2EA9A

Crystal structure of a hypothetical protein jw2626 from e.coli
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYHNGFTCEADTLGSCGYVYIAVYPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yfjZ
publication title Crystal structure of a hypothetical protein JW2626 from E.coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06154 CbeA_antitoxin CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ea9A01
3SW1A 2Z6DA 1LSWA 4MN5A 2PR6A 3A0SA 1N9OA 3UB8A 5G4ZA 1XJ4A 4EW7A 1OTIA 2W0NA 1WA9A 3NOTC 4EETB 4LRXC 3F1OB 2R78A 5HD5A 4HNBA 1F9IA 2QKPA 2V9AA 3K3DA 4BBTA 4RQ9A 3A0VA 4JGRA 2QJ5A 3H82A 2PR5A 2INWA 3IS2B 5F5YA 5TBMA 4M4XA 3UMDA 4I5SA 2WKQA 5IU1A 5IS1A 4L9GA 3H9WA 4HJ6A 4KUKA 5KIZA 1XJ3A 2PD8A 1S4RA 3GDIA 3LI8A 4L9EA 1T1CA 3F1PA 2I9VA 3EWKA 5A8BA 3RH8B 5HDDA 2ZBBA 3PHYA 4GHIA 3NHQA 4NXFA 3B33A 1UGUA 2J80A 1T18A 4E04A 2VV8A 3MQQA 3LI9A 4KUOA 3MFXA 2A24A 3VE3A 4NXEA 4WL9A 3LUQA 1TS7A 5J7EA 5F6AA 2PYRA 4EERA 1BYWA 4KQDA 5J4EA 3H7WB 2ZOIA 3E4OA 5DJUA 3IBRA 3C8CA 4MN6A 4GS9A 2OWJA 2CMNA 3MXQA 4HH3A 5HWTA 4NXGA 1VB6A 5DKLA 4HHDA 2V1BA 1S66L 3F1OA 3CWFA 4H6JB 4NXBA 4EEPA 5HZHA 2W27A 1DRMA 2HV1A 4B9OA 3UMEA 2YKHA 4EEUA 3BY9A 3IS2A 3MJQA 1OTEA 4HIAA 3ULFA 4EQ1A 2JHEA 4R38A 4WF0A 4R6LA 4WLAA 2K7SA 3ICYA 1DP8A 1GSXA 5DJTA 1N9NA 2VV6A 5F69A 3LIEA 1S67L 1OT6A 1DP9A 1MZUA 2V0WA 1OJGA 5HD3A 2ZOHA 4L9FA 1XFQA 3F1NB 2P7JA 4HJ4A 1EW0A 1XJ6A 3H82B 3PYPA 3ZQ5A 2GJ3A 5TBMB 3LIFA 3UB9A 4WUJA 2Z6CA 1ODVA 5AVEA 3CLOA 5HWWA 1D06A 1S1YA 4I3IA 1KOUA 4JGPA 3F1PB 3UB6A 4JGOA 2WKPA 3MR0A 1G28A 1Y28A 4R3AA 1OJ5A 3E4PA 1OTBA 1T1AA 3CAXA 4GHIB 4JGQA 2VEAA 3VOLA 2QJ7A 2L1MA 4LLOB 1T1BA 2L4RA 4I3AA 2OOLA 1N9LA 4XT2B 4R70A 1T19A 4H6JA 2VLGA 1X0OA 4HP4A 3C2WA 1LT0A 1D7EA 4DJ2A 2VV7A 1UWNX 3NOUC 4F3LB 4HQAA 4HP9A 3LICA 3K3CA 3RTYA 1XJ2A 3OLOA 2B02A 2D01A 3BWLA 4DJ3A 1UWPX 5I5LA 3UB7A 1OTDA 4LRYC 1GSWA 3LIAA 1F98A 4PKYA 4GS9B 3GECA 2OWHA 3A0RA 2QHKA 4BBUA 2V1AA 5EFWA 1OT9A 2YKFA 5DKKA 1V9ZA 1LL8A 4HJ3A 4GCZA 3F1NA 5J3WA 3HJIA 3E4QA 1V9YA 5F68A 4HOIA 2D02A 3MQOA 1GSVA 4HI4A 2QWSA 1TS6A 4HH2A 1XFNA 4GW9A 2EA9A 4PKYG 3G6OA 3NOPC 1P97A 5HDCA 2PHYA 2KDKA 3LIDA 3LYXA 4WN5A 1S4SA 1LSXA 3UE6A 1P0ZA 4LRZE 2V0UA 3P7NA 4LPZA 3KX0X 2L0WA 3LIBA 3H7WA 5AVFA 1LSVA 1S1ZA 2H28A 3FG8A 4BBVA 4YWZA 4XT2A 4HY8A 5HDSA 4EESA 4EXOA 4F3LA 1JNUA 2PDRA 4I39A 3EEHA 1TS8A 1OTAA 2PD7A 4K08A 2A24B 2M1CA 4I3JA 3BY8A 5G4YA 3T50A 5HWVA 2PYPA 2BASA 5HSQA 3D72A 2KX6A 3FC7A 1TS0A 3HJKA 2WKRA 3VE4A 1NWZA 3NJAA 2JN7A 4I38A 1DP6A
chains in the Genus database with same CATH superfamily
2Z6DA 2AVXA 4MN5A 2QPNA 2PR6A 3UPPA 1WYCA 3A0SA 3CHWP 2W1RA 2EX8A 3ZDJA 1XKZA 1PI4A 3IF6A 3UB8A 4EW7A 5HAIA 1OTIA 2W0NA 1L0FA 2ZC5B 1P9WA 4JXWA 2XGNA 3UNWA 2XR0A 3HLEA 3HLWA 4UHUA 5HD5A 2Z2LB 3A3EA 2QKPA 2V9AA 4RQ9A 4HESA 4P6ZS 2QJ5A 4OOYA 2INWA 3MQ0A 2Y8HA 4OQ0A 2P9VA 2W1TB 4K0WA 1K56A 5TBMA 4M4XA 2C5WB 3NBLA 5FI7A 4HEFA 4JLFA 1E4DA 3LEZA 4JXGA 1ZHHB 4RX2A 2R9XA 4HJ6A 1L0DA 4ETXA 2PD8A 3T4JA 2EWVA 2WUQA 1IKIA 3GDIA 1FIKA 3RFBA 5EM0A 4RA7A 2P04A 5TR7A 3W4PA 3F1PA 5HW3A 1J9MA 1NZOA 3QP8A 5A8BA 1YLJA 5FAPA 4QPRA 2A49A 3A3DA 3MZDA 4KG6A 1AWIA 2ZBBA 1XGJA 1XGIA 4GHIA 3B33A 4PM8A 3TJZC 1T18A 2W3EA 4E04A 3IH9A 3L9KA 4N1XA 2PU2A 4LCLA 3LI9A 3WWXA 4IUHA 1CF0A 4KUOA 3MFXA 4X69A 4QWOA 4PM7A 3OCLA 3PBSA 4NXEA 3LUQA 3JVUA 4P87A 5F6AA 1SKOB 1RCJA 4EERA 4B4XA 4GN2A 1EWZA 1K4EA 3ZG5A 5CGWA 2EWWA 3CI6A 2WKHA 4LV1A 1FR6A 3OPHA 4GKUA 4NXGA 3T4KA 2XK1A 4WEJA 4WBGA 2V1BA 4MBKA 1YMSA 3HL9A 3UPNA 4EEPA 5HZHA 2W27A 1DRMA 4R3JA 2XRNA 4GDBA 1C3BA 2YKHA 1ES4A 4L0LA 2DNSA 2FH5A 4P6BA 1P9RA 1S0WA 4QHCA 3ZNYA 1IELA 4ZBEA 1OTEA 4HIAA 5DF9A 3C4OA 4R38A 3AGDA 4WF0A 1VM1A 3ITBA 3FPVA 5CTMA 3VP0A 3ICYA 2XA7M 1VEUB 1N9NA 2JKTM 2WKIA 5EM1A 2FFFB 2QYBA 4Y0UA 3O86A 4Y7PA 4YOFA 3UN7A 5CHUA 5TFQA 3OPRA 5A92A 3CUEC 4L9FA 3S7PA 2V8CA 2Y55A 5CTNA 4K0XA 4X53A 1F2KA 3F1NB 2P7JA 5GLAA 1LL9A 3BLMA 1K57A 2GX5A 5HAQA 5MC7A 2V8FA 3ZQ5A 1ZTUA 4G3KA 1K57C 4RVAA 3LIFA 3W4OA 4WUJA 1CEFA 3QP6A 2Y2KA 3CLOA 2XH9A 3MS6A 4I3IA 3BW6A 4JGPA 3S7OA 2HP9A 3ITAA 4JGOA 2GNXA 1TDLA 2RCXA 1M6KA 2EXBA 4Y17A 3ZNTA 1T1AA 2WGWA 3CAXA 3LFVA 5GLBA 3VOLA 2QJ7A 2FZ0A 4I3AA 2PBYA 5DTSA 3G2ZA 1BULA 3CZDA 1T19A 2IWDA 4H6JA 3HLDA 4FUWA 2J7VA 5FI2A 5J8XA 4DJ2A 2VV7A 4F3LB 4IUKA 4HP9A 4S2LA 3RTYA 4KZ3A 4P6ZM 4LV0A 4ZTKA 1KDSA 1IYQA 2R9WA 2Y2LA 2W3FA 4LRYC 3R7WA 3LIAA 4FOFA 1F98A 4GDNA 5FQIA 5GLCA 3IT9A 2V1AA 5AQAA 4GD6A 4BL2A 4QJGA 3BECA 3SS3A 4K91A 1V9ZA 4AFIA 3E98A 2OLUA 3BFGA 3RJUA 5G18A 2WGVA 5FEFA 4XXRA 5EE8A 1YKDA 2X71A 4MN7A 4Q0HA 1H0MA 4HOIA 5CHJA 3SH7A 1ESIA 1GSVA 3HVFA 4A5RA 5HAPA 1ES5A 3I7JA 4HBTA 5DVAA 3FV7A 4C3QA 3RXWA 4U3TA 3S22A 4OPRA 4ZRRA 4FH2A 1BLPA 3LIDA 1K54C 1S4SA 4B88A 1P0ZA 4Q0IA 5E2EA 3VFHA 3P7NA 4Y5FA 5DF7A 4ZAMA 4CLCC 2BG1A 2BTFP 2ACGA 2Y2OA 1S1ZA 4JF4A 3MXRA 4CLCB 5FI6A 2ZLYA 4GJ4A 4DKIA 4HY8A 3GMWA 1YLYA 3MSHA 5FQKA 1CI9A 1RGYA 4RYEA 4Y3IA 4F94A 1H8YA 1CK3A 3IX8A 5TGFA 3HCYA 4E3IA 1XA7A 4QY6A 2VGJA 2VX8A 2ZL1A 1MBLA 5L10A 4I39A 2EX2A 4KQRA 3LR3A 