2EA9A

Crystal structure of a hypothetical protein jw2626 from e.coli
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAVYPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein JW2626 from E.coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yfjZ
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ea9A01
3UMDA 2WKRA 4K08A 4LPZA 2PD7A 4YWZA 3BY8A 1N9NA 4HOIA 3OLOA 4GW9A 5HDDA 5TBMA 5HWWA 5J7EA 4EXOA 4JGPA 4R3AA 1OTAA 3C2WA 3MXQA 4RQ9A 5F68A 4F3LA 4I38A 5HWVA 2PD8A 4HP9A 1ODVA 2PYRA 3LUQA 4HH3A 2W0NA 3EEHA 3F1OB 5G4ZA 4L9GA 1LSVA 3IBRA 1XFNA 4HP4A 3ULFA 4I3AA 4I3IA 1MZUA 2PHYA 2V1AA 4WF0A 5J3WA 4EQ1A 2D01A 4XT2A 1S66L 2V0WA 3H82A 5J4EA 1T19A 1OTDA 3NJAA 4R70A 3H7WA 1NWZA 2HV1A 3EWKA 2QJ5A 4R6LA 3A0VA 1DP8A 4MN5A 1OJGA 4EEUA 2K7SA 2WKPA 1V9YA 3LIEA 5EFWA 2INWA 4GS9A 5HD5A 1S4SA 3IS2B 1T18A 2VLGA 3UB8A 2V1BA 4HH2A 2QHKA 2JN7A 1X0OA 3UB6A 1OTBA 2OOLA 2V9AA 4F3LB 3FG8A 2L0WA 2A24A 4H6JB 2L4RA 3LIFA 2VV7A 3RTYA 1UGUA 2YKFA 3CWFA 5KIZA 1D7EA 5F5YA 3LI9A 3MJQA 3A0SA 2Z6DA 3ICYA 2M1CA 3E4OA 3GDIA 3IS2A 2J80A 2QWSA 2ZBBA 5DKKA 3T50A 1GSVA 3F1NA 3K3DA 1LSXA 4JGQA 5I5LA 2A24B 1DP9A 3CLOA 4HNBA 4M4XA 1XJ3A 3BY9A 3HJIA 2L1MA 1V9ZA 3NOUC 2OWJA 4HJ6A 5F69A 4I3JA 2EA9A 1D06A 4HIAA 5AVEA 5HDSA 3VE3A 3CAXA 3LIBA 3MFXA 3E4PA 4BBVA 1LT0A 1OTEA 3UMEA 2GJ3A 1F9IA 1OT6A 4I39A 4LLOB 3UB9A 4DJ3A 5G4YA 3SW1A 1S4RA 2H28A 1JNUA 4PKYG 4EW7A 2CMNA 2R78A 1GSWA 1XJ6A 5HDCA 1XFQA 1G28A 2YKHA 2ZOHA 3MR0A 4HY8A 2I9VA 4MN6A 5AVFA 3K3CA 2W27A 2VV8A 3GECA 4HI4A 4EETB 4EERA 4E04A 4B9OA 4NXBA 5IU1A 2PYPA 1F98A 1OJ5A 3F1OA 2ZOIA 1LL8A 3LI8A 3RH8B 5HSQA 4KUOA 4GHIA 4WUJA 2JHEA 3H82B 1T1CA 4I5SA 3ZQ5A 4HJ4A 3HJKA 1S1YA 3F1PA 1WA9A 2Z6CA 4L9FA 3MQOA 1XJ2A 3FC7A 3LICA 1T1AA 5HZHA 2B02A 4DJ2A 4LRXC 3BWLA 4LRZE 4GS9B 4NXFA 1N9LA 4BBTA 1GSXA 1OTIA 1N9OA 1S1ZA 5DJTA 3UE6A 2P7JA 4KQDA 4EESA 3NHQA 4WN5A 2D02A 3KX0X 2KDKA 4GCZA 4HQAA 3G6OA 4WLAA 2WKQA 3NOTC 3MQQA 5DKLA 5F6AA 3UB7A 2VV6A 3VE4A 3D72A 4H6JA 5A8BA 3PYPA 5TBMB 3A0RA 3LIAA 1DP6A 1EW0A 1VB6A 1T1BA 2KX6A 2PDRA 4HJ3A 4EEPA 1S67L 1DRMA 4XT2B 3E4QA 2PR5A 1TS6A 3NOPC 3PHYA 4LRYC 1BYWA 1XJ4A 3F1NB 1Y28A 2QJ7A 1TS7A 2BASA 3H7WB 4NXEA 4PKYA 4WL9A 5DJUA 5IS1A 4HHDA 1TS0A 4R38A 3LYXA 1TS8A 3P7NA 4JGOA 4JGRA 4NXGA 1KOUA 3VOLA 1LSWA 1P97A 1UWPX 1UWNX 2QKPA 3H9WA 2VEAA 4GHIB 1OT9A 3B33A 2OWHA 4L9EA 5HD3A 4BBUA 1P0ZA 2PR6A 5HWTA 3C8CA 4KUKA 3F1PB 3LIDA 2V0UA
chains in the Genus database with same CATH superfamily
3S4XA 5CEDA 4JF6A 1OTAA 4RQ9A 3V5MA 2GX5A 2NUTC 4I3IA 2P04A 3NECA 2V0WA 1PZOA 2WKPA 1F2KA 5GHXA 3FYZA 1JVJA 3UB8A 2ZL1B 2JN7A 2A24A 3G30A 3OCLA 3DTEA 5DKKA 4R4SA 1GHMA 2OWJA 2BLSA 3VE3A 2EFXA 2HP9A 4ETZA 3BRMA 1TEMA 4X55A 1W7FA 5HDCA 1MWRA 3HBRA 2ZC7A 4X53A 5CX7A 3KSHA 4PM5A 1TF1A 2K2NA 2RCXA 4KUOA 3V67A 4MNRA 3H82B 2VJWA 1S1YA 5CGWA 3VMAA 2Q0OA 1XJ2A 3FC7A 4OONA 4YINA 5L2FA 3RFBA 4BBTA 4OLDA 5C5KA 2W3FA 3R4KA 5TBMB 3MZFA 5FDSA 4YNRA 3HLDA 4A5RA 4UQIM 3ZFZA 4EEPA 1KDSA 5FQIA 1KVMA 4KZ4A 3N8SA 1ZHHB 1TS7A 3SS3A 4X68A 4PKYA 4RYEA 2HDRA 2Y2KA 3P7NA 3VOLA 1N4OA 5HD3A 3T1XA 2Y2GA 4BBUA 4RVAA 4JF4A 2V0UA 4X69A 3DWKA 2Y2QA 2PD7A 5EOOA 1SDNA 3OPHA 1N9NA 2EX6A 1SKOA 5MC7A 2H5SA 3N8LA 3C2WA 5E43A 2ZC6B 4MDZA 4S2OA 1MC0A 3F1OB 5AQ9A 2ZC4B 5HFOA 2QMIA 1SDEA 1HZOA 5E2EA 4ARZA 3S7NA 5EFWA 4E6XA 5EV0A 1T18A 1N9BA 2EFUA 1MBLA 2VV7A 1UGUA 2HP5A 5KIZA 1K55A 2Y2PA 1ZTUA 2QWSA 1XJ3A 1IYQA 2L1MA 1I5QA 2WZXA 1BTLA 4I3JA 4WZ4A 1K4FA 3U4LP 4OQHA 1YLWA 1RCJA 1KE4A 3T4TA 4OOMA 5L10A 4Q0HA 4GDBA 3HLCA 4BLMA 3Q07A 3F1OA 2OAP1 3WS2A 4GHIA 4OQIA 4IBRA 1WA9A 3NBLA 2OLUA 3UE6A 5DJTA 3HLFA 3CMZA 1E25A 1EW0A 3VV4A 1LL9A 1S67L 2O0YA 4ZDXA 1RGZA 1TDGA 4LRYC 1BYWA 4QB8A 2V8FA 3ZG9B 3B3XA 3LYXA 2GDNA 3HUMA 2E8IA 4L9EA 3CZDA 2ZQ7A 4WMCA 1DJCA 1WYCA 3GV9A 3BFFA 3PXPA 3QP2A 1A0KA 2C6WB 2HPBA 3LUQA 1XFNA 3L7HA 1S66L 4C6YA 5FASA 1DY6A 3UPNA 1SZVA 1LI0A 3OCNA 3Q7VA 1WYBA 4MN7A 5HX9A 3UDIA 5L07A 2LB5A 3FG8A 4H6JB 1LLBA 4OPRA 2L4RA 2IWDA 3CWFA 1D7EA 3MJQA 3ICYA 2WADA 3AGFA 4OKPA 2A49A 2B95A 1NLZA 3BM6A 5FDHA 3E4PA 3FZCA 2WZZA 3HUNA 2V20A 1FCNA 3ZVTA 4DN0A 3G31A 4QHCA 3G34A 1G6AA 4B93A 5IU1A 3ZYTA 3IF6A 1M6KA 4DDYA 4KQDA 3G6OA 5HAPA 4E3KA 2KLIA 4E3IA 4Y2FA 3RJUA 2O9AA 3SH9A 3A3DA 2HZ5A 1XJ4A 2RL3A 5IS1A 1LSWA 2OWHA 5GHZA 3F1PB 4K08A 4E3JA 2ACGA 5E2HA 4BQMA 3SS5A 4MLLA 4ZAMA 2W0NA 3BW6A 1XA7A 4L9GA 1KGFA 3SH7A 3WS0A 4OPYA 1Q2PA 2HV1A 3V3SA 4RA7A 4K0XA 1W8QA 4YOFA 1PYYA 4GN2A 3BQ8A 2JKFA 4HBUA 3DTMA 2X71A 3LIFA 2XEPA 2H10A 1NRJA 4OP5A 2EX8A 4G3VA 2IA2A 1O07A 4RX2A 1OTEA 1ALQA 2O99A 2ZMVA 3E2KA 3Q1FA 4QU3A 5DFYA 3C38A 3ITBA 3ZNYA 1XFQA 3GR2A 3P98A 3OPPA 2J7VA 4WEKA 3K3CA 3ZG8B 2EXAA 4EETB 3T1SA 2M7VA 3UY6A 3PBNA 4IEDA 1BT5A 2GNXA 2NUPC 1W63Q 1XGJA 2Y2LA 3T12B 1J3WA 4L0LA 3MQOA 2B02A 4LRXC 3BWLA 4NXFA 3MZEA 1PWCA 4KG5A 3LR4A 1LHYA 3MQQA 4B4XA 3Q7ZA 5DTKA 3A0RA 4ZBEA 2JCHA 3BQAA 3OC2A 4GNUA 2WGIA 4MBKA 4S2IA 1EWZA 1QMEA 2W3GA 2Q9MA 3R7WB 2A2LA 3G2YA 3HUOA 4R38A 5EUAA 2WKEA 1GA9A 2PRFA 3TRCA 4LFUA 4LV1A 2B5RA 5HWWA 5TBMA 3S22A 2PAVP 