2EAPA

Solution structure of the n-terminal sam-domain of human lymphocyte cytosolic protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
GSSGSSGMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphocyte cytosolic protein 2
publication title Solution structure of the N-terminal SAM-domain of human lymphocyte cytosolic protein 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eapA01
2D3DA 2Y9UA 1WWUA 2E8MA 2QB0A 1SV4A 1LKYB 3HILA 2KSOA 2YTUA 3SEIA 1COKA 2K60A 2QARB 3BS5A 2QKQA 1PK1A 2GLEA 2K4PA 2QB1A 3H8MA 2DKXA 2E8NA 5JRTA 2E8OA 1DXSA 1B4FA 1UQVA 2KG5A 2QB0B 3KKAC 2EANA 5JU5A 1V38A 2LMRA 1SXEA 3BS7A 2EAMA 2KSOB 2ESEA 3SENA 2KIVA 3K1RB 2F3NA 3BQ7A 4MHVA 2DKZA 5J8YA 1X40A 4PZOA 1OW5A 1WWVA 5F3XB 2F44A 4IS7A 5L1MA 2DL0A 2LPEA 1F0MA 3TACB 2KE7A 2ES6A 1KW4A 1SV0A 1B0XA 1SGGA 4NL9A 4PZNA 2EAPA 3BS5B 1SV0C 1PK1B 2L5YA 1Z1VA 1OXJA 2QARA 2E8PA 2JV3A 4NL9C 5KNIA 3TADA 2Y9TA 1JI7A 2B6GA 5J8YC 1UCVA 2EAOA 2FE9A 3TADC 4RQNA 1PK3A 2F8KA 1X9XA 2D8CA 3IDWA 1LKYA 1RG6A 4RQMA 1V85A 1SXDA 1X66A 2KMDA 3KKAA 4NJ8A 5JTIA
chains in the Genus database with same CATH superfamily
2NRVA 3IV6A 3AU6A 4B9VA 1XO1A 3ETRA 2BDUA 3I76A 2AGQA 1A76A 5ALPA 4KITB 5KT2A 4IRDA 1JMSA 1M6YA 5KFMA 5J0TA 4JWNA 7ICVA 5AKLA 1ZQOA 8ICVA 2FJ6A 4Q43A 4AP9A 4Y2RA 2BKEA 1N5XA 4PHAA 4IQVA 3B0YA 4ECQA 2WTFA 3HT3A 3PO4A 1ZQCA 4I2GA 4B9UA 3C28A 8ICWA 2KSOB 2ESEA 2ZIWA 4ECXA 3C2MA 2KP7A 5AKXA 1OUQA 1RXWA 4F5NA 5ALHA 2WF9A 3WKAA 4U6PA 5J2GA 3PMNA 1ZQVA 5KFVA 5J0XA 2F44A 4PH5A 3SAHA 2W9CA 2ZTDA 2RP5A 5HR6A 2LPEA 1T3NA 5ALZA 5AICA 5KG3A 5ALYA 1QQ5A 2C2EA 1WCLA 3C21A 4RT3A 3LDAA 4R63A 2ISPA 2UVWA 1NJXA 2M9NA 4UAVA 4QZIA 3EPGA 2R18A 4YD1A 9ICIA 4F5QA 2HOQA 1ZQNA 2RDIA 2ZG6A 5DB7A 1S5LU 4OJLA 2PI4A 2ZIVB 1ZETA 5TISU 2NRTA 1PK3A 3N7PD 4I2AA 2Z7JA 9ICBA 2W8KA 5KFNA 3QEBZ 2HBKA 3OJUA 4BWJA 3BDPA 2FMQA 1DK2A 3PO5A 5AKKA 1H38A 2HMXA 5ALUA 3IRUA 3QYPA 3V7KA 2H3ZA 4DSLA 2W9MA 5KTQA 3MR5A 1T4GA 4OCZA 5ALRA 3GU3A 4ELUA 3CNHA 1RYSA 3H7IA 1KLNA 4I2JA 4YQWA 4KMOB 1N61A 3BZKA 5KFAA 2MAXA 3KD3A 5DLFA 4LZDA 3ALRA 3RTVA 2W7OA 5AKIA 4KLSA 7ICGA 3H8MA 1ZQGA 3QU5A 1CUKA 2GO7A 1D8YA 4YVZA 1L3TA 4CCHA 1COOA 1TAUA 5AIBA 3SENA 4LJXA 8ICZA 2KFNA 2ZUDA 3PX6A 2OH2A 4Z6DA 2QLTA 3HKZF 4Y2QA 2Q4TA 3M7DA 5KFZA 4PGQA 3Q8KA 5JUMA 4KX5A 5HMMA 2XCAA 1Z1BA 5IIMA 3ZDEA 2KE7A 1ZQZA 3NRZA 5ALFA 4M9HA 2XIDA 4BUGA 7ICRA 4ED7A 3M9MB 3QNMA 2JV3A 5KFGA 5J29A 2EZXA 4M0AA 5HR7A 3QE9Y 1SL2A 8ICOA 3L3FX 4TUSA 2WAQF 2KOBA 4KLEA 3JPQA 3SR6A 1DRGA 3RAQA 3JPPA 5L1IA 4O0IA 4Y2JA 4TURA 4DFKA 4OO1J 3UPQA 4YXMA 2C2RA 5AIAA 4US9A 3EZ5A 2G0AA 3F2DA 4EYHB 4XQ8A 5DLGA 4PGXA 1TAQA 2E5SA 2P35A 3IHQB 5AKHA 4YMNA 1ZXIA 5BOLA 2R8GA 3H8WA 3KZIU 2XY6A 3CW2C 2VA8A 3GV5B 3GV8B 4MFFA 4O5CA 2HHVA 3RB0A 4RNMA 2K60A 4HYKA 3F2BA 8ICFA 2QKQA 5KFCA 3RJGA 3MABA 4Z6FA 4DSIA 5KFXA 3QU9A 4C8OA 4NY8A 1Y88A 3OPXA 5J0UA 2ALZA 4KLDA 5JU5A 5FP0A 3WKDA 3L4PA 1KRPA 5CWRA 2ZJAA 4QWCA 3ZI4A 4Z6EA 2F3NA 1XSNA 3UQ0A 2GH1A 2I5HA 1ZQQA 3HW8A 1Z4NA 1S0OA 1BVSA 4ZH4A 4Y2SA 5KFBA 4JV0A 1JX4A 4G9BA 4QW9A 1B22A 4PHDA 9ICMA 1MQ3A 5IIOA 4LZGA 2V4RA 4UB3A 1QTMA 1VDVA 4KLFA 4GC7A 1XU4A 4MF2A 1IIPA 9ICPA 5GTIU 1RXVA 3MR6A 1PK1B 3A0BU 1ZJNA 5B5EU 1GO3F 3GIKA 4XUSA 4EBEA 4DWIA 4NM1A 2HHTA 1KFTA 5D46A 3L5KA 5CRXA 5KFQA 1T94A 5CHGA 2ZXHA 2IOFK 3NVYA 3RJIA 5KAIU 4O3PA 1X6IA 8ICUA 1ZQDA 2JEGA 4QJFB 5G5HA 3RJKA 5D4BA 4F5RA 1Z3EB 4M9NA 4RQMA 4P0PB 2R8JA 5F9NA 1SXDA 3WK7A 5DQHA 3PMLA 4QNLA 1NI3A 2WF5A 1QLNA 4Y2UA 2KVSA 2CRXA 3QXGA 3WK4A 2EZYA 2MA1A 3RB6A 3RBDA 1NJWA 1RQNA 3JPNA 4FO6A 1NZBA 2YQEA 1XC9A 3C1ZA 3PSFA 5ALOA 1ZQIA 4QZEA 2VJ5A 8ICPA 2MUTA 9ICSA 3PW7A 2WAQC 5CEHA 9ICNA 1Z19A 8ICEA 2E8OA 1B4FA 1RZTA 4ECUA 3CRXA 9ICFA 1D8LA 5ALMA 3GFKB 8ICRA 3PW0A 5AK4A 1SL1A 1A6SA 8ICYA 1NK6A 5AKEA 1QCKA 1NZPA 5TZVA 2FMPA 4MEXA 2VA3A 5AI5A 4P4OA 1LB2B 1NKEA 5AI6A 2W9AA 4DLGA 2B0CA 1F0MA 4I2EA 4ZOHC 3TACB 2C28A 2CN1A 2HBLA 1TFRA 2ZIWB 3RB4A 1URJA 5J2EA 2ASLA 2KKVA 1AQ6A 2AHOB 3AMZA 2EAPA 2AGPA 1Z00A 7ICSA 4KLOA 1KFDA 1DK3A 5IIIA 2E8PA 1S0VA 4NL9C 