1TS8A 4KG2A 3BFFA 4K08A 2M1CA 4I3JA 3BY8A 1SDNA 3FKWA 2PYPA 5HSQA 3MZEA 3D72A 4B93A 4FH4A 2ZC6B 1JTDA 3FC7A 1KGGA 1H8MA 1SHVA 2H0YA 3BFEA 4CQHA 3NJAA 3IWOA 2A2LA 4OKPA 1YSQA 4I38A 2HJEA 1DP6A 5EECA 4ETZA 2XQZA 3V39A 4D2OA 1N9OA 2NUPC 3T4SA 3ZVTA 1W5DA 2JKGA 2XD1A 4QU3A 1WA9A 4UEYA 2JE5A 4S2NA 4LRXC 3F1OB 3VV4A 4S2KA 1HZOA 1F9IA 2ZD8A 3K3DA 4JXVA 4S2NC 5FQMA 1BTLA 4MBHA 4HBUA 1NYMA 1FSYA 2PR5A 1YLTA 3IS2B 1NYYA 4MDZA 5F5YA 3G4PA 2WKEA 3LGOA 5A91A 3JYIA 4I5SA 2WKQA 5IU1A 4UA9A 1GHMA 5KIZA 4GZBA 1XJ3A 3LI8A 4R1GA 5E43A 3QNBA 3UDXA 2XA7S 1LL5A 2V20A 3HLBA 3PBTA 5FATA 1UGUA 2J80A 3M2KA 3NULA 3T1XA 5CHMA 3ZYTA 1PWDA 1IYSA 1U60A 3G2YA 3LR4A 2J9OA 4ZJ2A 2BLSA 4PMAA 3QNCA 4BQMA 3Q07A 5J7EA 3MKFA 4O7DA 2Y2NA 3S7QA 1NXYA 1XP4A 3M6HA 3W8KA 1HTZA 4KZBA 5BOHA 5DJUA 2KOIA 3WS0A 2P74A 2ZM2A 5FEGA 4M3KA 4MN6A 4GS9A 5CRFA 4KZ6A 4OOMA 2MJ6A 4EV4A 1PNEA 1VB6A 4FCFA 3HUNA 1XX2A 2WYXA 1ZG6A 4KZ4A 3B47A 2VA0A 1NZUA 1LI0A 1YLWA 2HV1A 4B9OA 1F5MA 3BJNA 3BY9A 4KZ7A 2Y2JA 4OP5A 3O3VA 2O0YA 1KVLA 1SZVA 2W1TA 3MF0A 3ULFA 3BEBA 2DCFA 3GSGA 3N8LA 1BLHA 1IEMA 5DTTA 2K7SA 5FAOA 1N9BA 3BFCA 2HF6A 1Q2PA 3T1QB 2VV6A 5F69A 3LY3A 4R0QA 1TDGA 1JVJA 4OQHA 1DP9A 1MZUA 4DE2A 3T4LA 3KSIA 5HD3A 2HJ9C 4DRTA 3Q7ZA 5FA7A 5IT5A 4UQIM 1G6AA 1EW0A 4H8RA 4Y13A 1VETB 2XD5A 5TBMB 1EI5A 3LO7A 1G5UA 4OLGA 1BSGA 1YSPA 3ZGAB 1TVFA 3EGXC 4KQQA 5AVEA 4R23A 1G6OA 4ID4A 2V2FF 1JWPA 3EQUA 3F1PB 4KZ5A 3UB6A 1K0KA 1PIOA 1K56D 4R3AA 1OJ5A 1OTBA 4EU0A 2K2NA 4GHIB 5EVIC 3DWZA 4QY5A 2JCHA 1T1BA 1YPRA 3LR0A 5CEBA 5I94A 5EVIB 2J8YA 4XT2B 4ZJ3A 5L09A 1KVMA 1DJBA 4BL3A 1W63M 2VLGA 3PAEA 2XSSA 3EGDC 4HP4A 1BZAA 1UWNX 1I2WA 5F83A 2A3UA 4O0PA 3BWLA 2W3HA 1MKIA 3KYZA 3VP2A 1JWVA 1ZG4A 2H0TA 4G3WA 5I5LA 3EQVA 3Q82A 1OTDA 4JF5A 3LEQA 5C5KA 4PKYA 2HDSA 3IF5A 2E8IA 2P08A 1MXOA 1NRFA 5LBRA 3CPTB 4Q0JA 5DKKA 5EV0A 3IXDA 2PBDP 2H5SA 4Z9QA 4KG5A 1LL8A 4GCZA 3F1NA 3CUEA 1PRQA 4DXCA 2HPBA 5A93A 3E4QA 4R4RA 3BFDA 2D02A 2ZC7A 5GHZA 2CC1A 1XFNA 1DY6A 2ZC3B 3N8SA 4ESPA 3G6OA 1I5QA 4WZ5A 4OP8A 4DDYA 2KDKA 3LYXA 3VOYA 4WN5A 2Y4AA 1LSXA 3UE6A 4IJGA 4WZ5C 2V0UA 1NLYA 4S2JA 1YLPA 1Z6FA 2L0WA 5FDSA 3H7WA 1LSVA 2H28A 4X1LA 4UA6A 5K5BA 5HDSA 1L2SA 4KZ8A 5FQ9A 4PAUA 4F3LA 4D60A 5HX9A 5KSHA 3HBRA 2A24B 2PRFA 5GLDA 4C75A 5HWVA 2VZWA 2JBFA 4KZAA 3W4QA 2HDQA 1GCEA 1G68A 2UV0E 1GHIA 2Q0OA 1TS0A 4GNUA 1L3LA 2EFXA 3KO6A 2FFYA 4OQIA 2WKRA 4NKPA 1NWZA 3SH9A 3P98A 3PBOA 2Y2HA 3RXXA 1PZPA 1XPBA 4MEZA 3CG5A 5KSCA 3WRZA 2ZQ7A 3OPLA 5F82A 2ZQ8A 1VQQA 2EFUA 3UDFA 3N6IA 2RL3A 3ZG9B 1Q2QA 3UY6A 4P85A 3FPWA 4JGRA 3H82A 1JWZA 1KE3A 3HLGA 1CJFA 4E3OA 3UMDA 3S7NA 1CI8A 4LFUA 1DJCA 5IS1A 4L9GA 5HPIA 1PI5A 4KUKA 1K54A 1S4RA 3M2JA 4L9EA 1FOFA 3ZG7B 4CLCA 4ARZB 1K25A 2I9VA 3EWKA 2M7UA 2GDNA 3D3OA 1L0GA 3RH8B 2JKRM 4S2IA 5HDDA 1CEGA 3IHAA 3NHQA 1ERMA 4JXSA 4NEED 1BLCA 1L0EA 2VV8A 3BQ8A 3MQQA 2WAFA 4DE1A 3ZG8B 4UQIS 5L07A 3LCEA 3GV9A 5TJJA 4N9KA 3V3RA 4WL9A 5FSRA 1TS7A 4EWFA 1W8QA 2Y2MA 1W8YA 4NETA 5EVEA 5GHXA 1FSWA 1PW1A 1BYWA 1K4FA 3DTMA 3MBZA 4MLLA 5J4EA 5HFOA 2ZOIA 3E4OA 2ZQCA 5JYOA 3VMAA 1GA9A 3GVBA 5AQBA 2PAVP 3IH8A 2HP6A 4GLQA 4DE3A 3DBAA 4N1HA 2Y2QA 4E3KA 5FL3A 5HWTA 3OBFA 4OQGA 3P09A 3PBRA 5DKLA 1MC0A 2ZMVA 4HHDA 1BUEA 4LV2A 1S66L 2NUTC 3F1OA 2ZQAA 1NLZA 3T4TA 2W3DA 3UMEA 1KE4A 1KE0A 3TE8A 3Q7VB 3QP4A 4EEUA 3PAGA 2GZAA 3IS2A 3TRCA 3MJQA 2EX6A 4LENA 2VK3A 5DTKA 4EQ1A 3U4LP 2PT7A 4EUVA 3O87A 3N4IA 3SOIA 1K55C 1XA1A 2J3TC 2WAEA 2ZQDA 3MMHA 1DP8A 1GSXA 3WRTA 4BWIA 4KQOA 5HL1A 3LIEA 1NRJA 4S2OA 1S67L 5A90A 4Z1WA 1OT6A 1O7EA 3OCNA 1QMEA 3NI9A 3GRJA 2IWCA 3KSHA 2ZOHA 4YNRA 2JC7A 3G32A 3U2AA 2IWBA 1KGEA 1XFQA 2ZC4B 4X68A 1XJ6A 5GL9A 4KZ9A 2OAQ1 4CPKA 2XFTA 4BLMA 4S2PA 1H8ZA 2M7VA 2Y59A 4LCMA 4ZJ1A 4QD4A 4IVKA 5FASA 2B5RA 1SCWA 1S1YA 4E3MA 2ZMAA 5EVLA 1GHPA 2Y2IA 4WELA 3LR5A 4QB8A 2WKPA 3MR0A 1G28A 1Y28A 4JBFA 4FTXA 3E4PA 3LY4A 4JGQA 1S6RA 2VEAA 3KYQA 4Y15A 2L1MA 2L4RA 4R4SA 1SKFA 2OSUA 5M18A 1ACFA 3O5YA 3BLSA 3FYZA 3ZCZA 1X0OA 3C2WA 3DTEA 4E3NA 4HQAA 3DAVA 3LICA 1NY0A 3K3CA 1H5XA 2D01A 4ME4A 2Q9MA 3M6BA 3VFFA 2XDMA 3JPUA 1STZA 3G34A 2B95A 3OC2A 4EBPA 3N8RA 1IOUA 4WMCA 4GS9B 1MKMA 1YLZA 2QHKA 3AGEA 4WEKA 1IKGA 3A3IA 1SDEA 2Q9NA 5EFWA 1OT9A 3IQAA 1ONHA 3IF6C 4E3JA 4BJPA 3FZCA 4WM9A 3K2NA 2Y2PA 5EUAA 3IF6B 1J3WA 4HJ3A 3Q1FA 4NG2A 5J3WA 3IX3A 2J3WA 1K6RA 4FD8A 5L2FA 4OPZA 1ES2A 1VHMA 5F68A 1VETA 3G31A 1MWUA 4HI4A 1CQAA 2XEPA 2EX9A 2G7UA 1N4OA 4FSFA 3QP1A 4PKYG 2P9VB 1P97A 5HDCA 4YINA 2KLIA 2PHYA 3WS4A 4WYYA 4DE0A 3KSFA 4EBNA 2B18A 2VGKA 1SKOA 4WMCD 1FR1A 3DTKA 4X6TA 3P01A 1HVBA 3KX0X 1AXBA 4DMZA 3OPPA 1ESUA 5AVFA 4IBRA 2JKFA 2ZJ9A 5E2HA 3FG8A 4BBVA 5EVIA 2J9PA 4XT2A 3G35A 2C6WB 1YMXA 3VP3A 3SS4A 3GTCA 1I2SA 1ALQA 2ZM8A 1Z09A 5FQJA 4EXOA 3E2KA 1FCMA 2XF3A 3T1RA 2HGVA 3IXHA 2PDRA 3VOZA 1ONGA 3C7VA 3V3SA 3EEHA 4G3VA 4X25A 3IX4A 2UWXA 5E2FA 3TG9A 3NDGA 5G4YA 3VSKA 3MKEA 2KX6A 1YM1A 1WE4A 1MPLA 2JKTI 1ZC2A 4BD1A 4YFMA 2LB9A 2ZM0A 3DWKA 3KSGA 2JN7A 3NC8A 5EOEA 4S2MA 4X55A 1RP5A 3SW1A 3CPTA 1LSWA 1IYPA 1NJ4A 2G2WA 1VEUA 2HDUA 4B4ZA 2G2UA 3IHBA 