3A3IA 1S6RA 2Z2MB 3DAVA 4G3WA 3B47A 4HEFA 2P74A 3IBRA 3ULFA 3Q82A 4GD6A 5AQ7A 5HAQA 2XLNA 5KMWA 2JKGA 5HD5A 2J9PA 1PI5A 2W1TA 4UAAA 3EGDC 2P9VA 2Y2OA 1BZAA 2ZMFA 4ZJ2A 2P9VB 4M4XA 4NG2A 1VHMA 1ESIA 2J9OA 1KE0A 2H0TA 3IXHA 4MEZA 2Y2HA 1CEGA 5M1AA 4FTXA 2JKRI 4GZBA 4X1LA 4ID4A 5CHMA 1BSGA 2FFYA 4DXBA 1W63M 1KGEA 2P7JA 3SOIA 3DTKA 3V3RA 2IWBA 4C3QA 5EM0A 3D72A 2WUQA 4KZ6A 1T1BA 1ES3A 2EWVA 4S2PA 3QNBA 1Y28A 4II7A 2QPNA 3W4QA 3GRJA 4JGOA 4R1GA 4JXSA 1UWPX 2XA7S 4C75A 3EQVA 5HPFA 2VGLM 2XD1A 5M19A 2WKRA 5TFQA 3NCKA 4KZBA 3MXRA 4UQIS 3E98A 2XROA 4R3JA 5CTNA 2HGVA 3ZG7B 4CLCD 1T19A 4EBLA 3H7WA 1NWZA 4R23A 4WM9A 5EE8A 1OJGA 5EM1A 2OSUA 2G2WA 4LV0A 1IELA 4PPRA 4S2JA 5EVIB 3ITAA 4JXVA 3IF6C 2WAEA 3BY9A 1IYSA 4Y13A 2EA9A 3IHBA 2GJ3A 1F9IA 5EVEA 1H8MA 2IWCA 1GSWA 3VP3A 2YKHA 1ESUA 1YSPA 3Q81A 5FQ9A 3S1YA 2C5WB 2VV8A 4UA7A 1ONGA 1ZC2A 5F1GA 4KZ7A 1S0WA 5HSQA 3G4PA 1PW8A 1CEFA 3FV7A 4OH0A 2CC1A 2ZQDA 4GB7A 3C7VA 2HDUA 1LL5A 5DTTA 4OQGA 2O9BA 4X56A 4HQAA 4WLAA 3UB7A 5A8BA 3ZG0A 2H0YA 5D3OA 1DRMA 3EQUA 4E3LA 5A93A 3BYDA 1TDLA 5DJUA 4WBGA 3B42A 1ZG4A 3B33A 2PR6A 1HTZA 4BL3A 4GW9A 3GQZA 3PR6A 2DMWA 5HWVA 3HVFA 5GLBA 3PBOA 5G4ZA 3EEHA 1LSVA 2UV0E 1LI9A 1PWGA 2E8JA 4ZJ3A 5J4EA 3IHAA 4LENA 3A0VA 3A3EA 5FQQA 3HLEA 4R4RA 3UB6A 3QP1A 4OOLA 2W3DA 2M1CA 3UN7A 3WRZA 1CJFA 1AXBA 4HJ6A 5AVEA 4GJ4A 1CQAA 3DW0A 3PAEA 1P9RA 3N6IA 1MPLA 3BFGA 3HLGA 4WEJA 4FD8A 1K4EA 5FI6A 4HI4A 3VFHA 4KZ5A 3M2KA 3T1QB 4Y0OA 5GHYA 1NZUA 1T1CA 2O9CA 1C3BA 5FEGA 2OAQ1 4JXGA 2HP6A 3KX0X 1MXOA 1KE3A 1ES5A 3MKEA 1Z6FA 3TJZC 3E0YA 4XT2B 4XUXA 1K54A 3EGXC 5HARA 3PHYA 1ERMA 3S7PA 4BWIA 3WS4A 2EWWA 4P6ZS 1UWNX 3TSGA 2VZWA 4CLCA 3O5YA 4OQ0A 2X02A 2DRWA 3BY8A 4HOIA 5J7EA 3MXQA 5BOHA 4HP9A 1YLPA 1ACFA 2ZQAA 3VOZA 4DRTA 4JLFA 1VETA 1OPXA 3LCEA 2V9AA 3VP0A 1W5DA 4IJGA 3NI9A 1JWVA 2VGLS 3E4OA 1I2SA 2Y8HA 3K3DA 3CUEC 1U60A 3MXSA 3IT9A 4IUKA 3ZDJA 4JXWA 3IQAA 3LIBA 3O87A 3VOYA 4PHTA 5DF9A 3UB5P 1W8YA 2JKRM 3PBQA 4E6WA 4NEED 4K0WA 4EUZA 2ZM0A 4R3BA 5AVFA 1FSYA 2W1TB 1FCOA 4ME4A 4CLCE 1HVBA 4E04A 3DBAA 3SH8A 3OBFA 1FSWA 2XSSA 3FPWA 4H8RA 4CLCC 1NZOA 3W4OA 2VK3A 1IKGA 3O88A 3C30A 1T1AA 4UA9A 4NETA 4O0PA 2WKQA 3TE8A 1L0EA 2KX6A 2A3UA 3QP8A 3LGOA 3W2ZA 5M18A 4MBHA 3UE3A 2VKSA 1ONHA 4FH4A 5HL1A 4KQQA 1PWDA 2R9WA 1P0ZA 3C8CA 3UPOA 4IBXA 3MQ0A 4P85A 5CXWA 5FI7A 4S2NA 1YKDA 4Z1WA 4LPZA 4GLQA 5HW3A 3IWIA 3T1RA 3LO7A 3BLSA 4JGPA 1L2SA 2V8CA 5F68A 4I38A 3VSKA 1YLYA 4OPZA 4EBNA 4HP4A 1K0KA 1VQQA 2ZMAA 3H82A 4R6LA 2V1ZA 4Y3IA 4BMWA 3LR5A 5EOEA 2W3EA 4LV2A 1NLYA 3FPVA 5IT5A 3KO6A 4WELA 1JTGA 3O86A 3A0SA 4FOFA 4Q0JA 1GHIA 1GSVA 4IUHA 2A24B 1H0MA 3LY3A 3UPPA 4F3LB 3OZHA 4N92A 4HIAA 3CAXA 1OT6A 3SW1A 1JNUA 1W79A 1K56A 2WGWA 3MR0A 1ES2A 1G5UA 1SKOB 4OVDA 3IXDA 1O7EA 3IWQA 4NXBA 5FQKA 2XDMA 5KSCA 2VGKA 4CPKA 1MKMA 1H8ZA 3IH8A 2P08A 4DJ2A 4XXRA 1N9LA 4S2KA 2V2FF 1H5XA 4JF5A 5CTMA 3T4JA 4QJGA 1SKFA 4IVKA 2PR5A 5FSRA 1CF0A 3JVUA 4P6ZM 3RXXA 3CITA 3M2JA 1FIKA 1NXYA 4KUKA 4FUWA 2XR0A 2WGVA 2UWXA 3MF0A 3HREA 4R3AA 5I94A 4HH3A 4WYYA 4ARZB 4P87A 4Q8IA 4HBTA 3T4LA 3ZG5A 5DFXA 1G68A 3I7JA 1FR6A 3EWKA 1ES4A 1DP8A 1TVFA 1YLTA 2XD5A 3IS2B 4PM6A 2OOLA 4DE3A 2L0WA 3VP1A 2Y4AA 3LI9A 5KZHA 1H3QA 5A91A 1IYOA 3T50A 4Y17A 2QYBA 3IX3A 4FSFA 2XF3A 4EEUA 5GLCA 4F94A 4LCLA 4BL2A 2JKTM 4WZ5A 5G4YA 5AQAA 2CMNA 2R78A 1ZG6A 1L0GA 2ZC5B 4CQHA 2WKHA 1XA1A 1TD5A 3GECA 3W4PA 3UNWA 1OJ5A 5U47A 3LI8A 3RH8B 4NK3A 3PBTA 4UA6A 3WRTA 3F1PA 3TG9A 1K55C 3C7UA 2JBFA 3D9YA 4L9FA 2PT7A 2ZC3B 1XXMA 1JWZA 3IXBA 1N9OA 2JC7A 2MJ6A 1XGIA 2PU2A 4GOGA 1CK3A 4H6JA 1PW1A 4HJ3A 3FKVA 2DNSA 3T4OA 3CPTB 5EVIA 3NOPC 3AGDA 4Y0UA 3F1NB 4WL9A 3H7WB 1TS8A 4NXGA 3D4FA 3UE0A 2FFFB 5HWTA 5DVAA 5E2GA 3LIDA 4LV3A 4PM9A 3UMDA 1IEMA 4QD4A 2DCFA 4BD0A 4D2OA 1BLSA 3JVVA 3DWZA 3G32A 1FILA 1PI4A 4KZ3A 3V39A 1OTDA 3NJAA 4ZRRA 1NJ4A 2XGNA 2Y2JA 1NY0A 4MCWA 3LIEA 4U3TA 2INWA 5F83A 4B88A 2VLGA 5FAOA 2EXBA 2QHKA 1IOUA 3AGEA 1FCMA 4WMCD 3TOIA 4S2LA 1CI9A 1XPBA 2AVXA 5CGSA 5FL3A 3F1NA 2XQZA 4JGQA 5J8XA 1JWPA 1DP9A 2Q9NA 2QZ6A 2Y91A 3VSLA 5F69A 1K56D 3NDGA 4JKTA 3UMEA 1S4RA 4PKYG 5CECA 3FKWA 4DKIA 3PTEA 4Y0TA 3IX4A 2W27A 1NYYA 3VP4A 4EERA 1MWTA 1F98A 2ZOIA 4R0QA 4IHQA 5CGXA 1HLUP 5CERA 3PBSA 1IYPA 5HZHA 4LCMA 1K6SA 4LRZE 4GS9B 2Y2IA 3M6BA 4U0TA 1YMSA 2D02A 3VE4A 1IFQA 3SS4A 4U0XA 1DP6A 3E4QA 2BTFP 5CHJA 5A90A 4NXEA 4YFMA 2J3WA 2HDQA 2BG1A 1VM1A 2W3HA 3JYIA 4GHIB 3NC8A 3OPLA 2PBDP 4BENA 3IBJA 3LR3A 3T4QA 3O3VA 1Z09A 4DE0A 3UE1A 5LBRA 4YWZA 4B4ZA 5F1FA 3VFFA 2G2UA 4DE1A 4EQ1A 3PBRA 2WYXA 1K54C 4M3KA 3LEQA 4HH2A 1YLJA 3KYEA 2Y59A 5FAQA 1L0FA 2Z6DA 4KG2A 3GDIA 4WZ5C 2ZBBA 4BJPA 3N4IA 3CLOA 3EOIA 4BBVA 3M6HA 4LLOB 4HESA 3ISGA 2HDSA 2WAFA 3C4PA 2I9VA 4D60A 1VEUB 5FQJA 5FEFA 4B9OA 1XP4A 1PZPA 1MY8A 2ZM8A 3MMHA 3ZNTA 3ZQ5A 4HJ4A 2Z6CA 4Q0IA 2OLVA 5CRFA 5TR7A 3WWXA 4KENB 4EESA 3NHQA 4WN5A 4GCZA 2KOIA 1YQSA 2VV6A 2XH9A 4KQRA 3V50A 1PNEA 4OPQA 4EWFA 3DTIA 2ZQ8A 4DF6A 3KYZA 1BULA 1FOFA 1G6OA 2VX8A 2JKTI 2WKIA 4E3OA 5EVLA 1YM1A 1K6RA 3PAGA 1VEUA 3GTCA 4CLCB 2PBYA 4QPRA 