA 1BKSA 3G1HA 4AZ6A 5KZEA 4U5IA 4XVEA 1HL8A 2VX7A 3ZMRA 3CB3A 4RW3A 3ZJKA 2GVYA 5IBXA 2OCZA 1V3KA 4XD6A 5CC5A 5FESA 4G8TA 3ANUA 1C91A 3UCCA 2VELA 4NJKA 3LBOA 4LJ3A 4HPJA 1O6IA 2E6AA 1B2YA 3ANVA 4P7RA 1O7AA 1QATA 3M5VA 4Y2WA 1XP3A 2XFYA 1SQ7A 1RJQA 1KM4A 3CPGA 1IHIA 4W7UA 6REQA 2EPLX 4FNTA 4JTAA 2VTFA 3BE7A 3W1NA 4MPQA 3UZJA 1DJHA 3DGRA 1ZENA 5CJMA 3N2BA 2Y6ZA 4E2OA 4GX9A 3A12A 4MWAD 1H2JA 4NILA 4H6EA 4GK8A 3QC3A 4FX6M 1JUKA 1WZLA 2AQWA 3WJZA 4DEFA 3TSBA 3OOQA 4UCGA 3LS9A 2Z29A 1L9WA 4LEFA 1UBPC 1TPB1 1LBMA 1RBOB 2WMGA 5F2MA 3IVUA 3R13A 2VFEA 3KE0A 3FCPA 3TFXA 3PAJA 3D47A 3W1PA 3AU6A 4MNJA 1UR8A 1JQVA 2C91A 1UZDA 5A3HA 2PGWA 3W7QA 3THUA 4C6DA 4HA4A 4CNTA 4LT9A 1AUSL 3N18A 3PSWA 1E0UA 2WC7A 3CT2A 4BQ5A 4L4PA 4FNRA 4JYEA 2YB4A 1QI5A 3V5CA 3QQWA 2AKZA 3LHUA 1FHLA 2F61A 4EWND 5A8QA 3ZIZA 1GVFA 3U5UA 2ATSA 2OX4A 1ZGDA 3H24A 3H2EA 5I24A 5FSDC 1SMDA 1P0EA 1C90A 1P5BA 1EJSC 3L4TA 1MXDA 4E4PA 1B4EA 4YTUA 1ISYA 1YHTA 4Z2LA 3MUXA 4UB9A 3KWSA 3GS6A 1RA5A 1MEWA 5I3IA 3IJIA 3EWWA 3W7OA 3IRSA 4JTCA 4PTDA 5XIMA 4P7QA 1IZJA 1ESWA 4BR1A 4R3UA 1UD3A 3CT7A 3PWIA 3RDKA 1BYAA 4HNUA 1JD9A 4GZJA 1OCQA 4CEUC 3SDOA 1B3YA 3AIRA 1O5RA 3C4UA 3EOSA 3U2CA 1R9ZA 3UJSA 2DIKA 4A8NA 2W66A 3ITLA 1B31A 2RGLA 4O1AA 4MSSA 3GDKA 4P8VA 3VI2A 1MDRA 4JPGA 1XR2A 3W00A 1EEXA 3M9YA 2OTDA 1LP6A 2VEPA 3W6YA 4UTIA 3W2JA 3DFOA 3NPUA 3V18A 1NU5A 4AEEA 3RIKA 3CWOX 3T2OA 4O1CA 4XG1A 2YIHA 5HPCA 3WQGA 1I75A 1SZFA 2P8BA 1JZ3A 4UR9A 2E25A 4MLJA 1DORA 2X16A 3B8SA 3G6LA 3B0XA 3NQGA 4AWEA 3ZJ8A 3O0FA 2OJPA 3WLSA 2XPKA 2DP3A 2QPUA 3CGTA 4NZ4A 4XIMA 4NRSA 1H11A 1IZCA 1TTIA 1EWDA 4K39A 3ORWA 1YRRA 3K13A 1XRVA 2DVUA 2INZA 2R94A 1FFQA 1K03A 1O5QA 1FHVA 3OBAA 4IX2A 1DIKA 4HYVA 3FAXA 2O9PA 1Z48A 2NXIA 2GWNA 4FHAA 1RUSA 3O2LA 3N12A 1ZU8A 1I9CB 3AIVA 1B9ZA 4B5NA 1PKMA 5DY2A 5H8PA 3W2KA 1CXFA 2V82A 2ZRUA 3ZR4A 2Y7FA 1EDTA 4W8LA 2V2DA 3VUSA 4KWOA 1KD0A 4NQ1A 1DWGM 3GHSA 1PIIA 3SGUA 3U2ZA 1ZBCA 4MKNA 4UQCA 3UGRA 4Q8MA 3UPBA 2QCLA 3KOXA 3LSCA 1HKKA 1DXEA 4FX7A 2PDNA 4YVVA 5DRCA 1PO9A 1HUVA 2IKGA 5CPTA 2D73A 4WY0F 3VZZA 3TN4A 2WNZA 3AO0A 4KF1A 2CITA 4IPJA 1BYCA 3GTXA 4WY0A 2UV8G 5BZAA 2VZOA 1VIZA 3WLLA 4J3UA 5I00A 2QVHA 4AX7A 3JZEA 5I79A 1UD6A 1AQFA 1VEMA 5LIUX 4AMCA 3INPA 1XSJA 2QF8A 4LUIA 1JYVA 2P53A 2Q6ZA 3AJ7A 1M7JA 3V5OA 3N1AA 3BMXA 4D1JA 4ICMA 1S38A 4KRZA 1UUMA 3CHDA 2H8XA 1Q6DA 1A53A 2X42A 3O63A 5HA7A 3M5YA 1DTNA 2HZGA 5JBEA 2DUZA 3BGGA 4LB4A 1T5AA 2YW4A 1PIGA 2ZZ1A 4AZCB 2QCNA 2ATMA 5GJNA 3AYSA 1MQRA 3L2IA 4JIHA 4IMCA 3WL1A 1VFSA 5HBFA 4NAEA 1YEYA 2WO5A 4J27A 2O0TA 2YDQA 1VFMA 5LA0A 4DBDA 1V7AA 5CBJA 2NWRA 4F0MA 1WDPA 3WQ5A 5HWNA 4Q7IA 1ZZMA 1Q6EA 3NNTA 4Y9PA 4AYGA 3OIXA 