3UO9A 5G4ZA 1IYOA 4XUXA 1XJ4A 5EVID 3ISGA 3DTIA 3NOTC 2VGLS 4EETB 4P0MA 1PZOA 2R78A 4HNBA 5CGSA 1FILA 4BBTA 3A0VA 3VP4A 5F1GA 1OPXA 2W3GA 3QHYA 5HARA 3BYDA 5M19A 4Y0OA 1E25A 4O01A 4E3LA 2WGIA 3H9WA 1TF1A 3IXBA 1KDWA 2HDRA 1T1CA 3NIAA 4X56A 4OOLA 4CLCE 4JF6A 2QMIA 2IA2A 3MZFA 3E2LA 3HLFA 3O88A 1Y4OA 3C30A 3PHYA 4NXFA 3S1YA 1ZKJA 3ZHHA 5HL6A 4DN0A 4OPYA 5CXWA 2OAP1 3NY4A 4EUZA 2A24A 3VE3A 3HREA 3PBNA 3UDIA 3TSGA 5DF8A 4E6WA 1YAXA 2PYRA 5KZHA 2X02A 2DRWA 2VKSA 4KQDA 3FWLA 5HPFA 3H7WB 3EOIA 1A0KA 3B3XA 3IBRA 1MY8A 3UPOA 3C5AA 1HLUP 3AGFA 3C8CA 3JVVA 4U0XA 1YQSA 2WGWB 2OWJA 3FKVA 2CMNA 3HUMA 3MXQA 3Q81A 4LGWA 5M1AA 5CERA 4HH3A 2OV5A 4EQIA 3NECA 4XUZA 5D3OA 5JYPA 3T1SA 3CWFA 4H6JB 4NXBA 1PWCA 4GB7A 3WS1A 3BM6A 1WYBA 4EBLA 3HLCA 4UA7A 1YT4A 3PTEA 3OOVA 3IBJA 2X01A 4PM5A 1IFQA 1QMFA 1LHYA 2JHEA 2O9BA 2XFSA 1PWGA 2WADA 4R6LA 4WLAA 5FQQA 4C6YA 3R7WB 4OPQA 1LLBA 3N7WA 3C7UA 2JKRI 2V1ZA 5DJTA 3T4OA 4OVDA 3V50A 4Y0TA 1PW8A 2WK0A 1MWSA 2HP5A 4ARZA 4PPRA 1FQGA 2V0WA 3S4XA 1OJGA 5CECA 5IHVA 3WS5A 4IHQA 1FCOA 2XLNA 2PU4A 5F1FA 5E2GA 3C38A 4RX3A 3NCKA 4HJ4A 1BT5A 1H3QA 2Y2GA 3H82B 3MXSA 3PYPA 4IEDA 1PYYA 3IWQA 4N92A 2GJ3A 3SZTA 3ZVWA 2E8JA 3UB9A 5U47A 5L8MA 4OH0A 1Y54A 1DJAA 2Z6CA 4OONA 1K6SA 3OZHA 1ODVA 4BENA 5HWWA 3B42A 1D06A 3UB5P 3WS2A 2I72A 1KOUA 1MWRA 3BRMA 3VSLA 3TW8A 3IXGA 5AJGA 4LLOB 4ZDXA 3UE3A 3TOIA 2OOLA 3EEAA 2HZ5A 3PR6A 1N9LA 4JKTA 3UE0A 2LB5A 2XROA 5AQ7A 4R70A 2VGLM 4O8GA 4CLCD 4MMNA 4PM9A 3V67A 1LT0A 1D7EA 3NOUC 4BD0A 3Q7VA 3A3JA 2ZL1B 1XJ2A 3OLOA 3MFDA 2B02A 2WZZA 3VP1A 4DJ3A 2ZQ9A 1RGZA 1UWPX 5DFXA 3UB7A 3E0YA 1GSWA 1D1JA 4U0TA 3UE1A 3GECA 2OWHA 4PM6A 1W7FA 1K55A 3A0RA 3PBQA 1EROA 1LI9A 2O9AA 4BBUA 4X1MA 3W2ZA 3GQZA 2O9CA 3L7HA 5CX7A 5EOOA 2Z2MB 2YKFA 2Y79A 3D9YA 4GD8A 3R4KA 1PFLA 1O07A 2DMWA 1W79A 5AQ9A 2O99A 3HJIA 3GR2A 5GHYA 4LV3A 3ZG0A 5CGXA 1XXMA 4R3BA 1V9YA 2WZXA 4NK3A 3MQOA 2QWSA 4MNRA 3T4QA 3A3FA 1TS6A 4HH2A 2EXAA 3QP5A 2Y91A 1E3UA 1FCNA 4GW9A 4DXBA 2EA9A 3NOPC 4II7A 5EPHA 3T12B 1HD8A 3V5MA 1M40A 4DF6A 4MCWA 4MBFA 3D4FA 4DDSA 4LRZE 3KYEA 5FDHA 3SH8A 4LPZA 4IBXA 3G30A 4Q8IA 2J3TD 1BLSA 2QZ6A 3LIBA 5FAQA 5KMWA 3PXPA 3NDEA 4YWZA 3SS5A 1ES3A 3IWIA 4EESA 3ZFZA 1TEMA 1K38A 1GA0A 3CITA 1ERQA 4JPMA 4WZ4A 1JNUA 3HUOA 4OLDA 5CEDA 4KENB 4GOGA 4IVIA 4Y2FA 2ZMFA 2H10A 3C4PA 1OTAA 2PD7A 3BQAA 2K31A 1MWTA 3CJMA 3T50A 1E3UD 1OMEA 1TD5A 2BASA 4CJNA 4UAAA 1W63Q 2OLVA 3CMZA 4E6XA 5DFYA 1JTGA 4PHTA 3HJKA 3VE4A 1KGFA 4N9LA 4BMWA 3DW0A 2VJWA 3QP2A
chains in the Genus database with same CATH topology
3SW1A 2Z6DA 1LSWA 4MN5A 2PR6A 3PBOA 4ETZA 3A0SA 2W1RA 1N9OA 2NUPC 3T4SA 3UB8A 5G4ZA 1XJ4A 4EW7A 1OTIA 2W0NA 1WA9A 3NOTC 1P9WA 2VGLS 4UEYA 4EETB 4LRXC 3F1OB 3VV4A 2R78A 5HD5A 4HNBA 1F9IA 2QKPA 2V9AA 3K3DA 4BBTA 4RQ9A 3A0VA 4P6ZS 3FPWA 4JGRA 1OPXA 2QJ5A 3H82A 2PR5A 2W3GA 2INWA 3IS2B 5F5YA 4MDZA 3MQ0A 2Y8HA 2W1TB 5TBMA 4M4XA 3UMDA 3S7NA 4I5SA 2WKQA 5IU1A 4O01A 5IS1A 1ZHHB 4L9GA 5HPIA 3H9WA 4HJ6A 4ETXA 4KUKA 5KIZA 1XJ3A 1TF1A 2PD8A 3T4JA 2EWVA 1S4RA 3GDIA 3LI8A 4L9EA 3RFBA 1T1CA 2P04A 3F1PA 2XA7S 4CLCA 4ARZB 2I9VA 3EWKA 2M7UA 4OOLA 5A8BA 3D3OA 4CLCE 4QPRA 3RH8B 2IA2A 2JKRM 3PBTA 5HDDA 2ZBBA 3C30A 3PHYA 4GHIA 3NHQA 4NXFA 3B33A 1UGUA 2J80A 3TJZC 5HL6A 1T18A 4NEED 4DN0A 2W3EA 4E04A 3ZYTA 2VV8A 3BQ8A 2OAP1 3LI9A 3MQQA 4UQIS 4IUHA 4KUOA 3MFXA 3LR4A 2A24A 3VE3A 5TJJA 3OCLA 3PBSA 3PBNA 4NXEA 4WL9A 3LUQA 1TS7A 5J7EA 3JVUA 5F6AA 1YAXA 3S7QA 2PYRA 4EERA 1BYWA 2VKSA 4KQDA 5HPFA 5J4EA 3H7WB 2ZOIA 3E4OA 5DJUA 3EOIA 3IBRA 2KOIA 2EWWA 3C8CA 4MN6A 4GS9A 3CI6A 3JVVA 4GLQA 3DBAA 4OOMA 2OWJA 2MJ6A 2CMNA 3MXQA 4HH3A 5FL3A 5HWTA 4NXGA 3OBFA 1VB6A 3T4KA 3PBRA 5DKLA 1MC0A 4WEJA 2ZMVA 4HHDA 2V1BA 1S66L 2NUTC 3F1OA 3CWFA 4H6JB 3B47A 2VA0A 4NXBA 4EEPA 1NLZA 3T4TA 5HZHA 2W3DA 2W27A 1DRMA 2HV1A 4B9OA 1F5MA 3UMEA 2XRNA 3BJNA 3TE8A 2YKHA 4L0LA 4EEUA 2FH5A 1P9RA 3BY9A 2GZAA 3IS2A 3TRCA 2O0YA 3MJQA 3OOVA 2W1TA 3IBJA 1OTEA 4HIAA 5DF9A 3MF0A 3ULFA 4EQ1A 1IFQA 2JHEA 2O9BA 2PT7A 4EUVA 4R38A 4WF0A 4R6LA 4WLAA 3FPVA 2J3TC 2K7SA 3ICYA 3R7WB 3MMHA 1DP8A 1GSXA 2HF6A 2XA7M 2JKRI 1N9NA 5DJTA 2JKTM 4BWIA 2VV6A 3T4OA 5F69A 4KQOA 3LIEA 1NRJA 1S67L 2QYBA 4ARZA 4Z1WA 4YOFA 1OT6A 1DP9A 1MZUA 2V0WA 3OCNA 1OJGA 3T4LA 3KSIA 5HD3A 3KSHA 2HJ9C 2ZOHA 3CUEC 4IHQA 4YNRA 4L9FA 3S7PA 3U2AA 1XFQA 3F1NB 5IT5A 3C38A 4UQIM 2P7JA 4HJ4A 1EW0A 1XJ6A 2GX5A 1H3QA 3H82B 3PYPA 5MC7A 2OAQ1 2GJ3A 3ZQ5A 1ZTUA 4G3KA 5TBMB 3LIFA 3UB9A 4WUJA 5L8MA 2M7VA 2Z6CA 1YSPA 3EGXC 1ODVA 5AVEA 3CLOA 5HWWA 3B42A 1D06A 1S1YA 1G6OA 4I3IA 1KOUA 3BW6A 4JGPA 3EQUA 3F1PB 3TW8A 4WELA 3S7OA 3LR5A 3UB6A 4JGOA 2WKPA 2GNXA 3MR0A 1G28A 1Y28A 4R3AA 1OJ5A 3E4PA 1OTBA 1T1AA 3CAXA 4EU0A 2K2NA 4GHIB 3LFVA 4JGQA 5AJGA 2VEAA 3KYQA 3VOLA 2QJ7A 2L1MA 4LLOB 2FZ0A 1T1BA 2L4RA 4I3AA 3LR0A 3UE3A 2OOLA 3EEAA 3PR6A 1N9LA 3O5YA 4XT2B 2LB5A 2XROA 4R70A 1T19A 4H6JA 1W63M 1X0OA 2VLGA 2XSSA 2VGLM 3EGDC 4HP4A 4O8GA 4CLCD 3C2WA 4MMNA 3V67A 1LT0A 1D7EA 4DJ2A 2VV7A 1UWNX 3NOUC 4F3LB 4HQAA 4IUKA 4HP9A 3LICA 3K3CA 3RTYA 1XJ2A 4O0PA 3OLOA 4P6ZM 2B02A 