2PD8A 3GSGA 4X6TA 4G3KA 1XX2A 4WF0A 2V1AA 4OP8A 2D01A 5FI2A 5GL9A 1WE4A 3NY4A 4K91A 5IHVA 3A3JA 5EECA 1EROA 1XKZA 3HLBA 1DJBA 2V1BA 3GVBA 5L8MA 3IF5A 2J3TC 5K5BA 3RTYA 4Y5FA 3UO9A 2YKFA 3D3OA 3ZGAB 2G7UA 3KYQA 3MZDA 1L0DA 1SCWA 5JYOA 3MKFA 1STZA 3R7WA 4HNBA 4E3MA 1E4DA 1YT4A 2FH5A 3MFXA 3KSFA 1KDWA 1LT0A 4MMNA 4N9KA 2X01A 5CHUA 4ETXA 3BLMA 4ZJ1A 2B18A 1KVLA 2ZOHA 2XK1A 2XFSA 4HY8A 2GZAA 3CI6A 1SHVA 2PYPA 2FZ0A 1LL8A 2VA0A 4GKUA 4EUVA 5EVID 4QY5A 3FWLA 3LICA 3IX8A 3MS6A 3S7QA 1H8YA 3HL9A 5DKLA 3PYPA 5FQMA 3CG5A 2QJ7A 4ZTKA 1M40A 5GLDA 2W1RA 4KZ8A 5EPHA 4Y7PA 3LR0A 4UEYA 3E2LA 5TGFA 2WGWB 4EU0A 1BLHA 2ZM2A 3QP5A 5AQBA 2PYRA 3LY4A 2XFTA 1MWSA 1PFLA 2J3TD 4KQOA 4XT2A 3T4SA 4IVIA 3QNCA 3EEAA 1OMEA 3SZTA 4DXCA 1V9YA 3NULA 3CUEA 2Y2NA 2Y79A 2ZQ9A 1X0OA 4RX3A 1NRFA 1AWIA 3CPTA 1P9WA 2ZD8A 4P6BA 5L09A 1LSXA 3WS1A 2ZLYA 3HJIA 3NOUC 1BUEA 5HDSA 3ZHHA 3IWOA 4I39A 4DJ3A 1K25A 4EW7A 4O7DA 1CI8A 3KSIA 3OPRA 4OLGA 1D1JA 1K57C 1BLPA 2K31A 3LEZA 3OOVA 5EVIC 4O01A 1VETB 1ERQA 3WS5A 3IF6B 1Q2QA 3ZVWA 1GCEA 3W8KA 2JHEA 4ESPA 5HAIA 3P09A 2I72A 2ZQCA 4PM7A 1GSXA 3K2NA 4N9LA 5HPIA 3UDFA 3NOTC 4AFIA 3LIAA 1GA0A 1MWUA 1VB6A 4DMZA 1KGGA 3N7WA 3MBZA 1NYMA 5FATA 4GD8A 2OV5A 1BLCA 1YSQA 5HL6A 3ZCZA 4QWOA 1P97A 2QKPA 5G18A 3OLOA 4EQIA 5DF7A 2VGJA 2ZJ9A 3HCYA 3BECA 1Y4OA 5J3WA 5GLAA 3IH9A 2LB9A 4MN5A 3BJNA 2K7SA 3P01A 3NDEA 5DF8A 4P0MA 4MBFA 5F5YA 1PRQA 5AJGA 3IS2A 5CEBA 4QY6A 5I5LA 4N1HA 4BD1A 1V9ZA 3KSGA 4DE2A 1YMXA 1D06A 2M7UA 3QP4A 4X25A 5DTSA 3G2ZA 1XJ6A 4UHUA 3CJMA 4CJNA 3BFEA 3MSHA 4MN6A 4EV4A 5A92A 1E3UD 5TJJA 2Y2MA 2ZL1A 2XRNA 4NKPA 4S2MA 4WUJA 2Y55A 1L3LA 4I5SA 1RP5A 2EX9A 4JPMA 1OTIA 4LGWA 5F6AA 1TS6A 4EBPA 3S7OA 3HLWA 5E2FA 1TS0A 4JGRA 5JYPA 1KOUA 2WK0A 1FR1A 1DJAA 3H9WA 2VEAA 1JTDA 2EX2A 4XUZA 3RXWA 4Z9QA 1FQGA 3VP2A 5HDDA 4EXOA 3JPUA 4F3LA 4PAUA 1ODVA 1ZKJA 2JE5A 4I3AA 1MZUA 2PHYA 5FA7A 5F82A 2QJ5A 3BFDA 1E3UA 3G35A 3CHWP 2XA7M 4GS9A 3QP6A 4FH2A 1S4SA 1OTBA 3BEBA 2R9XA 2Z2LB 3Q7VB 2J80A 4PMAA 4S2NC 4OOYA 4O8GA 4X1MA 1IKIA 1K38A 1I2WA 3UB9A 3TW8A 1YPRA 1YAXA 2H28A 3BFCA 2HF6A 3QHYA 3C4OA 3A3FA 1G28A 3T4KA 4FCFA 3LFVA 2HJEA 3GMWA 4KZ9A 4N1XA 3NIAA 4E3NA 3HJKA 1K57A 1Y54A 3C5AA 1EI5A 3IXGA 1S1ZA 2J8YA 5FAPA 2KDKA 2PU4A 4GDNA 4PM8A 4Y15A 2PDRA 1RGYA 1PIOA 1QMFA 4KG6A 1YLZA 1GHPA 1F5MA 3U2AA 4KZAA 3L9KA 1MKIA 2BASA 1HD8A 2HJ9C 4HHDA 4DDSA 1J9MA 3MFDA 3UDXA 4R70A 3N8RA 1OT9A 5KSHA 4JBFA
chains in the Genus database with same CATH topology
4LPZA 3TRCA 4GLQA 5HWWA 5TBMA 4JGPA 4CLCB 1OTAA 4QPRA 4RQ9A 5F68A 4I38A 2PD8A 2GX5A 4G3WA 2NUTC 3B47A 4G3KA 3IBRA 4HP4A 3ULFA 4I3IA 4WF0A 2V1AA 2P04A 2D01A 2V0WA 3H82A 4R6LA 4Y3IA 2WKPA 4BMWA 3LR5A 5HD5A 2W3EA 3UB8A 1NLYA 2V1BA 2W1TA 5L8MA 2JN7A 3FPVA 5IT5A 3KO6A 2J3TC 3EGDC 4WELA 5K5BA 2A24A 3RTYA 4Y5FA 2YKFA 3D3OA 2ZMFA 3OCLA 2G7UA 3A0SA 3KYQA 4FOFA 4Q0JA 5DKKA 1GSVA 4IUHA 1STZA 2A24B 3R7WA 4M4XA 4HNBA 2OWJA 4F3LB 1VHMA 4HIAA 3VE3A 3CAXA 2FH5A 3MFXA 3KSFA 1LT0A 4ETZA 1OT6A 4MMNA 3SW1A 1JNUA 4ETXA 5HDCA 2B18A 2ZOHA 3MR0A 4HY8A 2GZAA 5CX7A 3CI6A 3KSHA 2JKRI 1TF1A 4NXBA 2PYPA 2K2NA 2FZ0A 1LL8A 2VA0A 4KUOA 3V67A 4EUVA 1MKMA 3H82B 2VJWA 1S1YA 1XJ2A 3FC7A 3LICA 2P08A 4DJ2A 3RFBA 1W63M 1N9LA 4BBTA 3S7QA 2P7JA 5C5KA 2W3FA 3R4KA 5TBMB 4YNRA 5DKLA 3D72A 3PYPA 3T4JA 4UQIM 4EEPA 1T1BA 2EWVA 2PR5A 3JVUA 1Y28A 4II7A 2QJ7A 1ZHHB 1TS7A 4P6ZM 4PKYA 4JGOA 3P7NA 2W1RA 3VOLA 3CITA 1UWPX 5HD3A 2XA7S 3EQVA 3LR0A 4BBUA 4KUKA 4UEYA 5HPFA 2VGLM 2V0UA 2WKRA 4EU0A 2PD7A 3MF0A 4UQIS 1N9NA 3E98A 5MC7A 4R3AA 2XROA 3C2WA 4MDZA 2PYRA 1MC0A 4HH3A 4ARZB 3F1OB 2J3TD 3T4LA 5DFXA 2HGVA 4KQOA 4XT2A 3T4SA 4CLCD 1T19A 3EEAA 3H7WA 1NWZA 3EWKA 1DP8A 4ARZA 1OJGA 3S7NA 1V9YA 5EFWA 3CUEA 3IS2B 1T18A 2Y79A 1X0OA 2OOLA 2L0WA 2VV7A 1UGUA 5KIZA 3LI9A 1H3QA 1P9WA 1ZTUA 2QWSA 3T50A 2QYBA 1LSXA 4FSFA 4EEUA 1XJ3A 3NOUC 3BY9A 3HJIA 2L1MA 4I3JA 2EA9A 5HDSA 2JKTM 2GJ3A 1F9IA 4I39A 1H8MA 4DJ3A 5G4YA 4EW7A 3T4TA 2CMNA 2R78A 3KSIA 1GSWA 4OOMA 2K31A 2YKHA 3OOVA 4O01A 4Q0HA 4CQHA 1YSPA 2VV8A 1TD5A 3GECA 3F1OA 1OJ5A 2OAP1 3LI8A 3RH8B 5HSQA 4GHIA 3PBTA 2JHEA 3F1PA 1WA9A 4L9FA 2PT7A 1GSXA 3UE6A 1N9OA 3K2NA 5DJTA 5HPIA 2MJ6A 2O9BA 4HQAA 4WLAA 3UB7A 3NOTC 5A8BA 4H6JA 4AFIA 3LIAA 4DMZA 1EW0A 1VB6A 4HJ3A 3VV4A 1S67L 1DRMA 2O0YA 3T4OA 3EQUA 3NOPC 4LRYC 1BYWA 3F1NB 4WL9A 3H7WB 5DJUA 1YSQA 3LYXA 1TS8A 3B42A 4NXGA 5HL6A 1P97A 2QKPA 4L9EA 3B33A 2PR6A 5HWTA 3LIDA 3UMDA 3PXPA 3OLOA 4GW9A 3PR6A 2DMWA 5HWVA 3JVVA 3PBOA 3LUQA 5G4ZA 3EEHA 1LSVA 3HCYA 1XFNA 5J3WA 1S66L 5J4EA 1OTDA 3NJAA 4ZRRA 2LB9A 3A0VA 4MN5A 4MCWA 3BJNA 2K7SA 3OCNA 3LIEA 3P01A 2INWA 4MN7A 2VLGA 2QHKA 3UB6A 1IOUA 2LB5A 3FG8A 4H6JB 2L4RA 4OOLA 3CWFA 1D7EA 5F5YA 3MJQA 2W3DA 3ICYA 5AJGA 2M1CA 3IS2A 5FL3A 3F1NA 5I5LA 4JGQA 1DP9A 1NLZA 1V9ZA 5F69A 4HJ6A 3KSGA 5AVEA 1D06A 4GJ4A 2M7UA 3E4PA 3UMEA 1S4RA 4PKYG 4DN0A 1P9RA 1XJ6A 4WEJA 4MN6A 2W27A 5TJJA 4HI4A 4B93A 4EERA 5IU1A 3ZYTA 1F98A 2ZOIA 2XRNA 4NKPA 4IHQA 4WUJA 1T1CA 4I5SA 3PBSA 5HZHA 2O9CA 4LRZE 4GS9B 1OTIA 4KQDA 2OAQ1 2D02A 3KX0X 3G6OA 3VE4A 1IFQA 