4KX3A 4F4YA 5ALTA 4LVSA 2JMGA 4YG2A 2FLLA 4KMUA 1S97A 1QSSA 3JPRA 5AI0A 2FE9A 3TADC 3D2NA 4RQ7A 3RR8A 3IN5A 5G5GA 4PGYA 4DFPA 8ICBA 4M9LA 3FM9A 8ICLA 1V85A 2A1JA 3QEAZ 5KFHA 2D3DA 2LYHA 2NO4A 4QZAA 4UATA 3AUOA 1KL9A 4M9GA 3PW5A 4F93B 5KFUA 5J0PA 3UMBA 2WHEA 1KFSA 2IBKA 2ZIUA 4DQRA 3EUB2 4KLHA 9ICXA 2QB1A 4NV0A 1O03A 5KFEA 1TK5A 1UQVA 4YMMA 1ZD4A 1U9LA 9ICUA 4XA5A 3C1YA 4P4MA 2BQUA 8ICHA 4PL1A 3ISBA 1ZQ1C 4IQTA 2NRWA 1BPYA 3NUQA 2FPLA 4DL5A 1UA0A 1L8OA 1CI4A 1YT3A 3B0XA 5J2BA 2DL0A 1ZQAA 4FE3A 1ECWA 4RQ5A 1CEZA 2KN7A 3RAXA 3H0RB 1ZQUA 3M9OB 4Y2TA 4PJ0U 4US8A 5CJ7A 3ONNA 1NK8A 2UVRA 2W43A 2W8LA 1N56A 3DDHA 4I2BA 4EBCA 2HOIA 2WF7A 2E1FA 1K1QA 3AQFA 3ED5A 1NK0A 4UW9A 1N5WA 3D6JA 2AJQA 4R8UB 2K8AA 5DG9A 3D2SA 3RRHA 2PMZF 2KK0A 3EW9A 5DQIA 4P0QA 2UVUA 2BPGA 4RPXA 3KHRA 1VJ5A 2HHXA 4C4TA 4KLLA 1BPDA 2CPRA 3FC4A 1TKDA 5AI4A 3Q8MA 3AN1A 7ICUA 2DKXA 4DSFA 1SKSA 4Y2XA 8ICMA 3QUCA 1FEZA 4ECTA 4DOCA 3F5AA 3RBEA 4J9MA 1ZQPA 1ZQJA 5IIJA 2VJ4A 5DKWA 2BHNA 2W04A 4KLJA 5HNKA 4QWDA 4C8LA 1S76D 2F8LA 2I1QA 5EE1A 2ATLA 2G5HB 2BPCA 5KL8B 3F2CA 2NRXA 3C2KA 2HCFA 4J03A 4QWEA 2BCSA 4DFJA 1D8BA 5EOZA 2OXOA 2HHWA 1JI7A 2H5XA 3BQTA 3NTUA 4UB5A 1XNSA 2YX8A 4CF4A 1A77A 4RQ4A 1NK9A 1QSYA 1XO0A 3GILA 1UT5A 2WF8A 2XGPA 4O3RA 3PX0A 4TUQA 4ED2A 2WB1F 3C2LA 2V9WA 2BZFA 1SWWA 3GIMA 3IP4B 4NWIA 2FLNA 5DQGA 5J2HA 1QH9A 4CDGA 1C20A 3UM9A 5KFDA 4F92B 4HAIA 1U49A 4I2CA 3D2QA 4RNNA 3BS5A 3EWAA 4M04A 2R8KA 5HHHA 4BXOA 2HVIA 4GIBA 4OJ5A 3V72A 1ZQLA 2Y1JA 3RRGA 2AXTU 3KKAC 2H3IA 2LMRA 1ZD3A 4NLGA 2G5IB 4YR2A 5DB9A 3JPSA 3BQ7A 2PMZC 3MR3A 2JR5A 2MUTB 3QU2A 2YMPA 4F5PA 9ICJA 4PZOA 4UB6U 2LYBA 2Y0SF 3ZD8A 1QSLA 5ALWA 4PHEA 4EENA 3MDAA 3GIIA 4RT2A 5AM3A 4YR0A 2BR0A 1JXLA 1SGGA 9ICQA 1VLBA 4YP3A 4R64A 4YMOA 1L3VA 2YMMA 3V7LA 5KNIA 3Q8RB 4A8EA 2O6KA 2OYYA 2R8IA 1RYUA 4ED8A 1N62A 3RJHA 7ICIA 3CP8A 1LVHA 2AQ0A 2HW3A 5ALEA 4E0DA 4IRKA 5J2KA 2GOLA 3I28A 4C4SA 2ZIXA 4BJQA 3SAFA 4QZDA 3WK8A 1Z00B 3OTQA 4EELA 2AQ4A 4UBBA 1F44A 1RG6A 9ICGA 5BPCA 2K4EA 3M8RA 1IV8A 4UAZA 3PX4A 3PY8A 2KEYA 2YB1A 1RYRA 2ZTCA 4OD0A 4B6JA 1FFVA 5AK6A 4J9QA 1DGJA 1KBUA 4YFKA 2HHUA 2ZUCA 1HUOA 2A1JB 1WYGA 4TQSA 2N1RA 5AK3A 5KG5A 4ECWA 2YB4A 2XGQA 1S9FA 5KFOA 5ALIA 3MGHA 1DXSA 2M0NA 2KG5A 4G3IA 1QQ6A 3UMGA 2BGWA 1XWLA 3BS7A 1MQ2A 2RRDA 3TFSA 4C80A 2WB1C 2BCVA 9ICTA 1SZHA 3ISDA 1NOMA 2ZIUB 1KKXA 2W7PA 1Q3VA 3EPIA 4GC6A 1JRPA 4DL4A 4DL3A 1S0NA 3RF9A 4TQRA 2W9BA 4DFDA 1XSPA 2ES6A 1KW4A 5KT5A 3QX7A 3M8SA 1UT8A 2OM6A 3ZDAA 2HVHA 1A0PA 3OGUA 5KFJA 1N48A 4RPZA 3N97B 3BJYA 4TUPA 1SV0C 3AL0B 4CE6A 3BQ1A 4EYIB 3ICXA 3N4MB 4GXKA 1J2MA 1RPLA 4F3OA 2EZZA 5DG8A 3S6JA 2IOFA 4QZFA 3PNCA 3AU2A 5KG2A 3QU7A 3BZCA 3EYZA 1NKBA 7ICOA 5L1KA 8ICAA 4ECSA 1X9XA 8ICCA 1LKYA 3Q8QB 5D49A 2P66A 4B9SA 3HRDD 4OJ6A 4B9NA 1SKRA 4O3MA 3PW2A 1T7PA 5JTIA 5J2IA 4X5VA 2JEJA 4NLKA 5KFKA 1B43A 4EBDA 1WWUA 2KJ8A 3RJFA 4CF3A 3M6KA 1ZQBA 2HBJA 5J0RA 3KTQA 3TANA 8ICXA 4F50A 3HKZC 2QARB 3H4BA 5L1LA 3PV8A 3V7JA 2I9GA 1U47A 2KFZA 3DV9A 2OEHA 4NLCA 3SZ2A 3UQ2A 2XVTA 3OSPA 3QUBA 5AKJA 2JHDA 4DQQA 3WKBA 4IR1A 1L7PA 5J2FA 4QZ8A 3T79A 2KIVA 3WKEA 4I2HA 4RUAA 2XICA 8ICTA 3SI8A 3NVZA 4OJOA 4GXIA 4GLXA 4F71A 3NS1A 5DDYA 1KDHA 3HWTA 2F76X 2K4IA 5A0LA 5HP4A 1PUZA 4RUCA 2FI1A 4O5EA 4K4IA 2PKEA 3RH5A 4K4GA 3SD7A 4YCXA 2GWSA 3BQ0A 2IHMA 3FYHA 4ED3A 2KZZA 4EEYA 1Z1VA 2DUYA 2FPMA 2AH5A 1J2NA 3RB3A 2HBMA 4KN4A 1PVRA 1IG6A 2KHQA 2HDOA 7ICNA 1SB3C 3OJSA 4I28A 4QZ9A 1KEJA 5EE3A 5DBCA 4RQ3A 2FDRA 3C5FA 2KZ3A 4AYBF 3MBYA 1ZRMA 2KIWA 2W9CB 2KMDA 3KKAA 4B9MA 4M47A 1NK4A 7ICKA 1ZQFA 4C0ZA 2XY5A 2XC9A 2LKYA 3M6ZA 4BX9C 4KLUA 2YMLA 2JH1A 2XO7A 1L7NA 4JUZA 2YTUA 2ZTEA 4YXJA 2C2DA 1JXEA 3V6KA 2F77X 1XSLA 4CGZA 1WG8A 2LI6A 4KLMA 4KLQA 2C22A 2IOHA 3O0FA 1AROP 3KBBA 3K1RB 3PSIA 4UQGA 1Z4OA 4QIWF 4RQ2A 4BXOB 4MFCA 1HJPA 5EWEA 3ZDCA 5J0SA 4UB2A 4DSKA 4F5OA 4DLEA 3GZFA 3LWLA 9ICVA 3NVVA 3H0MB 3C5GA 3T3FA 4QZBA 5L1JA 4QW8A 1NKCA 1MC8A 1S0MA 1S10A 2JH7A 4DSEA 1L5UA 9ICRA 4M2YA 3VCBA 3NVWA 4KLGA 4ECRA 3OHBA 3J81j 1BPEA 8ICSA 1UCVA 4RNOA 5KG7A 