2EA9A

Crystal structure of a hypothetical protein jw2626 from e.coli
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAVYPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yfjZ
publication title Crystal structure of a hypothetical protein JW2626 from E.coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ea9A01
4LRYC 2PR5A 3MXQA 1DP8A 2H28A 2GJ3A 3IS2A 4K08A 1NWZA 4L9FA 3LI8A 1S66L 3UB6A 4HJ6A 4R38A 4EEUA 2L1MA 4YWZA 1G28A 4WL9A 2V9AA 4DJ2A 1F98A 4EW7A 1N9NA 2PHYA 2JN7A 4I39A 4LRXC 4I3JA 4I38A 3E4PA 3UB9A 5J3WA 2L4RA 2VV6A 1DRMA 4WLAA 2M1CA 3LIFA 3MJQA 3F1OA 2Z6CA 4HIAA 2R78A 4DJ3A 3FC7A 4I3IA 1JNUA 2WKRA 1XJ3A 2ZBBA 1DP6A 4B9OA 2A24B 4WN5A 1MZUA 3LI9A 4WF0A 5IS1A 4JGRA 1XJ4A 4M4XA 4EETB 3K3CA 1D06A 3MR0A 2PDRA 2KX6A 5KIZA 3D72A 2JHEA 1BYWA 4R70A 4LRZE 1WA9A 3ICYA 1XJ2A 3PHYA 3OLOA 2D02A 3F1NA 1OT9A 5G4YA 3UB7A 4NXEA 2YKHA 3NOTC 3SW1A 5G4ZA 1S4RA 4BBVA 1Y28A 3E4QA 2W27A 4L9GA 3NJAA 4BBTA 3F1OB 3NOPC 1UGUA 4R6LA 2A24A 1ODVA 4HJ4A 1S1YA 1S67L 3NHQA 5A8BA 5TBMA 2WKPA 1T1CA 2KDKA 3UE6A 3CWFA 1V9YA 3UMDA 4E04A 3E4OA 5J7EA 3MFXA 2B02A 3T50A 1OTDA 2PR6A 4HH3A 1N9OA 1F9IA 5F69A 1TS7A 2PYRA 3UMEA 5EFWA 5HSQA 3FG8A 4I3AA 2I9VA 1D7EA 5F68A 3F1NB 4EERA 4H6JB 3EEHA 4GCZA 3HJIA 5F6AA 2YKFA 2ZOIA 4HY8A 3ULFA 4HHDA 4BBUA 1OJ5A 3LIEA 4GS9A 4KQDA 5IU1A 3CLOA 3G6OA 5HZHA 3H9WA 5DKKA 5HDDA 3UB8A 4HH2A 2OOLA 1GSWA 3GECA 4PKYG 5TBMB 4R3AA 5HWWA 3EWKA 3VOLA 3BWLA 1OJGA 3C8CA 5J4EA 4LPZA 2P7JA 2ZOHA 4I5SA 1UWPX 3IBRA 4NXBA 4NXGA 2OWJA 4RQ9A 1OT6A 2HV1A 5F5YA 4H6JA 1S1ZA 4KUKA 1TS6A 2L0WA 3MQQA 1T1AA 2QJ5A 4XT2A 3VE3A 3LIBA 2D01A 4HI4A 5HD5A 2CMNA 5I5LA 2PD8A 1LL8A 3C2WA 5HDCA 2EA9A 2PD7A 1P0ZA 3LICA 2W0NA 3P7NA 1OTEA 3HJKA 5AVEA 4HP9A 4F3LA 4GS9B 3RH8B 3LIDA 3RTYA 1KOUA 1XFNA 1XFQA 2V1BA 3LUQA 1OTBA 4JGQA 2OWHA 4MN6A 1GSXA 1T1BA 4HOIA 3MQOA 3A0VA 2K7SA 3VE4A 1UWNX 4GW9A 3PYPA 3H82B 4L9EA 1TS0A 3LIAA 2V1AA 4GHIB 3LYXA 2QKPA 2VV7A 1S4SA 1GSVA 5HWTA 3A0RA 3K3DA 4XT2B 4JGOA 1LSWA 1LSVA 3F1PA 1P97A 2QWSA 1X0OA 1T18A 5HWVA 2INWA 3ZQ5A 5AVFA 4MN5A 3B33A 1DP9A 2PYPA 2QHKA 3H7WA 4HJ3A 4EESA 4F3LB 2BASA 4EXOA 1T19A 3GDIA 2V0WA 2Z6DA 1TS8A 1LT0A 2J80A 2QJ7A 3H82A 4JGPA 1N9LA 3A0SA 5DJUA 4GHIA 4NXFA 4KUOA 5DJTA 4WUJA 2V0UA 3IS2B 1VB6A 1OTIA 3BY8A 2VLGA 4HQAA 5DKLA 4PKYA 4EEPA 1V9ZA 1LSXA 4HP4A 3BY9A 1OTAA 3F1PB 2WKQA 2VEAA 3KX0X 4EQ1A 4LLOB 3NOUC 5HDSA 2VV8A 5HD3A 3H7WB 4HNBA 1XJ6A 1EW0A 3CAXA
chains in the Genus database with same CATH superfamily
4OPZA 4ZBEA 4WEJA 4JLFA 3UB5P 4HESA 1Q2QA 1DP8A 3A3DA 3WRTA 2Y2LA 2GJ3A 1YAXA 2R9WA 4K08A 3V3SA 4MDZA 1K6RA 2FZ0A 3CJMA 5CERA 3GMWA 4BD1A 1PW8A 4HJ6A 1BLPA 1BZAA 3Q81A 2I72A 2IWDA 4R38A 2IWCA 4Y3IA 4Z1WA 1PFLA 3BECA 2V9AA 3LEZA 4DJ2A 1N9NA 4P6BA 3LY4A 2WGVA 4CLCB 2J3TD 2JN7A 2W1TA 4BLMA 4I38A 4QY5A 5J3WA 3V5MA 2H0TA 2VV6A 2M1CA 4OQ0A 4PHTA 2VKSA 2EWWA 3QNBA 4MEZA 1JNUA 4KG6A 4P6ZM 5FAQA 1EROA 3CG5A 5CRFA 2M7VA 3CPTA 4Q0JA 4EETB 5L10A 4X25A 5FQJA 3VOYA 2XSSA 5EM0A 5GHYA 1N9BA 1OPXA 2GX5A 1WA9A 3L7HA 4LV2A 3IHAA 4K0XA 1PWDA 3VP2A 1FQGA 1ACFA 3GR2A 1BSGA 3PHYA 4UA9A 3OLOA 3IF5A 1JWZA 5AJGA 2A3UA 2B95A 3UB7A 4DN0A 4OPQA 3MZFA 1YMSA 2XFTA 3QNCA 3SW1A 1VHMA 1LI9A 3BFDA 2VGKA 3UDFA 1Y28A 3HLEA 3IX8A 5EVIA 2W27A 1MBLA 3BFFA 5HW3A 4WYYA 4MBHA 2A49A 4WZ4A 1LHYA 3W8KA 1WE4A 2B5RA 2WZZA 3KSFA 1E4DA 4NETA 1YLWA 2WKPA 2HDQA 2C6WB 3CUEC 1T1CA 1V9YA 2OLUA 2KOIA 4FD8A 3CPTB 1MXOA 5TR7A 5A92A 4AFIA 3MFXA 1FCNA 4JF6A 1SKFA 2B02A 1OTDA 2PBYA 2ZMAA 2PR6A 3BFEA 4HH3A 2AVXA 2PYRA 4DDYA 2VGJA 4K91A 3FG8A 4I3AA 1YQSA 3S1YA 4EERA 2FFYA 3LY3A 4OP8A 4QY6A 2ZMVA 3HL9A 2ZQAA 4IUKA 5F6AA 4EBPA 3EGDC 5EECA 4HY8A 1K6SA 5EVIB 3TG9A 4OOLA 1OJ5A 4Q8IA 1K54A 5E2FA 3G6OA 3G2YA 2HGVA 1Y4OA 5IHVA 3KSHA 1SKOA 5EVID 3D9YA 1JTGA 3G31A 1FILA 1P9WA 3BFCA 3VOLA 3IWIA 3BWLA 4MMNA 3NY4A 2UV0E 1K55C 3W4OA 4DE3A 4Z9QA 3I7JA 2HV1A 3WS1A 3G35A 1H8YA 4OP5A 4FTXA 4FOFA 3BLMA 4H6JA 2H0YA 2QJ5A 4WEKA 3W4QA 5BOHA 3M6BA 2CMNA 3ITAA 4ID4A 4ZAMA 1P0ZA 4WBGA 4IHQA 3NDGA 3BJNA 2Y2IA 3HREA 3A3IA 4EUZA 1G5UA 3D4FA 1A0KA 1O7EA 3PAEA 3UPOA 3LIDA 1NXYA 2HDSA 1SKOB 2XFSA 1NLZA 4X1LA 3Q1FA 4YNRA 1OTBA 4BL3A 4ESPA 4ARZA 5M18A 3PBQA 1ESIA 4HOIA 1IYSA 3MQOA 5EVIC 2R9XA 4GW9A 3PYPA 3H82B 3ZHHA 2V1AA 1WYBA 5U47A 1W79A 2JKRI 2ZQ9A 5L07A 2EFUA 2Y4AA 1ZHHB 3A0RA 4CPKA 1HD8A 2EXAA 1LSWA 4OLGA 1LSVA 3F1PA 2QWSA 1ERMA 5HWVA 2INWA 2Y2PA 3ZQ5A 1YKDA 1DP9A 2QHKA 3T4QA 4E3IA 2JKGA 1W7FA 4ZJ1A 3MMHA 3MQ0A 5CX7A 4ETXA 3ZGAB 1ONGA 1F5MA 1EI5A 4UQIS 5A93A 4OVDA 5E43A 4EXOA 4RA7A 2GZAA 1GA0A 2V0WA 5KSHA 5M19A 4GLQA 1K56D 1TS8A 3DTMA 4R0QA 3P09A 4WELA 2Y2JA 4JGPA 4GKUA 3GV9A 4A5RA 4DXBA 2XLNA 4O7DA 1RP5A 1TF1A 1VM1A 2WGIA 5HPFA 1K54C 2V0UA 4ZJ3A 3LR3A 5HAQA 4HQAA 3U2AA 3E98A 4PKYA 4EEPA 5I94A 1XA1A 1LSXA 3BY9A 1OTAA 3F1PB 3DAVA 1G68A 1H8ZA 3KX0X 3UPPA 3V3RA 2PT7A 4IEDA 4Q0IA 1GA9A 4G3KA 3VFFA 4CLCE 5HDSA 2VV8A 5HD3A 4HNBA 3R7WB 1Z6FA 3LR0A 1NYMA 3V50A 4OQGA 1PNEA 4YFMA 4KZ8A 3HCYA 3T4TA 1YPRA 2V2FF 3DTKA 1EW0A 1N4OA 4Y7PA 4DMZA 3UDIA 2JKTM 2EX2A 4LRYC 3C7UA 2PR5A 