5F6AA 2KLIA 1DP6A 4Y2FA 3TJZC 3E0YA 4XT2B 3E4QA 1TS6A 2O9AA 3EGXC 3S7OA 3PHYA 1XJ4A 3S7PA 4NXEA 4BWIA 5IS1A 2J3WA 2EWWA 1TS0A 4JGRA 2W3HA 1KOUA 1LSWA 4P6ZS 1UWNX 3H9WA 4GHIB 2VEAA 2VZWA 2OWHA 4CLCA 3O5YA 3IBJA 3F1PB 3LR3A 3T4QA 4K08A 5LBRA 4YWZA 3BY8A 4HOIA 5HDDA 5J7EA 4EXOA 3MXQA 4F3LA 4HP9A 4PAUA 1ODVA 2W0NA 3BW6A 4L9GA 4I3AA 1MZUA 2PHYA 4EQ1A 3PBRA 2HV1A 2QJ5A 2XA7M 4YOFA 1OPXA 4GS9A 1S4SA 3BQ8A 4HH2A 1OTBA 2V9AA 4IJGA 3LIFA 2VGLS 2Z6DA 3GDIA 3E4OA 2J80A 2ZBBA 1NRJA 4BJPA 2Y8HA 3K3DA 3CUEC 4G3VA 3CLOA 4O8GA 3EOIA 2IA2A 4IUKA 3LIBA 4BBVA 1OTEA 4LLOB 3UB9A 3TW8A 4PHTA 1YAXA 2H28A 2O99A 2ZMVA 5DF9A 2HF6A 2JKRM 3PBQA 5DFYA 3C38A 4NEED 1XFQA 1G28A 5AVFA 2I9VA 4WEKA 2W1TB 3K3CA 4ME4A 4CLCE 3T4KA 4EETB 4E04A 2M7VA 4B9OA 3DBAA 3PBNA 3OBFA 2HJEA 3LFVA 2XSSA 3MMHA 2GNXA 2NUPC 1W63Q 3FPWA 4CLCC 3ZQ5A 4HJ4A 3HJKA 3C30A 2Z6CA 4L0LA 3MQOA 4Q0IA 1T1AA 2B02A 4LRXC 3BWLA 4NXFA 1S1ZA 4EESA 3NHQA 4WN5A 3LR4A 4O0PA 2KDKA 4GCZA 2KOIA 2WKQA 3MQQA 2VV6A 3TE8A 3A0RA 2PDRA 2KX6A 3BQAA 3OC2A 3W2ZA 3KYZA 3U2AA 1F5MA 3UE3A 2W3GA 1G6OA 2VX8A 2BASA 2VKSA 3R7WB 2JKTI 2A2LA 2HJ9C 4HHDA 4R38A 4R70A 1OT9A 1P0ZA 5KSHA 3C8CA 3MQ0A 1YKDA 4Z1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMD A;  2WKR A;  4K08 A;  4LPZ A;  2PD7 A;  4YWZ A;  3BY8 A;  1N9N A;  4HOI A;  3OLO A;  4GW9 A;  5HDD A;  5TBM A;  5HWW A;  5J7E A;  4EXO A;  4JGP A;  4R3A A;  1OTA A;  3C2W A;  3MXQ A;  4RQ9 A;  5F68 A;  4F3L A;  4I38 A;  5HWV A;  2PD8 A;  4HP9 A;  1ODV A;  2PYR A;  3LUQ A;  4HH3 A;  2W0N A;  3EEH A;  3F1O B;  5G4Z A;  4L9G A;  1LSV A;  3IBR A;  1XFN A;  4HP4 A;  3ULF A;  4I3A A;  4I3I A;  1MZU A;  2PHY A;  2V1A A;  4WF0 A;  5J3W A;  4EQ1 A;  2D01 A;  4XT2 A;  1S66 L;  2V0W A;  3H82 A;  5J4E A;  1T19 A;  1OTD A;  3NJA A;  4R70 A;  3H7W A;  1NWZ A;  2HV1 A;  3EWK A;  2QJ5 A;  4R6L A;  3A0V A;  1DP8 A;  4MN5 A;  1OJG A;  4EEU A;  2K7S A;  2WKP A;  1V9Y A;  3LIE A;  5EFW A;  2INW A;  4GS9 A;  5HD5 A;  1S4S A;  3IS2 B;  1T18 A;  2VLG A;  3UB8 A;  2V1B A;  4HH2 A;  2QHK A;  2JN7 A;  1X0O A;  3UB6 A;  1OTB A;  2OOL A;  2V9A A;  4F3L B;  3FG8 A;  2L0W A;  2A24 A;  4H6J B;  2L4R A;  3LIF A;  2VV7 A;  3RTY A;  1UGU A;  2YKF A;  3CWF A;  5KIZ A;  1D7E A;  5F5Y A;  3LI9 A;  3MJQ A;  3A0S A;  2Z6D A;  3ICY A;  2M1C A;  3E4O A;  3GDI A;  3IS2 A;  2J80 A;  2QWS A;  2ZBB A;  5DKK A;  3T50 A;  1GSV A;  3F1N A;  3K3D A;  1LSX A;  4JGQ A;  5I5L A;  2A24 B;  1DP9 A;  3CLO A;  4HNB A;  4M4X A;  1XJ3 A;  3BY9 A;  3HJI A;  2L1M A;  1V9Z A;  3NOU C;  2OWJ A;  4HJ6 A;  5F69 A;  4I3J A;  2EA9 A;  1D06 A;  4HIA A;  5AVE A;  5HDS A;  3VE3 A;  3CAX A;  3LIB A;  3MFX A;  3E4P A;  4BBV A;  1LT0 A;  1OTE A;  3UME A;  2GJ3 A;  1F9I A;  1OT6 A;  4I39 A;  4LLO B;  3UB9 A;  4DJ3 A;  5G4Y A;  3SW1 A;  1S4R A;  2H28 A;  1JNU A;  4PKY G;  4EW7 A;  2CMN A;  2R78 A;  1GSW A;  1XJ6 A;  5HDC A;  1XFQ A;  1G28 A;  2YKH A;  2ZOH A;  3MR0 A;  4HY8 A;  2I9V A;  4MN6 A;  5AVF A;  3K3C A;  2W27 A;  2VV8 A;  3GEC A;  4HI4 A;  4EET B;  4EER A;  4E04 A;  4B9O A;  4NXB A;  5IU1 A;  2PYP A;  1F98 A;  1OJ5 A;  3F1O A;  2ZOI A;  1LL8 A;  3LI8 A;  3RH8 B;  5HSQ A;  4KUO A;  4GHI A;  4WUJ A;  2JHE A;  3H82 B;  1T1C A;  4I5S A;  3ZQ5 A;  4HJ4 A;  3HJK A;  1S1Y A;  3F1P A;  1WA9 A;  2Z6C A;  4L9F A;  3MQO A;  1XJ2 A;  3FC7 A;  3LIC A;  1T1A A;  5HZH A;  2B02 A;  4DJ2 A;  4LRX C;  3BWL A;  4LRZ E;  4GS9 B;  4NXF A;  1N9L A;  4BBT A;  1GSX A;  1OTI A;  1N9O A;  1S1Z A;  5DJT A;  3UE6 A;  2P7J A;  4KQD A;  4EES A;  3NHQ A;  4WN5 A;  2D02 A;  3KX0 X;  2KDK A;  4GCZ A;  4HQA A;  3G6O A;  4WLA A;  2WKQ A;  3NOT C;  3MQQ A;  5DKL A;  5F6A A;  3UB7 A;  2VV6 A;  3VE4 A;  3D72 A;  4H6J A;  5A8B A;  3PYP A;  5TBM B;  3A0R A;  3LIA A;  1DP6 A;  1EW0 A;  1VB6 A;  1T1B A;  2KX6 A;  2PDR A;  4HJ3 A;  4EEP A;  1S67 L;  1DRM A;  4XT2 B;  3E4Q A;  2PR5 A;  1TS6 A;  3NOP C;  3PHY A;  4LRY C;  1BYW A;  1XJ4 A;  3F1N B;  1Y28 A;  2QJ7 A;  1TS7 A;  2BAS A;  3H7W B;  4NXE A;  4PKY A;  4WL9 A;  5DJU A;  5IS1 A;  4HHD A;  1TS0 A;  4R38 A;  3LYX A;  1TS8 A;  3P7N A;  4JGO A;  4JGR A;  4NXG A;  1KOU A;  3VOL A;  1LSW A;  1P97 A;  1UWP X;  1UWN X;  2QKP A;  3H9W A;  2VEA A;  4GHI B;  1OT9 A;  3B33 A;  2OWH A;  4L9E A;  5HD3 A;  4BBU A;  1P0Z A;  2PR6 A;  5HWT A;  3C8C A;  4KUK A;  3F1P B;  3LID A;  2V0U A; 
#chains in the Genus database with same CATH topology