2D01A 4ME4A 3BWLA 2W3HA 3KYZA 4DJ3A 1STZA 1UWPX 5I5LA 4G3WA 5DFXA 3OC2A 3UB7A 3EQVA 1OTDA 3E0YA 2W3FA 4LRYC 3R7WA 5C5KA 1GSWA 1IOUA 3LIAA 4FOFA 1F98A 4PKYA 4GS9B 3GECA 2OWHA 1MKMA 3A0RA 3PBQA 2P08A 2O9AA 2QHKA 4WEKA 4BBUA 2V1AA 3W2ZA 5EFWA 2O9CA 5CX7A 5LBRA 1OT9A 2YKFA 2Y79A 4Q0JA 5DKKA 4BJPA 3R4KA 1V9ZA 2DMWA 4AFIA 3K2NA 1LL8A 4HJ3A 3E98A 4GCZA 3F1NA 2O99A 5J3WA 2J3WA 3CUEA 3HJIA 3E4QA 1YKDA 1V9YA 1VHMA 4MN7A 4Q0HA 5F68A 4HOIA 2D02A 3MQOA 1GSVA 4HI4A 2QWSA 3T4QA 1TS6A 4HH2A 1XFNA 2G7UA 4GW9A 4ZRRA 4FSFA 2EA9A 4PKYG 3G6OA 3NOPC 4II7A 1P97A 5HDCA 2KLIA 2PHYA 4MCWA 2KDKA 3LIDA 3LYXA 4WN5A 1S4SA 3KSFA 1LSXA 1P0ZA 2B18A 4IJGA 4Q0IA 3UE6A 4LRZE 2V0UA 3P7NA 1NLYA 4Y5FA 4LPZA 3P01A 4CLCC 3KX0X 2L0WA 2J3TD 4DMZA 3LIBA 3H7WA 5AVFA 1LSVA 1S1ZA 2H28A 3PXPA 4CLCB 3FG8A 4BBVA 4YWZA 4GJ4A 4XT2A 4HY8A 5K5BA 5HDSA 4EESA 3CITA 4Y3IA 4EXOA 4PAUA 4F3LA 3HCYA 1JNUA 2HGVA 2VX8A 2PDRA 4I39A 4Y2FA 3EEHA 3LR3A 1TS8A 4G3VA 5KSHA 2ZMFA 1OTAA 2PD7A 3BQAA 2A24B 2K31A 4K08A 2M1CA 4I3JA 3BY8A 5G4YA 3T50A 5HWVA 2PYPA 1TD5A 2BASA 2VZWA 5HSQA 3D72A 1W63Q 4B93A 2KX6A 3FC7A 5DFYA 1H8MA 2JKTI 4PHTA 1TS0A 3KO6A 3HJKA 2WKRA 3VE4A 4CQHA 2LB9A 4NKPA 1NWZA 3NJAA 3KSGA 2A2LA 2JN7A 4BMWA 1YSQA 4I38A 2VJWA 2HJEA 1DP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW1 A;  2Z6D A;  1LSW A;  4MN5 A;  2PR6 A;  3A0S A;  1N9O A;  3UB8 A;  5G4Z A;  1XJ4 A;  4EW7 A;  1OTI A;  2W0N A;  1WA9 A;  3NOT C;  4EET B;  4LRX C;  3F1O B;  2R78 A;  5HD5 A;  4HNB A;  1F9I A;  2QKP A;  2V9A A;  3K3D A;  4BBT A;  4RQ9 A;  3A0V A;  4JGR A;  2QJ5 A;  3H82 A;  2PR5 A;  2INW A;  3IS2 B;  5F5Y A;  5TBM A;  4M4X A;  3UMD A;  4I5S A;  2WKQ A;  5IU1 A;  5IS1 A;  4L9G A;  3H9W A;  4HJ6 A;  4KUK A;  5KIZ A;  1XJ3 A;  2PD8 A;  1S4R A;  3GDI A;  3LI8 A;  4L9E A;  1T1C A;  3F1P A;  2I9V A;  3EWK A;  5A8B A;  3RH8 B;  5HDD A;  2ZBB A;  3PHY A;  4GHI A;  3NHQ A;  4NXF A;  3B33 A;  1UGU A;  2J80 A;  1T18 A;  4E04 A;  2VV8 A;  3MQQ A;  3LI9 A;  4KUO A;  3MFX A;  2A24 A;  3VE3 A;  4NXE A;  4WL9 A;  3LUQ A;  1TS7 A;  5J7E A;  5F6A A;  2PYR A;  4EER A;  1BYW A;  4KQD A;  5J4E A;  3H7W B;  2ZOI A;  3E4O A;  5DJU A;  3IBR A;  3C8C A;  4MN6 A;  4GS9 A;  2OWJ A;  2CMN A;  3MXQ A;  4HH3 A;  5HWT A;  4NXG A;  1VB6 A;  5DKL A;  4HHD A;  2V1B A;  1S66 L;  3F1O A;  3CWF A;  4H6J B;  4NXB A;  4EEP A;  5HZH A;  2W27 A;  1DRM A;  2HV1 A;  4B9O A;  3UME A;  2YKH A;  4EEU A;  3BY9 A;  3IS2 A;  3MJQ A;  1OTE A;  4HIA A;  3ULF A;  4EQ1 A;  2JHE A;  4R38 A;  4WF0 A;  4R6L A;  4WLA A;  2K7S A;  3ICY A;  1DP8 A;  1GSX A;  5DJT A;  1N9N A;  2VV6 A;  5F69 A;  3LIE A;  1S67 L;  1OT6 A;  1DP9 A;  1MZU A;  2V0W A;  1OJG A;  5HD3 A;  2ZOH A;  4L9F A;  1XFQ A;  3F1N B;  2P7J A;  4HJ4 A;  1EW0 A;  1XJ6 A;  3H82 B;  3PYP A;  3ZQ5 A;  2GJ3 A;  5TBM B;  3LIF A;  3UB9 A;  4WUJ A;  2Z6C A;  1ODV A;  5AVE A;  3CLO A;  5HWW A;  1D06 A;  1S1Y A;  4I3I A;  1KOU A;  4JGP A;  3F1P B;  3UB6 A;  4JGO A;  2WKP A;  3MR0 A;  1G28 A;  1Y28 A;  4R3A A;  1OJ5 A;  3E4P A;  1OTB A;  1T1A A;  3CAX A;  4GHI B;  4JGQ A;  2VEA A;  3VOL A;  2QJ7 A;  2L1M A;  4LLO B;  1T1B A;  2L4R A;  4I3A A;  2OOL A;  1N9L A;  4XT2 B;  4R70 A;  1T19 A;  4H6J A;  2VLG A;  1X0O A;  4HP4 A;  3C2W A;  1LT0 A;  1D7E A;  4DJ2 A;  2VV7 A;  1UWN X;  3NOU C;  4F3L B;  4HQA A;  4HP9 A;  3LIC A;  3K3C A;  3RTY A;  1XJ2 A;  3OLO A;  2B02 A;  2D01 A;  3BWL A;  4DJ3 A;  1UWP X;  5I5L A;  3UB7 A;  1OTD A;  4LRY C;  1GSW A;  3LIA A;  1F98 A;  4PKY A;  4GS9 B;  3GEC A;  2OWH A;  3A0R A;  2QHK A;  4BBU A;  2V1A A;  5EFW A;  1OT9 A;  2YKF A;  5DKK A;  1V9Z A;  1LL8 A;  4HJ3 A;  4GCZ A;  3F1N A;  5J3W A;  3HJI A;  3E4Q A;  1V9Y A;  5F68 A;  4HOI A;  2D02 A;  3MQO A;  1GSV A;  4HI4 A;  2QWS A;  1TS6 A;  4HH2 A;  1XFN A;  4GW9 A;  2EA9 A;  4PKY G;  3G6O A;  3NOP C;  1P97 A;  5HDC A;  2PHY A;  2KDK A;  3LID A;  3LYX A;  4WN5 A;  1S4S A;  1LSX A;  3UE6 A;  1P0Z A;  4LRZ E;  2V0U A;  3P7N A;  4LPZ A;  3KX0 X;  2L0W A;  3LIB A;  3H7W A;  5AVF A;  1LSV A;  1S1Z A;  2H28 A;  3FG8 A;  4BBV A;  4YWZ A;  4XT2 A;  4HY8 A;  5HDS A;  4EES A;  4EXO A;  4F3L A;  1JNU A;  2PDR A;  4I39 A;  3EEH A;  1TS8 A;  1OTA A;  2PD7 A;  4K08 A;  2A24 B;  2M1C A;  4I3J A;  3BY8 A;  5G4Y A;  3T50 A;  5HWV A;  2PYP A;  2BAS A;  5HSQ A;  3D72 A;  2KX6 A;  3FC7 A;  1TS0 A;  3HJK A;  2WKR A;  3VE4 A;  1NWZ A;  3NJA A;  2JN7 A;  4I38 A;  1DP6 A; 
#chains in the Genus database with same CATH topology