3VOZA 3MXQA 4N1HA 1XA7A 4KQQA 2H28A 4KZBA 1IKIA 2XR0A 1BLHA 2J9OA 1NWZA 4JF5A 3BRMA 4EU0A 4M3KA 3N8RA 2J3WA 4JXVA 4OPRA 1ES5A 1KGGA 5GLAA 4G3VA 4EQIA 3IXDA 1BLSA 1RCJA 4OLDA 3WS2A 4WL9A 4RYEA 4EW7A 1TVFA 2HP6A 5DVAA 2ZC3B 4LCMA 5AQBA 5CGXA 4PPRA 2L4RA 4WLAA 2VGLS 3RFBA 3MJQA 3IWQA 1K38A 2Z6CA 5KMWA 2ZQCA 4HIAA 2Y8HA 4DJ3A 1MWRA 3FC7A 3RJUA 4Y2FA 4II7A 2WKRA 1XJ3A 2ZBBA 1DP6A 3C5AA 2WADA 1ZKJA 2EX9A 1PW1A 5IS1A 3NULA 1VEUA 3T1QB 2EX6A 4M4XA 4MLLA 3AGDA 1D06A 3OPRA 4LGWA 3MXSA 2PDRA 3VP1A 2PU4A 4E6XA 4LRZE 3JYIA 3NECA 2O9AA 2Z2LB 4OQIA 1K25A 3S7PA 4ZJ2A 3CUEA 2D02A 3F1NA 1W63Q 3MSHA 5JYPA 1ZC2A 4GD6A 4NXEA 2YKHA 5G4ZA 2KLIA 1NYYA 5FI6A 2NUTC 2CC1A 3IH9A 3KO6A 2W3HA 3C4OA 3W4PA 1NZOA 3NJAA 4WZ5C 2XA7S 4KZ7A 2ZLYA 1F2KA 4R4SA 3IQAA 1XP4A 2E8IA 2XH9A 4R6LA 3OPLA 5CHJA 4HJ4A 5A8BA 1KE4A 4X68A 3N8SA 5EOOA 4MN7A 1J3WA 3C7VA 3UE6A 1SDNA 3UMDA 4E04A 1VEUB 2O9CA 2QPNA 1I2SA 4RX2A 5CTNA 1RGZA 1JTDA 1LI0A 3HUOA 1BULA 1CEFA 5FEGA 2OV5A 1IFQA 4CQHA 2O0YA 3IH8A 1D7EA 2ZM8A 3N7WA 5HL1A 1L3LA 3F1NB 3HBRA 3EQVA 5AQ9A 1TDLA 3RXWA 1XXMA 4S2JA 3ZCZA 1K55A 5FI7A 3ZNYA 3NIAA 4UA7A 2ZOIA 5A91A 4BBUA 3VSLA 3JVVA 3IF6C 2MJ6A 3O5YA 1Z09A 4KQDA 5IU1A 2BG1A 3GRJA 2W3EA 3BQ8A 5DKKA 3UB8A 2OOLA 1GSWA 2Q9NA 4KZ9A 4PMAA 5EOEA 5DF7A 1OJGA 2EX8A 1PI4A 1DJCA 5FQQA 1GCEA 3O86A 2ZOHA 1YM1A 3A3JA 4C3QA 2BTFP 1CQAA 4N1XA 1MY8A 3IWOA 2OWJA 2QZ6A 4GZBA 3U4LP 2C5WB 1GHIA 3DW0A 4EV4A 1S1ZA 4KUKA 1ALQA 3CHWP 3TJZC 4O01A 2D01A 3W2ZA 1IOUA 3BFGA 2XD1A 3UE3A 1LL8A 5HDCA 5L2FA 1YLYA 1ONHA 4RX3A 3Q07A 5CEDA 5FDSA 2Y2QA 3P7NA 4MBFA 1CK3A 3FZCA 2J3TC 2FH5A 5D3OA 2DMWA 4X1MA 2DRWA 3RH8B 1LL9A 3V67A 3FKVA 2Y2OA 3BQAA 3E2LA 5DF9A 3LUQA 3UDXA 1MKIA 2W1RA 4MN6A 4EWFA 1GSXA 1T1BA 3NCKA 5CGWA 5CEBA 1UWNX 2WKHA 1I2WA 4L9EA 3QP2A 3G2ZA 4FH4A 4EBLA 1VETA 1JWPA 2QKPA 2Y79A 1YSQA 1S4SA 2XROA 2XEPA 5FI2A 4QHCA 5HWTA 3S7QA 4X53A 4KZ6A 1FR6A 5CHMA 4JGOA 2W3GA 4ZDXA 3BLSA 3VP3A 1W8YA 4S2IA 4MN5A 4H8RA 5TFQA 3C38A 1PIOA 1FSWA 4JXWA 4JKTA 3HLDA 2HP9A 2K31A 4MNRA 3DBAA 3PBRA 4KENB 3T1SA 4MBKA 2V1ZA 2JKFA 2J80A 4DE2A 2W3DA 3H82A 3CMZA 4S2PA 4B93A 1N9LA 3A0SA 4DE0A 4NXFA 3SS3A 4EUVA 2Y2MA 4OOMA 4WMCD 2JCHA 4BMWA 1H8MA 3N8LA 5FATA 3IS2B 1VETB 3ZG5A 3BYDA 4X6TA 2VLGA 4NG2A 3T1RA 4E3OA 4OQHA 5DKLA 2WZXA 3MS6A 1V9ZA 2EWVA 3SS5A 3T12B 1MKMA 2VEAA 1K56A 5E2HA 4ZTKA 4DRTA 4IUHA 4X56A 2ZQDA 3QHYA 2QYBA 4N9LA 4OH0A 4E3JA 5AQAA 3IX3A 2Y2HA 4Q0HA 1YLTA 3IX4A 4KQOA 5G18A 5FASA 3TSGA 4YINA 2G7UA 1O07A 2OSUA 1XKZA 4Y17A 4NK3A 4L9FA 3S7NA 3WS4A 3FPVA 1Y54A 3LI8A 1S66L 4R3JA 3G32A 1CI8A 1NY0A 1BT5A 1SDEA 3MKEA 4EEUA 1G28A 2ZC4B 1C3BA 5DTKA 3PR6A 1VQQA 3OOVA 5GHXA 2XF3A 1F98A 5DFYA 4PM5A 1QMEA 3TOIA 3C4PA 4LRXC 3R7WA 1PZPA 2WGWA 3BW6A 3UE1A 3UB9A 5FQKA 3DTEA 4B4XA 1S6RA 1D1JA 2XDMA 4OONA 1BTLA 1W8QA 1KGEA 3T4LA 4I3IA 3ZVTA 1YLJA 2OAQ1 1SHVA 3OBFA 3DTIA 2A24B 4WN5A 5FQ9A 3LEQA 1L0GA 1MZUA 3LI9A 4WF0A 5TJJA 3WS0A 1KVLA 4WZ5A 5L09A 4Y15A 3HLBA 3BEBA 3MR0A 5KIZA 4GDBA 3HUNA 3FWLA 4IVKA 3R4KA 2Y59A 3MZDA 1XJ2A 2PAVP 5MC7A 1BUEA 3VV4A 1OT9A 5G4YA 2WUQA 3V39A 1DY6A 2DCFA 3NOTC 4IVIA 1TDGA 1MC0A 2OLVA 3L9KA 2WGWB 1SCWA 3Q7ZA 3EGXC 1MWSA 4L9GA 3FPWA 4BBTA 5FL3A 4E3LA 5DFXA 1UGUA 4RVAA 1ODVA 1S67L 2JE5A 3PTEA 3JVUA 3UNWA 5F83A 2E8JA 4GN2A 1H3QA 4N9KA 3UPNA 2KDKA 3CWFA 3FYZA 4S2NC 3KSIA 4UHUA 3UY6A 3E4OA 5J7EA 1CI9A 1PZOA 3ZG0A 3IF6A 3LGOA 4S2KA 1U60A 3P98A 2RL3A 2J9PA 2HF6A 5FAOA 1N9OA 1F9IA 5F69A 1ES3A 5HSQA 4B4ZA 3TW8A 1S0WA 4QPRA 3S4XA 3GSGA 4GCZA 2HPBA 2VJWA 4HBTA 3M2JA 3IXGA 2YKFA 1WYCA 3ZVWA 3ULFA 3LIEA 3TRCA 3MBZA 1JVJA 5HZHA 2VA0A 1XGIA 5HDDA 1L0EA 4OPYA 3GECA 4PKYG 3WS5A 5HWWA 3IXBA 3EWKA 3C8CA 5GLDA 1YMXA 4GNUA 5J4EA 2ZC6B 4LV3A 2P7JA 1UWPX 3IF6B 3T4OA 1GHPA 1HVBA 5F82A 4RQ9A 2HJEA 1OT6A 4LFUA 2PBDP 2P9VA 3B3XA 4BL2A 4HI4A 3Q7VA 5HD5A 5I5LA 3ZFZA 1I5QA 2EA9A 3EOIA 4G3WA 3LICA 2W0NA 3HJKA 1IYQA 4HP9A 4L0LA 1NLYA 3A3EA 3GTCA 5L8MA 2X71A 1E3UD 1NJ4A 2VZWA 1HLUP 3RTYA 3DWKA 1XFNA 1XFQA 2V1BA 1KGFA 2PU2A 1K4FA 5CECA 4JGQA 1XGJA 2OWHA 3UN7A 4BQMA 4OKPA 4DF6A 2K7SA 2M7UA 5K5BA 2P74A 2X01A 1TS0A 3LIAA 4XXRA 3HLFA 5EVLA 2J7VA 4D60A 1TD5A 4GHIB 3LYXA 3VSKA 5CXWA 3SOIA 5KSCA 2WK0A 5FQIA 1IYOA 1GSVA 2P9VB 3T4SA 3VP0A 1P9RA 3Q7VB 1PYYA 5CGSA 3OCLA 1X0OA 1T18A 3KYQA 4Y5FA 2HP5A 4S2OA 3B33A 2Q0OA 2NUPC 4R1GA 4NKPA 3VFHA 4EESA 1FR1A 2Y91A 3M2KA 4C75A 3SH8A 1K57A 3OPHA 2XRNA 4KZ5A 2ZL1B 2JBFA 3HLCA 1E25A 2BASA 4CLCD 1MWTA 4GOGA 1T19A 5KZHA 2Z6DA 1STZA 1ES2A 4C6YA 2JKRM 1NZUA 1Q2PA 4KUOA 3E2KA 4P0MA 2XGNA 5DJTA 2JKTI 3PBNA 4UQIM 4WUJA 2ZMFA 1ESUA 1VB6A 2ZC5B 1YLPA 1OMEA 2HDUA 1PRQA 2Y55A 3CITA 4LENA 2VX8A 2O99A 2V20A 4GJ4A 3K2NA 4HP4A 1L2SA 4S2MA 5EPHA 2WKQA 5CTMA 4EQ1A 3ISGA 3OC2A 5DTTA 5E2GA 4XUXA 4LLOB 4R4RA 3IBJA 4QJGA 3NOUC 3Q82A 5AQ7A 1RGYA 2W1TB 1CF0A 5A90A 4D2OA 2HDRA 2WAFA 4WMCA 3B47A 4E3MA 3O3VA 3CAXA 4JPMA 3T4KA 5TGFA 1ERQA 1NRJA 2Z2MB 4BENA 1FSYA 5EE8A 4CLCC 4E3NA 2P08A 3IS2A 3NI9A 3BM6A 2IWBA 5HFOA 2WYXA 3KYZA 2Q9MA 3UB6A 3SH7A 2P04A 1AXBA 1PWGA 2K2NA 4NEED 5GHZA 2L1MA 4YWZA 4LCLA 1SZVA 5HPIA 