2EAPA

Solution structure of the n-terminal sam-domain of human lymphocyte cytosolic protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
GSSGSSGMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal SAM-domain of human lymphocyte cytosolic protein 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Lymphocyte cytosolic protein 2
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eapA01
3K1RB 2KIVA 2EAMA 4MHVA 1SV4A 1SGGA 2ES6A 1X40A 5J8YA 2B6GA 2K60A 3SEIA 2F44A 1X66A 1V85A 1SV0C 1X9XA 2Y9TA 3H8MA 1JI7A 5JTIA 1B4FA 2F8KA 2E8PA 1LKYB 1SV0A 4IS7A 2DKZA 2D8CA 2DL0A 2KE7A 5J8YC 2Y9UA 1B0XA 2LPEA 1PK3A 2K4PA 2QB0A 1KW4A 1PK1B 2DKXA 2KG5A 2QB0B 4NL9A 3BQ7A 2KSOB 3TADA 3BS7A 1Z1VA 2FE9A 4NL9C 1OXJA 2F3NA 2QKQA 1UQVA 2GLEA 5KNIA 2ESEA 1OW5A 3KKAC 2D3DA 3SENA 2YTUA 2KMDA 1V38A 4NJ8A 3HILA 3KKAA 1DXSA 1LKYA 1WWUA 1COKA 5JRTA 3BS5B 4PZNA 2LMRA 5JU5A 2JV3A 1WWVA 2L5YA 1SXEA 2EAOA 3TACB 2QB1A 5F3XB 1RG6A 3TADC 1PK1A 1F0MA 2EANA 2E8MA 3BS5A 4PZOA 2E8OA 1SXDA 2EAPA 3IDWA 2QARB 2KSOA 5L1MA 4RQMA 2QARA 1UCVA 2E8NA 4RQNA
chains in the Genus database with same CATH superfamily
4MFAA 2MAXA 3RJFA 3QU2A 7ICSA 4EZ9A 5KG6A 3THVA 3MFHA 3SAGA 1MA7A 5J8YA 4K4IA 1X66A 4ECSA 4O5CA 2ZUDA 2Y9TA 3RJEA 4UATA 1IXRA 2EDUA 4J03A 5ALOA 2PFNA 4DEZA 1K5OA 5AM4A 4CCHA 5KT2A 8ICVA 4E0DA 3BQ7A 3BQ2A 2OM6A 4EBCA 2KSOB 2MUTB 5JUMA 4YR0A 2G07A 1U45A 2QKQA 2HW3A 9ICIA 2WF7A 3H8SA 3OHAA 4F5QA 4DQSA 3V72A 3CNHA 2DPIA 9ICOA 3KKAC 4DQQA 1N63A 2DPJA 5CR0A 1A76A 4NLBA 3G6XA 2LYBA 1LVHA 2VJ5A 2AGOA 2A19A 3KBBA 2DUYA 3I28A 2WAQC 4M47A 4B9LA 4QWAA 5AM1A 4I2IA 3TADC 1T3QA 5KFQA 2EANA 3VCBA 2ZJ8A 1KFDA 3GU3A 4MFFA 5DBBA 1SXDA 4PHPA 3N7SC 1VJ5A 1CEZA 4RUCA 5KT4A 1N60A 1SL0A 2Y1JA 4YG2A 8ICSA 2G09A 4C8MA 1SL2A 4CDGA 4DWIA 3SMVA 1NNLA 1MN8A 3IP4B 3QZ7A 4KLMA 4MHVA 2Z7JA 2ZTEA 5DGAA 1U47A 4KITB 4JV2A 3BQ0A 4O9MA 5DB8A 3QEAZ 1XSPA 2PXIA 3OJSA 3UQ2A 3HPOA 4Y2TA 1SV0C 1GO3F 1MC8A 3ISDA 2F8KA 2F8LA 1KQQA 4ED2A 2DKZA 2XICA 5J8YC 1MSWD 3MR3A 4YCXA 1RYUA 4BWJA 1LV5A 1ZQPA 5CRXA 4Z6FA 2HCFA 1KW4A 4C8KA 3ZI4A 2JEGA 2QB0B 8ICIA 4Y2QA 5HHHA 5C0YA 9ICHA 1S0OA 5DQHA 3WKCA 4BWMA 4GC6A 2YMQA 3GIMA 4IR9A 1U48A 3CP8A 4NL9C 4ED6A 4O5KA 2WB1F 4I27A 5EE1A 4B6JA 1NKEA 