 3S4X A;  5CED A;  4JF6 A;  1OTA A;  4RQ9 A;  3V5M A;  2GX5 A;  2NUT C;  4I3I A;  2P04 A;  3NEC A;  2V0W A;  1PZO A;  2WKP A;  1F2K A;  5GHX A;  3FYZ A;  1JVJ A;  3UB8 A;  2ZL1 B;  2JN7 A;  2A24 A;  3G30 A;  3OCL A;  3DTE A;  5DKK A;  4R4S A;  1GHM A;  2OWJ A;  2BLS A;  3VE3 A;  2EFX A;  2HP9 A;  4ETZ A;  3BRM A;  1TEM A;  4X55 A;  1W7F A;  5HDC A;  1MWR A;  3HBR A;  2ZC7 A;  4X53 A;  5CX7 A;  3KSH A;  4PM5 A;  1TF1 A;  2K2N A;  2RCX A;  4KUO A;  3V67 A;  4MNR A;  3H82 B;  2VJW A;  1S1Y A;  5CGW A;  3VMA A;  2Q0O A;  1XJ2 A;  3FC7 A;  4OON A;  4YIN A;  5L2F A;  3RFB A;  4BBT A;  4OLD A;  5C5K A;  2W3F A;  3R4K A;  5TBM B;  3MZF A;  5FDS A;  4YNR A;  3HLD A;  4A5R A;  4UQI M;  3ZFZ A;  4EEP A;  1KDS A;  5FQI A;  1KVM A;  4KZ4 A;  3N8S A;  1ZHH B;  1TS7 A;  3SS3 A;  4X68 A;  4PKY A;  4RYE A;  2HDR A;  2Y2K A;  3P7N A;  3VOL A;  1N4O A;  5HD3 A;  3T1X A;  2Y2G A;  4BBU A;  4RVA A;  4JF4 A;  2V0U A;  4X69 A;  3DWK A;  2Y2Q A;  2PD7 A;  5EOO A;  1SDN A;  3OPH A;  1N9N A;  2EX6 A;  1SKO A;  5MC7 A;  2H5S A;  3N8L A;  3C2W A;  5E43 A;  2ZC6 B;  4MDZ A;  4S2O A;  1MC0 A;  3F1O B;  5AQ9 A;  2ZC4 B;  5HFO A;  2QMI A;  1SDE A;  1HZO A;  5E2E A;  4ARZ A;  3S7N A;  5EFW A;  4E6X A;  5EV0 A;  1T18 A;  1N9B A;  2EFU A;  1MBL A;  2VV7 A;  1UGU A;  2HP5 A;  5KIZ A;  1K55 A;  2Y2P A;  1ZTU A;  2QWS A;  1XJ3 A;  1IYQ A;  2L1M A;  1I5Q A;  2WZX A;  1BTL A;  4I3J A;  4WZ4 A;  1K4F A;  3U4L P;  4OQH A;  1YLW A;  1RCJ A;  1KE4 A;  3T4T A;  4OOM A;  5L10 A;  4Q0H A;  4GDB A;  3HLC A;  4BLM A;  3Q07 A;  3F1O A;  2OAP 1;  3WS2 A;  4GHI A;  4OQI A;  4IBR A;  1WA9 A;  3NBL A;  2OLU A;  3UE6 A;  5DJT A;  3HLF A;  3CMZ A;  1E25 A;  1EW0 A;  3VV4 A;  1LL9 A;  1S67 L;  2O0Y A;  4ZDX A;  1RGZ A;  1TDG A;  4LRY C;  1BYW A;  4QB8 A;  2V8F A;  3ZG9 B;  3B3X A;  3LYX A;  2GDN A;  3HUM A;  2E8I A;  4L9E A;  3CZD A;  2ZQ7 A;  4WMC A;  1DJC A;  1WYC A;  3GV9 A;  3BFF A;  3PXP A;  3QP2 A;  1A0K A;  2C6W B;  2HPB A;  3LUQ A;  1XFN A;  3L7H A;  1S66 L;  4C6Y A;  5FAS A;  1DY6 A;  3UPN A;  1SZV A;  1LI0 A;  3OCN A;  3Q7V A;  1WYB A;  4MN7 A;  5HX9 A;  3UDI A;  5L07 A;  2LB5 A;  3FG8 A;  4H6J B;  1LLB A;  4OPR A;  2L4R A;  2IWD A;  3CWF A;  1D7E A;  3MJQ A;  3ICY A;  2WAD A;  3AGF A;  4OKP A;  2A49 A;  2B95 A;  1NLZ A;  3BM6 A;  5FDH A;  3E4P A;  3FZC A;  2WZZ A;  3HUN A;  2V20 A;  1FCN A;  3ZVT A;  4DN0 A;  3G31 A;  4QHC A;  3G34 A;  1G6A A;  4B93 A;  5IU1 A;  3ZYT A;  3IF6 A;  1M6K A;  4DDY A;  4KQD A;  3G6O A;  5HAP A;  4E3K A;  2KLI A;  4E3I A;  4Y2F A;  3RJU A;  2O9A A;  3SH9 A;  3A3D A;  2HZ5 A;  1XJ4 A;  2RL3 A;  5IS1 A;  1LSW A;  2OWH A;  5GHZ A;  3F1P B;  4K08 A;  4E3J A;  2ACG A;  5E2H A;  4BQM A;  3SS5 A;  4MLL A;  4ZAM A;  2W0N A;  3BW6 A;  1XA7 A;  4L9G A;  1KGF A;  3SH7 A;  3WS0 A;  4OPY A;  1Q2P A;  2HV1 A;  3V3S A;  4RA7 A;  4K0X A;  1W8Q A;  4YOF A;  1PYY A;  4GN2 A;  3BQ8 A;  2JKF A;  4HBU A;  3DTM A;  2X71 A;  3LIF A;  2XEP A;  2H10 A;  1NRJ A;  4OP5 A;  2EX8 A;  4G3V A;  2IA2 A;  1O07 A;  4RX2 A;  1OTE A;  1ALQ A;  2O99 A;  2ZMV A;  3E2K A;  3Q1F A;  4QU3 A;  5DFY A;  3C38 A;  3ITB A;  3ZNY A;  1XFQ A;  3GR2 A;  3P98 A;  3OPP A;  2J7V A;  4WEK A;  3K3C A;  3ZG8 B;  2EXA A;  4EET B;  3T1S A;  2M7V A;  3UY6 A;  3PBN A;  4IED A;  1BT5 A;  2GNX A;  2NUP C;  1W63 Q;  1XGJ A;  2Y2L A;  3T12 B;  1J3W A;  4L0L A;  3MQO A;  2B02 A;  4LRX C;  3BWL A;  4NXF A;  3MZE A;  1PWC A;  4KG5 A;  3LR4 A;  1LHY A;  3MQQ A;  4B4X A;  3Q7Z A;  5DTK A;  3A0R A;  4ZBE A;  2JCH A;  3BQA A;  3OC2 A;  4GNU A;  2WGI A;  4MBK A;  4S2I A;  1EWZ A;  1QME A;  2W3G A;  2Q9M A;  3R7W B;  2A2L A;  3G2Y A;  3HUO A;  4R38 A;  5EUA A;  2WKE A;  1GA9 A;  2PRF A;  3TRC A;  4LFU A;  4LV1 A;  2B5R A;  5HWW A;  5TBM A;  3S22 A;  2PAV P;  3A3I A;  1S6R A;  2Z2M B;  3DAV A;  4G3W A;  3B47 A;  4HEF A;  2P74 A;  3IBR A;  3ULF A;  3Q82 A;  4GD6 A;  5AQ7 A;  5HAQ A;  2XLN A;  5KMW A;  2JKG A;  5HD5 A;  2J9P A;  1PI5 A;  2W1T A;  4UAA A;  3EGD C;  2P9V A;  2Y2O A;  1BZA A;  2ZMF A;  4ZJ2 A;  2P9V B;  4M4X A;  4NG2 A;  1VHM A;  1ESI A;  2J9O A;  1KE0 A;  2H0T A;  3IXH A;  4MEZ A;  2Y2H A;  1CEG A;  5M1A A;  4FTX A;  2JKR I;  4GZB A;  4X1L A;  4ID4 A;  5CHM A;  1BSG A;  2FFY A;  4DXB A;  1W63 M;  1KGE A;  2P7J A;  3SOI A;  3DTK A;  3V3R A;  2IWB A;  4C3Q A;  5EM0 A;  3D72 A;  2WUQ A;  4KZ6 A;  1T1B A;  1ES3 A;  2EWV A;  4S2P A;  3QNB A;  1Y28 A;  4II7 A;  2QPN A;  3W4Q A;  3GRJ A;  4JGO A;  4R1G A;  4JXS A;  1UWP X;  2XA7 S;  4C75 A;  3EQV A;  5HPF A;  2VGL M;  2XD1 A;  5M19 A;  2WKR A;  5TFQ A;  3NCK A;  4KZB A;  3MXR A;  4UQI S;  3E98 A;  2XRO A;  4R3J A;  5CTN A;  2HGV A;  3ZG7 B;  4CLC D;  1T19 A;  4EBL A;  3H7W A;  1NWZ A;  4R23 A;  4WM9 A;  5EE8 A;  1OJG A;  5EM1 A;  2OSU A;  2G2W A;  4LV0 A;  1IEL A;  4PPR A;  4S2J A;  5EVI B;  3ITA A;  4JXV A;  3IF6 C;  2WAE A;  3BY9 A;  1IYS A;  4Y13 A;  2EA9 A;  3IHB A;  2GJ3 A;  1F9I A;  5EVE A;  1H8M A;  2IWC A;  1GSW A;  3VP3 A;  2YKH A;  1ESU A;  1YSP A;  3Q81 A;  5FQ9 A;  3S1Y A;  2C5W B;  2VV8 A;  4UA7 A;  1ONG A;  1ZC2 A;  5F1G A;  4KZ7 A;  1S0W A;  5HSQ A;  3G4P A;  1PW8 A;  1CEF A;  3FV7 A;  4OH0 A;  2CC1 A;  2ZQD A;  4GB7 A;  3C7V A;  2HDU A;  1LL5 A;  5DTT A;  4OQG A;  2O9B A;  4X56 A;  4HQA A;  4WLA A;  3UB7 A;  5A8B A;  3ZG0 A;  2H0Y A;  5D3O A;  1DRM A;  3EQU A;  4E3L A;  5A93 A;  3BYD A;  1TDL A;  5DJU A;  4WBG A;  3B42 A;  1ZG4 A;  3B33 A;  2PR6 A;  1HTZ A;  4BL3 A;  4GW9 A;  3GQZ A;  3PR6 A;  2DMW A;  5HWV A;  3HVF A;  5GLB A;  3PBO A;  5G4Z A;  3EEH A;  1LSV A;  2UV0 E;  