1W5DA 2PHYA 3OCNA 2EXBA 4I39A 4R23A 4I3JA 3QP1A 1PWCA 3VP4A 3MKFA 3E4PA 2ZJ9A 1DRMA 3LIFA 3VMAA 3F1OA 4X69A 1ZG4A 2R78A 3IHBA 4KZAA 2GNXA 2XD5A 5GL9A 5EM1A 2LB5A 3NC8A 2JC7A 1IYPA 4B9OA 4DDSA 1IKGA 2DNSA 4BD0A 4FH2A 4FSFA 4JGRA 1XJ4A 5FA7A 2VGLM 3ZDJA 3T4JA 5E2EA 3K3CA 2HJ9C 2KX6A 1L0FA 4QD4A 4QB8A 3QP6A 3D72A 2X02A 2JHEA 1BYWA 1K57C 2VK3A 3OPPA 3LO7A 4R70A 4UA6A 5HARA 3ICYA 4O0PA 3ZYTA 3HLWA 3PAGA 4S2NA 3LCEA 3AGFA 2W3FA 3NDEA 4E3KA 3MFDA 1S4RA 3C30A 4Y0OA 4BBVA 2PRFA 4KQRA 1DJAA 1TEMA 3E4QA 2GDNA 3DWZA 3F1OB 2ZC7A 3NOPC 5GLCA 2A24A 2V8FA 1S1YA 4PM9A 1EWZA 3RXXA 3NHQA 3LR5A 2RCXA 1IEMA 4PM6A 2ZQ7A 5TBMA 4OOYA 2HZ5A 3D3OA 1KE0A 3SZTA 2XA7M 4UEYA 3OZHA 3MXRA 2LB9A 1XX2A 5EV0A 4LV1A 3T50A 2FFFB 1HTZA 3UO9A 2G2WA 3N4IA 1TS7A 1L0DA 3HLGA 2Y2GA 4P85A 3UMEA 5EFWA 4K0WA 2I9VA 4ETZA 2BLSA 4P6ZS 2ZM0A 1AWIA 4DKIA 4WM9A 5F68A 1M40A 4H6JB 3EEHA 1GHMA 3IT9A 3HJIA 4O8GA 1YT4A 3PBTA 3LR4A 3A3FA 4HHDA 4GS9A 3CLOA 1ZTUA 3H9WA 1FIKA 3PXPA 4F94A 4HH2A 1ES4A 5LBRA 4JXGA 5JYOA 1IELA 3S7OA 5TBMB 4R3AA 5HAIA 2O9BA 4QU3A 1CJFA 4LPZA 1JWVA 3WWXA 3AGEA 4FUWA 4I5SA 3IBRA 4NXBA 4NXGA 1FOFA 5HX9A 3CZDA 3B42A 4ARZB 4ME4A 5F5YA 3JPUA 5EVEA 4UAAA 1KVMA 4Y0TA 2ZQ8A 1G6OA 5DF8A 1TS6A 1YLZA 1HZOA 2L0WA 3FKWA 3MQQA 1T1AA 4XT2A 3VE3A 3LIBA 4ZRRA 2PD8A 2H10A 3C2WA 2PD7A 1K0KA 2ZM2A 4IBRA 2IA2A 3M6HA 1NRFA 5C5KA 3UE0A 1OTEA 2V8CA 1XPBA 1J9MA 5AVEA 4KZ3A 4PAUA 3WRZA 1KDSA 4F3LA 4GS9B 5FDHA 5GLBA 3ZG9B 4GD8A 1KOUA 1LL5A 1MWUA 4DE1A 5HAPA 2G2UA 1W63M 2UWXA 2EFXA 4JF4A 5IT5A 3MF0A 4XUZA 4DXCA 2ACGA 5EUAA 3A0VA 3ZG8B 3VE4A 3ZG7B 4N92A 2WKIA 1KDWA 3O87A 4FCFA 1KE3A 2XQZA 4EBNA 2VV7A 1FCMA 5J8XA 4Y13A 4KG2A 2ZD8A 3LFVA 3SH9A 3K3DA 2QMIA 4XT2B 3E0YA 5M1AA 1P97A 5FEFA 1E3UA 4X55A 1H0MA 2B18A 3GQZA 3N6IA 5F1GA 4U3TA 4IBXA 4MCWA 3P01A 1BLCA 5AVFA 4LV0A 2PYPA 4KG5A 3SS4A 3GVBA 3H7WA 4HJ3A 4IJGA 3TE8A 2J8YA 3MZEA 5F1FA 3G4PA 3NBLA 3IXHA 4BJPA 5CHUA 1ZG6A 4HEFA 3HUMA 2OAP1 4F3LB 4GB7A 2Y2KA 2A2LA 4HBUA 3FV7A 3PBSA 2Y2NA 3HVFA 3GDIA 4BWIA 4PM7A 3G34A 3S22A 1FCOA 3EEAA 3T1XA 4PM8A 1LT0A 2QJ7A 5DTSA 4S2LA 5DJUA 3EQUA 4GHIA 3O88A 4B88A 4CJNA 3G30A 1DJBA 4KZ4A 4U0XA 2WKEA 5FAPA 1QMFA 1OTIA 1G6AA 2XK1A 4JXSA 2WAEA 3BY8A 1PI5A 5FQMA 3QP8A 4GDNA 4JBFA 4E6WA 1LLBA 4YOFA 3ZNTA 4R3BA 3QP5A 3CI6A 1YSPA 3QP4A 4CLCA 4QWOA 4U0TA 3ITBA 1CEGA 1K4EA 1MPLA 4P87A 2ZL1A 4Y0UA 2H5SA 3PBOA 1M6KA 1H5XA 3H7WB 5FSRA 3KSGA 1XJ6A 3KYEA 5HL6A
chains in the Genus database with same CATH topology
4Q0HA 4WEJA 4LRYC 1NRJA 4KQOA 2PR5A 3MXQA 2G7UA 1DP8A 2H28A 4CLCC 2GJ3A 2P08A 3IS2A 1YAXA 4K08A 1NWZA 4L9FA 4MDZA 2FZ0A 3S7NA 3KYZA 3FPVA 4EU0A 3LI8A 1S66L 3UB6A 4HJ6A 2P04A 2J3WA 2K2NA 4NEED 4R38A 4EEUA 2L1MA 4YWZA 1G28A 4G3VA 4Y3IA 3PR6A 4Z1WA 4WL9A 3OOVA 2V9AA 4DJ2A 1F98A 4EW7A 5DFYA 5HPIA 1N9NA 2PHYA 3OCNA 4CLCB 2J3TD 2JN7A 4I39A 2W1TA 4LRXC 3R7WA 4I3JA 3BW6A 4I38A 3E4PA 3UB9A 5J3WA 2L4RA 2VV6A 1DRMA 4WLAA 2M1CA 2VGLS 3LIFA 3RFBA 3MJQA 3F1OA 2Z6CA 4HIAA 2R78A 2Y8HA 4DJ3A 4PHTA 3FC7A 4I3IA 3T4LA 2VKSA 2EWWA 2GNXA 4Y2FA 1JNUA 2OAQ1 4II7A 2WKRA 1XJ3A 2ZBBA 4P6ZM 3OBFA 2LB5A 1DP6A 4B9OA 2A24B 4WN5A 1MZUA 3LI9A 4WF0A 5IS1A 4FSFA 5TJJA 2M7VA 4JGRA 1XJ4A 4M4XA 4Q0JA 2VGLM 4EETB 3T4JA 3K3CA 1D06A 2HJ9C 3MR0A 2PDRA 2KX6A 2XSSA 5KIZA 3D72A 2JHEA 1BYWA 4R70A 1OPXA 2GX5A 4LRZE 2O9AA 1WA9A 3R4KA 3ICYA 4O0PA 3ZYTA 1XJ2A 5MC7A 3VV4A 3S7PA 3CUEA 3PHYA 3OLOA 2D02A 3F1NA 5AJGA 1W63Q 1OT9A 5G4YA 3UB7A 4DN0A 4NXEA 2YKHA 2W3FA 3NOTC 3SW1A 5G4ZA 2KLIA 1S4RA 3C30A 1VHMA 1MC0A 4BBVA 2NUTC 1Y28A 3KO6A 2W3HA 3E4QA 2W27A 3EGXC 4L9GA 3FPWA 3NJAA 2XA7S 4BBTA 5FL3A 3F1OB 3NOPC 5DFXA 1UGUA 4R6LA 2A24A 1ODVA 4HJ4A 1S1YA 1S67L 3NHQA 3LR5A 5A8BA 3JVUA 3KSFA 5TBMA 2WKPA 1H3QA 3T4KA 3CUEC 4MN7A 1T1CA 2KDKA 3D3OA 3UE6A 3CWFA 1V9YA 3UMDA 2KOIA 3KSIA 4E04A 3E4OA 2XA7M 4UEYA 5J7EA 4AFIA 3MFXA 2LB9A 2O9CA 2B02A 3T50A 1OTDA 2PR6A 2HF6A 4HH3A 1N9OA 1F9IA 5F69A 1TS7A 2PYRA 3UMEA 5EFWA 5HSQA 3FG8A 1IFQA 4I3AA 2I9VA 4CQHA 2O0YA 3TW8A 4ETZA 4P6ZS 1D7EA 4QPRA 5F68A 3F1NB 4EERA 4H6JB 3EEHA 3EQVA 4GCZA 2VJWA 2ZMVA 3HJIA 4IUKA 5F6AA 4O8GA 3PBTA 2YKFA 3EGDC 2ZOIA 3LR4A 4HY8A 3ULFA 4HHDA 4BBUA 4OOLA 3JVVA 1OJ5A 2MJ6A 3LIEA 4GS9A 3O5YA 3TRCA 4KQDA 5IU1A 3CLOA 3G6OA 2HGVA 2W3EA 3BQ8A 5HZHA 2VA0A 1ZTUA 3H9WA 5DKKA 3PXPA 5HDDA 3KSHA 3UB8A 4HH2A 2OOLA 1GSWA 5LBRA 3GECA 3S7OA 4PKYG 5TBMB 4R3AA 5HWWA 1P9WA 2O9BA 3EWKA 3VOLA 3BWLA 1OJGA 3C8CA 4MMNA 5J4EA 4LPZA 2P7JA 2ZOHA 4I5SA 1UWPX 3IBRA 4NXBA 4NXGA 2OWJA 3B42A 3T4OA 4ARZB 4RQ9A 2HJEA 1OT6A 2HV1A 4ME4A 5F5YA 1G6OA 4FOFA 4H6JA 1S1ZA 4KUKA 1TS6A 2L0WA 3MQQA 1T1AA 2QJ5A 4XT2A 3VE3A 4WEKA 3TJZC 3LIBA 4O01A 2D01A 3W2ZA 1IOUA 4HI4A 4ZRRA 5HD5A 2CMNA 5I5LA 2PD8A 3UE3A 1LL8A 3C2WA 5HDCA 2EA9A 2PD7A 3EOIA 1P0ZA 2IA2A 4G3WA 3LICA 5C5KA 2W0NA 3P7NA 4IHQA 1OTEA 3BJNA 3HJKA 2J3TC 2FH5A 5AVEA 4HP9A 2DMWA 4PAUA 4L0LA 1NLYA 4F3LA 4GS9B 5L8MA 3RH8B 2VZWA 3V67A 3LIDA 3RTYA 1KOUA 1XFNA 1XFQA 1NLZA 2V1BA 3BQAA 4YNRA 5DF9A 1W63M 3LUQA 5IT5A 1OTBA 4JGQA 2OWHA 2W1RA 3MF0A 4MN6A 4ARZA 1GSXA 3PBQA 1T1BA 4HOIA 