4ELVA 4Q8EA 3TARA 4J9PA 2IMWP 4Y2PA 4IC9A 2F8KA 9ICAA 2CXYA 3QU4A 4CF5A 3LVVA 2VANA 1PVQA 3MGIA 2E1EA 3I1YA 3NRWA 4FS2A 4NJ8A 5KFIA 2ZUBA 2KHVA 2ODGA 8ICGA 2G09A 2ZIXB 3SAGA 3T5LA 3U26A 2BQRA 3JPTA 5ALGA 9ICEA 2YY6A 2RLTA 1MA7A 4RU9A 5GTHU 5KFRA 1F5SA 1PK1A 2GLEA 4KN7A 3BQ2A 4J9LA 3H40A 5JRTA 4DL7A 3MC1A 4UB8U 5C0YA 4NLNA 4Q44A 1V38A 7ICJA 2EAMA 1ZQMA 1SL0A 4GXJA 3LVWA 1ZQSA 3N28A 2DKZA 1ZOLA 4MEYA 3VC8A 2OWOA 1WWVA 5F3XB 4YD2A 3ZDDA 4I29A 1NNLA 1ZQXA 2E3TA 1JUDA 1S8OA 4MF8A 3WU2U 2IHNA 4DF4A 4O3NA 5B66U 4XRHA 8ICQA 2HHQA 1MSWD 4DS4A 2KJ9A 4BWMA 2WF6A 3N7SC 2KVCA 3ZD9A 8ICNA 3KFUF 2Y9TA 2W9BB 4ED6A 4O9MA 3QUQA 4PHPA 2EH9A 4QIWC 1BPBA 1JIHA 5AKZA 5IIKA 2Y1IA 5ALQA 4UAYA 1SZPA 4B9TA 1PZNA 2D8CA 4ICAA 2FLPA 2ZJ5A 1S77D 5KG0A 3UXNA 5IILA 1UA1A 2K4HA 4UARA 1ZQRA 1U48A 7ICHA 3WKCA 1KSPA 3UMCA 7ICTA 3QZ7A 5KAFU 5KFPA 1ZQWA 1LKYB 3M1YA 1COKA 4K4HA 1DOQA 2P6RA 2NV3A 2KV2A 2ZXIA 3IG8A 2B21A 4C8KA 4FBTA 2E8NA 4J9KA 4DSJA 2DBYA 4UAWA 4J9OA 4OJPA 4F2RA 3GIJA 2EANA 2DWQA 4F4WA 2A3VA 4EEKA 5C5JA 3B9JA 3K75D 4UASA 5ALKA 3G6YA 4NLBA 4JV2A 5AKYA 1MN8A 5H2FU 4RQ6A 4J9RA 2JRZA 2JEFA 1NK7A 1L3SA 1OW5A 2AU0A 1L7MA 2JZBA 3FAHA 4IS7A 5DGBA 4QWBA 1ZQYA 4RQ8A 4B9LA 9ICLA 2J6TA 3LK9A 4RPYA 1BPZA 3TAPA 3IM1A 3TAQA 3T5KA 1V97A 4ED0A 4RQ0A 1K1SA 1D9DA 3H0LB 4NL9A 4PZNA 2BPFA 4PL2A 4EZ9A 9ICOA 5AI8A 2BQ3A 3E2EA 5AM4A 5BOMA 2BCUA 1C7YA 3ISCA 3TKAA 3TADA 4F8RA 1KTQA 5J8YC 2PFQA 5ALNA 5ALXA 2EAOA 3PSPA 3KHHA 7ICQA 3H8SA 2F2AB 5DB6A 1ZQHA 2IA6A 1T3QA 3IDWA 3OHAA 5IINA 4I27A 1O08A 4KLIA 3SQIA 3TQ1A 5CP2A 2RQ5A 1RQLA 5KFSA 4GFJA 4UBCA 3LWMA 2PXIA 1L3UA 1RDFA 2QB0A 1CRXA 2FPKA 1JROA 3HILA 3M9NB 8ICKA 4P4PA 4QWAA 3Q8SB 1ZJMA 2PFOA 3MFHA 3IG5A 2RDJA 5AM2A 2XI9A 1V9PA 1P7DA 5J2JA 4Y2YA 5ALLA 1JN3A 4F4XA 2D6FC 1SXEA 1TE2A 2I6XA 4J9SA 4C8NA 3V6HA 2RHFA 1N60A 3Q8PB 4C7YA 3PR4A 4Y2VA 5DBBA 4R8UA 1HUZA 5KT4A 4M6WA 1X9SA 3OSNA 2W55A 4RZRA 4JWMA 5ALSA 4P2HA 1TK0A 4QZHA 1D9FA 5KFYA 5J0OA 3MR2A 3HPOA 4UB1A 5DB8A 4DL2A 2OCEA 5J2AA 5KFTA 5EE0A 5HMLA 4ECYA 3KZXA 4NM2A 9ICHA 4JB3A 1OXJA 1IXRA 1N2XA 5J0QA 1X9WA 1NK5A 4PPXA 2KICA 2KZMA 2LM4A 1L7OA 3PVXA 5KFLA 2LYAA 5DBAA 2DQNB 2Q0ZX 4O3QA 4FS1A 4CNQA 2K8BB 1SIJA 3F53A 2W3RA 4JV1A 4U7CA 5CR0A 3MFIA 4IRCA 7ICFA 2Y9UA 1X2IA 3E58A 4R65A 5CB1A 4C7ZA 1NJYA 4DO9A 7ICMA 1SV4A 3AM9A 2H3QA 1J97A 1BNPA 2KSOA 5AKGA 4BDPA 4CRXA 4YR3A 1Q8KA 1KQQA 5CA7A 2Y0SC 5L9XA 2MRLA 5AHXA 3PZPA 3K4GA 1FO4A 1BNOA 1U4BA 1NJZA 5J2DA 3PSTA 3RJJA 3AEVA 2XY7A 2BDPA 4MHVA 2H3VA 2UVVA 4DQPA 4UAUA 1X42A 1X40A 5L1MA 4P0QB 3H4DA 4WJ3B 2LHTA 3TI0A 3PW4A 4FZLA 1L6NA 2BCQA 5F9LA 4J9NA 2ZIVA 4C8MA 3FDSA 2F1IA 4F91B 3SMVA 4DQIA 3KOOA 4F72A 3SYZA 2NO5A 4ECVA 3THVA 3ORYA 5T14A 4FBUA 2W11A 2MSNA 2HI0A 4KTQA 2VIXA 4I2DA 5K4LA 4I2FA 5J2CA 3KHLA 2VA2A 4M9JA 4F4ZA 2DGZA 3AQEA 3RH4A 4C4RA 4R66A 5DGAA 3E0FA 1ZYQA 2DF4B 5DDMA 1X6JA 3JPOA 2EQYA 1X66A 1ZD5A 2HHSA 4IL6U 3WK6A 2ASDA 3G6VA 1HIWA 5KFFA 1IM4A 2KD1A 5KG4A 3T5HA 4DOBA 7ICLA 3F5EA 4F2SA 4QZGA 2V4QA 3R9KA 5KT7A 1TAMA 3K1ZA 3WK9A 1KN5A 1ED1A 4Q8FA 3NASA 5J0YA 5KT3A 3G6XA 2AGOA 1TV9A 1ZQKA 1ZD2P 5J8YA 4IQUA 2K89A 9ICCA 8ICJA 9ICWA 4ACOA 4JK1A 4IQWA 3CYMA 4DCCA 3WK5A 4I2IA 2PFNA 4FZNA 3GV7B 3DEEA 2P6UA 3KHGA 4FZMA 5EWGA 5HHIA 1B0XA 2G08A 4EZ6A 1WUDA 2F1HA 4F4KA 1ZRNA 1L8LA 5EE9A 1TK8A 5J0WA 3BS5B 1ZQEA 2ISOA 2L5YA 2JZBB 1WCNA 1DGSA 5ALJA 4ED1A 2JXJA 2YMQA 2ASJA 1UPHA 1UHUA 4NXZA 1BPXA 2LM1A 1X9MA 4O3OA 4RQNA 2EDUA 1N63A 5KL1B 5KG1A 4UB4A 3LYSA 3C23A 3RH6A 2KTQA 3HJEA 1FIQA 1SKWA 4DL6A 3ETLA 4KLTA 1FFUA 2A1AA 4DQSA 4FFDA 2E8MA 2OHFA 2W54A 3QUTA 3MGVA 2W3SA 4NLZA 4DF8A 1PVPA 2PI5A 4ELTA 3SEIA 3SV3A 2NYVA 4USAA 1XS9D 3SV4A 4EX7A 1LV5A 4IR9A 3C29A 4ECZA 2K4PA 5AM0A 3GDXA 4DFMA 2HOFA 1BGXT 4RQ1A 5AM5A 2FMSA 2W03A 2F1JA 3RJEA 2QB0B 1Q3UA 5AM1A 4DEZA 2DPIA 2H3FA 4BGDA 5KT6A 3Q8LA 2KNJA 3HX0A 3N7RC 4EX6A 2JGAA 4MFAA 2ZJ8A 3TFRA 1Q46A 2NRZA 5ALVA 5KG6A 5DG7A 1YZ6A 4DS5A 3NGDA 2BCRA 2JEIA 2HSZA 5EWFA 1ZQTA 3GQCA 7ICPA 4JMUA 4O5KA 2KKPA 5AK5A 3T5JA 5KFWA 4AYBC 1T8EA 1HEKA 1SV0A 1EXNA 3PR5B 1YZ7A 4M6WB 3H8JA 1TVAA 2QARA 3MDCA 2DFLA 3HP6A 2J6SA 4P0PA 4YN4A 2XCPA 3UXPA 2G07A 4Q45A 5AI9A 2VKQA 2LBOA 2B6GA 2KJ5A 3ZDBA 4O3SA 2MU2A 2YN4A 5E79U 4DOAA 2DPJA 8ICIA 4Z6CA 2R8HA 1K5OA 3A0HU 3RR7A 3V6JA 1QQ7A 1JALA 7ICEA 4QZCA 2J6UA 2A19A 1RM6C 2PFPA 3RFAA 3QZ8A 1SWVA 1U45A 5ALDA 2K8CB 2G06A 9ICKA 3UXOA 2WFAA