1LI9 A;  1PWG A;  2E8J A;  4ZJ3 A;  5J4E A;  3IHA A;  4LEN A;  3A0V A;  3A3E A;  5FQQ A;  3HLE A;  4R4R A;  3UB6 A;  3QP1 A;  4OOL A;  2W3D A;  2M1C A;  3UN7 A;  3WRZ A;  1CJF A;  1AXB A;  4HJ6 A;  5AVE A;  4GJ4 A;  1CQA A;  3DW0 A;  3PAE A;  1P9R A;  3N6I A;  1MPL A;  3BFG A;  3HLG A;  4WEJ A;  4FD8 A;  1K4E A;  5FI6 A;  4HI4 A;  3VFH A;  4KZ5 A;  3M2K A;  3T1Q B;  4Y0O A;  5GHY A;  1NZU A;  1T1C A;  2O9C A;  1C3B A;  5FEG A;  2OAQ 1;  4JXG A;  2HP6 A;  3KX0 X;  1MXO A;  1KE3 A;  1ES5 A;  3MKE A;  1Z6F A;  3TJZ C;  3E0Y A;  4XT2 B;  4XUX A;  1K54 A;  3EGX C;  5HAR A;  3PHY A;  1ERM A;  3S7P A;  4BWI A;  3WS4 A;  2EWW A;  4P6Z S;  1UWN X;  3TSG A;  2VZW A;  4CLC A;  3O5Y A;  4OQ0 A;  2X02 A;  2DRW A;  3BY8 A;  4HOI A;  5J7E A;  3MXQ A;  5BOH A;  4HP9 A;  1YLP A;  1ACF A;  2ZQA A;  3VOZ A;  4DRT A;  4JLF A;  1VET A;  1OPX A;  3LCE A;  2V9A A;  3VP0 A;  1W5D A;  4IJG A;  3NI9 A;  1JWV A;  2VGL S;  3E4O A;  1I2S A;  2Y8H A;  3K3D A;  3CUE C;  1U60 A;  3MXS A;  3IT9 A;  4IUK A;  3ZDJ A;  4JXW A;  3IQA A;  3LIB A;  3O87 A;  3VOY A;  4PHT A;  5DF9 A;  3UB5 P;  1W8Y A;  2JKR M;  3PBQ A;  4E6W A;  4NEE D;  4K0W A;  4EUZ A;  2ZM0 A;  4R3B A;  5AVF A;  1FSY A;  2W1T B;  1FCO A;  4ME4 A;  4CLC E;  1HVB A;  4E04 A;  3DBA A;  3SH8 A;  3OBF A;  1FSW A;  2XSS A;  3FPW A;  4H8R A;  4CLC C;  1NZO A;  3W4O A;  2VK3 A;  1IKG A;  3O88 A;  3C30 A;  1T1A A;  4UA9 A;  4NET A;  4O0P A;  2WKQ A;  3TE8 A;  1L0E A;  2KX6 A;  2A3U A;  3QP8 A;  3LGO A;  3W2Z A;  5M18 A;  4MBH A;  3UE3 A;  2VKS A;  1ONH A;  4FH4 A;  5HL1 A;  4KQQ A;  1PWD A;  2R9W A;  1P0Z A;  3C8C A;  3UPO A;  4IBX A;  3MQ0 A;  4P85 A;  5CXW A;  5FI7 A;  4S2N A;  1YKD A;  4Z1W A;  4LPZ A;  4GLQ A;  5HW3 A;  3IWI A;  3T1R A;  3LO7 A;  3BLS A;  4JGP A;  1L2S A;  2V8C A;  5F68 A;  4I38 A;  3VSK A;  1YLY A;  4OPZ A;  4EBN A;  4HP4 A;  1K0K A;  1VQQ A;  2ZMA A;  3H82 A;  4R6L A;  2V1Z A;  4Y3I A;  4BMW A;  3LR5 A;  5EOE A;  2W3E A;  4LV2 A;  1NLY A;  3FPV A;  5IT5 A;  3KO6 A;  4WEL A;  1JTG A;  3O86 A;  3A0S A;  4FOF A;  4Q0J A;  1GHI A;  1GSV A;  4IUH A;  2A24 B;  1H0M A;  3LY3 A;  3UPP A;  4F3L B;  3OZH A;  4N92 A;  4HIA A;  3CAX A;  1OT6 A;  3SW1 A;  1JNU A;  1W79 A;  1K56 A;  2WGW A;  3MR0 A;  1ES2 A;  1G5U A;  1SKO B;  4OVD A;  3IXD A;  1O7E A;  3IWQ A;  4NXB A;  5FQK A;  2XDM A;  5KSC A;  2VGK A;  4CPK A;  1MKM A;  1H8Z A;  3IH8 A;  2P08 A;  4DJ2 A;  4XXR A;  1N9L A;  4S2K A;  2V2F F;  1H5X A;  4JF5 A;  5CTM A;  3T4J A;  4QJG A;  1SKF A;  4IVK A;  2PR5 A;  5FSR A;  1CF0 A;  3JVU A;  4P6Z M;  3RXX A;  3CIT A;  3M2J A;  1FIK A;  1NXY A;  4KUK A;  4FUW A;  2XR0 A;  2WGV A;  2UWX A;  3MF0 A;  3HRE A;  4R3A A;  5I94 A;  4HH3 A;  4WYY A;  4ARZ B;  4P87 A;  4Q8I A;  4HBT A;  3T4L A;  3ZG5 A;  5DFX A;  1G68 A;  3I7J A;  1FR6 A;  3EWK A;  1ES4 A;  1DP8 A;  1TVF A;  1YLT A;  2XD5 A;  3IS2 B;  4PM6 A;  2OOL A;  4DE3 A;  2L0W A;  3VP1 A;  2Y4A A;  3LI9 A;  5KZH A;  1H3Q A;  5A91 A;  1IYO A;  3T50 A;  4Y17 A;  2QYB A;  3IX3 A;  4FSF A;  2XF3 A;  4EEU A;  5GLC A;  4F94 A;  4LCL A;  4BL2 A;  2JKT M;  4WZ5 A;  5G4Y A;  5AQA A;  2CMN A;  2R78 A;  1ZG6 A;  1L0G A;  2ZC5 B;  4CQH A;  2WKH A;  1XA1 A;  1TD5 A;  3GEC A;  3W4P A;  3UNW A;  1OJ5 A;  5U47 A;  3LI8 A;  3RH8 B;  4NK3 A;  3PBT A;  4UA6 A;  3WRT A;  3F1P A;  3TG9 A;  1K55 C;  3C7U A;  2JBF A;  3D9Y A;  4L9F A;  2PT7 A;  2ZC3 B;  1XXM A;  1JWZ A;  3IXB A;  1N9O A;  2JC7 A;  2MJ6 A;  1XGI A;  2PU2 A;  4GOG A;  1CK3 A;  4H6J A;  1PW1 A;  4HJ3 A;  3FKV A;  2DNS A;  3T4O A;  3CPT B;  5EVI A;  3NOP C;  3AGD A;  4Y0U A;  3F1N B;  4WL9 A;  3H7W B;  1TS8 A;  4NXG A;  3D4F A;  3UE0 A;  2FFF B;  5HWT A;  5DVA A;  5E2G A;  3LID A;  4LV3 A;  4PM9 A;  3UMD A;  1IEM A;  4QD4 A;  2DCF A;  4BD0 A;  4D2O A;  1BLS A;  3JVV A;  3DWZ A;  3G32 A;  1FIL A;  1PI4 A;  4KZ3 A;  3V39 A;  1OTD A;  3NJA A;  4ZRR A;  1NJ4 A;  2XGN A;  2Y2J A;  1NY0 A;  4MCW A;  3LIE A;  4U3T A;  2INW A;  5F83 A;  4B88 A;  2VLG A;  5FAO A;  2EXB A;  2QHK A;  1IOU A;  3AGE A;  1FCM A;  4WMC D;  3TOI A;  4S2L A;  1CI9 A;  1XPB A;  2AVX A;  5CGS A;  5FL3 A;  3F1N A;  2XQZ A;  4JGQ A;  5J8X A;  1JWP A;  1DP9 A;  2Q9N A;  2QZ6 A;  2Y91 A;  3VSL A;  5F69 A;  1K56 D;  3NDG A;  4JKT A;  3UME A;  1S4R A;  4PKY G;  5CEC A;  3FKW A;  4DKI A;  3PTE A;  4Y0T A;  3IX4 A;  2W27 A;  1NYY A;  3VP4 A;  4EER A;  1MWT A;  1F98 A;  2ZOI A;  4R0Q A;  4IHQ A;  5CGX A;  1HLU P;  5CER A;  3PBS A;  1IYP A;  5HZH A;  4LCM A;  1K6S A;  4LRZ E;  4GS9 B;  2Y2I A;  3M6B A;  4U0T A;  1YMS A;  2D02 A;  3VE4 A;  1IFQ A;  3SS4 A;  4U0X A;  1DP6 A;  3E4Q A;  2BTF P;  5CHJ A;  5A90 A;  4NXE A;  4YFM A;  2J3W A;  2HDQ A;  2BG1 A;  1VM1 A;  2W3H A;  3JYI A;  4GHI B;  3NC8 A;  3OPL A;  2PBD P;  4BEN A;  3IBJ A;  3LR3 A;  3T4Q A;  3O3V A;  1Z09 A;  4DE0 A;  3UE1 A;  5LBR A;  4YWZ A;  4B4Z A;  5F1F A;  3VFF A;  2G2U A;  4DE1 A;  4EQ1 A;  3PBR A;  2WYX A;  1K54 C;  4M3K A;  3LEQ A;  4HH2 A;  1YLJ A;  3KYE