4O3OA 3M6KA 1NZPA 3GDXA 3AM9A 2YTUA 8ICAA 2ASDA 1YT3A 1NOMA 5DQIA 2FMQA 4IQWA 4F2RA 4NJ8A 4TQRA 1BPBA 3LK9A 4K4GA 1L6NA 4C80A 2KFNA 3NVWA 2XY7A 4PZNA 4TUSA 1ZQSA 3I76A 3GV5B 3C5FA 4O3QA 2FDRA 2DQNB 3CYMA 4AYBC 4DS5A 5L1IA 5DBCA 1N61A 8ICJA 2WB1C 1NK9A 3MABA 2E8OA 4P4MA 2I1QA 3TKAA 1DRGA 1BPYA 3FM9A 4KLJA 1BNPA 5ALZA 1YZ7A 3D2SA 3PW5A 1V97A 3T5LA 5D46A 4RPYA 4YMNA 4C8NA 4ZOHC 4FBTA 1DK3A 2IOFA 4EX6A 4P0PB 3H0MB 2AQ4A 4M9NA 4QZEA 2W7PA 1SWWA 2BPFA 4UB3A 1URJA 1JI7A 7ICKA 8ICCA 1B4FA 4J9SA 3KZIU 3AU2A 5CHGA 2HHTA 4EENA 4QW9A 4PH5A 2LPEA 5KFTA 4UAWA 5CP2A 5IINA 2DGZA 1ED1A 3BDPA 2V9WA 1V9PA 2W8LA 4NLNA 4KX5A 2ALZA 1VLBA 3RRHA 4BXOB 2HBKA 2F1HA 4NM1A 3I1YA 2AQ0A 3QU7A 5AM2A 1YZ6A 3ISBA 2AGPA 3Q8RB 4J9NA 3C28A 3PZPA 5J0XA 2BZFA 4R8UB 2YMMA 4UW9A 5TZVA 2UVRA 4B9TA 1IV8A 5F9NA 3ZDEA 3AU6A 1RXWA 2ISOA 1L3TA 2HBMA 2BPGA 4YFKA 2H3QA 3PR5B 5BOMA 4KLIA 3QU5A 2QB1A 4P0QB 4CF3A 1SWVA 4EZ6A 3BS5A 3AQFA 2XIDA 3ETLA 1ZD2P 7ICHA 3N4MB 1Q3UA 1UT8A 3MGHA 5DB6A 4DSIA 3L3FX 3EZ5A 5IILA 4O5EA 2BCUA 2HI0A 3JPSA 5TISU 1T4GA 4O3RA 4F71A 2KEYA 5AIAA 4X5VA 4B9MA 5IIKA 8ICXA 2W54A 2DBYA 5KT6A 8ICNA 4C8LA 2CPRA 4IC9A 3HKZC 2I5HA 8ICRA 3H7IA 4A8EA 3SEIA 5EE9A 3KHHA 1QSSA 1JXEA 3L4PA 3IG8A 2Y0SC 5KFEA 3EYZA 1ZQNA 2R8IA 8ICPA 3BQ1A 2VANA 3ZDCA 9ICTA 5AM0A 4B9NA 3QX7A 2FPMA 1KDHA 1QH9A 2JEJA 2JZBA 3A0HU 5J0QA 3BS7A 1OXJA 5KFGA 9ICNA 4NLGA 3UXOA 2NV3A 2ESEA 4ED3A 1ZQBA 1M6YA 3WK7A 2ISPA 4C4TA 2HVHA 9ICRA 1S76D 8ICUA 4RPXA 3RAQA 4IQTA 3Q8LA 4DQPA 2BQUA 9ICBA 1SIJA 4TURA 3F5AA 5ALHA 2KJ8A 5J0YA 3ONNA 1WWVA 3GZFA 5J0SA 3MBYA 3NRZA 5AHXA 4EEKA 3QEBZ 2H3VA 1XS9D 2W9CA 4OJ6A 3RFAA 4UAYA 1ZOLA 3NGDA 4USAA 3RR7A 1S0MA 5HMMA 3AN1A 3E2EA 3M7DA 7ICUA 3M8SA 3IDWA 1EXNA 1S0VA 2ZIVA 4RQ6A 1L8LA 1RXVA 5KFIA 4PHEA 1RQNA 2HBJA 1D8YA 3BJYA 2KKVA 1Z4OA 2AXTU 2PMZF 4I2BA 2CXYA 5CWRA 4FZLA 1L7OA 2V4RA 1XC9A 2KZ3A 2BCSA 1ZXIA 5KFHA 1JUDA 8ICLA 4DOCA 4U6PA 1KFTA 5KFUA 3TAQA 1S0NA 4QWCA 1X9WA 4IQVA 1BVSA 1NK7A 2FLLA 1ZQIA 1FO4A 2YN4A 3MR5A 1PK1B 1XO1A 4ECQA 1S9FA 4BJQA 2W9BB 3IV6A 1OUQA 2OWOA 2NO4A 4Q43A 1ZQZA 1BPEA 4P4PA 7ICTA 4KLLA 2F3NA 5KFBA 4NM2A 1ZJMA 2PFPA 3RJJA 4DL5A 4I2HA 4IL6U 2D3DA 3QE9Y 4OO1J 2OYYA 2J6SA 4F50A 2V4QA 3V6JA 3JPNA 2FJ6A 1HUZA 4MF8A 