3T78A 3UERA 4DY1A 1DWIM 1CGUA 2VMFA 4H19A 1UJQA 5G2IA 1M01A 5DN1A 2IS7A 1JGMA 1F4HA 3G0UA 3KZSA 4G7FA 4PMJA 3VIKA 4DWSA 4YWIA 3GYEA 3RF9A 3S9YA 4GYFA 1W3KA 1QR7A 5AHFA 1G1YA 2ZOXA 2V5KA 4KGLA 2XUCA 5A94A 3FGCA 2X1UA 2QDHA 3CUZA 3AISA 1W8SA 3ARZA 1XI3A 2QUNA 3IJ8A 2VEFA 1UWSA 4Y9AA 4O18A 2ZIDA 3WQEA 1N55A 3CV6A 4KKXA 1NJJA 3PTQA 1W1IE 2AGKA 2GVLA 5BMWA 4LUSA 4HCDA 1QO5A 2GGGA 4KBXA 1IGWA 1ISWA 3LRLA 3GXNA 2PZNA 3S2NA 3VFLA 5E6YA 1QXLA 1OC7A 1UR3M 4DZIA 5D2VA 1OADA 4C5YA 3W27A 1OYBA 3WNPA 1W9XA 4PCNA 5IFPA 3I3EA 3UPWA 4DUOA 4JKKA 4US5D 2PLJA 1P7TB 2EXOA 1YMYA 4ZODA 4WSHA 3M0IA 1UD2A 1NF7A 3PPGA 2IMRA 4GZ7A 5BU9A 4Q8OA 3CAWA 4FIQA 4PL2A 2CZ5A 4N2YA 3DIPA 1UD4A 3VC5A 3DGBA 4HT3A 5TBOA 3F2CA 3SUTA 3LRMA 3LY0A 4Z2HA 3MMUA 3W1LA 3P84A 3R1ZA 1TWIA 1NP0A 1TMHA 1MZRA 3D5HA 5CGTA 4PGLA 2EG7A 2IKIA 4CGTA 1EP3A 8XIMA 4C6EA 3IK2A 4E4FA 3KTSA 4PUUA 1WB0A 2ISWA 5LNRA 1QJWA 2UZ9A 3B04A 5C0QA 3GFXA 4O0QA 4RX0A 3WL0A 3BV7A 1Z8AA 4UTJA 3WUEA 1SSGA 4IHCA 1VPXA 1YTDA 1B5TA 1TVNA 3FJLA 3W1AA 2ZRZA 3GDMA 3RPMA 1SZEA 3VE9A 1MNSA 2Y5SA 2G3MA 2XIIA 4FEZA 1LQ2A 2PB1A 2Z0IA 1G7VA 2CZEA 2J7CA 4IGNA 4JGDA 5DEZA 1E0VA 3SRKA 4KCVA 6ALDA 3DHFA 2ON3A 2VOTA 5T91A 1GW1A 4PULA 3DHUA 4ICNA 1H1ZA 4CVWA 4HZMA 3MQTA 2BASA 2ZX9A 2ZUSA 1XM3A 1RD5A 1KRBC 1VENA 3GTIA 5AC7A 2RHGA 3ARXA 3AZTA 1H7OA 4ASTA 4AD3A 4BF5A 5IOBA 3K1GA 4V1XA 4R7WA 4JAWA 4IH3A 1NAL1 3B05A 3I7SA 2CLOA 4JX6A 3VM7A 2FJKA 3BOXA 1ADDA 4LCQA 3QTPA 5D9MA 4QITA 2X41A 1TTJA 4KCTA 1GOQA 1K70A 2G37A 2TRSA 1JPMA 4GQRA 3UY7A 4AIBA 1X8FA 4XAGA 5C9WA 1BTCA 1OGGA 3KTXA 1S5NA 5I06A 2WHLA 2WMIB 3NZ1A 2PP0A 1NDYA 3AS3A 3DESA 1PUDA 1JZ6A 4FF5A 5BU6A 2PDJA 3V5FA 1IE7C 4CD6A 7CGTA 3AIEA 4PEEA 4JL1A 1OFRA 4G1KA 1XYLA 3II1A 2GGHA 2DZVA 2NLIA 4X2PA 4DBSA 3ALGA 4GH3A 1F73A 1IEXA 1P0NA 3RO6A 4EOUA 5A6BD 2OELA 1JPIA 4E8DA 1TFVA 4FXJA 3TYCA 3KL5A 4HPHA 1W9UA 1SW7A 2QJGA 3NYZA 4JTQA 2YR1A 4AZGA 4N4PA 2C0HA 3W37A 2HISA 3EX2A 3ABSA 2OLAA 1DE6A 2E6DA 2I1OA 3N6JA 1SR0A 3EWCA 1OGSA 3WMLA 2P8CA 3LEPA 3GVRA 3NA8A 3ARYA 3VD3A 4DJEC 2E9MA 1US0A 3T81A 1Q45A 2CLHA 2O55A 2V8ZA 2DT0A 3THAA 1LT7A 5FEXA 5E9XA 3H7UA 2A85A 4JHMA 1TV3A 2PTYA 3C5QA 3M0LA 3VMOA 2E7FA 2FH6A 1KV5A 3EB4A 1OY0A 2FB3A 3M44A 1J6PA 3ZLFA 2NT1A 3R0DA 2FHCA 1V3HA 3UWEA 3MHGA 4FO4A 1XWYA 1QUMA 3NQ7A 4M19A 3W23A 2W9MA 4O1EA 4O4WA 2WWCA 5GNZA 5J04A 3NO5A 3NQEA 3CEPA 4JTTA 4C90A 4LUYA 4OV9A 3SCSA 4IJRA 3UVAA 2O7QA 1SFLA 2IXVA 4M1BA 4JTRA 3B9EA 4OU1A 1DPMA 3LB0A 5K9XA 2WK2A 4JQ4A 2FTYA 4YN5A 3DKJA 1S1RA 4WK9A 3WBWA 4JFVA 5ABGA 5JBDA 3ANYA 2CLLA 1Q6QA 3GRIA 5HOSA 4JOMA 2ZWZA 1WDWA 2BODX 4B5VA 1ZBWA 3NQCA 3R8GA 4F3HA 3BXWA 1R2SA 4KQNA 3BSHA 4KPLA 4GRSA 2VXNA 4HN4A 