3MQOA 3A0VA 2K7SA 2M7UA 3VE4A 5K5BA 1UWNX 4GW9A 3PYPA 3H82B 4L9EA 1TS0A 3LIAA 2V1AA 1TD5A 4GHIB 3LYXA 2QKPA 2Y79A 2VV7A 1YSQA 1S4SA 2XROA 2JKRI 1GSVA 3LFVA 5HWTA 3S7QA 3T4SA 1ZHHB 3A0RA 1P9RA 3K3DA 4XT2B 3E0YA 4JGOA 1LSWA 2W3GA 1LSVA 3F1PA 1P97A 2QWSA 3OCLA 2B18A 1X0OA 1T18A 3KYQA 4MCWA 3P01A 4Y5FA 2INWA 5HWVA 3ZQ5A 1YKDA 5AVFA 4MN5A 3B33A 1DP9A 2PYPA 2NUPC 2QHKA 3T4QA 4IJGA 3H7WA 4HJ3A 4NKPA 3TE8A 4EESA 3C38A 3MMHA 3MQ0A 5CX7A 4ETXA 2XRNA 4BJPA 1F5MA 2OAP1 2K31A 4UQIS 4F3LB 2BASA 4CLCD 3DBAA 2A2LA 3PBRA 3PBSA 4EXOA 1T19A 2GZAA 3GDIA 4BWIA 2V0WA 2Z6DA 1STZA 5KSHA 4GLQA 1TS8A 3EEAA 1LT0A 2J80A 2QJ7A 2W3DA 2JKRM 4WELA 3H82A 4JGPA 4B93A 1N9LA 3A0SA 5DJUA 3EQUA 4GHIA 4NXFA 4KUOA 4EUVA 4OOMA 1TF1A 5DJTA 2JKTI 4BMWA 1H8MA 3PBNA 4UQIM 4WUJA 5HPFA 2V0UA 2ZMFA 3IS2B 1VB6A 1OTIA 3BY8A 2VLGA 3LR3A 3CITA 2VX8A 4HQAA 2O99A 4GJ4A 5DKLA 3U2AA 3E98A 4PKYA 4EEPA 4YOFA 1V9ZA 1LSXA 3K2NA 4HP4A 3BY9A 1OTAA 2EWVA 3CI6A 1YSPA 3F1PB 4CLCA 1MKMA 2WKQA 2VEAA 3KX0X 4EQ1A 3OC2A 4LLOB 2PT7A 4Q0IA 3IBJA 4G3KA 3PBOA 4CLCE 3NOUC 5HDSA 2VV8A 5HD3A 2W1TB 3H7WB 4HNBA 3R7WB 3LR0A 4IUHA 3HCYA 3T4TA 3B47A 2QYBA 3KSGA 1XJ6A 1EW0A 3CAXA 4DMZA 5HL6A 2JKTM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRY C;  2PR5 A;  3MXQ A;  1DP8 A;  2H28 A;  2GJ3 A;  3IS2 A;  4K08 A;  1NWZ A;  4L9F A;  3LI8 A;  1S66 L;  3UB6 A;  4HJ6 A;  4R38 A;  4EEU A;  2L1M A;  4YWZ A;  1G28 A;  4WL9 A;  2V9A A;  4DJ2 A;  1F98 A;  4EW7 A;  1N9N A;  2PHY A;  2JN7 A;  4I39 A;  4LRX C;  4I3J A;  4I38 A;  3E4P A;  3UB9 A;  5J3W A;  2L4R A;  2VV6 A;  1DRM A;  4WLA A;  2M1C A;  3LIF A;  3MJQ A;  3F1O A;  2Z6C A;  4HIA A;  2R78 A;  4DJ3 A;  3FC7 A;  4I3I A;  1JNU A;  2WKR A;  1XJ3 A;  2ZBB A;  1DP6 A;  4B9O A;  2A24 B;  4WN5 A;  1MZU A;  3LI9 A;  4WF0 A;  5IS1 A;  4JGR A;  1XJ4 A;  4M4X A;  4EET B;  3K3C A;  1D06 A;  3MR0 A;  2PDR A;  2KX6 A;  5KIZ A;  3D72 A;  2JHE A;  1BYW A;  4R70 A;  4LRZ E;  1WA9 A;  3ICY A;  1XJ2 A;  3PHY A;  3OLO A;  2D02 A;  3F1N A;  1OT9 A;  5G4Y A;  3UB7 A;  4NXE A;  2YKH A;  3NOT C;  3SW1 A;  5G4Z A;  1S4R A;  4BBV A;  1Y28 A;  3E4Q A;  2W27 A;  4L9G A;  3NJA A;  4BBT A;  3F1O B;  3NOP C;  1UGU A;  4R6L A;  2A24 A;  1ODV A;  4HJ4 A;  1S1Y A;  1S67 L;  3NHQ A;  5A8B A;  5TBM A;  2WKP A;  1T1C A;  2KDK A;  3UE6 A;  3CWF A;  1V9Y A;  3UMD A;  4E04 A;  3E4O A;  5J7E A;  3MFX A;  2B02 A;  3T50 A;  1OTD A;  2PR6 A;  4HH3 A;  1N9O A;  1F9I A;  5F69 A;  1TS7 A;  2PYR A;  3UME A;  5EFW A;  5HSQ A;  3FG8 A;  4I3A A;  2I9V A;  1D7E A;  5F68 A;  3F1N B;  4EER A;  4H6J B;  3EEH A;  4GCZ A;  3HJI A;  5F6A A;  2YKF A;  2ZOI A;  4HY8 A;  3ULF A;  4HHD A;  4BBU A;  1OJ5 A;  3LIE A;  4GS9 A;  4KQD A;  5IU1 A;  3CLO A;  3G6O A;  5HZH A;  3H9W A;  5DKK A;  5HDD A;  3UB8 A;  4HH2 A;  2OOL A;  1GSW A;  3GEC A;  4PKY G;  5TBM B;  4R3A A;  5HWW A;  3EWK A;  3VOL A;  3BWL A;  1OJG A;  3C8C A;  5J4E A;  4LPZ A;  2P7J A;  2ZOH A;  4I5S A;  1UWP X;  3IBR A;  4NXB A;  4NXG A;  2OWJ A;  4RQ9 A;  1OT6 A;  2HV1 A;  5F5Y A;  4H6J A;  1S1Z A;  4KUK A;  1TS6 A;  2L0W A;  3MQQ A;  1T1A A;  2QJ5 A;  4XT2 A;  3VE3 A;  3LIB A;  2D01 A;  4HI4 A;  5HD5 A;  2CMN A;  5I5L A;  2PD8 A;  1LL8 A;  3C2W A;  5HDC A;  2EA9 A;  2PD7 A;  1P0Z A;  3LIC A;  2W0N A;  3P7N A;  1OTE A;  3HJK A;  5AVE A;  4HP9 A;  4F3L A;  4GS9 B;  3RH8 B;  3LID A;  3RTY A;  1KOU A;  1XFN A;  1XFQ A;  2V1B A;  3LUQ A;  1OTB A;  4JGQ A;  2OWH A;  4MN6 A;  1GSX A;  1T1B A;  4HOI A;  3MQO A;  3A0V A;  2K7S A;  3VE4 A;  1UWN X;  4GW9 A;  3PYP A;  3H82 B;  4L9E A;  1TS0 A;  3LIA A;  2V1A A;  4GHI B;  3LYX A;  2QKP A;  2VV7 A;  1S4S A;  1GSV A;  5HWT A;  3A0R A;  3K3D A;  4XT2 B;  4JGO A;  1LSW A;  1LSV A;  3F1P A;  1P97 A;  2QWS A;  1X0O A;  1T18 A;  5HWV A;  2INW A;  3ZQ5 A;  5AVF A;  4MN5 A;  3B33 A;  1DP9 A;  2PYP A;  2QHK A;  3H7W A;  4HJ3 A;  4EES A;  4F3L B;  2BAS A;  4EXO A;  1T19 A;  3GDI A;  2V0W A;  2Z6D A;  1TS8 A;  1LT0 A;  2J80 A;  2QJ7 A;  3H82 A;  4JGP A;  1N9L A;  3A0S A;  5DJU A;  4GHI A;  4NXF A;  4KUO A;  5DJT A;  4WUJ A;  2V0U A;  3IS2 B;  1VB6 A;  1OTI A;  3BY8 A;  2VLG A;  4HQA A;  5DKL A;  4PKY A;  4EEP A;  1V9Z A;  1LSX A;  4HP4 A;  3BY9 A;  1OTA A;  3F1P B;  2WKQ A;  2VEA A;  3KX0 X;  4EQ1 A;  4LLO B;  3NOU C;  5HDS A;  2VV8 A;  5HD3 A;  3H7W B;  4HNB A;  1XJ6 A;  1EW0 A;  3CAX A; 
#chains in the Genus database with same CATH topology