chains in the Genus database with same CATH topology
2D3DA 2Y9UA 1WWUA 2E8MA 2QB0A 1SV4A 1LKYB 3HILA 2KSOA 2YTUA 3SEIA 1COKA 2K60A 2QARB 3BS5A 2QKQA 1PK1A 2GLEA 2K4PA 2QB1A 3H8MA 2DKXA 2E8NA 5JRTA 2E8OA 1DXSA 1B4FA 1UQVA 2KG5A 2QB0B 3KKAC 2EANA 5JU5A 1V38A 2LMRA 1SXEA 3BS7A 2EAMA 2KSOB 2ESEA 3SENA 2KIVA 3K1RB 2F3NA 3BQ7A 4MHVA 2DKZA 5J8YA 1X40A 4PZOA 1OW5A 1WWVA 5F3XB 2F44A 4IS7A 5L1MA 2DL0A 2LPEA 1F0MA 3TACB 2KE7A 2ES6A 1KW4A 1SV0A 1B0XA 1SGGA 4NL9A 4PZNA 2EAPA 3BS5B 1SV0C 1PK1B 2L5YA 1Z1VA 1OXJA 2QARA 2E8PA 2JV3A 4NL9C 5KNIA 3TADA 2Y9TA 1JI7A 2B6GA 5J8YC 1UCVA 2EAOA 2FE9A 3TADC 4RQNA 1PK3A 2F8KA 1X9XA 2D8CA 3IDWA 1LKYA 1RG6A 4RQMA 1V85A 1SXDA 1X66A 2KMDA 3KKAA 4NJ8A 5JTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3D A;  2Y9U A;  1WWU A;  2E8M A;  2QB0 A;  1SV4 A;  1LKY B;  3HIL A;  2KSO A;  2YTU A;  3SEI A;  1COK A;  2K60 A;  2QAR B;  3BS5 A;  2QKQ A;  1PK1 A;  2GLE A;  2K4P A;  2QB1 A;  3H8M A;  2DKX A;  2E8N A;  5JRT A;  2E8O A;  1DXS A;  1B4F A;  1UQV A;  2KG5 A;  2QB0 B;  3KKA C;  2EAN A;  5JU5 A;  1V38 A;  2LMR A;  1SXE A;  3BS7 A;  2EAM A;  2KSO B;  2ESE A;  3SEN A;  2KIV A;  3K1R B;  2F3N A;  3BQ7 A;  4MHV A;  2DKZ A;  5J8Y A;  1X40 A;  4PZO A;  1OW5 A;  1WWV A;  5F3X B;  2F44 A;  4IS7 A;  5L1M A;  2DL0 A;  2LPE A;  1F0M A;  3TAC B;  2KE7 A;  2ES6 A;  1KW4 A;  1SV0 A;  1B0X A;  1SGG A;  4NL9 A;  4PZN A;  2EAP A;  3BS5 B;  1SV0 C;  1PK1 B;  2L5Y A;  1Z1V A;  1OXJ A;  2QAR A;  2E8P A;  2JV3 A;  4NL9 C;  5KNI A;  3TAD A;  2Y9T A;  1JI7 A;  2B6G A;  5J8Y C;  1UCV A;  2EAO A;  2FE9 A;  3TAD C;  4RQN A;  1PK3 A;  2F8K A;  1X9X A;  2D8C A;  3IDW A;  1LKY A;  1RG6 A;  4RQM A;  1V85 A;  1SXD A;  1X66 A;  2KMD A;  3KKA A;  4NJ8 A;  5JTI A; 
#chains in the Genus database with same CATH topology
 2NRV A;  3IV6 A;  3AU6 A;  4B9V A;  1XO1 A;  3ETR A;  2BDU A;  3I76 A;  2AGQ A;  1A76 A;  5ALP A;  4KIT B;  5KT2 A;  4IRD A;  1JMS A;  1M6Y A;  5KFM A;  5J0T A;  4JWN A;  7ICV A;  5AKL A;  1ZQO A;  8ICV A;  2FJ6 A;  4Q43 A;  4AP9 A;  4Y2R A;  2BKE A;  1N5X A;  4PHA A;  4IQV A;  3B0Y A;  4ECQ A;  2WTF A;  3HT3 A;  3PO4 A;  1ZQC A;  4I2G A;  4B9U A;  3C28 A;  8ICW A;  2KSO B;  2ESE A;  2ZIW A;  4ECX A;  3C2M A;  2KP7 A;  5AKX A;  1OUQ A;  1RXW A;  4F5N A;  5ALH A;  2WF9 A;  3WKA A;  4U6P A;  5J2G A;  3PMN A;  1ZQV A;  5KFV A;  5J0X A;  2F44 A;  4PH5 A;  3SAH A;  2W9C A;  2ZTD A;  2RP5 A;  5HR6 A;  2LPE A;  1T3N A;  5ALZ A;  5AIC A;  5KG3 A;  5ALY A;  1QQ5 A;  2C2E A;  1WCL A;  3C21 A;  4RT3 A;  3LDA A;  4R63 A;  2ISP A;  2UVW A;  1NJX A;  2M9N A;  4UAV A;  4QZI A;  3EPG A;  2R18 A;  4YD1 A;  9ICI A;  4F5Q A;  2HOQ A;  1ZQN A;  2RDI A;  2ZG6 A;  5DB7 A;  1S5L U;  4OJL A;  2PI4 A;  2ZIV B;  1ZET A;  5TIS U;  2NRT A;  1PK3 A;  3N7P D;  4I2A A;  2Z7J A;  9ICB A;  2W8K A;  5KFN A;  3QEB Z;  2HBK A;  3OJU A;  4BWJ A;  3BDP A;  2FMQ A;  1DK2 A;  3PO5 A;  5AKK A;  1H38 A;  2HMX A;  5ALU A;  3IRU A;  3QYP A;  3V7K A;  2H3Z A;  4DSL A;  2W9M A;  5KTQ A;  3MR5 A;  1T4G A;  4OCZ A;  5ALR A;  3GU3 A;  4ELU A;  3CNH A;  1RYS A;  3H7I A;  1KLN A;  4I2J A;  4YQW A;  4KMO B;  1N61 A;  3BZK A;  5KFA A;  2MAX A;  3KD3 A;  5DLF A;  4LZD A;  3ALR A;  3RTV A;  2W7O A;  5AKI A;  4KLS A;  7ICG A;  3H8M A;  1ZQG A;  3QU5 A;  1CUK A;  2GO7 A;  1D8Y A;  4YVZ A;  1L3T A;  4CCH A;  1COO A;  1TAU A;  5AIB A;  3SEN A;  4LJX A;  8ICZ A;  2KFN A;  2ZUD A;  3PX6 A;  2OH2 A;  4Z6D A;  2QLT A;  3HKZ F;  4Y2Q A;  2Q4T A;  3M7D A;  5KFZ A;  4PGQ A;  3Q8K A;  5JUM A;  4KX5 A;  5HMM A;  2XCA A;  1Z1B A;  5IIM A;  3ZDE A;  2KE7 A;  1ZQZ A;  3NRZ A;  5ALF A;  4M9H A;  2XID A;  4BUG A;  7ICR A;  4ED7 A;  3M9M B;  3QNM A;  