1MW0A 4F0RA 3S5SA 4ICCX 3I6TA 4GFSA 4D6JA 1E4LA 4TTGA 1J18A 1UWAA 3SO7A 4O10A 4NZ3A 1YBQB 2DH3A 3SN4A 4B5SA 4L1GA 1QT1A 2ZZ4A 3MT1A 4R7OA 1XC4A 3S1XA 2VUNA 1CCWB 1DHKA 1XISA 2OSWA 5I3GA 4PBEA 2P1FA 6XIMA 2A0NA 1E6PA 3BLEA 5B7ZA 3TQKA 3BCDA 4LYRA 1Q8JA 1OX4A 3QYSA 1CLVA 3JR2A 2Z4GA 4MIMA 2XIMA 3CUIA 5EFFA 3UU0A 4QS6A 3AROA 1G67A 2VDHA 3MMTA 1PJ9A 3BMVA 1EJ7L 4KWUA 5FJRA 1HIZA 4KRUA 4RZ4A 4CQ8A 1PL9A 4CD8A 2GGJA 4IPIA 5G4EA 5E0KA 4OV4A 3UZXA 5HWJA 1GEHA 3CHFA 3TN3A 1JJKA 1SR9A 2BB0A 1V5XA 3OA3A 3PBGA 1D2KA 1NH6A 4DO5A 1EDQA 1EH9A 4UQ9A 3GX9A 4AIOA 4Y9NA 4F2UA 3FEQA 3ONCA 1TPC1 1OCNA 1FXPA 1V02E 5I3FA 1FCBA 3GU9A 4S23A 2FZMA 2VEKA 5GNXA 1W5MA 1KFKA 1Y5WA 3DFHA 3APTA 3AXXA 1JUBA 5E93A 3WEMA 1C9WA 2ZZ2A 3TK7A 2X7VA 2X30A 4Q6JA 1H7NA 1R7AA 6REQB 4UFKA 4I9AA 4UTTA 4NY2A 4AD5A 3VNKA 4QJ4B 2VX5A 3TYUA 5BXTA 3O9NA 1AH0A 4ADTA 3CAQA 3TSMA 3SEPA 2DH2A 3VO0A 4WR3A 2PDUA 3HGSA 3HA1A 2Y5JA 3BW4A 5EY5A 3CZEA 3I7RA 1EBHA 1BSLA 2NQLA 1EIXA 2ISDA 4NIRA 4DPQA 3WD3A 1WE5A 4TVDA 1F74A 4FMVA 3AIWA 2GGIA 3BZGA 1WKFA 4LYKA 1JCLA 1XBVA 3R79A 4H00A 1H5VA 4J3SA 1TQJA 1XUUA 1ZL1A 2NXGA 3CPRA 1XIBA 3T4WA 1J79A 1EIBA 4N9EA 1XV8A 2Z2UA 3G0XA 3CJPA 3NYDA 5JIPA 1CDGA 4IOTA 3WMBA 3P67A 2OWWA 4NZFA 2P5NA 1TV8A 3VOIA 4IIEA 5DX7A 3UA4A 4IQEA 1QAPA 1W2VA 2QDEA 5EKYA 4UNLA 1E1EA 4V2XA 3QMSA 2GOUA 1SJDA 4XTDA 3R7MA 1KO0A 2NXHA 4GYPA 4ZE5A 4MYAA 1XLGA 2RDTA 2INFA 3ABXA 3VX0A 4ZEPA 3H23A 1S5MA 4RKAA 1FWFC 5JUVA 2QNEA 3NQMA 1TPWA 3MCNA 2WZIA 1TV4A 4YMZA 4JTDA 4BZYA 1VFHA 2WLYA 3MJYA 1FHUA 5HULA 3QPYA 2OZ8A 3WNNA 5REQA 3P61A 3WH8A 1ITUA 5HR7A 1Q4WA 5HQMA 4CU8A 4AFYA 1CT5A 2OVLA 1C8VA 5HMFA 1CGTA 1UZ1A 3LXBA 3CQIA 1Z44A 4UXDA 4WKAA 1ZAIA 1BKHA 4Q7BA 1RSCA 1P0DA 5CBIA 1BVNP 1R3TA 5D9OA 1GCYA 1A5OC 3M0VA 4ZMGA 1VYPX 4PRWA 3WUFA 4ZO7A 3FJ4A 5EMKA 1XCFA 2DW7A 4HB7A 2PF0A 3AIUA 2V38A 3R0UA 1VP5A 5U4NA 3VGEA 4YVPA 1CI1A 1G5AA 1QBAA 1VBUA 1VBRA 3E0LA 2YB1A 5D02A 4Q4QA 1W9PA 1SO4A 1TTPA 3KCJA 4IX0A 3QQ1A 1MSSA 4LVGA 5AYXA 3THQA 3LI0A 4NYUA 4ATWA 4E38A 2X1RA 1V8EA 1UROA 3HV8A 3PZIA 2WKGA 2PODA 1BAGA 5FJPA 3H8AA 1KXHA 1XGEA 3QGKC 3EXSA 1NEYA 3DH7A 3W1RA 5I77A 1NTHA 3MDUA 4A3UA 1V3LA 3UXLA 4UTHA 1PSCA 1AODA 1KTCA 4KRTA 1DQWA 1K02A 2JGYA 2QLYA 3A4WA 4RJEA 1R87A 3VDCA 2ZWYA 1CXEA 3FFSA 4CQCA 4D8AA 1HKVA 2QGYA 1EJWC 5B7YA 4TIMA 1UHVA 1KWKA 1A47A 1QPKA 3N2CA 3BAYA 5FJIA 3W74A 3G0SA 5LNVA 4Z42C 1YDVA 1XH2A 3CLMA 4JY9A 3NVDA 1E56A 4AHPA 4HZ6A 1PDZA 2DT3A 4FXSA 2F2HA 4YYFA 3DFPA 4MGGA 4Z1BA 3AHYA 1W1B1 2X1IA 3R43A 2J6VA 5LSMA 5LNSA 2V3DA 3K8MA 1V93A 1ITQA 1XLBA 1ZY9A 5CQ1A 4UWMA 4ROQA 1NFBA 4RDWA 5E9AA 3W7KA 1HVQA 1BRLA 2VCBA 2V5BA 3VOFA 1W3IA 2Y4SA 1Q7MA 4LQ1A 4NX0A 