 2Z6D A;  2AVX A;  4MN5 A;  2QPN A;  2PR6 A;  3UPP A;  1WYC A;  3A0S A;  3CHW P;  2W1R A;  2EX8 A;  3ZDJ A;  1XKZ A;  1PI4 A;  3IF6 A;  3UB8 A;  4EW7 A;  5HAI A;  1OTI A;  2W0N A;  1L0F A;  2ZC5 B;  1P9W A;  4JXW A;  2XGN A;  3UNW A;  2XR0 A;  3HLE A;  3HLW A;  4UHU A;  5HD5 A;  2Z2L B;  3A3E A;  2QKP A;  2V9A A;  4RQ9 A;  4HES A;  4P6Z S;  2QJ5 A;  4OOY A;  2INW A;  3MQ0 A;  2Y8H A;  4OQ0 A;  2P9V A;  2W1T B;  4K0W A;  1K56 A;  5TBM A;  4M4X A;  2C5W B;  3NBL A;  5FI7 A;  4HEF A;  4JLF A;  1E4D A;  3LEZ A;  4JXG A;  1ZHH B;  4RX2 A;  2R9X A;  4HJ6 A;  1L0D A;  4ETX A;  2PD8 A;  3T4J A;  2EWV A;  2WUQ A;  1IKI A;  3GDI A;  1FIK A;  3RFB A;  5EM0 A;  4RA7 A;  2P04 A;  5TR7 A;  3W4P A;  3F1P A;  5HW3 A;  1J9M A;  1NZO A;  3QP8 A;  5A8B A;  1YLJ A;  5FAP A;  4QPR A;  2A49 A;  3A3D A;  3MZD A;  4KG6 A;  1AWI A;  2ZBB A;  1XGJ A;  1XGI A;  4GHI A;  3B33 A;  4PM8 A;  3TJZ C;  1T18 A;  2W3E A;  4E04 A;  3IH9 A;  3L9K A;  4N1X A;  2PU2 A;  4LCL A;  3LI9 A;  3WWX A;  4IUH A;  1CF0 A;  4KUO A;  3MFX A;  4X69 A;  4QWO A;  4PM7 A;  3OCL A;  3PBS A;  4NXE A;  3LUQ A;  3JVU A;  4P87 A;  5F6A A;  1SKO B;  1RCJ A;  4EER A;  4B4X A;  4GN2 A;  1EWZ A;  1K4E A;  3ZG5 A;  5CGW A;  2EWW A;  3CI6 A;  2WKH A;  4LV1 A;  1FR6 A;  3OPH A;  4GKU A;  4NXG A;  3T4K A;  2XK1 A;  4WEJ A;  4WBG A;  2V1B A;  4MBK A;  1YMS A;  3HL9 A;  3UPN A;  4EEP A;  5HZH A;  2W27 A;  1DRM A;  4R3J A;  2XRN A;  4GDB A;  1C3B A;  2YKH A;  1ES4 A;  4L0L A;  2DNS A;  2FH5 A;  4P6B A;  1P9R A;  1S0W A;  4QHC A;  3ZNY A;  1IEL A;  4ZBE A;  1OTE A;  4HIA A;  5DF9 A;  3C4O A;  4R38 A;  3AGD A;  4WF0 A;  1VM1 A;  3ITB A;  3FPV A;  5CTM A;  3VP0 A;  3ICY A;  2XA7 M;  1VEU B;  1N9N A;  2JKT M;  2WKI A;  5EM1 A;  2FFF B;  2QYB A;  4Y0U A;  3O86 A;  4Y7P A;  4YOF A;  3UN7 A;  5CHU A;  5TFQ A;  3OPR A;  5A92 A;  3CUE C;  4L9F A;  3S7P A;  2V8C A;  2Y55 A;  5CTN A;  4K0X A;  4X53 A;  1F2K A;  3F1N B;  2P7J A;  5GLA A;  1LL9 A;  3BLM A;  1K57 A;  2GX5 A;  5HAQ A;  5MC7 A;  2V8F A;  3ZQ5 A;  1ZTU A;  4G3K A;  1K57 C;  4RVA A;  3LIF A;  3W4O A;  4WUJ A;  1CEF A;  3QP6 A;  2Y2K A;  3CLO A;  2XH9 A;  3MS6 A;  4I3I A;  3BW6 A;  4JGP A;  3S7O A;  2HP9 A;  3ITA A;  4JGO A;  2GNX A;  1TDL A;  2RCX A;  1M6K A;  2EXB A;  4Y17 A;  3ZNT A;  1T1A A;  2WGW A;  3CAX A;  3LFV A;  5GLB A;  3VOL A;  2QJ7 A;  2FZ0 A;  4I3A A;  2PBY A;  5DTS A;  3G2Z A;  1BUL A;  3CZD A;  1T19 A;  2IWD A;  4H6J A;  3HLD A;  4FUW A;  2J7V A;  5FI2 A;  5J8X A;  4DJ2 A;  2VV7 A;  4F3L B;  4IUK A;  4HP9 A;  4S2L A;  3RTY A;  4KZ3 A;  4P6Z M;  4LV0 A;  4ZTK A;  1KDS A;  1IYQ A;  2R9W A;  2Y2L A;  2W3F A;  4LRY C;  3R7W A;  3LIA A;  4FOF A;  1F98 A;  4GDN A;  5FQI A;  5GLC A;  3IT9 A;  2V1A A;  5AQA A;  4GD6 A;  4BL2 A;  4QJG A;  3BEC A;  3SS3 A;  4K91 A;  1V9Z A;  4AFI A;  3E98 A;  2OLU A;  3BFG A;  3RJU A;  5G18 A;  2WGV A;  5FEF A;  4XXR A;  5EE8 A;  1YKD A;  2X71 A;  4MN7 A;  4Q0H A;  1H0M A;  4HOI A;  5CHJ A;  3SH7 A;  1ESI A;  1GSV A;  3HVF A;  4A5R A;  5HAP A;  1ES5 A;  3I7J A;  4HBT A;  5DVA A;  3FV7 A;  4C3Q A;  3RXW A;  4U3T A;  3S22 A;  4OPR A;  4ZRR A;  4FH2 A;  1BLP A;  3LID A;  1K54 C;  1S4S A;  4B88 A;  1P0Z A;  4Q0I A;  5E2E A;  3VFH A;  3P7N A;  4Y5F A;  5DF7 A;  4ZAM A;  4CLC C;  2BG1 A;  2BTF P;  2ACG A;  2Y2O A;  1S1Z A;  4JF4 A;  3MXR A;  4CLC B;  5FI6 A;  2ZLY A;  4GJ4 A;  4DKI A;  4HY8 A;  3GMW A;  1YLY A;  3MSH A;  5FQK A;  1CI9 A;  1RGY A;  4RYE A;  4Y3I A;  4F94 A;  1H8Y A;  1CK3 A;  3IX8 A;  5TGF A;  3HCY A;  4E3I A;  1XA7 A;  4QY6 A;  2VGJ A;  2VX8 A;  2ZL1 A;  1MBL A;  5L10 A;  4I39 A;  2EX2 A;  4KQR A;  3LR3 A;  1TS8 A;  4KG2 A;  3BFF A;  4K08 A;  2M1C A;  4I3J A;  3BY8 A;  1SDN A;  3FKW A;  2PYP A;  5HSQ A;  3MZE A;  3D72 A;  4B93 A;  4FH4 A;  2ZC6 B;  1JTD A;  3FC7 A;  1KGG A;  1H8M A;  1SHV A;  2H0Y A;  3BFE A;  4CQH A;  3NJA A;  3IWO A;  2A2L A;  4OKP A;  1YSQ A;  4I38 A;  2HJE A;  1DP6 A;  5EEC A;  4ETZ A;  2XQZ A;  3V39 A;  4D2O A;  1N9O A;  2NUP C;  3T4S A;  3ZVT A;  1W5D A;  2JKG A;  2XD1 A;  4QU3 A;  1WA9 A;  4UEY A;  2JE5 A;  4S2N A;  4LRX C;  3F1O B;  3VV4 A;  4S2K A;  1HZO A;  1F9I A;  2ZD8 A;  3K3D A;  4JXV A;  4S2N C;  5FQM A;  1BTL A;  4MBH A;  4HBU A;  1NYM A;  1FSY A;  2PR5 A;  1YLT A;  3IS2 B;  1NYY A;  4MDZ A;  5F5Y A;  3G4P A;  2WKE A;  3LGO A;  5A91 A;  3JYI A;  4I5S A;  2WKQ A;  5IU1 A;  4UA9 A;  1GHM A;  5KIZ A;  4GZB A;  1XJ3 A;  3LI8 A;  4R1G A;  5E43 A;  3QNB A;  3UDX A;  2XA7 S;  1LL5 A;  2V20 A;  3HLB A;  3PBT A;  5FAT A;  1UGU A;  2J80 A;  3M2K A;  3NUL A;  3T1X A;  5CHM A;  3ZYT A;  1PWD A;  1IYS A;  1U60 A;  3G2Y A;  3LR4 A;  2J9O A;  4ZJ2 A;  2BLS A;  4PMA A;  3QNC A;  4BQM A;  3Q07 A;  5J7E A;  3MKF A;  4O7D A;  2Y2N A;  3S7Q A;  1NXY A;  1XP4 A;  3M6H A;  3W8K A;  1HTZ A;  4KZB A;  5BOH A;  5DJU A;  2KOI A;  3WS0 A;  2P74 A;  2ZM2 A;  5FEG A;  4M3K A;  4MN6 A;  4GS9 A;  5CRF A;  4KZ6 A;  4OOM A;  2MJ6 A;  4EV4 A;  1PNE A;  1VB6 A;  4FCF A;  3HUN A;  1XX2 A;  2WYX A;  1ZG6 A;  4KZ4 A;  3B47 A;  2VA0 A;  1NZU A;  1LI0 A;  1YLW A;  2HV1 A;  4B9O A;  1F5M A;  3BJN A;  3BY9 A;  4KZ7 A;  2Y2J A;  4OP5 A;  3O3V A;  2O0Y A;  1KVL A;  1SZV A;  2W1T A;  3MF0 A;  3ULF A;  3BEB A;  2DCF A;  3GSG A;  3N8L A;  1BLH A;  1IEM A;  5DTT A;  2K7S A;  5FAO A;  1N9B A;  3BFC A;  2HF6 A;  1Q2P A;  3T1Q B;  2VV6 A;  5F69 A;  3LY3 A;  4R0Q A;  1TDG A;  1JVJ A;  4OQH A;  1DP9 A;  1MZU A;  4DE2 A;  3T4L A;  3KSI A;  5HD3 A;  2HJ9 C;  4DRT A;  3Q7Z A;  5FA7 A;  5IT5 A;  4UQI M;  1G6A A;  