 4OPZ A;  4ZBE A;  4WEJ A;  4JLF A;  3UB5 P;  4HES A;  1Q2Q A;  1DP8 A;  3A3D A;  3WRT A;  2Y2L A;  2GJ3 A;  1YAX A;  2R9W A;  4K08 A;  3V3S A;  4MDZ A;  1K6R A;  2FZ0 A;  3CJM A;  5CER A;  3GMW A;  4BD1 A;  1PW8 A;  4HJ6 A;  1BLP A;  1BZA A;  3Q81 A;  2I72 A;  2IWD A;  4R38 A;  2IWC A;  4Y3I A;  4Z1W A;  1PFL A;  3BEC A;  2V9A A;  3LEZ A;  4DJ2 A;  1N9N A;  4P6B A;  3LY4 A;  2WGV A;  4CLC B;  2J3T D;  2JN7 A;  2W1T A;  4BLM A;  4I38 A;  4QY5 A;  5J3W A;  3V5M A;  2H0T A;  2VV6 A;  2M1C A;  4OQ0 A;  4PHT A;  2VKS A;  2EWW A;  3QNB A;  4MEZ A;  1JNU A;  4KG6 A;  4P6Z M;  5FAQ A;  1ERO A;  3CG5 A;  5CRF A;  2M7V A;  3CPT A;  4Q0J A;  4EET B;  5L10 A;  4X25 A;  5FQJ A;  3VOY A;  2XSS A;  5EM0 A;  5GHY A;  1N9B A;  1OPX A;  2GX5 A;  1WA9 A;  3L7H A;  4LV2 A;  3IHA A;  4K0X A;  1PWD A;  3VP2 A;  1FQG A;  1ACF A;  3GR2 A;  1BSG A;  3PHY A;  4UA9 A;  3OLO A;  3IF5 A;  1JWZ A;  5AJG A;  2A3U A;  2B95 A;  3UB7 A;  4DN0 A;  4OPQ A;  3MZF A;  1YMS A;  2XFT A;  3QNC A;  3SW1 A;  1VHM A;  1LI9 A;  3BFD A;  2VGK A;  3UDF A;  1Y28 A;  3HLE A;  3IX8 A;  5EVI A;  2W27 A;  1MBL A;  3BFF A;  5HW3 A;  4WYY A;  4MBH A;  2A49 A;  4WZ4 A;  1LHY A;  3W8K A;  1WE4 A;  2B5R A;  2WZZ A;  3KSF A;  1E4D A;  4NET A;  1YLW A;  2WKP A;  2HDQ A;  2C6W B;  3CUE C;  1T1C A;  1V9Y A;  2OLU A;  2KOI A;  4FD8 A;  3CPT B;  1MXO A;  5TR7 A;  5A92 A;  4AFI A;  3MFX A;  1FCN A;  4JF6 A;  1SKF A;  2B02 A;  1OTD A;  2PBY A;  2ZMA A;  2PR6 A;  3BFE A;  4HH3 A;  2AVX A;  2PYR A;  4DDY A;  2VGJ A;  4K91 A;  3FG8 A;  4I3A A;  1YQS A;  3S1Y A;  4EER A;  2FFY A;  3LY3 A;  4OP8 A;  4QY6 A;  2ZMV A;  3HL9 A;  2ZQA A;  4IUK A;  5F6A A;  4EBP A;  3EGD C;  5EEC A;  4HY8 A;  1K6S A;  5EVI B;  3TG9 A;  4OOL A;  1OJ5 A;  4Q8I A;  1K54 A;  5E2F A;  3G6O A;  3G2Y A;  2HGV A;  1Y4O A;  5IHV A;  3KSH A;  1SKO A;  5EVI D;  3D9Y A;  1JTG A;  3G31 A;  1FIL A;  1P9W A;  3BFC A;  3VOL A;  3IWI A;  3BWL A;  4MMN A;  3NY4 A;  2UV0 E;  1K55 C;  3W4O A;  4DE3 A;  4Z9Q A;  3I7J A;  2HV1 A;  3WS1 A;  3G35 A;  1H8Y A;  4OP5 A;  4FTX A;  4FOF A;  3BLM A;  4H6J A;  2H0Y A;  2QJ5 A;  4WEK A;  3W4Q A;  5BOH A;  3M6B A;  2CMN A;  3ITA A;  4ID4 A;  4ZAM A;  1P0Z A;  4WBG A;  4IHQ A;  3NDG A;  3BJN A;  2Y2I A;  3HRE A;  3A3I A;  4EUZ A;  1G5U A;  3D4F A;  1A0K A;  1O7E A;  3PAE A;  3UPO A;  3LID A;  1NXY A;  2HDS A;  1SKO B;  2XFS A;  1NLZ A;  4X1L A;  3Q1F A;  4YNR A;  1OTB A;  4BL3 A;  4ESP A;  4ARZ A;  5M18 A;  3PBQ A;  1ESI A;  4HOI A;  1IYS A;  3MQO A;  5EVI C;  2R9X A;  4GW9 A;  3PYP A;  3H82 B;  3ZHH A;  2V1A A;  1WYB A;  5U47 A;  1W79 A;  2JKR I;  2ZQ9 A;  5L07 A;  2EFU A;  2Y4A A;  1ZHH B;  3A0R A;  4CPK A;  1HD8 A;  2EXA A;  1LSW A;  4OLG A;  1LSV A;  3F1P A;  2QWS A;  1ERM A;  5HWV A;  2INW A;  2Y2P A;  3ZQ5 A;  1YKD A;  1DP9 A;  2QHK A;  3T4Q A;  4E3I A;  2JKG A;  1W7F A;  4ZJ1 A;  3MMH A;  3MQ0 A;  5CX7 A;  4ETX A;  3ZGA B;  1ONG A;  1F5M A;  1EI5 A;  4UQI S;  5A93 A;  4OVD A;  5E43 A;  4EXO A;  4RA7 A;  2GZA A;  1GA0 A;  2V0W A;  5KSH A;  5M19 A;  4GLQ A;  1K56 D;  1TS8 A;  3DTM A;  4R0Q A;  3P09 A;  4WEL A;  2Y2J A;  4JGP A;  4GKU A;  3GV9 A;  4A5R A;  4DXB A;  2XLN A;  4O7D A;  1RP5 A;  1TF1 A;  1VM1 A;  2WGI A;  5HPF A;  1K54 C;  2V0U A;  4ZJ3 A;  3LR3 A;  5HAQ A;  4HQA A;  3U2A A;  3E98 A;  4PKY A;  4EEP A;  5I94 A;  1XA1 A;  1LSX A;  3BY9 A;  1OTA A;  3F1P B;  3DAV A;  1G68 A;  1H8Z A;  3KX0 X;  3UPP A;  3V3R A;  2PT7 A;  4IED A;  4Q0I A;  1GA9 A;  4G3K A;  3VFF A;  4CLC E;  5HDS A;  2VV8 A;  5HD3 A;  4HNB A;  3R7W B;  1Z6F A;  3LR0 A;  1NYM A;  3V50 A;  4OQG A;  1PNE A;  4YFM A;  4KZ8 A;  3HCY A;  3T4T A;  1YPR A;  2V2F F;  3DTK A;  1EW0 A;  1N4O A;  4Y7P A;  4DMZ A;  3UDI A;  2JKT M;  2EX2 A;  4LRY C;  3C7U A;  2PR5 A;  3VOZ A;  3MXQ A;  4N1H A;  1XA7 A;  4KQQ A;  2H28 A;  4KZB A;  1IKI A;  2XR0 A;  1BLH A;  2J9O A;  1NWZ A;  4JF5 A;  3BRM A;  4EU0 A;  4M3K A;  3N8R A;  2J3W A;  4JXV A;  4OPR A;  1ES5 A;  1KGG A;  5GLA A;  4G3V A;  4EQI A;  3IXD A;  1BLS A;  1RCJ A;  4OLD A;  3WS2 A;  4WL9 A;  4RYE A;  4EW7 A;  1TVF A;  2HP6 A;  5DVA A;  2ZC3 B;  4LCM A;  5AQB A;  5CGX A;  4PPR A;  2L4R A;  4WLA A;  2VGL S;  3RFB A;  3MJQ A;  3IWQ A;  1K38 A;  2Z6C A;  5KMW A;  2ZQC A;  4HIA A;  2Y8H A;  4DJ3 A;  1MWR A;  3FC7 A;  3RJU A;  4Y2F A;  4II7 A;  2WKR A;  1XJ3 A;  2ZBB A;  1DP6 A;  3C5A A;  2WAD A;  1ZKJ A;  2EX9 A;  1PW1 A;  5IS1 A;  3NUL A;  1VEU A;  3T1Q B;  2EX6 A;  4M4X A;  4MLL A;  3AGD A;  1D06 A;  3OPR A;  4LGW A;  3MXS A;  2PDR A;  3VP1 A;  2PU4 A;  4E6X A;  4LRZ E;  3JYI A;  3NEC A;  2O9A A;  2Z2L B;  4OQI A;  1K25 A;  3S7P A;  4ZJ2 A;  3CUE A;  2D02 A;  3F1N A;  1W63 Q;  3MSH A;  5JYP A;  1ZC2 A;  4GD6 A;  4NXE A;  2YKH A;  5G4Z A;  2KLI A;  1NYY A;  5FI6 A;  2NUT C;  2CC1 A;  3IH9 A;  3KO6 A;  2W3H A;  3C4O A;  3W4P A;  1NZO A;  3NJA A;  4WZ5 C;  2XA7 S;  4KZ7 A;  2ZLY A;  1F2K A;  4R4S A;  3IQA A;  1XP4 A;  2E8I A;  2XH9 A;  4R6L A;  3OPL A;  5CHJ A;  4HJ4 A;  5A8B A;  1KE4 A;  4X68 A;  3N8S A;  5EOO A;  4MN7 A;  1J3W A;  3C7V A;  3UE6 A;  1SDN A;  3UMD A;  4E04 A;  1VEU B;  2O9C A;  2QPN A;  1I2S A;  4RX2 A;  5CTN A;  1RGZ A;  1JTD A;  1LI0 A;  3HUO A;  1BUL A;  1CEF A;  5FEG A;  2OV5 A;  1IFQ A;  4CQH A;  2O0Y A;  3IH8 A;  1D7E A;  2ZM8 A;  3N7W A;  5HL1 A;  1L3L A;  3F1N B;  3HBR A;  3EQV A;  5AQ9 A;  1TDL A;  3RXW A;  1XXM A;  4S2J A;  3ZCZ A;  1K55 A;  5FI7 A;  3ZNY A;  3NIA A;  4UA7 A;  2ZOI A;  5A91 A;  4BBU A;  3VSL A;  3JVV A;  3IF6 C;  2MJ6 A;  3O5Y A;  1Z09 A;  4KQD A;  5IU1 A;  2BG1 A;  3GRJ A;  