1LF1A 4P8UA 1KV8A 4DM1A 1XRFA 5AHMA 3KUMA 4AX6A 4HU0A 1MWOA 2EF9A 1FY6A 3W3OA 4HTYA 2ABAA 3VOCA 4BK9A 4UQAA 2PC4A 3IARA 5D8ZA 4DNHA 3H70A 1NOFA 5BXRA 3ZJ6A 2VFGA 1EZ2A 4LYQA 2QPSA 1OD0A 1RP8A 2QJMA 1TO3A 4C7FA 1X97A 3SQLA 3SY5A 2ZICA 2Z24A 3CUGA 4S3GA 5AY7A 3B0VC 1NFGA 3HG5A 4JDYA 4H8HA 1RPKA 1XDLA 4KIEA 4Z1DA 3PP7A 1ADOA 1GK8A 2Z1SA 4PSRA 3BDKA 4RCXA 4AF0B 3V0SA 4TX8A 4K1GA 3HBLA 3TC3A 3MHUA 2BHUA 1PHQA 2B0MA 8TIMA 3QY8A 1UKQA 3MI3A 1J5SA 3L21A 2KZHA 3W7IA 2ZBTA 3HGJA 1O60A 2WOQA 3NXFA 3F2BA 4JYDA 4XKYB 2VT0A 3ITYA 2CXGA 2XSXA 5I6SA 3E2QA 4XTIA 3TCEA 3WK1A 1H7XA 3HQPA 2XH7A 3H54A 4AZ5A 1IYXA 3WQCA 1XIMA 5KEZA 1XGZA 2GQAA 2WZHA 2VGIA 3T2QA 2AQVA 3SCWA 1S2WA 2WSYA 4AISA 3ZOAA 2VRJA 4KT2A 1MXSA 1W5QA 1YADA 1F3XA 1UYQA 3CYVA 3VGFA 2FZDA 1XLLA 2BX7A 2CKRA 3RX4A 3GDRA 5FJJA 4YWSA 4MNMA 4ORIA 3TQVA 1A0CA 1EBGA 1KB3A 1JCJA 4B5XA 4ACZA 2UY4A 4CNSA 3P80A 2QUVA 2C0AA 3R8RA 1GEQA 1ICSA 4DWDA 1Z41A 3UR8A 2ZTJA 3H12A 2G96A 2A2IA 3MO7A 2PGFA 3TAKA 3CNYA 2J9ZA 2J9XA 4TOQA 1EXBA 2WMFA 1S2CA 3WQPA 4TX9A 4A3QA 5AHNA 4WGHA 4A29A 4QDMA 4XZBA 1P6BA 1DBTA 5I0DA 3V0UA 1HGYA 3SI9A 4ADUA 4NZJA 3N3TA 1RHCA 3B9OA 4FLRA 3S6TA 2E28A 2PWEA 4EIVA 3DBPA 4EAMA 4MG4A 1ZB5A 4NAFB 1QTWA 4YXGA 3RLVA 1A5LC 1NP2A 4AWTA 3R8HA 4ZO6A 3BSMA 3QY7A 1XSKA 1H0GA 3GC5A 4DBUA 2WVVA 4ZTXA 3E0WA 4C7DA 1XYFA 3B4YA 3HQ1A 4HA3A 1PXGA 2VRQA 4GNVA 2GVJA 2PDFA 4IG2B 4Q8PA 4Q32A 1BEUA 2TAAA 3GDTA 2WLZA 5LHFA 3OA5A 3W2MA 4INFA 2D0HA 2DEPA 3OVQA 4DJDC 1HFBA 1UMYA 2V3FA 4DXKA 5DCDA 5E0CA 2QJJA 3EYPA 4D8LA 3GG1A 4YCOA 1L8NA 4J3WA 1MW1A 7A3HA 4HHPA 4LV9A 1LJYA 3ITOA 4U31A 2FGLA 4XD3A 1VFFA 4QLKA 2DQWA 2O9OA 3LLDA 1JZ8A 3A9IA 1EEPA 4EX4A 4JCLA 4HD5A 3RHGA 1C8YA 2WVTA 3WFZA 2EG6A 1LL7A 2GDQA 4DWSD 5I02A 1D8CA 1VBJA 4IMFA 5JQ9A 1K8YA 1KBLA 1R9YA 2QF7A 4BWLC 1W2PA 1WO2A 4J4KA 3S3GA 5D9NA 1D3CA 3QFWA 3EWXA 1LWJA 2H9AA 1E15A 3FY1A 3IVTA 4NJHA 4GGHA 1Q6OA 4XD5A 1GTEA 3PZGA 4XZ9A 3NQVA 3VIOA 5RUBA 3KBWA 3SRFA 4GPNA 4J3VA 3GBEA 3MJMA 4ZOAA 1L6FA 1K1DA 1XD0A 1EF3A 4PE8A 4ZOBA 3A4JA 4ZFMA 2NLYA 2PLCA 4GY0A 2VL4A 3EWUA 1W3TA 5FEWA 1NOUA 1UH4A 4GABA 3TOPA 4B3LA 2PFHA 4LRTA 2CHRA 1HTIA 1QI2A 3ZM8A 3W81A 4XZWA 4JDBA 1EGVA 3E2SA 1DHPA 1U5HA 3NEHA 1YQ2A 3S1WA 2ZTKA 3B8VA 4JTUA 4A8RA 3PPFA 5T8GA 2YYTA 3A22A 5MKGB 1OYAA 3UCQA 2VYOA 1OHLA 1XSIA 1W9DM 2XH2A 1VH7A 3RITA 3KBSA 1UKSA 4TMBA 5MF5A 3K1DA 1XPYA 5XINA 2TSYA 4QROA 6A3HA 1XUZA 4L6DA 1NY1A 4L65A 3RN6A 4L9XA 1Y7VA 1TX2A 4JIEA 5LIXX 4H9UA 3SCTA 2A3CA 1BYBA 4OVXA 2VDIA 3U7BA 1XKJA 4CCCA 2O56A 5AOUA 3RJXA 4R53A 3V7PA 1WAWA 5A6TC 1L2QA 3REQB 3VKAA 3HFYA 1MZHA 4H7VA 1GVOA 2ABBA 4A35A 1NWTA 5HWMA 1GG0A 3BLPX 4PN2A 5HINA 3CMFA 4K1WA 2G8ZA 3BWWA 