2JV3 A;  5KFG A;  5J29 A;  2EZX A;  4M0A A;  5HR7 A;  3QE9 Y;  1SL2 A;  8ICO A;  3L3F X;  4TUS A;  2WAQ F;  2KOB A;  4KLE A;  3JPQ A;  3SR6 A;  1DRG A;  3RAQ A;  3JPP A;  5L1I A;  4O0I A;  4Y2J A;  4TUR A;  4DFK A;  4OO1 J;  3UPQ A;  4YXM A;  2C2R A;  5AIA A;  4US9 A;  3EZ5 A;  2G0A A;  3F2D A;  4EYH B;  4XQ8 A;  5DLG A;  4PGX A;  1TAQ A;  2E5S A;  2P35 A;  3IHQ B;  5AKH A;  4YMN A;  1ZXI A;  5BOL A;  2R8G A;  3H8W A;  3KZI U;  2XY6 A;  3CW2 C;  2VA8 A;  3GV5 B;  3GV8 B;  4MFF A;  4O5C A;  2HHV A;  3RB0 A;  4RNM A;  2K60 A;  4HYK A;  3F2B A;  8ICF A;  2QKQ A;  5KFC A;  3RJG A;  3MAB A;  4Z6F A;  4DSI A;  5KFX A;  3QU9 A;  4C8O A;  4NY8 A;  1Y88 A;  3OPX A;  5J0U A;  2ALZ A;  4KLD A;  5JU5 A;  5FP0 A;  3WKD A;  3L4P A;  1KRP A;  5CWR A;  2ZJA A;  4QWC A;  3ZI4 A;  4Z6E A;  2F3N A;  1XSN A;  3UQ0 A;  2GH1 A;  2I5H A;  1ZQQ A;  3HW8 A;  1Z4N A;  1S0O A;  1BVS A;  4ZH4 A;  4Y2S A;  5KFB A;  4JV0 A;  1JX4 A;  4G9B A;  4QW9 A;  1B22 A;  4PHD A;  9ICM A;  1MQ3 A;  5IIO A;  4LZG A;  2V4R A;  4UB3 A;  1QTM A;  1VDV A;  4KLF A;  4GC7 A;  1XU4 A;  4MF2 A;  1IIP A;  9ICP A;  5GTI U;  1RXV A;  3MR6 A;  1PK1 B;  3A0B U;  1ZJN A;  5B5E U;  1GO3 F;  3GIK A;  4XUS A;  4EBE A;  4DWI A;  4NM1 A;  2HHT A;  1KFT A;  5D46 A;  3L5K A;  5CRX A;  5KFQ A;  1T94 A;  5CHG A;  2ZXH A;  2IOF K;  3NVY A;  3RJI A;  5KAI U;  4O3P A;  1X6I A;  8ICU A;  1ZQD A;  2JEG A;  4QJF B;  5G5H A;  3RJK A;  5D4B A;  4F5R A;  1Z3E B;  4M9N A;  4RQM A;  4P0P B;  2R8J A;  5F9N A;  1SXD A;  3WK7 A;  5DQH A;  3PML A;  4QNL A;  1NI3 A;  2WF5 A;  1QLN A;  4Y2U A;  2KVS A;  2CRX A;  3QXG A;  3WK4 A;  2EZY A;  2MA1 A;  3RB6 A;  3RBD A;  1NJW A;  1RQN A;  3JPN A;  4FO6 A;  1NZB A;  2YQE A;  1XC9 A;  3C1Z A;  3PSF A;  5ALO A;  1ZQI A;  4QZE A;  2VJ5 A;  8ICP A;  2MUT A;  9ICS A;  3PW7 A;  2WAQ C;  5CEH A;  9ICN A;  1Z19 A;  8ICE A;  2E8O A;  1B4F A;  1RZT A;  4ECU A;  3CRX A;  9ICF A;  1D8L A;  5ALM A;  3GFK B;  8ICR A;  3PW0 A;  5AK4 A;  1SL1 A;  1A6S A;  8ICY A;  1NK6 A;  5AKE A;  1QCK A;  1NZP A;  5TZV A;  2FMP A;  4MEX A;  2VA3 A;  5AI5 A;  4P4O A;  1LB2 B;  1NKE A;  5AI6 A;  2W9A A;  4DLG A;  2B0C A;  1F0M A;  4I2E A;  4ZOH C;  3TAC B;  2C28 A;  2CN1 A;  2HBL A;  1TFR A;  2ZIW B;  3RB4 A;  1URJ A;  5J2E A;  2ASL A;  2KKV A;  1AQ6 A;  2AHO B;  3AMZ A;  2EAP A;  2AGP A;  1Z00 A;  7ICS A;  4KLO A;  1KFD A;  1DK3 A;  5III A;  2E8P A;  1S0V A;  4NL9 C;  4KX3 A;  4F4Y A;  5ALT A;  4LVS A;  2JMG A;  4YG2 A;  2FLL A;  4KMU A;  1S97 A;  1QSS A;  3JPR A;  5AI0 A;  2FE9 A;  3TAD C;  3D2N A;  4RQ7 A;  3RR8 A;  3IN5 A;  5G5G A;  4PGY A;  4DFP A;  8ICB A;  4M9L A;  3FM9 A;  8ICL A;  1V85 A;  2A1J A;  3QEA Z;  5KFH A;  2D3D A;  2LYH A;  2NO4 A;  4QZA A;  4UAT A;  3AUO A;  1KL9 A;  4M9G A;  3PW5 A;  4F93 B;  5KFU A;  5J0P A;  3UMB A;  2WHE A;  1KFS A;  2IBK A;  2ZIU A;  4DQR A;  3EUB 2;  4KLH A;  9ICX A;  2QB1 A;  4NV0 A;  1O03 A;  5KFE A;  1TK5 A;  1UQV A;  4YMM A;  1ZD4 A;  1U9L A;  9ICU A;  4XA5 A;  3C1Y A;  4P4M A;  2BQU A;  8ICH A;  4PL1 A;  3ISB A;  1ZQ1 C;  4IQT A;  2NRW A;  1BPY A;  3NUQ A;  2FPL A;  4DL5 A;  1UA0 A;  1L8O A;  1CI4 A;  1YT3 A;  3B0X A;  5J2B A;  2DL0 A;  1ZQA A;  4FE3 A;  1ECW A;  4RQ5 A;  1CEZ A;  2KN7 A;  3RAX A;  3H0R B;  1ZQU A;  3M9O B;  4Y2T A;  4PJ0 U;  4US8 A;  5CJ7 A;  3ONN A;  1NK8 A;  2UVR A;  2W43 A;  2W8L A;  1N56 A;  3DDH A;  4I2B A;  4EBC A;  2HOI A;  2WF7 A;  2E1F A;  1K1Q A;  3AQF A;  3ED5 A;  1NK0 A;  4UW9 A;  1N5W A;  3D6J A;  2AJQ A;  4R8U B;  2K8A A;  5DG9 A;  3D2S A;  3RRH A;  2PMZ F;  2KK0 A;  3EW9 A;  5DQI A;  4P0Q A;  2UVU A;  2BPG A;  4RPX A;  3KHR A;  1VJ5 A;  2HHX A;  4C4T A;  4KLL A;  1BPD A;  2CPR A;  3FC4 A;  1TKD A;  5AI4 A;  3Q8M A;  3AN1 A;  7ICU A;  2DKX A;  4DSF A;  1SKS A;  4Y2X A;  8ICM A;  3QUC A;  1FEZ A;  4ECT A;  4DOC A;  3F5A A;  3RBE A;  4J9M A;  1ZQP A;  1ZQJ A;  5IIJ A;  2VJ4 A;  5DKW A;  2BHN A;  2W04 A;  4KLJ A;  5HNK A;  4QWD A;  4C8L A;  1S76 D;  2F8L A;  2I1Q A;  5EE1 A;  