2W3E A;  3BQ8 A;  5DKK A;  3UB8 A;  2OOL A;  1GSW A;  2Q9N A;  4KZ9 A;  4PMA A;  5EOE A;  5DF7 A;  1OJG A;  2EX8 A;  1PI4 A;  1DJC A;  5FQQ A;  1GCE A;  3O86 A;  2ZOH A;  1YM1 A;  3A3J A;  4C3Q A;  2BTF P;  1CQA A;  4N1X A;  1MY8 A;  3IWO A;  2OWJ A;  2QZ6 A;  4GZB A;  3U4L P;  2C5W B;  1GHI A;  3DW0 A;  4EV4 A;  1S1Z A;  4KUK A;  1ALQ A;  3CHW P;  3TJZ C;  4O01 A;  2D01 A;  3W2Z A;  1IOU A;  3BFG A;  2XD1 A;  3UE3 A;  1LL8 A;  5HDC A;  5L2F A;  1YLY A;  1ONH A;  4RX3 A;  3Q07 A;  5CED A;  5FDS A;  2Y2Q A;  3P7N A;  4MBF A;  1CK3 A;  3FZC A;  2J3T C;  2FH5 A;  5D3O A;  2DMW A;  4X1M A;  2DRW A;  3RH8 B;  1LL9 A;  3V67 A;  3FKV A;  2Y2O A;  3BQA A;  3E2L A;  5DF9 A;  3LUQ A;  3UDX A;  1MKI A;  2W1R A;  4MN6 A;  4EWF A;  1GSX A;  1T1B A;  3NCK A;  5CGW A;  5CEB A;  1UWN X;  2WKH A;  1I2W A;  4L9E A;  3QP2 A;  3G2Z A;  4FH4 A;  4EBL A;  1VET A;  1JWP A;  2QKP A;  2Y79 A;  1YSQ A;  1S4S A;  2XRO A;  2XEP A;  5FI2 A;  4QHC A;  5HWT A;  3S7Q A;  4X53 A;  4KZ6 A;  1FR6 A;  5CHM A;  4JGO A;  2W3G A;  4ZDX A;  3BLS A;  3VP3 A;  1W8Y A;  4S2I A;  4MN5 A;  4H8R A;  5TFQ A;  3C38 A;  1PIO A;  1FSW A;  4JXW A;  4JKT A;  3HLD A;  2HP9 A;  2K31 A;  4MNR A;  3DBA A;  3PBR A;  4KEN B;  3T1S A;  4MBK A;  2V1Z A;  2JKF A;  2J80 A;  4DE2 A;  2W3D A;  3H82 A;  3CMZ A;  4S2P A;  4B93 A;  1N9L A;  3A0S A;  4DE0 A;  4NXF A;  3SS3 A;  4EUV A;  2Y2M A;  4OOM A;  4WMC D;  2JCH A;  4BMW A;  1H8M A;  3N8L A;  5FAT A;  3IS2 B;  1VET B;  3ZG5 A;  3BYD A;  4X6T A;  2VLG A;  4NG2 A;  3T1R A;  4E3O A;  4OQH A;  5DKL A;  2WZX A;  3MS6 A;  1V9Z A;  2EWV A;  3SS5 A;  3T12 B;  1MKM A;  2VEA A;  1K56 A;  5E2H A;  4ZTK A;  4DRT A;  4IUH A;  4X56 A;  2ZQD A;  3QHY A;  2QYB A;  4N9L A;  4OH0 A;  4E3J A;  5AQA A;  3IX3 A;  2Y2H A;  4Q0H A;  1YLT A;  3IX4 A;  4KQO A;  5G18 A;  5FAS A;  3TSG A;  4YIN A;  2G7U A;  1O07 A;  2OSU A;  1XKZ A;  4Y17 A;  4NK3 A;  4L9F A;  3S7N A;  3WS4 A;  3FPV A;  1Y54 A;  3LI8 A;  1S66 L;  4R3J A;  3G32 A;  1CI8 A;  1NY0 A;  1BT5 A;  1SDE A;  3MKE A;  4EEU A;  1G28 A;  2ZC4 B;  1C3B A;  5DTK A;  3PR6 A;  1VQQ A;  3OOV A;  5GHX A;  2XF3 A;  1F98 A;  5DFY A;  4PM5 A;  1QME A;  3TOI A;  3C4P A;  4LRX C;  3R7W A;  1PZP A;  2WGW A;  3BW6 A;  3UE1 A;  3UB9 A;  5FQK A;  3DTE A;  4B4X A;  1S6R A;  1D1J A;  2XDM A;  4OON A;  1BTL A;  1W8Q A;  1KGE A;  3T4L A;  4I3I A;  3ZVT A;  1YLJ A;  2OAQ 1;  1SHV A;  3OBF A;  3DTI A;  2A24 B;  4WN5 A;  5FQ9 A;  3LEQ A;  1L0G A;  1MZU A;  3LI9 A;  4WF0 A;  5TJJ A;  3WS0 A;  1KVL A;  4WZ5 A;  5L09 A;  4Y15 A;  3HLB A;  3BEB A;  3MR0 A;  5KIZ A;  4GDB A;  3HUN A;  3FWL A;  4IVK A;  3R4K A;  2Y59 A;  3MZD A;  1XJ2 A;  2PAV P;  5MC7 A;  1BUE A;  3VV4 A;  1OT9 A;  5G4Y A;  2WUQ A;  3V39 A;  1DY6 A;  2DCF A;  3NOT C;  4IVI A;  1TDG A;  1MC0 A;  2OLV A;  3L9K A;  2WGW B;  1SCW A;  3Q7Z A;  3EGX C;  1MWS A;  4L9G A;  3FPW A;  4BBT A;  5FL3 A;  4E3L A;  5DFX A;  1UGU A;  4RVA A;  1ODV A;  1S67 L;  2JE5 A;  3PTE A;  3JVU A;  3UNW A;  5F83 A;  2E8J A;  4GN2 A;  1H3Q A;  4N9K A;  3UPN A;  2KDK A;  3CWF A;  3FYZ A;  4S2N C;  3KSI A;  4UHU A;  3UY6 A;  3E4O A;  5J7E A;  1CI9 A;  1PZO A;  3ZG0 A;  3IF6 A;  3LGO A;  4S2K A;  1U60 A;  3P98 A;  2RL3 A;  2J9P A;  2HF6 A;  5FAO A;  1N9O A;  1F9I A;  5F69 A;  1ES3 A;  5HSQ A;  4B4Z A;  3TW8 A;  1S0W A;  4QPR A;  3S4X A;  3GSG A;  4GCZ A;  2HPB A;  2VJW A;  4HBT A;  3M2J A;  3IXG A;  2YKF A;  1WYC A;  3ZVW A;  3ULF A;  3LIE A;  3TRC A;  3MBZ A;  1JVJ A;  5HZH A;  2VA0 A;  1XGI A;  5HDD A;  1L0E A;  4OPY A;  3GEC A;  4PKY G;  3WS5 A;  5HWW A;  3IXB A;  3EWK A;  3C8C A;  5GLD A;  1YMX A;  4GNU A;  5J4E A;  2ZC6 B;  4LV3 A;  2P7J A;  1UWP X;  3IF6 B;  3T4O A;  1GHP A;  1HVB A;  5F82 A;  4RQ9 A;  2HJE A;  1OT6 A;  4LFU A;  2PBD P;  2P9V A;  3B3X A;  4BL2 A;  4HI4 A;  3Q7V A;  5HD5 A;  5I5L A;  3ZFZ A;  1I5Q A;  2EA9 A;  3EOI A;  4G3W A;  3LIC A;  2W0N A;  3HJK A;  1IYQ A;  4HP9 A;  4L0L A;  1NLY A;  3A3E A;  3GTC A;  5L8M A;  2X71 A;  1E3U D;  1NJ4 A;  2VZW A;  1HLU P;  3RTY A;  3DWK A;  1XFN A;  1XFQ A;  2V1B A;  1KGF A;  2PU2 A;  1K4F A;  5CEC A;  4JGQ A;  1XGJ A;  2OWH A;  3UN7 A;  4BQM A;  4OKP A;  4DF6 A;  2K7S A;  2M7U A;  5K5B A;  2P74 A;  2X01 A;  1TS0 A;  3LIA A;  4XXR A;  3HLF A;  5EVL A;  2J7V A;  4D60 A;  1TD5 A;  4GHI B;  3LYX A;  3VSK A;  5CXW A;  3SOI A;  5KSC A;  2WK0 A;  5FQI A;  1IYO A;  1GSV A;  2P9V B;  3T4S A;  3VP0 A;  1P9R A;  3Q7V B;  1PYY A;  5CGS A;  3OCL A;  1X0O A;  1T18 A;  3KYQ A;  4Y5F A;  2HP5 A;  4S2O A;  3B33 A;  2Q0O A;  2NUP C;  4R1G A;  4NKP A;  3VFH A;  4EES A;  1FR1 A;  2Y91 A;  3M2K A;  4C75 A;  3SH8 A;  1K57 A;  3OPH A;  2XRN A;  4KZ5 A;  2ZL1 B;  2JBF A;  3HLC A;  1E25 A;  2BAS A;  4CLC D;  1MWT A;  4GOG A;  1T19 A;  5KZH A;  2Z6D A;  1STZ A;  1ES2 A;  4C6Y A;  2JKR M;  1NZU A;  1Q2P A;  4KUO A;  3E2K A;  4P0M A;  2XGN A;  5DJT A;  2JKT I;  3PBN A;  4UQI M;  4WUJ A;  2ZMF A;  1ESU A;  1VB6 A;  2ZC5 B;  1YLP A;  1OME