3WBAA 4B15A 4C6LA 2IW0A 2V30A 3GXIA 3LYEA 3EOEA 4RNIA 3A5VA 3K2GA 4B4FA 3N73A 1YXCA 2FTPA 2A3EA 3GC2A 4EPEC 4JTEA 1HO4A 3VGGA 1XG3A 4LCSA 4DHGA 1GW9A 1TWSA 1YNPA 2R82A 3F5KA 4J3XA 2PGRA 3CM4A 1KXQA 3TDFA 4BF7A 3E0FA 4LWWA 3CHCA 2PDMA 1LLWA 1QASA 3CC1A 2HTMA 3RPTA 5AZ0A 4MB5A 5H6HA 1RZMA 4KESA 4JTFA 1DJGA 3E0VA 2BMBA 2PSNA 4MPKA 1DVJA 4LB3A 1P48A 1F8MA 4IP7A 4HNOA 3HOJA 2G5WA 2D0FA 3DFTA 3VDHA 4HZ7A 1LORA 2J6XA 1P1MA 1FWNA 2WNQA 3WQFA 3IUIA 3RX2A 3W53A 1U2YA 2GJRA 1GONA 3KHDA 3WLOA 2FZBA 4AMAA 4ZO9A 3WY1A 1UWUA 3PANA 3QEZA 4JTGA 1UUOA 2B7PA 1EGZA 3IPWA 1KC7A 1TELA 1U83A 3LNMA 3FSUA 3P60A 4NG3A 1JPDX 4LYPA 3DI1A 2HS6A 4REQA 1JZ4A 2XIQA 4QCEA 3QN3A 1CEOA 1B90A 3GK0A 1D7FA 1WBHA 2E6FA 1R6WA 2SFPA 5HATA 2Y63A 2NUWA 1S2TA 3EOLA 3M43A 4QE5A 5D32A 2XIBA 4O15A 1DJNA 3VM5A 4C6PA 2VKZG 3E74A 3DKLA 3PFMA 5C8BB 3WBYA 1QW9A 3L4VA 4J2MA 1XBYA 1AQHA 3MZ2A 3NGFA 5AHLA 2RH9A 3IVSA 2F38A 5K3VA 1O12A 1QPOA 4Z0JA 1UKOA 2HVMA 2HMCA 2EPMX 2PDLA 2WJZA 4QRNA 1A5UA 5F1VA 1VCFA 4ERGA 5AVHA 3PWGA 4GJJA 1B3OA 3PZVA 1PX4A 4QG8A 2YCJA 3BAKA 2QPXA 3CU2A 4U2ZA 5CJ5A 4U4MA 2FKPA 2FMNA 2J27A 3LX9A 1GNXA 1XL9A 1Z6KA 2QCDA 1SFTA 3W2NA 2XIJA 2ZA2A 1VBHA 1S2AA 3GXPA 2BOGX 4CU7A 3N2OA 1Z42A 2OEKA 1ADSA 4L61A 1W1PA 2GVEA 4O0KA 3HPAA 3PJTA 4A3HA 3S1VA 3K5XA 2VQUA 3OLDA 4ZOCA 1ECEA 2V5JA 1OF8A 1LRQA 3O16A 4FR6A 3TNBA 2D3LA 4Q8UA 3WF3A 1TTQA 2QCHA 3G1VA 5AC8A 1WCGA 3D0CA 1T40A 3B9NA 2HNEA 4O1DA 5DXXA 3L4XA 1KBIA 3HG2A 2WC3A 1WZMA 2HXUA 4L56A 2BNJA 4GUJA 3JU2A 4WKHA 2HPMA 1AW2A 4G2DA 2ZXAA 4GZEA 1ZCCA 5G1MA 4Z1YA 1GVSA 1H5YA 4Y9MA 1J01A 5G1TA 4ZQCA 2QV5A 3AUOA 2HROA 3ECQA 5M2FX 2V9DA 2CHNA 3E02A 3SUWA 3KEHA 1NDVA 2PMQA 2HK0A 2LLEA 2DVXA 3ARRA 2E77A 3R10A 3FA5A 4D1IA 4ATDA 2NSOA 2WPBA 5FL0A 3SGGA 3WF0A 1ZJIA 1EX5A 4F0SA 1UR4A 3W72A 5HXMA 4NL1A 3THDA 2YL8A 4GCXA 2O4MA 3H26A 5AN7A 3AXMA 1UA7A 1UJPA 3W73A 1YXDA 3GAKA 1G4SA 2OWXA 4H8UA 4QJ5B 1AZ1A 1IXPA 1OK6A 2XWDA 1PBGA 3QHMA 4GBUA 5KINA 2B81A 3NDYA 2Y85A 4IMAA 4XIAA 3RGTA 2E8YA 1OFDA 1EKOA 2REQB 2FHFA 3GU2A 1Q5MA 3G3DA 3LHTA 4UZUA 1BF2A 1LBLA 3SIZA 2A7RA 3V16A 5D09A 3PZOA 7REQB 4O8AA 3MUY1 5FJTA 3AHZA 3QVQA 4IWWA 1UWRA 3EX1A 2BXZA 4AVNA 1SPQA 4S1FA 2PDGA 1WNOA 3FEMA 1I2OA 4TV5A 5F7UA 4GACA 1N8FA 4C6JA 1W56A 4W5ZA 3OBEA 5G4WA 1YYAA 1XCXA 2DORA 1CXIA 2WJFA 4JQ1A 1I4NA 4YCPA 4M3PA 2NV9A 5C9XA 3WG6A 1K4GA 2XFFA 2PDXA 2VR2A 1A5KC 2BHZA 3M1ZA 1T8QA 4UNKA 1G69A 1XDMA 2XVLA 3DFNA 2MUCA 1M03A 2X2YA 4GBDA 1U30A 3U5YA 2JQXA 3UWUA 4EXBA 4GIYA 4GOAA 4E6MA 3T0TA 3IJ7A 3UXIA 1QOQA 5C9ZA 4GNJA 3EWDA 4EKJA 1S2UA 1SVDA 4V15A 3A5FA 1UG6A 2YDRA 3A3XA 4U10A 1YW1A 2W92A 4W4QA 1K4HA 2EJ1A 3OGVA 2BP1A 3F5LA 3GR8A 4YYCA 1A4LA 