2ATL A;  2G5H B;  2BPC A;  5KL8 B;  3F2C A;  2NRX A;  3C2K A;  2HCF A;  4J03 A;  4QWE A;  2BCS A;  4DFJ A;  1D8B A;  5EOZ A;  2OXO A;  2HHW A;  1JI7 A;  2H5X A;  3BQT A;  3NTU A;  4UB5 A;  1XNS A;  2YX8 A;  4CF4 A;  1A77 A;  4RQ4 A;  1NK9 A;  1QSY A;  1XO0 A;  3GIL A;  1UT5 A;  2WF8 A;  2XGP A;  4O3R A;  3PX0 A;  4TUQ A;  4ED2 A;  2WB1 F;  3C2L A;  2V9W A;  2BZF A;  1SWW A;  3GIM A;  3IP4 B;  4NWI A;  2FLN A;  5DQG A;  5J2H A;  1QH9 A;  4CDG A;  1C20 A;  3UM9 A;  5KFD A;  4F92 B;  4HAI A;  1U49 A;  4I2C A;  3D2Q A;  4RNN A;  3BS5 A;  3EWA A;  4M04 A;  2R8K A;  5HHH A;  4BXO A;  2HVI A;  4GIB A;  4OJ5 A;  3V72 A;  1ZQL A;  2Y1J A;  3RRG A;  2AXT U;  3KKA C;  2H3I A;  2LMR A;  1ZD3 A;  4NLG A;  2G5I B;  4YR2 A;  5DB9 A;  3JPS A;  3BQ7 A;  2PMZ C;  3MR3 A;  2JR5 A;  2MUT B;  3QU2 A;  2YMP A;  4F5P A;  9ICJ A;  4PZO A;  4UB6 U;  2LYB A;  2Y0S F;  3ZD8 A;  1QSL A;  5ALW A;  4PHE A;  4EEN A;  3MDA A;  3GII A;  4RT2 A;  5AM3 A;  4YR0 A;  2BR0 A;  1JXL A;  1SGG A;  9ICQ A;  1VLB A;  4YP3 A;  4R64 A;  4YMO A;  1L3V A;  2YMM A;  3V7L A;  5KNI A;  3Q8R B;  4A8E A;  2O6K A;  2OYY A;  2R8I A;  1RYU A;  4ED8 A;  1N62 A;  3RJH A;  7ICI A;  3CP8 A;  1LVH A;  2AQ0 A;  2HW3 A;  5ALE A;  4E0D A;  4IRK A;  5J2K A;  2GOL A;  3I28 A;  4C4S A;  2ZIX A;  4BJQ A;  3SAF A;  4QZD A;  3WK8 A;  1Z00 B;  3OTQ A;  4EEL A;  2AQ4 A;  4UBB A;  1F44 A;  1RG6 A;  9ICG A;  5BPC A;  2K4E A;  3M8R A;  1IV8 A;  4UAZ A;  3PX4 A;  3PY8 A;  2KEY A;  2YB1 A;  1RYR A;  2ZTC A;  4OD0 A;  4B6J A;  1FFV A;  5AK6 A;  4J9Q A;  1DGJ A;  1KBU A;  4YFK A;  2HHU A;  2ZUC A;  1HUO A;  2A1J B;  1WYG A;  4TQS A;  2N1R A;  5AK3 A;  5KG5 A;  4ECW A;  2YB4 A;  2XGQ A;  1S9F A;  5KFO A;  5ALI A;  3MGH A;  1DXS A;  2M0N A;  2KG5 A;  4G3I A;  1QQ6 A;  3UMG A;  2BGW A;  1XWL A;  3BS7 A;  1MQ2 A;  2RRD A;  3TFS A;  4C80 A;  2WB1 C;  2BCV A;  9ICT A;  1SZH A;  3ISD A;  1NOM A;  2ZIU B;  1KKX A;  2W7P A;  1Q3V A;  3EPI A;  4GC6 A;  1JRP A;  4DL4 A;  4DL3 A;  1S0N A;  3RF9 A;  4TQR A;  2W9B A;  4DFD A;  1XSP A;  2ES6 A;  1KW4 A;  5KT5 A;  3QX7 A;  3M8S A;  1UT8 A;  2OM6 A;  3ZDA A;  2HVH A;  1A0P A;  3OGU A;  5KFJ A;  1N48 A;  4RPZ A;  3N97 B;  3BJY A;  4TUP A;  1SV0 C;  3AL0 B;  4CE6 A;  3BQ1 A;  4EYI B;  3ICX A;  3N4M B;  4GXK A;  1J2M A;  1RPL A;  4F3O A;  2EZZ A;  5DG8 A;  3S6J A;  2IOF A;  4QZF A;  3PNC A;  3AU2 A;  5KG2 A;  3QU7 A;  3BZC A;  3EYZ A;  1NKB A;  7ICO A;  5L1K A;  8ICA A;  4ECS A;  1X9X A;  8ICC A;  1LKY A;  3Q8Q B;  5D49 A;  2P66 A;  4B9S A;  3HRD D;  4OJ6 A;  4B9N A;  1SKR A;  4O3M A;  3PW2 A;  1T7P A;  5JTI A;  5J2I A;  4X5V A;  2JEJ A;  4NLK A;  5KFK A;  1B43 A;  4EBD A;  1WWU A;  2KJ8 A;  3RJF A;  4CF3 A;  3M6K A;  1ZQB A;  2HBJ A;  5J0R A;  3KTQ A;  3TAN A;  8ICX A;  4F50 A;  3HKZ C;  2QAR B;  3H4B A;  5L1L A;  3PV8 A;  3V7J A;  2I9G A;  1U47 A;  2KFZ A;  3DV9 A;  2OEH A;  4NLC A;  3SZ2 A;  3UQ2 A;  2XVT A;  3OSP A;  3QUB A;  5AKJ A;  2JHD A;  4DQQ A;  3WKB A;  4IR1 A;  1L7P A;  5J2F A;  4QZ8 A;  3T79 A;  2KIV A;  3WKE A;  4I2H A;  4RUA A;  2XIC A;  8ICT A;  3SI8 A;  3NVZ A;  4OJO A;  4GXI A;  4GLX A;  4F71 A;  3NS1 A;  5DDY A;  1KDH A;  3HWT A;  2F76 X;  2K4I A;  5A0L A;  5HP4 A;  1PUZ A;  4RUC A;  2FI1 A;  4O5E A;  4K4I A;  2PKE A;  3RH5 A;  4K4G A;  3SD7 A;  4YCX A;  2GWS A;  3BQ0 A;  2IHM A;  3FYH A;  4ED3 A;  2KZZ A;  4EEY A;  1Z1V A;  2DUY A;  2FPM A;  2AH5 A;  1J2N A;  3RB3 A;  2HBM A;  4KN4 A;  1PVR A;  1IG6 A;  2KHQ A;  2HDO A;  7ICN A;  1SB3 C;  3OJS A;  4I28 A;  4QZ9 A;  1KEJ A;  5EE3 A;  5DBC A;  4RQ3 A;  2FDR A;  3C5F A;  2KZ3 A;  4AYB F;  3MBY A;  1ZRM A;  2KIW A;  2W9C B;  2KMD A;  3KKA A;  4B9M A;  4M47 A;  1NK4 A;  7ICK A;  1ZQF A;  4C0Z A;  2XY5 A;  2XC9 A;  2LKY A;  3M6Z A;  4BX9 C;  4KLU A;  2YML A;  2JH1 A;  2XO7 A;  1L7N A;  4JUZ A;  2YTU A;  2ZTE A;  4YXJ A;  2C2D A;  1JXE A;  3V6K A;  2F77 X;  1XSL A;  4CGZ A;  1WG8 A;  2LI6 A;  4KLM A;  4KLQ A;  2C22 A;  2IOH A;  3O0F A;  1ARO P;  3KBB A;  3K1R