A;  2HDU A;  1PRQ A;  2Y55 A;  3CIT A;  4LEN A;  2VX8 A;  2O99 A;  2V20 A;  4GJ4 A;  3K2N A;  4HP4 A;  1L2S A;  4S2M A;  5EPH A;  2WKQ A;  5CTM A;  4EQ1 A;  3ISG A;  3OC2 A;  5DTT A;  5E2G A;  4XUX A;  4LLO B;  4R4R A;  3IBJ A;  4QJG A;  3NOU C;  3Q82 A;  5AQ7 A;  1RGY A;  2W1T B;  1CF0 A;  5A90 A;  4D2O A;  2HDR A;  2WAF A;  4WMC A;  3B47 A;  4E3M A;  3O3V A;  3CAX A;  4JPM A;  3T4K A;  5TGF A;  1ERQ A;  1NRJ A;  2Z2M B;  4BEN A;  1FSY A;  5EE8 A;  4CLC C;  4E3N A;  2P08 A;  3IS2 A;  3NI9 A;  3BM6 A;  2IWB A;  5HFO A;  2WYX A;  3KYZ A;  2Q9M A;  3UB6 A;  3SH7 A;  2P04 A;  1AXB A;  1PWG A;  2K2N A;  4NEE D;  5GHZ A;  2L1M A;  4YWZ A;  4LCL A;  1SZV A;  5HPI A;  1W5D A;  2PHY A;  3OCN A;  2EXB A;  4I39 A;  4R23 A;  4I3J A;  3QP1 A;  1PWC A;  3VP4 A;  3MKF A;  3E4P A;  2ZJ9 A;  1DRM A;  3LIF A;  3VMA A;  3F1O A;  4X69 A;  1ZG4 A;  2R78 A;  3IHB A;  4KZA A;  2GNX A;  2XD5 A;  5GL9 A;  5EM1 A;  2LB5 A;  3NC8 A;  2JC7 A;  1IYP A;  4B9O A;  4DDS A;  1IKG A;  2DNS A;  4BD0 A;  4FH2 A;  4FSF A;  4JGR A;  1XJ4 A;  5FA7 A;  2VGL M;  3ZDJ A;  3T4J A;  5E2E A;  3K3C A;  2HJ9 C;  2KX6 A;  1L0F A;  4QD4 A;  4QB8 A;  3QP6 A;  3D72 A;  2X02 A;  2JHE A;  1BYW A;  1K57 C;  2VK3 A;  3OPP A;  3LO7 A;  4R70 A;  4UA6 A;  5HAR A;  3ICY A;  4O0P A;  3ZYT A;  3HLW A;  3PAG A;  4S2N A;  3LCE A;  3AGF A;  2W3F A;  3NDE A;  4E3K A;  3MFD A;  1S4R A;  3C30 A;  4Y0O A;  4BBV A;  2PRF A;  4KQR A;  1DJA A;  1TEM A;  3E4Q A;  2GDN A;  3DWZ A;  3F1O B;  2ZC7 A;  3NOP C;  5GLC A;  2A24 A;  2V8F A;  1S1Y A;  4PM9 A;  1EWZ A;  3RXX A;  3NHQ A;  3LR5 A;  2RCX A;  1IEM A;  4PM6 A;  2ZQ7 A;  5TBM A;  4OOY A;  2HZ5 A;  3D3O A;  1KE0 A;  3SZT A;  2XA7 M;  4UEY A;  3OZH A;  3MXR A;  2LB9 A;  1XX2 A;  5EV0 A;  4LV1 A;  3T50 A;  2FFF B;  1HTZ A;  3UO9 A;  2G2W A;  3N4I A;  1TS7 A;  1L0D A;  3HLG A;  2Y2G A;  4P85 A;  3UME A;  5EFW A;  4K0W A;  2I9V A;  4ETZ A;  2BLS A;  4P6Z S;  2ZM0 A;  1AWI A;  4DKI A;  4WM9 A;  5F68 A;  1M40 A;  4H6J B;  3EEH A;  1GHM A;  3IT9 A;  3HJI A;  4O8G A;  1YT4 A;  3PBT A;  3LR4 A;  3A3F A;  4HHD A;  4GS9 A;  3CLO A;  1ZTU A;  3H9W A;  1FIK A;  3PXP A;  4F94 A;  4HH2 A;  1ES4 A;  5LBR A;  4JXG A;  5JYO A;  1IEL A;  3S7O A;  5TBM B;  4R3A A;  5HAI A;  2O9B A;  4QU3 A;  1CJF A;  4LPZ A;  1JWV A;  3WWX A;  3AGE A;  4FUW A;  4I5S A;  3IBR A;  4NXB A;  4NXG A;  1FOF A;  5HX9 A;  3CZD A;  3B42 A;  4ARZ B;  4ME4 A;  5F5Y A;  3JPU A;  5EVE A;  4UAA A;  1KVM A;  4Y0T A;  2ZQ8 A;  1G6O A;  5DF8 A;  1TS6 A;  1YLZ A;  1HZO A;  2L0W A;  3FKW A;  3MQQ A;  1T1A A;  4XT2 A;  3VE3 A;  3LIB A;  4ZRR A;  2PD8 A;  2H10 A;  3C2W A;  2PD7 A;  1K0K A;  2ZM2 A;  4IBR A;  2IA2 A;  3M6H A;  1NRF A;  5C5K A;  3UE0 A;  1OTE A;  2V8C A;  1XPB A;  1J9M A;  5AVE A;  4KZ3 A;  4PAU A;  3WRZ A;  1KDS A;  4F3L A;  4GS9 B;  5FDH A;  5GLB A;  3ZG9 B;  4GD8 A;  1KOU A;  1LL5 A;  1MWU A;  4DE1 A;  5HAP A;  2G2U A;  1W63 M;  2UWX A;  2EFX A;  4JF4 A;  5IT5 A;  3MF0 A;  4XUZ A;  4DXC A;  2ACG A;  5EUA A;  3A0V A;  3ZG8 B;  3VE4 A;  3ZG7 B;  4N92 A;  2WKI A;  1KDW A;  3O87 A;  4FCF A;  1KE3 A;  2XQZ A;  4EBN A;  2VV7 A;  1FCM A;  5J8X A;  4Y13 A;  4KG2 A;  2ZD8 A;  3LFV A;  3SH9 A;  3K3D A;  2QMI A;  4XT2 B;  3E0Y A;  5M1A A;  1P97 A;  5FEF A;  1E3U A;  4X55 A;  1H0M A;  2B18 A;  3GQZ A;  3N6I A;  5F1G A;  4U3T A;  4IBX A;  4MCW A;  3P01 A;  1BLC A;  5AVF A;  4LV0 A;  2PYP A;  4KG5 A;  3SS4 A;  3GVB A;  3H7W A;  4HJ3 A;  4IJG A;  3TE8 A;  2J8Y A;  3MZE A;  5F1F A;  3G4P A;  3NBL A;  3IXH A;  4BJP A;  5CHU A;  1ZG6 A;  4HEF A;  3HUM A;  2OAP 1;  4F3L B;  4GB7 A;  2Y2K A;  2A2L A;  4HBU A;  3FV7 A;  3PBS A;  2Y2N A;  3HVF A;  3GDI A;  4BWI A;  4PM7 A;  3G34 A;  3S22 A;  1FCO A;  3EEA A;  3T1X A;  4PM8 A;  1LT0 A;  2QJ7 A;  5DTS A;  4S2L A;  5DJU A;  3EQU A;  4GHI A;  3O88 A;  4B88 A;  4CJN A;  3G30 A;  1DJB A;  4KZ4 A;  4U0X A;  2WKE A;  5FAP A;  1QMF A;  1OTI A;  1G6A A;  2XK1 A;  4JXS A;  2WAE A;  3BY8 A;  1PI5 A;  5FQM A;  3QP8 A;  4GDN A;  4JBF A;  4E6W A;  1LLB A;  4YOF A;  3ZNT A;  4R3B A;  3QP5 A;  3CI6 A;  1YSP A;  3QP4 A;  4CLC A;  4QWO A;  4U0T A;  3ITB A;  1CEG A;  1K4E A;  1MPL A;  4P87 A;  2ZL1 A;  4Y0U A;  2H5S A;  3PBO A;  1M6K A;  1H5X A;  3H7W B;  5FSR A;  3KSG A;  1XJ6 A;  3KYE A;  5HL6 A; 
#chains in the Genus database with same CATH homology