3BLIA 2ZX7A 3ZR5A 4GYKA 1UZ4A 3SSJA 2E0PA 3QFEA 1JCYA 3CUJA 5CEWA 2W3ZA 2Z6JA 1PKYA 4GVGA 3ATYA 1EO5A 3DFQA 1HKMA 4AZBA 1KFBA 2A5HA 4EE9A 1ZP4A 4G5DA 1ISZA 4BEQA 1OB0A 2OODA 3RAOA 4K38A 3TW6A 4I6VA 4A22A 3VGDA 1V6YA 4JNMA 3N2MA 1EA9C 3M7SA 2POZA 3QC0A 1RJRA 1E6NA 3BG3A 1LWIA 2PLKA 2FVKA 3OVPA 1JNDA 6CGTA 3RG6A 7ENLA 3DYMA 2YBVA 3PF3A 1RAKA 5LHEA 3GNDA 5FD0A 2PS2A 2YSWA 3LLXA 7ODCA 2DZBA 3O06A 1LDCA 4FSAA 3BOFA 3KCLA 3PJWA 3PBVA 2E1DA 1WP6A 4DI9A 1VYSX 2PD5A 2VR4A 4ADSA 4B5WA 4P2VA 3HGOA 1R3QA 4XZNX 2BOEX 3MZNA 4IGMA 1PAMA 4O4VA 4XZLX 1MNZA 3SAZA 5A8PA 3B0PA 1XH0A 4JTKA 3FAWA 4XBSA 4ZCWA 3S6OA 3KBVA 1F3WA 3NZPA 3KBMA 4S2BA 1M68A 1FTXA 4V33A 3BK0A 3IAPA 3PJUA 4EACA 1SMAA 3QF0A 4NHVA 1OIMA 1EWEA 2GL5A 2OX1A 1UR2A 2WZTA 4C6QA 4JS3A 4KS0A 3LHZA 3LOTA 2JF7A 3BAXA 4U3CA 2C6QA 9CGTA 1UP0A 4V1YA 3QRHA 2EPKX 1D3HA 1R8LA 3VIHA 3BURA 3T9PA 3UETA 3VVGA 1QK2A 1UW9A 4ILSA 2ZDRA 1CTNA 4RPPA 1HJWA 1E1FA 4UTWC 4QP0A 1J0ZA 2MNRA 4ZA0A 2ZKMX 4JTJA 1IEVA 1UIPA 4DYEA 3TLLA 2R6OA 4NXKA 2HBXA 2GDVA 2GSJA 4AD4A 1OFPA 1S5VA 1FP9A 4MKVA 3FYPA 4AZCA 2I7GA 1Q3NA 3MMDA 3WNLA 2CKSA 4GCAA 3G77A 3GW3A 4XK2A 3AALA 1GYMA 4JTHA 3B0YA 1NF0A 4UTLA 2PDBA 2W5FA 3AI0A 5CG7A 3XIMA 1TPFA 4J7RA 3DYPA 1R9XA 4OTKA 3RRXA 1EF2A 3AFBA 4JY8A 3KP1A 4NUWA 1RQEA 2C14A 4IUGA 2AMXA 3RCMA 5JXQA 4RE2A 4Q8NA 1C9DA 2CC0A 1EP2A 2OOGA 5AYYA 1RY8A 5IDZA 4PBFA 3TVAA 1KKRA 3DI0A 3T8QA 4RDZA 1ZSXA 4ML9A 3AXKA 1F05A 1E6ZA 2EAWA 3GNNA 4NJIA 5ABEA 3DCPA 2RKXA 3B9AA 5LYRA 1BTMA 5BNKA 2ADAA 2DQXA 4QJ3B 5GNYA 2BS9A 1HNYA 1QNSA 2QULA 2VZUA 1D9EA 4LPCA 1Z3NA 3NPXA 4TQTA 3W07A 2E4TA 4N42A 2WHKA 3TTYA 3AMGA 3KAOA 2DVTA 3I4KA 1TWZA 5H8UA 3UCDA 4PFHA 1DQXA 2F9RA 4JQAA 3EZ4A 4KW2A 1IWAA 3R11A 4MJ4A 1IT0A 3ZFHA 1HT6A 3N9KA 4RNFA 5D2YA 3MPGA 5C55A 1W1A1 3M0KA 2W79A 5H2ZA 4CCEA 3OLIA 3MP3A 2O92A 4MAVA 1XYCA 1CGWA 3TX9A 4IL2A 2GQ9A 4WDWA 1ZALA 3T44A 3EMQA 2GUUA 5H1WA 1R30A 2DFAA 3UW6A 1W54A 4ZQMA 1KCZA 2GSHA 4MYXA 1RR2A 3T0AA 3FS2A 1Z69A 3VD9A 2ZXQA 2A3BA 4QISA 1JG9A 1DP0A 4GQ0A 3O6CA 5PTDA 1LG2A 4GY7A 1JF5A 3V35A 2WMHA 3UG4A 2DSVA 3NZGA 3ITGA 3TTOA 4YL2A 3M7WA 2E5DA 3MUAA 2NX9A 3GVGA 4DJFC 2PGEA 5DFAA 1RD6A 1ODUA 4NNCA 1UR1A 3BARA 5A6BA 2ZADA 4G7EA 3GKFA 3IIVA 3Q58A 2J66A 4HNCA 3LBCA 1XW8A 3Q67A 4PMDA 3TW9A 2B7OA 4M8UA 3G1XA 3EKZA 3CS2A 2L5HA 3S42A 2WNWA 2PPGA 4ZB0A 3TQPA 1ZAJA 1XC6A 3KOYA 2JIEA 1WAUA 1YDOA 3SADA 2NZLA 1I2RA 1XLJA 1FDJA 2TODA 4PR4A 4NKCA 3NDZA 1L2UA 4D6GA 4EPKA 1HO1A 1M53A 3L66A 1MQQA 4IPPA 3W7HA 3W86A 2BHYA 4PFMA 4W89A 2PA6A 5C9UA 2HK1A 1ZUAX 2YCKX 1TWWA 1ZTVA 2X8RA 3W28A 3F4CA 1E3XA 3LHYA 2EPOA 1W32A 4IGSA 2Q02A 1VFOA 3QV7A 4ZB2A 3VKKA 1C7SA 1WQ5A 3PPCA 5DMMA 3O3RA 1EQCA 