1EW0 A;  4H8R A;  4Y13 A;  1VET B;  2XD5 A;  5TBM B;  1EI5 A;  3LO7 A;  1G5U A;  4OLG A;  1BSG A;  1YSP A;  3ZGA B;  1TVF A;  3EGX C;  4KQQ A;  5AVE A;  4R23 A;  1G6O A;  4ID4 A;  2V2F F;  1JWP A;  3EQU A;  3F1P B;  4KZ5 A;  3UB6 A;  1K0K A;  1PIO A;  1K56 D;  4R3A A;  1OJ5 A;  1OTB A;  4EU0 A;  2K2N A;  4GHI B;  5EVI C;  3DWZ A;  4QY5 A;  2JCH A;  1T1B A;  1YPR A;  3LR0 A;  5CEB A;  5I94 A;  5EVI B;  2J8Y A;  4XT2 B;  4ZJ3 A;  5L09 A;  1KVM A;  1DJB A;  4BL3 A;  1W63 M;  2VLG A;  3PAE A;  2XSS A;  3EGD C;  4HP4 A;  1BZA A;  1UWN X;  1I2W A;  5F83 A;  2A3U A;  4O0P A;  3BWL A;  2W3H A;  1MKI A;  3KYZ A;  3VP2 A;  1JWV A;  1ZG4 A;  2H0T A;  4G3W A;  5I5L A;  3EQV A;  3Q82 A;  1OTD A;  4JF5 A;  3LEQ A;  5C5K A;  4PKY A;  2HDS A;  3IF5 A;  2E8I A;  2P08 A;  1MXO A;  1NRF A;  5LBR A;  3CPT B;  4Q0J A;  5DKK A;  5EV0 A;  3IXD A;  2PBD P;  2H5S A;  4Z9Q A;  4KG5 A;  1LL8 A;  4GCZ A;  3F1N A;  3CUE A;  1PRQ A;  4DXC A;  2HPB A;  5A93 A;  3E4Q A;  4R4R A;  3BFD A;  2D02 A;  2ZC7 A;  5GHZ A;  2CC1 A;  1XFN A;  1DY6 A;  2ZC3 B;  3N8S A;  4ESP A;  3G6O A;  1I5Q A;  4WZ5 A;  4OP8 A;  4DDY A;  2KDK A;  3LYX A;  3VOY A;  4WN5 A;  2Y4A A;  1LSX A;  3UE6 A;  4IJG A;  4WZ5 C;  2V0U A;  1NLY A;  4S2J A;  1YLP A;  1Z6F A;  2L0W A;  5FDS A;  3H7W A;  1LSV A;  2H28 A;  4X1L A;  4UA6 A;  5K5B A;  5HDS A;  1L2S A;  4KZ8 A;  5FQ9 A;  4PAU A;  4F3L A;  4D60 A;  5HX9 A;  5KSH A;  3HBR A;  2A24 B;  2PRF A;  5GLD A;  4C75 A;  5HWV A;  2VZW A;  2JBF A;  4KZA A;  3W4Q A;  2HDQ A;  1GCE A;  1G68 A;  2UV0 E;  1GHI A;  2Q0O A;  1TS0 A;  4GNU A;  1L3L A;  2EFX A;  3KO6 A;  2FFY A;  4OQI A;  2WKR A;  4NKP A;  1NWZ A;  3SH9 A;  3P98 A;  3PBO A;  2Y2H A;  3RXX A;  1PZP A;  1XPB A;  4MEZ A;  3CG5 A;  5KSC A;  3WRZ A;  2ZQ7 A;  3OPL A;  5F82 A;  2ZQ8 A;  1VQQ A;  2EFU A;  3UDF A;  3N6I A;  2RL3 A;  3ZG9 B;  1Q2Q A;  3UY6 A;  4P85 A;  3FPW A;  4JGR A;  3H82 A;  1JWZ A;  1KE3 A;  3HLG A;  1CJF A;  4E3O A;  3UMD A;  3S7N A;  1CI8 A;  4LFU A;  1DJC A;  5IS1 A;  4L9G A;  5HPI A;  1PI5 A;  4KUK A;  1K54 A;  1S4R A;  3M2J A;  4L9E A;  1FOF A;  3ZG7 B;  4CLC A;  4ARZ B;  1K25 A;  2I9V A;  3EWK A;  2M7U A;  2GDN A;  3D3O A;  1L0G A;  3RH8 B;  2JKR M;  4S2I A;  5HDD A;  1CEG A;  3IHA A;  3NHQ A;  1ERM A;  4JXS A;  4NEE D;  1BLC A;  1L0E A;  2VV8 A;  3BQ8 A;  3MQQ A;  2WAF A;  4DE1 A;  3ZG8 B;  4UQI S;  5L07 A;  3LCE A;  3GV9 A;  5TJJ A;  4N9K A;  3V3R A;  4WL9 A;  5FSR A;  1TS7 A;  4EWF A;  1W8Q A;  2Y2M A;  1W8Y A;  4NET A;  5EVE A;  5GHX A;  1FSW A;  1PW1 A;  1BYW A;  1K4F A;  3DTM A;  3MBZ A;  4MLL A;  5J4E A;  5HFO A;  2ZOI A;  3E4O A;  2ZQC A;  5JYO A;  3VMA A;  1GA9 A;  3GVB A;  5AQB A;  2PAV P;  3IH8 A;  2HP6 A;  4GLQ A;  4DE3 A;  3DBA A;  4N1H A;  2Y2Q A;  4E3K A;  5FL3 A;  5HWT A;  3OBF A;  4OQG A;  3P09 A;  3PBR A;  5DKL A;  1MC0 A;  2ZMV A;  4HHD A;  1BUE A;  4LV2 A;  1S66 L;  2NUT C;  3F1O A;  2ZQA A;  1NLZ A;  3T4T A;  2W3D A;  3UME A;  1KE4 A;  1KE0 A;  3TE8 A;  3Q7V B;  3QP4 A;  4EEU A;  3PAG A;  2GZA A;  3IS2 A;  3TRC A;  3MJQ A;  2EX6 A;  4LEN A;  2VK3 A;  5DTK A;  4EQ1 A;  3U4L P;  2PT7 A;  4EUV A;  3O87 A;  3N4I A;  3SOI A;  1K55 C;  1XA1 A;  2J3T C;  2WAE A;  2ZQD A;  3MMH A;  1DP8 A;  1GSX A;  3WRT A;  4BWI A;  4KQO A;  5HL1 A;  3LIE A;  1NRJ A;  4S2O A;  1S67 L;  5A90 A;  4Z1W A;  1OT6 A;  1O7E A;  3OCN A;  1QME A;  3NI9 A;  3GRJ A;  2IWC A;  3KSH A;  2ZOH A;  4YNR A;  2JC7 A;  3G32 A;  3U2A A;  2IWB A;  1KGE A;  1XFQ A;  2ZC4 B;  4X68 A;  1XJ6 A;  5GL9 A;  4KZ9 A;  2OAQ 1;  4CPK A;  2XFT A;  4BLM A;  4S2P A;  1H8Z A;  2M7V A;  2Y59 A;  4LCM A;  4ZJ1 A;  4QD4 A;  4IVK A;  5FAS A;  2B5R A;  1SCW A;  1S1Y A;  4E3M A;  2ZMA A;  5EVL A;  1GHP A;  2Y2I A;  4WEL A;  3LR5 A;  4QB8 A;  2WKP A;  3MR0 A;  1G28 A;  1Y28 A;  4JBF A;  4FTX A;  3E4P A;  3LY4 A;  4JGQ A;  1S6R A;  2VEA A;  3KYQ A;  4Y15 A;  2L1M A;  2L4R A;  4R4S A;  1SKF A;  2OSU A;  5M18 A;  1ACF A;  3O5Y A;  3BLS A;  3FYZ A;  3ZCZ A;  1X0O A;  3C2W A;  3DTE A;  4E3N A;  4HQA A;  3DAV A;  3LIC A;  1NY0 A;  3K3C A;  1H5X A;  2D01 A;  4ME4 A;  2Q9M A;  3M6B A;  3VFF A;  2XDM A;  3JPU A;  1STZ A;  3G34 A;  2B95 A;  3OC2 A;  4EBP A;  3N8R A;  1IOU A;  4WMC A;  4GS9 B;  1MKM A;  1YLZ A;  2QHK A;  3AGE A;  4WEK A;  1IKG A;  3A3I A;  1SDE A;  2Q9N A;  5EFW A;  1OT9 A;  3IQA A;  1ONH A;  3IF6 C;  4E3J A;  4BJP A;  3FZC A;  4WM9 A;  3K2N A;  2Y2P A;  5EUA A;  3IF6 B;  1J3W A;  4HJ3 A;  3Q1F A;  4NG2 A;  5J3W A;  3IX3 A;  2J3W A;  1K6R A;  4FD8 A;  5L2F A;  4OPZ A;  1ES2 A;  1VHM A;  5F68 A;  1VET A;  3G31 A;  1MWU A;  4HI4 A;  1CQA A;  2XEP A;  2EX9 A;  2G7U A;  1N4O A;  4FSF A;  3QP1 A;  4PKY G;  2P9V B;  1P97 A;  5HDC A;  4YIN A;  2KLI A;  2PHY A;  3WS4 A;  4WYY A;  4DE0 A;  3KSF A;  4EBN A;  2B18 A;  2VGK A;  1SKO A;  4WMC D;  1FR1 A;  3DTK A;  4X6T A;  3P01 A;  1HVB A;  3KX0 X;  1AXB A;  4DMZ A;  3OPP A;  1ESU A;  5AVF A;  4IBR A;  2JKF A;  2ZJ9 A;  5E2H A;  3FG8 A;  4BBV A;  5EVI A;  