B;  3PSI A;  4UQG A;  1Z4O A;  4QIW F;  4RQ2 A;  4BXO B;  4MFC A;  1HJP A;  5EWE A;  3ZDC A;  5J0S A;  4UB2 A;  4DSK A;  4F5O A;  4DLE A;  3GZF A;  3LWL A;  9ICV A;  3NVV A;  3H0M B;  3C5G A;  3T3F A;  4QZB A;  5L1J A;  4QW8 A;  1NKC A;  1MC8 A;  1S0M A;  1S10 A;  2JH7 A;  4DSE A;  1L5U A;  9ICR A;  4M2Y A;  3VCB A;  3NVW A;  4KLG A;  4ECR A;  3OHB A;  3J81 j;  1BPE A;  8ICS A;  1UCV A;  4RNO A;  5KG7 A;  4ELV A;  4Q8E A;  3TAR A;  4J9P A;  2IMW P;  4Y2P A;  4IC9 A;  2F8K A;  9ICA A;  2CXY A;  3QU4 A;  4CF5 A;  3LVV A;  2VAN A;  1PVQ A;  3MGI A;  2E1E A;  3I1Y A;  3NRW A;  4FS2 A;  4NJ8 A;  5KFI A;  2ZUB A;  2KHV A;  2ODG A;  8ICG A;  2G09 A;  2ZIX B;  3SAG A;  3T5L A;  3U26 A;  2BQR A;  3JPT A;  5ALG A;  9ICE A;  2YY6 A;  2RLT A;  1MA7 A;  4RU9 A;  5GTH U;  5KFR A;  1F5S A;  1PK1 A;  2GLE A;  4KN7 A;  3BQ2 A;  4J9L A;  3H40 A;  5JRT A;  4DL7 A;  3MC1 A;  4UB8 U;  5C0Y A;  4NLN A;  4Q44 A;  1V38 A;  7ICJ A;  2EAM A;  1ZQM A;  1SL0 A;  4GXJ A;  3LVW A;  1ZQS A;  3N28 A;  2DKZ A;  1ZOL A;  4MEY A;  3VC8 A;  2OWO A;  1WWV A;  5F3X B;  4YD2 A;  3ZDD A;  4I29 A;  1NNL A;  1ZQX A;  2E3T A;  1JUD A;  1S8O A;  4MF8 A;  3WU2 U;  2IHN A;  4DF4 A;  4O3N A;  5B66 U;  4XRH A;  8ICQ A;  2HHQ A;  1MSW D;  4DS4 A;  2KJ9 A;  4BWM A;  2WF6 A;  3N7S C;  2KVC A;  3ZD9 A;  8ICN A;  3KFU F;  2Y9T A;  2W9B B;  4ED6 A;  4O9M A;  3QUQ A;  4PHP A;  2EH9 A;  4QIW C;  1BPB A;  1JIH A;  5AKZ A;  5IIK A;  2Y1I A;  5ALQ A;  4UAY A;  1SZP A;  4B9T A;  1PZN A;  2D8C A;  4ICA A;  2FLP A;  2ZJ5 A;  1S77 D;  5KG0 A;  3UXN A;  5IIL A;  1UA1 A;  2K4H A;  4UAR A;  1ZQR A;  1U48 A;  7ICH A;  3WKC A;  1KSP A;  3UMC A;  7ICT A;  3QZ7 A;  5KAF U;  5KFP A;  1ZQW A;  1LKY B;  3M1Y A;  1COK A;  4K4H A;  1DOQ A;  2P6R A;  2NV3 A;  2KV2 A;  2ZXI A;  3IG8 A;  2B21 A;  4C8K A;  4FBT A;  2E8N A;  4J9K A;  4DSJ A;  2DBY A;  4UAW A;  4J9O A;  4OJP A;  4F2R A;  3GIJ A;  2EAN A;  2DWQ A;  4F4W A;  2A3V A;  4EEK A;  5C5J A;  3B9J A;  3K75 D;  4UAS A;  5ALK A;  3G6Y A;  4NLB A;  4JV2 A;  5AKY A;  1MN8 A;  5H2F U;  4RQ6 A;  4J9R A;  2JRZ A;  2JEF A;  1NK7 A;  1L3S A;  1OW5 A;  2AU0 A;  1L7M A;  2JZB A;  3FAH A;  4IS7 A;  5DGB A;  4QWB A;  1ZQY A;  4RQ8 A;  4B9L A;  9ICL A;  2J6T A;  3LK9 A;  4RPY A;  1BPZ A;  3TAP A;  3IM1 A;  3TAQ A;  3T5K A;  1V97 A;  4ED0 A;  4RQ0 A;  1K1S A;  1D9D A;  3H0L B;  4NL9 A;  4PZN A;  2BPF A;  4PL2 A;  4EZ9 A;  9ICO A;  5AI8 A;  2BQ3 A;  3E2E A;  5AM4 A;  5BOM A;  2BCU A;  1C7Y A;  3ISC A;  3TKA A;  3TAD A;  4F8R A;  1KTQ A;  5J8Y C;  2PFQ A;  5ALN A;  5ALX A;  2EAO A;  3PSP A;  3KHH A;  7ICQ A;  3H8S A;  2F2A B;  5DB6 A;  1ZQH A;  2IA6 A;  1T3Q A;  3IDW A;  3OHA A;  5IIN A;  4I27 A;  1O08 A;  4KLI A;  3SQI A;  3TQ1 A;  5CP2 A;  2RQ5 A;  1RQL A;  5KFS A;  4GFJ A;  4UBC A;  3LWM A;  2PXI A;  1L3U A;  1RDF A;  2QB0 A;  1CRX A;  2FPK A;  1JRO A;  3HIL A;  3M9N B;  8ICK A;  4P4P A;  4QWA A;  3Q8S B;  1ZJM A;  2PFO A;  3MFH A;  3IG5 A;  2RDJ A;  5AM2 A;  2XI9 A;  1V9P A;  1P7D A;  5J2J A;  4Y2Y A;  5ALL A;  1JN3 A;  4F4X A;  2D6F C;  1SXE A;  1TE2 A;  2I6X A;  4J9S A;  4C8N A;  3V6H A;  2RHF A;  1N60 A;  3Q8P B;  4C7Y A;  3PR4 A;  4Y2V A;  5DBB A;  4R8U A;  1HUZ A;  5KT4 A;  4M6W A;  1X9S A;  3OSN A;  2W55 A;  4RZR A;  4JWM A;  5ALS A;  4P2H A;  1TK0 A;  4QZH A;  1D9F A;  5KFY A;  5J0O A;  3MR2 A;  3HPO A;  4UB1 A;  5DB8 A;  4DL2 A;  2OCE A;  5J2A A;  5KFT A;  5EE0 A;  5HML A;  4ECY A;  3KZX A;  4NM2 A;  9ICH A;  4JB3 A;  1OXJ A;  1IXR A;  1N2X A;  5J0Q A;  1X9W A;  1NK5 A;  4PPX A;  2KIC A;  2KZM A;  2LM4 A;  1L7O A;  3PVX A;  5KFL A;  2LYA A;  5DBA A;  2DQN B;  2Q0Z X;  4O3Q A;  4FS1 A;  4CNQ A;  2K8B B;  1SIJ A;  3F53 A;  2W3R A;  4JV1 A;  4U7C A;  5CR0 A;  3MFI A;  4IRC A;  7ICF A;  2Y9U A;  1X2I A;  3E58 A;  4R65 A;  5CB1 A;  4C7Z A;  1NJY A;  4DO9 A;  7ICM A;  1SV4 A;  3AM9 A;  2H3Q A;  1J97 A;  1BNP A;  2KSO A;  5AKG A;  4BDP A;  4CRX A;  4YR3 A;  1Q8K A;  1KQQ A;  5CA7 A;  2Y0S C;  5L9X A;  2MRL A;  