3GU1A 2G4FA 3GZ3A 1PYFA 5I23A 1TIWA 4WSJA 3PZQA 3DFYA 5JBFA 2FTWA 3MW7A 3CB8A 5CSYA 1S5WA 3K4DA 1S5TA 2I16A 1X1ZA 3KP0A 4JKLA 5HAOA 4R9OA 4D6HA 1UKTA 3NQ6A 3Q2DA 1EX1A 2DIJA 3UEQA 3PPHA 2QYGA 1DWHM 3IUDA 2WMIA 2RDUA 2G0WA 1T7LA 4O1BA 3EXTA 3T55A 2R24A 3OLGA 4V28A 5CBBA 4KERA 1BD0A 5EMMA 2VNCA 2XTKA 2X0SA 2QR6A 3OU8A 5CPOA 2P88A 2FVLA 2J8GA 4XZHA 3HU7A 1QPNA 1PS9A 1ZHAA 1FCVA 1R86A 2V5DA 1J4EA 1FWAC 4D9PA 1SYTA 5AC5A 4MLRA 2XH4A 1C8QA 4D71A 1QI3A 4I6KA 2GQ8A 4IUOA 4HNVA 4E0CA 4UFJA 4XZMX 1GYNA 4UTMA 2JEQA 1JDCA 2P3EA 2Z28A 2E68A 3GQYA 4C6NA 5M1TA 1IV8A 4E5TA 3AJXA 1TV7A 3VIJA 4OE7A 3FKRA 4OFCA 4AEOA 1R2TA 2EHHA 1CXLA 4HHMA 4O52A 3W76A 1GZ1A 5CAHA 4XV0A 3GKAA 3KX6A 3M6YA 1KQYA 1FA2A 3TJXA 3C2RA 1TR1A 4CD7A 1VHNA 3UG8A 5A5WA 4QNWA 1UWIA 4GIAA 4MHBA 2W67A 2QAPA 1E9ZB 2CWXA 1Q6CA 3TIMA 5F2IA 3I6EA 3ID7A 4FLOA 3PC0A 5TNVA 1LTDA 4CNPA 4YPJA 4I5XA 1KCXA 4BCEA 3Q4DA 2A3HA 1NWSA 4DPPA 4UBPC 4PCPA 1DL3A 3G1FA 4L4LA 4IP4A 4ENLA 5M5DA 2C71A 3W29A 1K7FA 3GDBA 4UZSA 1FDYA 1QHOA 1FRBA 3V3WA 3WN6A 1KQZA 1VEPA 3AUJA 1IR2A 4YNGA 4I8YA 1V51A 1AD4A 1W5NA 1LLZA 3PFRA 3EAUA 4LANA 3ZR6A 1DJWA 1HJUA 1PCWA 1HP5A 5CPMA 3O07A 2ZE3A 2F7FA 3TTSA 2XG9A 1FKXA 1WKEA 2CBIA 1QO2A 3T6CA 3DHDA 1K9EA 1J96A 1KFCA 4ZVJA 3MP4A 3W83A 4Q4PA 4F66A 3RX3A 1YBQA 3ALFA 5TIMA 1YPIA 4AY1A 1JNEA 3EMCA 4G1NA 5IDIA 4NP7A 1PVNA 3VZYA 3S2JA 3BL3A 3HIJA 3SIMA 4C60A 4PMYA 1SO5A 3C2VA 1A0EA 3B03A 3GO2A 5JH2A 1JI1A 1OFQA 2NQHA 5I2UA 4GI4A 3MCOA 4I8DA 3PZNA 3R4IA 1PKNA 1DIDA 5LNUA 2A7NA 2XN1A 3M64A 2DZWA 1SO3A 3JRKA 3CWNA 4CKQA 3G2GA 2QCDB 2AQOA 3UWZA 3W88A 2E3ZA 2DUAA 4UR7A 3G1RA 3CXOA 4L9ZA 3IAQA 3QR1A 5K7JA 4LNYA 2BXYA 4QNEA 1WOBA 5C7VA 3WF1A 2GDUA 4Y9OA 1ICQA 3WDPP 3OHIA 4HNTA 1QOPA 2XH0A 4NJJA 2V63A 3SCRA 5DY3A 3SM0A 3FVDA 3SCVA 3BTNA 4LH8A 4H2CA 1Y5VA 4HP5A 3B4UA 2XM2A 3HJZA 3URQA 1R3VA 1LROA 4OZOA 3MUCA 3QSRA 1EFZA 3T7VA 4JN7A 1P4CA 5KTLA 2J78A 3GXTA 2NV1A 3ICJA 4LV4A 2V81A 4HTBA 4KFPA 5F2GA 3TYDA 3EKLA 2G41A 1MI3A 4YVXA 1JDDA 3TU9A 4FAMA 5AHIA 1A5CA 4XAPA 2QW5A 1YNYA 1LL6A 1J93A 4PZVA 3GY1A 3PBYA 2X09A 4WKFA 1UD5A 3BQ5A 2VC6A 3LK6A 3WD4A 1M7OA 5HDRA 3L0GA 3SN1A 2VWTA 3A3HA 2YBTA 3AICA 3N4AA 4RV8A 2FZ8A 3TWBA 5HQLA 1MFUA 3JS3A 2ICSA 4GQBA 3NPWA 3R6IA 1LLOA 3LCLA 4JHZA 5FF3A 3KVKA 3LHVA 4HOZA 3VNMA 2PDWA 1V6TA 3BCFA 3W82A 4RUBA 3SJNA 4DB7A 4C1NB 3HQOA 3OEXA 1Q6GA 3IIOA 5FAGA 2YXXA 4JZ5A 2BVDA 2J7FA 2VC5A 4BI6A 2EO7A 1EQPA 5T26A 4CLMA 2OSXA 4O54A 1X7FA 5F4XA 2QMJA 2ZX8A 4GX8A 4PMXA 1XYBA 4LVAA 2OZ0A 4I9TA 2YA1A 3EMZA 1FWIC 1KR1A 1GHRA 2BY3A 1M1BA 4FX8A 3RK8A 5I3DA 2OKTA 4LEQA 3WMSA 2QQ6A 3VNIA 5FACA 3TYBA 1FKWA 3AIQA 2C8NA 4TTUA 4HN8A 5A8NA 3WDIA 2VCAA 4H41A 