A;  2Y59 A;  5FAQ A;  1L0F A;  2Z6D A;  4KG2 A;  3GDI A;  4WZ5 C;  2ZBB A;  4BJP A;  3N4I A;  3CLO A;  3EOI A;  4BBV A;  3M6H A;  4LLO B;  4HES A;  3ISG A;  2HDS A;  2WAF A;  3C4P A;  2I9V A;  4D60 A;  1VEU B;  5FQJ A;  5FEF A;  4B9O A;  1XP4 A;  1PZP A;  1MY8 A;  2ZM8 A;  3MMH A;  3ZNT A;  3ZQ5 A;  4HJ4 A;  2Z6C A;  4Q0I A;  2OLV A;  5CRF A;  5TR7 A;  3WWX A;  4KEN B;  4EES A;  3NHQ A;  4WN5 A;  4GCZ A;  2KOI A;  1YQS A;  2VV6 A;  2XH9 A;  4KQR A;  3V50 A;  1PNE A;  4OPQ A;  4EWF A;  3DTI A;  2ZQ8 A;  4DF6 A;  3KYZ A;  1BUL A;  1FOF A;  1G6O A;  2VX8 A;  2JKT I;  2WKI A;  4E3O A;  5EVL A;  1YM1 A;  1K6R A;  3PAG A;  1VEU A;  3GTC A;  4CLC B;  2PBY A;  4QPR A;  2PD8 A;  3GSG A;  4X6T A;  4G3K A;  1XX2 A;  4WF0 A;  2V1A A;  4OP8 A;  2D01 A;  5FI2 A;  5GL9 A;  1WE4 A;  3NY4 A;  4K91 A;  5IHV A;  3A3J A;  5EEC A;  1ERO A;  1XKZ A;  3HLB A;  1DJB A;  2V1B A;  3GVB A;  5L8M A;  3IF5 A;  2J3T C;  5K5B A;  3RTY A;  4Y5F A;  3UO9 A;  2YKF A;  3D3O A;  3ZGA B;  2G7U A;  3KYQ A;  3MZD A;  1L0D A;  1SCW A;  5JYO A;  3MKF A;  1STZ A;  3R7W A;  4HNB A;  4E3M A;  1E4D A;  1YT4 A;  2FH5 A;  3MFX A;  3KSF A;  1KDW A;  1LT0 A;  4MMN A;  4N9K A;  2X01 A;  5CHU A;  4ETX A;  3BLM A;  4ZJ1 A;  2B18 A;  1KVL A;  2ZOH A;  2XK1 A;  2XFS A;  4HY8 A;  2GZA A;  3CI6 A;  1SHV A;  2PYP A;  2FZ0 A;  1LL8 A;  2VA0 A;  4GKU A;  4EUV A;  5EVI D;  4QY5 A;  3FWL A;  3LIC A;  3IX8 A;  3MS6 A;  3S7Q A;  1H8Y A;  3HL9 A;  5DKL A;  3PYP A;  5FQM A;  3CG5 A;  2QJ7 A;  4ZTK A;  1M40 A;  5GLD A;  2W1R A;  4KZ8 A;  5EPH A;  4Y7P A;  3LR0 A;  4UEY A;  3E2L A;  5TGF A;  2WGW B;  4EU0 A;  1BLH A;  2ZM2 A;  3QP5 A;  5AQB A;  2PYR A;  3LY4 A;  2XFT A;  1MWS A;  1PFL A;  2J3T D;  4KQO A;  4XT2 A;  3T4S A;  4IVI A;  3QNC A;  3EEA A;  1OME A;  3SZT A;  4DXC A;  1V9Y A;  3NUL A;  3CUE A;  2Y2N A;  2Y79 A;  2ZQ9 A;  1X0O A;  4RX3 A;  1NRF A;  1AWI A;  3CPT A;  1P9W A;  2ZD8 A;  4P6B A;  5L09 A;  1LSX A;  3WS1 A;  2ZLY A;  3HJI A;  3NOU C;  1BUE A;  5HDS A;  3ZHH A;  3IWO A;  4I39 A;  4DJ3 A;  1K25 A;  4EW7 A;  4O7D A;  1CI8 A;  3KSI A;  3OPR A;  4OLG A;  1D1J A;  1K57 C;  1BLP A;  2K31 A;  3LEZ A;  3OOV A;  5EVI C;  4O01 A;  1VET B;  1ERQ A;  3WS5 A;  3IF6 B;  1Q2Q A;  3ZVW A;  1GCE A;  3W8K A;  2JHE A;  4ESP A;  5HAI A;  3P09 A;  2I72 A;  2ZQC A;  4PM7 A;  1GSX A;  3K2N A;  4N9L A;  5HPI A;  3UDF A;  3NOT C;  4AFI A;  3LIA A;  1GA0 A;  1MWU A;  1VB6 A;  4DMZ A;  1KGG A;  3N7W A;  3MBZ A;  1NYM A;  5FAT A;  4GD8 A;  2OV5 A;  1BLC A;  1YSQ A;  5HL6 A;  3ZCZ A;  4QWO A;  1P97 A;  2QKP A;  5G18 A;  3OLO A;  4EQI A;  5DF7 A;  2VGJ A;  2ZJ9 A;  3HCY A;  3BEC A;  1Y4O A;  5J3W A;  5GLA A;  3IH9 A;  2LB9 A;  4MN5 A;  3BJN A;  2K7S A;  3P01 A;  3NDE A;  5DF8 A;  4P0M A;  4MBF A;  5F5Y A;  1PRQ A;  5AJG A;  3IS2 A;  5CEB A;  4QY6 A;  5I5L A;  4N1H A;  4BD1 A;  1V9Z A;  3KSG A;  4DE2 A;  1YMX A;  1D06 A;  2M7U A;  3QP4 A;  4X25 A;  5DTS A;  3G2Z A;  1XJ6 A;  4UHU A;  3CJM A;  4CJN A;  3BFE A;  3MSH A;  4MN6 A;  4EV4 A;  5A92 A;  1E3U D;  5TJJ A;  2Y2M A;  2ZL1 A;  2XRN A;  4NKP A;  4S2M A;  4WUJ A;  2Y55 A;  1L3L A;  4I5S A;  1RP5 A;  2EX9 A;  4JPM A;  1OTI A;  4LGW A;  5F6A A;  1TS6 A;  4EBP A;  3S7O A;  3HLW A;  5E2F A;  1TS0 A;  4JGR A;  5JYP A;  1KOU A;  2WK0 A;  1FR1 A;  1DJA A;  3H9W A;  2VEA A;  1JTD A;  2EX2 A;  4XUZ A;  3RXW A;  4Z9Q A;  1FQG A;  3VP2 A;  5HDD A;  4EXO A;  3JPU A;  4F3L A;  4PAU A;  1ODV A;  1ZKJ A;  2JE5 A;  4I3A A;  1MZU A;  2PHY A;  5FA7 A;  5F82 A;  2QJ5 A;  3BFD A;  1E3U A;  3G35 A;  3CHW P;  2XA7 M;  4GS9 A;  3QP6 A;  4FH2 A;  1S4S A;  1OTB A;  3BEB A;  2R9X A;  2Z2L B;  3Q7V B;  2J80 A;  4PMA A;  4S2N C;  4OOY A;  4O8G A;  4X1M A;  1IKI A;  1K38 A;  1I2W A;  3UB9 A;  3TW8 A;  1YPR A;  1YAX A;  2H28 A;  3BFC A;  2HF6 A;  3QHY A;  3C4O A;  3A3F A;  1G28 A;  3T4K A;  4FCF A;  3LFV A;  2HJE A;  3GMW A;  4KZ9 A;  4N1X A;  3NIA A;  4E3N A;  3HJK A;  1K57 A;  1Y54 A;  3C5A A;  1EI5 A;  3IXG A;  1S1Z A;  2J8Y A;  5FAP A;  2KDK A;  2PU4 A;  4GDN A;  4PM8 A;  4Y15 A;  2PDR A;  1RGY A;  1PIO A;  1QMF A;  4KG6 A;  1YLZ A;  1GHP A;  1F5M A;  3U2A A;  4KZA A;  3L9K A;  1MKI A;  2BAS A;  1HD8 A;  2HJ9 C;  4HHD A;  4DDS A;  1J9M A;  3MFD A;  3UDX A;  4R70 A;  3N8R A;  1OT9 A;  5KSH A;  4JBF A; 
#chains in the Genus database with same CATH homology