 4Q0H A;  4WEJ A;  4LRY C;  1NRJ A;  4KQO A;  2PR5 A;  3MXQ A;  2G7U A;  1DP8 A;  2H28 A;  4CLC C;  2GJ3 A;  2P08 A;  3IS2 A;  1YAX A;  4K08 A;  1NWZ A;  4L9F A;  4MDZ A;  2FZ0 A;  3S7N A;  3KYZ A;  3FPV A;  4EU0 A;  3LI8 A;  1S66 L;  3UB6 A;  4HJ6 A;  2P04 A;  2J3W A;  2K2N A;  4NEE D;  4R38 A;  4EEU A;  2L1M A;  4YWZ A;  1G28 A;  4G3V A;  4Y3I A;  3PR6 A;  4Z1W A;  4WL9 A;  3OOV A;  2V9A A;  4DJ2 A;  1F98 A;  4EW7 A;  5DFY A;  5HPI A;  1N9N A;  2PHY A;  3OCN A;  4CLC B;  2J3T D;  2JN7 A;  4I39 A;  2W1T A;  4LRX C;  3R7W A;  4I3J A;  3BW6 A;  4I38 A;  3E4P A;  3UB9 A;  5J3W A;  2L4R A;  2VV6 A;  1DRM A;  4WLA A;  2M1C A;  2VGL S;  3LIF A;  3RFB A;  3MJQ A;  3F1O A;  2Z6C A;  4HIA A;  2R78 A;  2Y8H A;  4DJ3 A;  4PHT A;  3FC7 A;  4I3I A;  3T4L A;  2VKS A;  2EWW A;  2GNX A;  4Y2F A;  1JNU A;  2OAQ 1;  4II7 A;  2WKR A;  1XJ3 A;  2ZBB A;  4P6Z M;  3OBF A;  2LB5 A;  1DP6 A;  4B9O A;  2A24 B;  4WN5 A;  1MZU A;  3LI9 A;  4WF0 A;  5IS1 A;  4FSF A;  5TJJ A;  2M7V A;  4JGR A;  1XJ4 A;  4M4X A;  4Q0J A;  2VGL M;  4EET B;  3T4J A;  3K3C A;  1D06 A;  2HJ9 C;  3MR0 A;  2PDR A;  2KX6 A;  2XSS A;  5KIZ A;  3D72 A;  2JHE A;  1BYW A;  4R70 A;  1OPX A;  2GX5 A;  4LRZ E;  2O9A A;  1WA9 A;  3R4K A;  3ICY A;  4O0P A;  3ZYT A;  1XJ2 A;  5MC7 A;  3VV4 A;  3S7P A;  3CUE A;  3PHY A;  3OLO A;  2D02 A;  3F1N A;  5AJG A;  1W63 Q;  1OT9 A;  5G4Y A;  3UB7 A;  4DN0 A;  4NXE A;  2YKH A;  2W3F A;  3NOT C;  3SW1 A;  5G4Z A;  2KLI A;  1S4R A;  3C30 A;  1VHM A;  1MC0 A;  4BBV A;  2NUT C;  1Y28 A;  3KO6 A;  2W3H A;  3E4Q A;  2W27 A;  3EGX C;  4L9G A;  3FPW A;  3NJA A;  2XA7 S;  4BBT A;  5FL3 A;  3F1O B;  3NOP C;  5DFX A;  1UGU A;  4R6L A;  2A24 A;  1ODV A;  4HJ4 A;  1S1Y A;  1S67 L;  3NHQ A;  3LR5 A;  5A8B A;  3JVU A;  3KSF A;  5TBM A;  2WKP A;  1H3Q A;  3T4K A;  3CUE C;  4MN7 A;  1T1C A;  2KDK A;  3D3O A;  3UE6 A;  3CWF A;  1V9Y A;  3UMD A;  2KOI A;  3KSI A;  4E04 A;  3E4O A;  2XA7 M;  4UEY A;  5J7E A;  4AFI A;  3MFX A;  2LB9 A;  2O9C A;  2B02 A;  3T50 A;  1OTD A;  2PR6 A;  2HF6 A;  4HH3 A;  1N9O A;  1F9I A;  5F69 A;  1TS7 A;  2PYR A;  3UME A;  5EFW A;  5HSQ A;  3FG8 A;  1IFQ A;  4I3A A;  2I9V A;  4CQH A;  2O0Y A;  3TW8 A;  4ETZ A;  4P6Z S;  1D7E A;  4QPR A;  5F68 A;  3F1N B;  4EER A;  4H6J B;  3EEH A;  3EQV A;  4GCZ A;  2VJW A;  2ZMV A;  3HJI A;  4IUK A;  5F6A A;  4O8G A;  3PBT A;  2YKF A;  3EGD C;  2ZOI A;  3LR4 A;  4HY8 A;  3ULF A;  4HHD A;  4BBU A;  4OOL A;  3JVV A;  1OJ5 A;  2MJ6 A;  3LIE A;  4GS9 A;  3O5Y A;  3TRC A;  4KQD A;  5IU1 A;  3CLO A;  3G6O A;  2HGV A;  2W3E A;  3BQ8 A;  5HZH A;  2VA0 A;  1ZTU A;  3H9W A;  5DKK A;  3PXP A;  5HDD A;  3KSH A;  3UB8 A;  4HH2 A;  2OOL A;  1GSW A;  5LBR A;  3GEC A;  3S7O A;  4PKY G;  5TBM B;  4R3A A;  5HWW A;  1P9W A;  2O9B A;  3EWK A;  3VOL A;  3BWL A;  1OJG A;  3C8C A;  4MMN A;  5J4E A;  4LPZ A;  2P7J A;  2ZOH A;  4I5S A;  1UWP X;  3IBR A;  4NXB A;  4NXG A;  2OWJ A;  3B42 A;  3T4O A;  4ARZ B;  4RQ9 A;  2HJE A;  1OT6 A;  2HV1 A;  4ME4 A;  5F5Y A;  1G6O A;  4FOF A;  4H6J A;  1S1Z A;  4KUK A;  1TS6 A;  2L0W A;  3MQQ A;  1T1A A;  2QJ5 A;  4XT2 A;  3VE3 A;  4WEK A;  3TJZ C;  3LIB A;  4O01 A;  2D01 A;  3W2Z A;  1IOU A;  4HI4 A;  4ZRR A;  5HD5 A;  2CMN A;  5I5L A;  2PD8 A;  3UE3 A;  1LL8 A;  3C2W A;  5HDC A;  2EA9 A;  2PD7 A;  3EOI A;  1P0Z A;  2IA2 A;  4G3W A;  3LIC A;  5C5K A;  2W0N A;  3P7N A;  4IHQ A;  1OTE A;  3BJN A;  3HJK A;  2J3T C;  2FH5 A;  5AVE A;  4HP9 A;  2DMW A;  4PAU A;  4L0L A;  1NLY A;  4F3L A;  4GS9 B;  5L8M A;  3RH8 B;  2VZW A;  3V67 A;  3LID A;  3RTY A;  1KOU A;  1XFN A;  1XFQ A;  1NLZ A;  2V1B A;  3BQA A;  4YNR A;  5DF9 A;  1W63 M;  3LUQ A;  5IT5 A;  1OTB A;  4JGQ A;  2OWH A;  2W1R A;  3MF0 A;  4MN6 A;  4ARZ A;  1GSX A;  3PBQ A;  1T1B A;  4HOI A;  3MQO A;  3A0V A;  2K7S A;  2M7U A;  3VE4 A;  5K5B A;  1UWN X;  4GW9 A;  3PYP A;  3H82 B;  4L9E A;  1TS0 A;  3LIA A;  2V1A A;  1TD5 A;  4GHI B;  3LYX A;  2QKP A;  2Y79 A;  2VV7 A;  1YSQ A;  1S4S A;  2XRO A;  2JKR I;  1GSV A;  3LFV A;  5HWT A;  3S7Q A;  3T4S A;  1ZHH B;  3A0R A;  1P9R A;  3K3D A;  4XT2 B;  3E0Y A;  4JGO A;  1LSW A;  2W3G A;  1LSV A;  3F1P A;  1P97 A;  2QWS A;  3OCL A;  2B18 A;  1X0O A;  1T18 A;  3KYQ A;  4MCW A;  3P01 A;  4Y5F A;  2INW A;  5HWV A;  3ZQ5 A;  1YKD A;  5AVF A;  4MN5 A;  3B33 A;  1DP9 A;  2PYP A;  2NUP C;  2QHK A;  3T4Q A;  4IJG A;  3H7W A;  4HJ3 A;  4NKP A;  3TE8 A;  4EES A;  3C38 A;  3MMH A;  3MQ0 A;  5CX7 A;  4ETX A;  2XRN A;  4BJP A;  1F5M A;  2OAP 1;  2K31 A;  4UQI S;  4F3L B;  2BAS A;  4CLC D;  3DBA A;  2A2L A;  3PBR A;  3PBS A;  4EXO A;  1T19 A;  2GZA A;  3GDI A;  4BWI A;  2V0W A;  2Z6D A;  1STZ A;  5KSH A;  4GLQ A;  1TS8 A;  3EEA A;  1LT0 A;  2J80 A;  2QJ7 A;  2W3D A;  2JKR M;  4WEL A;  3H82 A;  4JGP A;  4B93 A;  1N9L A;  3A0S A;  5DJU A;  3EQU A;  4GHI A;  4NXF A;  4KUO A;  4EUV A;  4OOM A;  1TF1 A;  5DJT A;  2JKT I;  4BMW A;  1H8M A;  3PBN A;  4UQI M;  4WUJ A;  5HPF A;  2V0U A;  2ZMF A;  3IS2 B;  1VB6 A;  1OTI A;  3BY8 A;  2VLG A;  3LR3 A;  3CIT A;  2VX8 A;  4HQA A;  2O99 A;  4GJ4 A;  5DKL A;  3U2A A;  3E98 A;  4PKY A;  4EEP A;  4YOF A;  1V9Z A;  1LSX A;  3K2N A;  4HP4 A;  3BY9 A;  1OTA A;  2EWV A;  3CI6 A;  1YSP A;  3F1P B;  4CLC A;  1MKM A;  2WKQ A;  2VEA A;  3KX0 X;  4EQ1 A;  3OC2 A;  4LLO B;  2PT7 A;  4Q0I A;  3IBJ A;  4G3K A;  3PBO A;  4CLC E;  3NOU C;  5HDS A;  2VV8 A;  5HD3 A;  2W1T B;  3H7W B;  4HNB A;  3R7W B;  3LR0 A;  4IUH A;  3HCY A;  3T4T A;  3B47 A;  2QYB A;  3KSG A;  1XJ6 A;  1EW0 A;  3CAX A;  4DMZ A;  5HL6 A;  2JKT M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...