2J9P A;  4XT2 A;  3G35 A;  2C6W B;  1YMX A;  3VP3 A;  3SS4 A;  3GTC A;  1I2S A;  1ALQ A;  2ZM8 A;  1Z09 A;  5FQJ A;  4EXO A;  3E2K A;  1FCM A;  2XF3 A;  3T1R A;  2HGV A;  3IXH A;  2PDR A;  3VOZ A;  1ONG A;  3C7V A;  3V3S A;  3EEH A;  4G3V A;  4X25 A;  3IX4 A;  2UWX A;  5E2F A;  3TG9 A;  3NDG A;  5G4Y A;  3VSK A;  3MKE A;  2KX6 A;  1YM1 A;  1WE4 A;  1MPL A;  2JKT I;  1ZC2 A;  4BD1 A;  4YFM A;  2LB9 A;  2ZM0 A;  3DWK A;  3KSG A;  2JN7 A;  3NC8 A;  5EOE A;  4S2M A;  4X55 A;  1RP5 A;  3SW1 A;  3CPT A;  1LSW A;  1IYP A;  1NJ4 A;  2G2W A;  1VEU A;  2HDU A;  4B4Z A;  2G2U A;  3IHB A;  3UO9 A;  5G4Z A;  1IYO A;  4XUX A;  1XJ4 A;  5EVI D;  3ISG A;  3DTI A;  3NOT C;  2VGL S;  4EET B;  4P0M A;  1PZO A;  2R78 A;  4HNB A;  5CGS A;  1FIL A;  4BBT A;  3A0V A;  3VP4 A;  5F1G A;  1OPX A;  2W3G A;  3QHY A;  5HAR A;  3BYD A;  5M19 A;  4Y0O A;  1E25 A;  4O01 A;  4E3L A;  2WGI A;  3H9W A;  1TF1 A;  3IXB A;  1KDW A;  2HDR A;  1T1C A;  3NIA A;  4X56 A;  4OOL A;  4CLC E;  4JF6 A;  2QMI A;  2IA2 A;  3MZF A;  3E2L A;  3HLF A;  3O88 A;  1Y4O A;  3C30 A;  3PHY A;  4NXF A;  3S1Y A;  1ZKJ A;  3ZHH A;  5HL6 A;  4DN0 A;  4OPY A;  5CXW A;  2OAP 1;  3NY4 A;  4EUZ A;  2A24 A;  3VE3 A;  3HRE A;  3PBN A;  3UDI A;  3TSG A;  5DF8 A;  4E6W A;  1YAX A;  2PYR A;  5KZH A;  2X02 A;  2DRW A;  2VKS A;  4KQD A;  3FWL A;  5HPF A;  3H7W B;  3EOI A;  1A0K A;  3B3X A;  3IBR A;  1MY8 A;  3UPO A;  3C5A A;  1HLU P;  3AGF A;  3C8C A;  3JVV A;  4U0X A;  1YQS A;  2WGW B;  2OWJ A;  3FKV A;  2CMN A;  3HUM A;  3MXQ A;  3Q81 A;  4LGW A;  5M1A A;  5CER A;  4HH3 A;  2OV5 A;  4EQI A;  3NEC A;  4XUZ A;  5D3O A;  5JYP A;  3T1S A;  3CWF A;  4H6J B;  4NXB A;  1PWC A;  4GB7 A;  3WS1 A;  3BM6 A;  1WYB A;  4EBL A;  3HLC A;  4UA7 A;  1YT4 A;  3PTE A;  3OOV A;  3IBJ A;  2X01 A;  4PM5 A;  1IFQ A;  1QMF A;  1LHY A;  2JHE A;  2O9B A;  2XFS A;  1PWG A;  2WAD A;  4R6L A;  4WLA A;  5FQQ A;  4C6Y A;  3R7W B;  4OPQ A;  1LLB A;  3N7W A;  3C7U A;  2JKR I;  2V1Z A;  5DJT A;  3T4O A;  4OVD A;  3V50 A;  4Y0T A;  1PW8 A;  2WK0 A;  1MWS A;  2HP5 A;  4ARZ A;  4PPR A;  1FQG A;  2V0W A;  3S4X A;  1OJG A;  5CEC A;  5IHV A;  3WS5 A;  4IHQ A;  1FCO A;  2XLN A;  2PU4 A;  5F1F A;  5E2G A;  3C38 A;  4RX3 A;  3NCK A;  4HJ4 A;  1BT5 A;  1H3Q A;  2Y2G A;  3H82 B;  3MXS A;  3PYP A;  4IED A;  1PYY A;  3IWQ A;  4N92 A;  2GJ3 A;  3SZT A;  3ZVW A;  2E8J A;  3UB9 A;  5U47 A;  5L8M A;  4OH0 A;  1Y54 A;  1DJA A;  2Z6C A;  4OON A;  1K6S A;  3OZH A;  1ODV A;  4BEN A;  5HWW A;  3B42 A;  1D06 A;  3UB5 P;  3WS2 A;  2I72 A;  1KOU A;  1MWR A;  3BRM A;  3VSL A;  3TW8 A;  3IXG A;  5AJG A;  4LLO B;  4ZDX A;  3UE3 A;  3TOI A;  2OOL A;  3EEA A;  2HZ5 A;  3PR6 A;  1N9L A;  4JKT A;  3UE0 A;  2LB5 A;  2XRO A;  5AQ7 A;  4R70 A;  2VGL M;  4O8G A;  4CLC D;  4MMN A;  4PM9 A;  3V67 A;  1LT0 A;  1D7E A;  3NOU C;  4BD0 A;  3Q7V A;  3A3J A;  2ZL1 B;  1XJ2 A;  3OLO A;  3MFD A;  2B02 A;  2WZZ A;  3VP1 A;  4DJ3 A;  2ZQ9 A;  1RGZ A;  1UWP X;  5DFX A;  3UB7 A;  3E0Y A;  1GSW A;  1D1J A;  4U0T A;  3UE1 A;  3GEC A;  2OWH A;  4PM6 A;  1W7F A;  1K55 A;  3A0R A;  3PBQ A;  1ERO A;  1LI9 A;  2O9A A;  4BBU A;  4X1M A;  3W2Z A;  3GQZ A;  2O9C A;  3L7H A;  5CX7 A;  5EOO A;  2Z2M B;  2YKF A;  2Y79 A;  3D9Y A;  4GD8 A;  3R4K A;  1PFL A;  1O07 A;  2DMW A;  1W79 A;  5AQ9 A;  2O99 A;  3HJI A;  3GR2 A;  5GHY A;  4LV3 A;  3ZG0 A;  5CGX A;  1XXM A;  4R3B A;  1V9Y A;  2WZX A;  4NK3 A;  3MQO A;  2QWS A;  4MNR A;  3T4Q A;  3A3F A;  1TS6 A;  4HH2 A;  2EXA A;  3QP5 A;  2Y91 A;  1E3U A;  1FCN A;  4GW9 A;  4DXB A;  2EA9 A;  3NOP C;  4II7 A;  5EPH A;  3T12 B;  1HD8 A;  3V5M A;  1M40 A;  4DF6 A;  4MCW A;  4MBF A;  3D4F A;  4DDS A;  4LRZ E;  3KYE A;  5FDH A;  3SH8 A;  4LPZ A;  4IBX A;  3G30 A;  4Q8I A;  2J3T D;  1BLS A;  2QZ6 A;  3LIB A;  5FAQ A;  5KMW A;  3PXP A;  3NDE A;  4YWZ A;  3SS5 A;  1ES3 A;  3IWI A;  4EES A;  3ZFZ A;  1TEM A;  1K38 A;  1GA0 A;  3CIT A;  1ERQ A;  4JPM A;  4WZ4 A;  1JNU A;  3HUO A;  4OLD A;  5CED A;  4KEN B;  4GOG A;  4IVI A;  4Y2F A;  2ZMF A;  2H10 A;  3C4P A;  1OTA A;  2PD7 A;  3BQA A;  2K31 A;  1MWT A;  3CJM A;  3T50 A;  1E3U D;  1OME A;  1TD5 A;  2BAS A;  4CJN A;  4UAA A;  1W63 Q;  2OLV A;  3CMZ A;  4E6X A;  5DFY A;  1JTG A;  4PHT A;  3HJK A;  3VE4 A;  1KGF A;  4N9L A;  4BMW A;  3DW0 A;  2VJW A;  3QP2 A; 
#chains in the Genus database with same CATH homology