1AFSA 1WZAA 1PIFA 3SRDA 1EDGA 2IKHA 3OPSA 1Q4NX 2XGBA 3O0KA 4O28A 2BGQA 4Q3MA 3B8WA 3UG5A 3W6MA 2ZX6A 2H6RA 1I60A 3GB6A 4HSOA 3WD0A 4GXMA 4ACYA 4JICA 4X60A 1TVLA 5DT5A 4NT0A 4E3TA 3BUVA 1FCUA 1KM5A 1GOOA 2XFWA 4C6BA 2OYLA 1V02A 3M41A 1MUWA 1UH3A 1QOXA 4B9ZA 3PR2A 1PEZA 3SCQA 3P6LA 3SY1A 3IV3A 2BFGA 4XAYA 3W87A 2WHMA 2A79A 3GLCA 2DU2A 3MDWA 1F6KA 1Q13A 4N9CA 1LWHA 5HJXA 4MF4A 2ZE0A 4DYJA 1GHSA 2XVPA 2XU2A 3N34A 2I5GA 4QG6A 2QDDA 2HBVA 1NSJA 2VM8A 1WDRA 3ZT7A 3OVGA 3TC7A 1B9BA 3HF3A 3H55A 4MJZA 4WSKA 4N0RA 2PTXA 1KBBA 4KEMA 2VHLA 1BWKA 4RXFA 3N04A 2J74A 2Q09A 4AHQA 3GFYA 3S1GA 5EBAA 2IPFA 1NELA 4LC8A 3LU2A 5DQPA 1F3TA 2OYMA 3SQSA 5DCBA 1EB3A 5KETA 1E1CB 1VJSA 2DV0A 3S5ZA 5DLCA 5I78A 1LM1A 4H04A 3STPA 4AWUA 5BW6A 5C6MA 2ZVIA 5DELA 5EMLA 5A69A 5KSWA 3C52A 1TZZA 1XLHA 4A8IA 5FF7A 1KRAC 3UXAA 4WDXA 4ZZ9A 1I0DA 1CW2A 4JX5A 3VDBA 1A50A 3W7NA 3KLKA 1VCGA 1NARA 3SW6A 3BPWA 3F4WA 3CH9A 3WQWA 2NX3A 2WQPA 7PTDA 2V0TA 2EEXA 4LY4A 3N9SA 2NV2A 5G1YA 4A2SA 1FWJC 1BXCA 1R46A 1US2A 1XGDA 1F07A 1FVPA 3FHQA 4IPNB 2ALDA 2Z6IA 4KCWA 3LPPA 3MP5A 1XBZA 1ZRQA 2ZZ3A 2BVWA 3P5ZA 4K2SA 1H49A 1VC4A 1VJZA 4S3KA 5F2LA 1YXYA 1G4TA 4KIRA 4AC7C 2OFJA 2ZA3A 2VO5A 1T41A 3AQUA 4HSHA 4DXVA 1CBGA 1ZQ5A 3UA3A 1U33A 3SECA 2GJXA 2GJLA 3GVQA 3I7QA 3U9IA 1W9VA 5BCAA 1E9IA 1V4YA 1H0IA 2HPIA 1J11A 1HG3A 3C0SA 2GQ3A 3NTYA 3GXFA 3NFUA 2W63A 2BV9A 3GAYA 4H01A 1OD8A 4IISA 4MJ2A 4FB7A 3EWYA 2VD9A 1M7XA 2KX9A 4EXAA 3PZ9A 4AF0A 2WC4A 3LCGA 3QM3A 4DO6A 2Q3RA 3WH9A 3IWPA 1MXGA 2FGZA 3E96A 3LLFA 3VMNA 3UZZA 3C2YA 1B3VA 4B5TA 3THCA 3XINA 3ARTA 3M47A 4CUCA 3EOUA 5BYWA 4Q7NA 5FF4A 5D04C 2UY5A 3U2EA 1Z89A 1IEWA 4XKYA 1XYZA 1F5ZA 1BWLA 3DC0A 3ES8A 2NQ5A 4GNKB 3MSRA 3DC8A 1TVPA 3VDAA 4JBRA 4S3BA 4KEVA 4EXQA 3MUZ1 4ONVA 2CPUA 2VEMA 3MKKA 2UWFA 2P0IA 5BRPA 2DZSA 4WXYA 1KTNA 4FLSA 2R8WA 2B31A 3G8EA 3KM8A 1BG4A 1KWGA 1PZ1A 3DEQA 3WUGA 2OEMA 2YYUA 1H4PA 4K8HA 3R5EA 4C5ZA 2A21A 3PBUA 1RBLA 3DYOA 2PU0A 5CGMA 2EBNA 3EKGA 3WFLA 2Z27A 5LIYX 4XSMA 2FB2A 4MB3A 4L1WA 3GH5A 3EGJA 1XLFA 3TR9A 4W93A 4AC1X 1XLCA 3LDVA 3OLEA 4XX6A 5EFDA 3C3NA 4NXSA 1QNPA 2WV8A 4R33A 2GUBA 3N25A 1OBAA 4WOQA 4O50A 3KVLA 3KL3A 2YXGA 5HQEA 3CMJA 5ABTA 1I6NA 3O15A 4D6EA 2DIEA 1LOSA 5AKQA 2VZTA 2DZXA 4NAFA 4AVOA 4CQBA 3HFTA 1UIOA 3RILA 3IEBA 1QW8A 1M65A 4XAFA 3E12A 1JYNA 3CZLA 2PAJA 3VDGA 3LPOA 1LOLA 3B8DA 3NQAA 4QFUA 3TEVA 3C2FA 3CUHA 1FOBA 1JCTA 1E4MM 4IG2A 4CNOA 1T8XA 1PYMA 3SCPA 3WYZA 1BQGA 3H22A 4F9DA 5E1QA 3OO2A 3E0IA 4ZXOA 1POJA 2PBOA 4LUTA 1E3ZA 3BJTA 3VFCA 1V6WA 2VCCA 3MU7A 1B4KA 5DCEA 1UWTA 3P0WA 4G7EB 3U2OA 3GDLA 2D3NA 2D0GA 2PRMA 2CZFA 1KFLA 1BHGA 1NM9A 2YZ5A 3ZXWA 2FPTA 1PTDA 2PTZA 2P10A 4S3AA 1XLAA