 4LPZ A;  3TRC A;  4GLQ A;  5HWW A;  5TBM A;  4JGP A;  4CLC B;  1OTA A;  4QPR A;  4RQ9 A;  5F68 A;  4I38 A;  2PD8 A;  2GX5 A;  4G3W A;  2NUT C;  3B47 A;  4G3K A;  3IBR A;  4HP4 A;  3ULF A;  4I3I A;  4WF0 A;  2V1A A;  2P04 A;  2D01 A;  2V0W A;  3H82 A;  4R6L A;  4Y3I A;  2WKP A;  4BMW A;  3LR5 A;  5HD5 A;  2W3E A;  3UB8 A;  1NLY A;  2V1B A;  2W1T A;  5L8M A;  2JN7 A;  3FPV A;  5IT5 A;  3KO6 A;  2J3T C;  3EGD C;  4WEL A;  5K5B A;  2A24 A;  3RTY A;  4Y5F A;  2YKF A;  3D3O A;  2ZMF A;  3OCL A;  2G7U A;  3A0S A;  3KYQ A;  4FOF A;  4Q0J A;  5DKK A;  1GSV A;  4IUH A;  1STZ A;  2A24 B;  3R7W A;  4M4X A;  4HNB A;  2OWJ A;  4F3L B;  1VHM A;  4HIA A;  3VE3 A;  3CAX A;  2FH5 A;  3MFX A;  3KSF A;  1LT0 A;  4ETZ A;  1OT6 A;  4MMN A;  3SW1 A;  1JNU A;  4ETX A;  5HDC A;  2B18 A;  2ZOH A;  3MR0 A;  4HY8 A;  2GZA A;  5CX7 A;  3CI6 A;  3KSH A;  2JKR I;  1TF1 A;  4NXB A;  2PYP A;  2K2N A;  2FZ0 A;  1LL8 A;  2VA0 A;  4KUO A;  3V67 A;  4EUV A;  1MKM A;  3H82 B;  2VJW A;  1S1Y A;  1XJ2 A;  3FC7 A;  3LIC A;  2P08 A;  4DJ2 A;  3RFB A;  1W63 M;  1N9L A;  4BBT A;  3S7Q A;  2P7J A;  5C5K A;  2W3F A;  3R4K A;  5TBM B;  4YNR A;  5DKL A;  3D72 A;  3PYP A;  3T4J A;  4UQI M;  4EEP A;  1T1B A;  2EWV A;  2PR5 A;  3JVU A;  1Y28 A;  4II7 A;  2QJ7 A;  1ZHH B;  1TS7 A;  4P6Z M;  4PKY A;  4JGO A;  3P7N A;  2W1R A;  3VOL A;  3CIT A;  1UWP X;  5HD3 A;  2XA7 S;  3EQV A;  3LR0 A;  4BBU A;  4KUK A;  4UEY A;  5HPF A;  2VGL M;  2V0U A;  2WKR A;  4EU0 A;  2PD7 A;  3MF0 A;  4UQI S;  1N9N A;  3E98 A;  5MC7 A;  4R3A A;  2XRO A;  3C2W A;  4MDZ A;  2PYR A;  1MC0 A;  4HH3 A;  4ARZ B;  3F1O B;  2J3T D;  3T4L A;  5DFX A;  2HGV A;  4KQO A;  4XT2 A;  3T4S A;  4CLC D;  1T19 A;  3EEA A;  3H7W A;  1NWZ A;  3EWK A;  1DP8 A;  4ARZ A;  1OJG A;  3S7N A;  1V9Y A;  5EFW A;  3CUE A;  3IS2 B;  1T18 A;  2Y79 A;  1X0O A;  2OOL A;  2L0W A;  2VV7 A;  1UGU A;  5KIZ A;  3LI9 A;  1H3Q A;  1P9W A;  1ZTU A;  2QWS A;  3T50 A;  2QYB A;  1LSX A;  4FSF A;  4EEU A;  1XJ3 A;  3NOU C;  3BY9 A;  3HJI A;  2L1M A;  4I3J A;  2EA9 A;  5HDS A;  2JKT M;  2GJ3 A;  1F9I A;  4I39 A;  1H8M A;  4DJ3 A;  5G4Y A;  4EW7 A;  3T4T A;  2CMN A;  2R78 A;  3KSI A;  1GSW A;  4OOM A;  2K31 A;  2YKH A;  3OOV A;  4O01 A;  4Q0H A;  4CQH A;  1YSP A;  2VV8 A;  1TD5 A;  3GEC A;  3F1O A;  1OJ5 A;  2OAP 1;  3LI8 A;  3RH8 B;  5HSQ A;  4GHI A;  3PBT A;  2JHE A;  3F1P A;  1WA9 A;  4L9F A;  2PT7 A;  1GSX A;  3UE6 A;  1N9O A;  3K2N A;  5DJT A;  5HPI A;  2MJ6 A;  2O9B A;  4HQA A;  4WLA A;  3UB7 A;  3NOT C;  5A8B A;  4H6J A;  4AFI A;  3LIA A;  4DMZ A;  1EW0 A;  1VB6 A;  4HJ3 A;  3VV4 A;  1S67 L;  1DRM A;  2O0Y A;  3T4O A;  3EQU A;  3NOP C;  4LRY C;  1BYW A;  3F1N B;  4WL9 A;  3H7W B;  5DJU A;  1YSQ A;  3LYX A;  1TS8 A;  3B42 A;  4NXG A;  5HL6 A;  1P97 A;  2QKP A;  4L9E A;  3B33 A;  2PR6 A;  5HWT A;  3LID A;  3UMD A;  3PXP A;  3OLO A;  4GW9 A;  3PR6 A;  2DMW A;  5HWV A;  3JVV A;  3PBO A;  3LUQ A;  5G4Z A;  3EEH A;  1LSV A;  3HCY A;  1XFN A;  5J3W A;  1S66 L;  5J4E A;  1OTD A;  3NJA A;  4ZRR A;  2LB9 A;  3A0V A;  4MN5 A;  4MCW A;  3BJN A;  2K7S A;  3OCN A;  3LIE A;  3P01 A;  2INW A;  4MN7 A;  2VLG A;  2QHK A;  3UB6 A;  1IOU A;  2LB5 A;  3FG8 A;  4H6J B;  2L4R A;  4OOL A;  3CWF A;  1D7E A;  5F5Y A;  3MJQ A;  2W3D A;  3ICY A;  5AJG A;  2M1C A;  3IS2 A;  5FL3 A;  3F1N A;  5I5L A;  4JGQ A;  1DP9 A;  1NLZ A;  1V9Z A;  5F69 A;  4HJ6 A;  3KSG A;  5AVE A;  1D06 A;  4GJ4 A;  2M7U A;  3E4P A;  3UME A;  1S4R A;  4PKY G;  4DN0 A;  1P9R A;  1XJ6 A;  4WEJ A;  4MN6 A;  2W27 A;  5TJJ A;  4HI4 A;  4B93 A;  4EER A;  5IU1 A;  3ZYT A;  1F98 A;  2ZOI A;  2XRN A;  4NKP A;  4IHQ A;  4WUJ A;  1T1C A;  4I5S A;  3PBS A;  5HZH A;  2O9C A;  4LRZ E;  4GS9 B;  1OTI A;  4KQD A;  2OAQ 1;  2D02 A;  3KX0 X;  3G6O A;  3VE4 A;  1IFQ A;  5F6A A;  2KLI A;  1DP6 A;  4Y2F A;  3TJZ C;  3E0Y A;  4XT2 B;  3E4Q A;  1TS6 A;  2O9A A;  3EGX C;  3S7O A;  3PHY A;  1XJ4 A;  3S7P A;  4NXE A;  4BWI A;  5IS1 A;  2J3W A;  2EWW A;  1TS0 A;  4JGR A;  2W3H A;  1KOU A;  1LSW A;  4P6Z S;  1UWN X;  3H9W A;  4GHI B;  2VEA A;  2VZW A;  2OWH A;  4CLC A;  3O5Y A;  3IBJ A;  3F1P B;  3LR3 A;  3T4Q A;  4K08 A;  5LBR A;  4YWZ A;  3BY8 A;  4HOI A;  5HDD A;  5J7E A;  4EXO A;  3MXQ A;  4F3L A;  4HP9 A;  4PAU A;  1ODV A;  2W0N A;  3BW6 A;  4L9G A;  4I3A A;  1MZU A;  2PHY A;  4EQ1 A;  3PBR A;  2HV1 A;  2QJ5 A;  2XA7 M;  4YOF A;  1OPX A;  4GS9 A;  1S4S A;  3BQ8 A;  4HH2 A;  1OTB A;  2V9A A;  4IJG A;  3LIF A;  2VGL S;  2Z6D A;  3GDI A;  3E4O A;  2J80 A;  2ZBB A;  1NRJ A;  4BJP A;  2Y8H A;  3K3D A;  3CUE C;  4G3V A;  3CLO A;  4O8G A;  3EOI A;  2IA2 A;  4IUK A;  3LIB A;  4BBV A;  1OTE A;  4LLO B;  3UB9 A;  3TW8 A;  4PHT A;  1YAX A;  2H28 A;  2O99 A;  2ZMV A;  5DF9 A;  2HF6 A;  2JKR M;  3PBQ A;  5DFY A;  3C38 A;  4NEE D;  1XFQ A;  1G28 A;  5AVF A;  2I9V A;  4WEK A;  2W1T B;  3K3C A;  4ME4 A;  4CLC E;  3T4K A;  4EET B;  4E04 A;  2M7V A;  4B9O A;  3DBA A;  3PBN A;  3OBF A;  2HJE A;  3LFV A;  2XSS A;  3MMH A;  2GNX A;  2NUP C;  1W63 Q;  3FPW A;  4CLC C;  3ZQ5 A;  4HJ4 A;  3HJK A;  3C30 A;  2Z6C A;  4L0L A;  3MQO A;  4Q0I A;  1T1A A;  2B02 A;  4LRX C;  3BWL A;  4NXF A;  1S1Z A;  4EES A;  3NHQ A;  4WN5 A;  3LR4 A;  4O0P A;  2KDK A;  4GCZ A;  2KOI A;  2WKQ A;  3MQQ A;  2VV6 A;  3TE8 A;  3A0R A;  2PDR A;  2KX6 A;  3BQA A;  3OC2 A;  3W2Z A;  3KYZ A;  3U2A A;  1F5M A;  3UE3 A;  2W3G A;  1G6O A;  2VX8 A;  2BAS A;  2VKS A;  3R7W B;  2JKT I;  2A2L A;  2HJ9 C;  4HHD A;  4R38 A;  4R70 A;  1OT9 A;  1P0Z A;  5KSH A;  3C8C A;  3MQ0 A;  1YKD A;  4Z1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...