 3SW1 A;  2Z6D A;  1LSW A;  4MN5 A;  2PR6 A;  3PBO A;  4ETZ A;  3A0S A;  2W1R A;  1N9O A;  2NUP C;  3T4S A;  3UB8 A;  5G4Z A;  1XJ4 A;  4EW7 A;  1OTI A;  2W0N A;  1WA9 A;  3NOT C;  1P9W A;  2VGL S;  4UEY A;  4EET B;  4LRX C;  3F1O B;  3VV4 A;  2R78 A;  5HD5 A;  4HNB A;  1F9I A;  2QKP A;  2V9A A;  3K3D A;  4BBT A;  4RQ9 A;  3A0V A;  4P6Z S;  3FPW A;  4JGR A;  1OPX A;  2QJ5 A;  3H82 A;  2PR5 A;  2W3G A;  2INW A;  3IS2 B;  5F5Y A;  4MDZ A;  3MQ0 A;  2Y8H A;  2W1T B;  5TBM A;  4M4X A;  3UMD A;  3S7N A;  4I5S A;  2WKQ A;  5IU1 A;  4O01 A;  5IS1 A;  1ZHH B;  4L9G A;  5HPI A;  3H9W A;  4HJ6 A;  4ETX A;  4KUK A;  5KIZ A;  1XJ3 A;  1TF1 A;  2PD8 A;  3T4J A;  2EWV A;  1S4R A;  3GDI A;  3LI8 A;  4L9E A;  3RFB A;  1T1C A;  2P04 A;  3F1P A;  2XA7 S;  4CLC A;  4ARZ B;  2I9V A;  3EWK A;  2M7U A;  4OOL A;  5A8B A;  3D3O A;  4CLC E;  4QPR A;  3RH8 B;  2IA2 A;  2JKR M;  3PBT A;  5HDD A;  2ZBB A;  3C30 A;  3PHY A;  4GHI A;  3NHQ A;  4NXF A;  3B33 A;  1UGU A;  2J80 A;  3TJZ C;  5HL6 A;  1T18 A;  4NEE D;  4DN0 A;  2W3E A;  4E04 A;  3ZYT A;  2VV8 A;  3BQ8 A;  2OAP 1;  3LI9 A;  3MQQ A;  4UQI S;  4IUH A;  4KUO A;  3MFX A;  3LR4 A;  2A24 A;  3VE3 A;  5TJJ A;  3OCL A;  3PBS A;  3PBN A;  4NXE A;  4WL9 A;  3LUQ A;  1TS7 A;  5J7E A;  3JVU A;  5F6A A;  1YAX A;  3S7Q A;  2PYR A;  4EER A;  1BYW A;  2VKS A;  4KQD A;  5HPF A;  5J4E A;  3H7W B;  2ZOI A;  3E4O A;  5DJU A;  3EOI A;  3IBR A;  2KOI A;  2EWW A;  3C8C A;  4MN6 A;  4GS9 A;  3CI6 A;  3JVV A;  4GLQ A;  3DBA A;  4OOM A;  2OWJ A;  2MJ6 A;  2CMN A;  3MXQ A;  4HH3 A;  5FL3 A;  5HWT A;  4NXG A;  3OBF A;  1VB6 A;  3T4K A;  3PBR A;  5DKL A;  1MC0 A;  4WEJ A;  2ZMV A;  4HHD A;  2V1B A;  1S66 L;  2NUT C;  3F1O A;  3CWF A;  4H6J B;  3B47 A;  2VA0 A;  4NXB A;  4EEP A;  1NLZ A;  3T4T A;  5HZH A;  2W3D A;  2W27 A;  1DRM A;  2HV1 A;  4B9O A;  1F5M A;  3UME A;  2XRN A;  3BJN A;  3TE8 A;  2YKH A;  4L0L A;  4EEU A;  2FH5 A;  1P9R A;  3BY9 A;  2GZA A;  3IS2 A;  3TRC A;  2O0Y A;  3MJQ A;  3OOV A;  2W1T A;  3IBJ A;  1OTE A;  4HIA A;  5DF9 A;  3MF0 A;  3ULF A;  4EQ1 A;  1IFQ A;  2JHE A;  2O9B A;  2PT7 A;  4EUV A;  4R38 A;  4WF0 A;  4R6L A;  4WLA A;  3FPV A;  2J3T C;  2K7S A;  3ICY A;  3R7W B;  3MMH A;  1DP8 A;  1GSX A;  2HF6 A;  2XA7 M;  2JKR I;  1N9N A;  5DJT A;  2JKT M;  4BWI A;  2VV6 A;  3T4O A;  5F69 A;  4KQO A;  3LIE A;  1NRJ A;  1S67 L;  2QYB A;  4ARZ A;  4Z1W A;  4YOF A;  1OT6 A;  1DP9 A;  1MZU A;  2V0W A;  3OCN A;  1OJG A;  3T4L A;  3KSI A;  5HD3 A;  3KSH A;  2HJ9 C;  2ZOH A;  3CUE C;  4IHQ A;  4YNR A;  4L9F A;  3S7P A;  3U2A A;  1XFQ A;  3F1N B;  5IT5 A;  3C38 A;  4UQI M;  2P7J A;  4HJ4 A;  1EW0 A;  1XJ6 A;  2GX5 A;  1H3Q A;  3H82 B;  3PYP A;  5MC7 A;  2OAQ 1;  2GJ3 A;  3ZQ5 A;  1ZTU A;  4G3K A;  5TBM B;  3LIF A;  3UB9 A;  4WUJ A;  5L8M A;  2M7V A;  2Z6C A;  1YSP A;  3EGX C;  1ODV A;  5AVE A;  3CLO A;  5HWW A;  3B42 A;  1D06 A;  1S1Y A;  1G6O A;  4I3I A;  1KOU A;  3BW6 A;  4JGP A;  3EQU A;  3F1P B;  3TW8 A;  4WEL A;  3S7O A;  3LR5 A;  3UB6 A;  4JGO A;  2WKP A;  2GNX A;  3MR0 A;  1G28 A;  1Y28 A;  4R3A A;  1OJ5 A;  3E4P A;  1OTB A;  1T1A A;  3CAX A;  4EU0 A;  2K2N A;  4GHI B;  3LFV A;  4JGQ A;  5AJG A;  2VEA A;  3KYQ A;  3VOL A;  2QJ7 A;  2L1M A;  4LLO B;  2FZ0 A;  1T1B A;  2L4R A;  4I3A A;  3LR0 A;  3UE3 A;  2OOL A;  3EEA A;  3PR6 A;  1N9L A;  3O5Y A;  4XT2 B;  2LB5 A;  2XRO A;  4R70 A;  1T19 A;  4H6J A;  1W63 M;  1X0O A;  2VLG A;  2XSS A;  2VGL M;  3EGD C;  4HP4 A;  4O8G A;  4CLC D;  3C2W A;  4MMN A;  3V67 A;  1LT0 A;  1D7E A;  4DJ2 A;  2VV7 A;  1UWN X;  3NOU C;  4F3L B;  4HQA A;  4IUK A;  4HP9 A;  3LIC A;  3K3C A;  3RTY A;  1XJ2 A;  4O0P A;  3OLO A;  4P6Z M;  2B02 A;  2D01 A;  4ME4 A;  3BWL A;  2W3H A;  3KYZ A;  4DJ3 A;  1STZ A;  1UWP X;  5I5L A;  4G3W A;  5DFX A;  3OC2 A;  3UB7 A;  3EQV A;  1OTD A;  3E0Y A;  2W3F A;  4LRY C;  3R7W A;  5C5K A;  1GSW A;  1IOU A;  3LIA A;  4FOF A;  1F98 A;  4PKY A;  4GS9 B;  3GEC A;  2OWH A;  1MKM A;  3A0R A;  3PBQ A;  2P08 A;  2O9A A;  2QHK A;  4WEK A;  4BBU A;  2V1A A;  3W2Z A;  5EFW A;  2O9C A;  5CX7 A;  5LBR A;  1OT9 A;  2YKF A;  2Y79 A;  4Q0J A;  5DKK A;  4BJP A;  3R4K A;  1V9Z A;  2DMW A;  4AFI A;  3K2N A;  1LL8 A;  4HJ3 A;  3E98 A;  4GCZ A;  3F1N A;  2O99 A;  5J3W A;  2J3W A;  3CUE A;  3HJI A;  3E4Q A;  1YKD A;  1V9Y A;  1VHM A;  4MN7 A;  4Q0H A;  5F68 A;  4HOI A;  2D02 A;  3MQO A;  1GSV A;  4HI4 A;  2QWS A;  3T4Q A;  1TS6 A;  4HH2 A;  1XFN A;  2G7U A;  4GW9 A;  4ZRR A;  4FSF A;  2EA9 A;  4PKY G;  3G6O A;  3NOP C;  4II7 A;  1P97 A;  5HDC A;  2KLI A;  2PHY A;  4MCW A;  2KDK A;  3LID A;  3LYX A;  4WN5 A;  1S4S A;  3KSF A;  1LSX A;  1P0Z A;  2B18 A;  4IJG A;  4Q0I A;  3UE6 A;  4LRZ E;  2V0U A;  3P7N A;  1NLY A;  4Y5F A;  4LPZ A;  3P01 A;  4CLC C;  3KX0 X;  2L0W A;  2J3T D;  4DMZ A;  3LIB A;  3H7W A;  5AVF A;  1LSV A;  1S1Z A;  2H28 A;  3PXP A;  4CLC B;  3FG8 A;  4BBV A;  4YWZ A;  4GJ4 A;  4XT2 A;  4HY8 A;  5K5B A;  5HDS A;  4EES A;  3CIT A;  4Y3I A;  4EXO A;  4PAU A;  4F3L A;  3HCY A;  1JNU A;  2HGV A;  2VX8 A;  2PDR A;  4I39 A;  4Y2F A;  3EEH A;  3LR3 A;  1TS8 A;  4G3V A;  5KSH A;  2ZMF A;  1OTA A;  2PD7 A;  3BQA A;  2A24 B;  2K31 A;  4K08 A;  2M1C A;  4I3J A;  3BY8 A;  5G4Y A;  3T50 A;  5HWV A;  2PYP A;  1TD5 A;  2BAS A;  2VZW A;  5HSQ A;  3D72 A;  1W63 Q;  4B93 A;  2KX6 A;  3FC7 A;  5DFY A;  1H8M A;  2JKT I;  4PHT A;  1TS0 A;  3KO6 A;  3HJK A;  2WKR A;  3VE4 A;  4CQH A;  2LB9 A;  4NKP A;  1NWZ A;  3NJA A;  3KSG A;  2A2L A;  2JN7 A;  4BMW A;  1YSQ A;  4I38 A;  2VJW A;  2HJE A;  1DP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...