5AHX A;  3PZP A;  3K4G A;  1FO4 A;  1BNO A;  1U4B A;  1NJZ A;  5J2D A;  3PST A;  3RJJ A;  3AEV A;  2XY7 A;  2BDP A;  4MHV A;  2H3V A;  2UVV A;  4DQP A;  4UAU A;  1X42 A;  1X40 A;  5L1M A;  4P0Q B;  3H4D A;  4WJ3 B;  2LHT A;  3TI0 A;  3PW4 A;  4FZL A;  1L6N A;  2BCQ A;  5F9L A;  4J9N A;  2ZIV A;  4C8M A;  3FDS A;  2F1I A;  4F91 B;  3SMV A;  4DQI A;  3KOO A;  4F72 A;  3SYZ A;  2NO5 A;  4ECV A;  3THV A;  3ORY A;  5T14 A;  4FBU A;  2W11 A;  2MSN A;  2HI0 A;  4KTQ A;  2VIX A;  4I2D A;  5K4L A;  4I2F A;  5J2C A;  3KHL A;  2VA2 A;  4M9J A;  4F4Z A;  2DGZ A;  3AQE A;  3RH4 A;  4C4R A;  4R66 A;  5DGA A;  3E0F A;  1ZYQ A;  2DF4 B;  5DDM A;  1X6J A;  3JPO A;  2EQY A;  1X66 A;  1ZD5 A;  2HHS A;  4IL6 U;  3WK6 A;  2ASD A;  3G6V A;  1HIW A;  5KFF A;  1IM4 A;  2KD1 A;  5KG4 A;  3T5H A;  4DOB A;  7ICL A;  3F5E A;  4F2S A;  4QZG A;  2V4Q A;  3R9K A;  5KT7 A;  1TAM A;  3K1Z A;  3WK9 A;  1KN5 A;  1ED1 A;  4Q8F A;  3NAS A;  5J0Y A;  5KT3 A;  3G6X A;  2AGO A;  1TV9 A;  1ZQK A;  1ZD2 P;  5J8Y A;  4IQU A;  2K89 A;  9ICC A;  8ICJ A;  9ICW A;  4ACO A;  4JK1 A;  4IQW A;  3CYM A;  4DCC A;  3WK5 A;  4I2I A;  2PFN A;  4FZN A;  3GV7 B;  3DEE A;  2P6U A;  3KHG A;  4FZM A;  5EWG A;  5HHI A;  1B0X A;  2G08 A;  4EZ6 A;  1WUD A;  2F1H A;  4F4K A;  1ZRN A;  1L8L A;  5EE9 A;  1TK8 A;  5J0W A;  3BS5 B;  1ZQE A;  2ISO A;  2L5Y A;  2JZB B;  1WCN A;  1DGS A;  5ALJ A;  4ED1 A;  2JXJ A;  2YMQ A;  2ASJ A;  1UPH A;  1UHU A;  4NXZ A;  1BPX A;  2LM1 A;  1X9M A;  4O3O A;  4RQN A;  2EDU A;  1N63 A;  5KL1 B;  5KG1 A;  4UB4 A;  3LYS A;  3C23 A;  3RH6 A;  2KTQ A;  3HJE A;  1FIQ A;  1SKW A;  4DL6 A;  3ETL A;  4KLT A;  1FFU A;  2A1A A;  4DQS A;  4FFD A;  2E8M A;  2OHF A;  2W54 A;  3QUT A;  3MGV A;  2W3S A;  4NLZ A;  4DF8 A;  1PVP A;  2PI5 A;  4ELT A;  3SEI A;  3SV3 A;  2NYV A;  4USA A;  1XS9 D;  3SV4 A;  4EX7 A;  1LV5 A;  4IR9 A;  3C29 A;  4ECZ A;  2K4P A;  5AM0 A;  3GDX A;  4DFM A;  2HOF A;  1BGX T;  4RQ1 A;  5AM5 A;  2FMS A;  2W03 A;  2F1J A;  3RJE A;  2QB0 B;  1Q3U A;  5AM1 A;  4DEZ A;  2DPI A;  2H3F A;  4BGD A;  5KT6 A;  3Q8L A;  2KNJ A;  3HX0 A;  3N7R C;  4EX6 A;  2JGA A;  4MFA A;  2ZJ8 A;  3TFR A;  1Q46 A;  2NRZ A;  5ALV A;  5KG6 A;  5DG7 A;  1YZ6 A;  4DS5 A;  3NGD A;  2BCR A;  2JEI A;  2HSZ A;  5EWF A;  1ZQT A;  3GQC A;  7ICP A;  4JMU A;  4O5K A;  2KKP A;  5AK5 A;  3T5J A;  5KFW A;  4AYB C;  1T8E A;  1HEK A;  1SV0 A;  1EXN A;  3PR5 B;  1YZ7 A;  4M6W B;  3H8J A;  1TVA A;  2QAR A;  3MDC A;  2DFL A;  3HP6 A;  2J6S A;  4P0P A;  4YN4 A;  2XCP A;  3UXP A;  2G07 A;  4Q45 A;  5AI9 A;  2VKQ A;  2LBO A;  2B6G A;  2KJ5 A;  3ZDB A;  4O3S A;  2MU2 A;  2YN4 A;  5E79 U;  4DOA A;  2DPJ A;  8ICI A;  4Z6C A;  2R8H A;  1K5O A;  3A0H U;  3RR7 A;  3V6J A;  1QQ7 A;  1JAL A;  7ICE A;  4QZC A;  2J6U A;  2A19 A;  1RM6 C;  2PFP A;  3RFA A;  3QZ8 A;  1SWV A;  1U45 A;  5ALD A;  2K8C B;  2G06 A;  9ICK A;  3UXO A;  2WFA A; 
#chains in the Genus database with same CATH homology
 2D3D A;  2Y9U A;  1WWU A;  2E8M A;  2QB0 A;  1SV4 A;  1LKY B;  3HIL A;  2KSO A;  2YTU A;  3SEI A;  1COK A;  2K60 A;  2QAR B;  3BS5 A;  2QKQ A;  1PK1 A;  2GLE A;  2K4P A;  2QB1 A;  3H8M A;  2DKX A;  2E8N A;  5JRT A;  2E8O A;  1DXS A;  1B4F A;  1UQV A;  2KG5 A;  2QB0 B;  3KKA C;  2EAN A;  5JU5 A;  1V38 A;  2LMR A;  1SXE A;  3BS7 A;  2EAM A;  2KSO B;  2ESE A;  3SEN A;  2KIV A;  3K1R B;  2F3N A;  3BQ7 A;  4MHV A;  2DKZ A;  5J8Y A;  1X40 A;  4PZO A;  1OW5 A;  1WWV A;  5F3X B;  2F44 A;  4IS7 A;  5L1M A;  2DL0 A;  2LPE A;  1F0M A;  3TAC B;  2KE7 A;  2ES6 A;  1KW4 A;  1SV0 A;  1B0X A;  1SGG A;  4NL9 A;  4PZN A;  2EAP A;  3BS5 B;  1SV0 C;  1PK1 B;  2L5Y A;  1Z1V A;  1OXJ A;  2QAR A;  2E8P A;  2JV3 A;  4NL9 C;  5KNI A;  3TAD A;  2Y9T A;  1JI7 A;  2B6G A;  5J8Y C;  1UCV A;  2EAO A;  2FE9 A;  3TAD C;  4RQN A;  1PK3 A;  2F8K A;  1X9X A;  2D8C A;  3IDW A;  1LKY A;  1RG6 A;  4RQM A;  1V85 A;  1SXD A;  1X66 A;  2KMD A;  3KKA A;  4NJ8 A;  5JTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...