1T3NA 3K1ZA 4RNOA 1QCKA 2A1JA 5J0TA 1WWUA 2QLTA 4DFPA 1NK0A 4DOBA 3CRXA 4U7CA 1B22A 2RDIA 5AK5A 3JPTA 3LWLA 3V6KA 3GILA 3RJHA 5KT3A 1SB3C 4F8RA 2OCEA 3OJUA 2RRDA 2XGQA 4BXOA 2HBLA 2JHDA 4RQ0A 4RZRA 3NVVA 5EE0A 1BPXA 4BGDA 2W43A 2C2EA 1Q46A 2JH7A 3T79A 2W3RA 3PW4A 1HIWA 1SKRA 1SV4A 4PL2A 3PNCA 3KHRA 4M9LA 3RJGA 2W8KA 2WTFA 3V7JA 4KLDA 1V85A 1Z1BA 4UBCA 4CNQA 2H5XA 9ICQA 2ASLA 2Y9UA 3N28A 1NK8A 4G9BA 3H8WA 3NUQA 1AROP 2XO7A 3EUB2 5T14A 4Y2XA 5HMLA 4M9HA 4ECUA 2HSZA 3H0LB 4DSEA 4RQ8A 2HOFA 4DF8A 2R8GA 3O0FA 4CF4A 4CE6A 4TUPA 4RQ7A 1ZQTA 5ALIA 4M9GA 9ICKA 5KFCA 3KKAA 1XSNA 1LKYA 1JALA 4QZFA 2BQRA 4ED7A 3RR8A 1DGSA 2WFAA 4XRHA 5HR7A 5ALRA 4IRCA 2XI9A 2KJ9A 1JX4A 1BPDA 4UAZA 2JV3A 4O3PA 5D4BA 5J0UA 2L5YA 2MSNA 2UVUA 3GIKA 5ALXA 2R8JA 1D9DA 1F44A 3M9NB 3FAHA 5IIIA 4YQWA 4R63A 3DEEA 2NRWA 3LYSA 2Y1IA 4PZOA 2AU0A 2LYAA 5ALFA 4J9OA 1RDFA 3UM9A 3HW8A 3B0YA 1UPHA 2F1IA 2C28A 1QTMA 1CUKA 3SI8A 5AI6A 2RQ5A 2KICA 2K89A 2ZTDA 2KOBA 1ZD5A 4RQNA 2KIVA 1UA0A 5DG9A 2VA3A 3J81j 3RH4A 5AK3A 3HT3A 4Q8FA 5ALEA 2ES6A 8ICBA 3QUQA 3PX0A 1DK2A 1KN5A 3T3FA 2G5IB 1SV0A 2W9BA 4EYHB 2IMWP 2MA1A 5EWFA 3C29A 5KFDA 4I2GA 9ICXA 1IIPA 2K4PA 5EWGA 2H3ZA 2VIXA 2W04A 4RNMA 5ALMA 1TKDA 1Z00B 5J0WA 3F5EA 2W9MA 1N48A 7ICGA 4KLUA 4GLXA 2JEFA 1RM6C 5J2AA 4Q45A 5CJ7A 4EEYA 5KFPA 1IM4A 2ZIVB 2C2DA 4C4SA 1X42A 1ZQUA 2YMPA 2KZMA 5IIJA 1SKWA 1ZQOA 9ICPA 3RB0A 2F2AB 5AI0A 2BGWA 1V38A 2W55A 5KG4A 4KLGA 5C5JA 2AJQA 3HILA 1FFUA 2W9AA 4F4XA 4PL1A 1WG8A 3M9OB 1ZQGA 1L8OA 3H8JA 2XC9A 2R8HA 2RLTA 2KJ5A 1ZQYA 4DSFA 9ICLA 4KMOB 1ZQVA 2E8MA 4DO9A 4Y2SA 5DLGA 3WK8A 2HOIA 1O03A 3NS1A 2WF6A 4RQ5A 4QJFB 4UB2A 5KFVA 3RB6A 4QZIA 2EQYA 4ED1A 3IRUA 4HAIA 4GC7A 2MRLA 3F2BA 4NXZA 2QARA 8ICGA 2BCRA 2LM1A 3F53A 8ICKA 4PHDA 2CRXA 2LKYA 1KL9A 3PMNA 1JMSA 2G06A 4Y2VA 5KFAA 3M9MB 2VJ4A 4QWDA 5KG7A 5A0LA 1WCLA 4J9LA 2W11A 1J2NA 4UAUA 4R64A 2ODGA 2K8BB 3H8MA 1ZQXA 5J2EA 2BCVA 4ELVA 5AKXA 1QQ5A 3S6JA 2KIWA 4Y2RA 4BUGA 3NTUA 2DKXA 4OJ5A 1N56A 2BPCA 4C0ZA 2XY5A 4DL7A 4OJLA 3MC1A 3TADA 7ICLA 3KHLA 8ICOA 5J2KA 4WJ3B 4DQIA 1TK5A 5BPCA 5KAIU 4FZNA 2XVTA 5KL8B 2FE9A 2ZJAA 5KFMA 4AP9A 1JN3A 4ECRA 1PVRA 1OW5A 2A1AA 5KL1B 1XU4A 4YXMA 4J9QA 1XSLA 4LZDA 4B9SA 2I9GA 3QUBA 4M04A 1ECWA 2ZIXA 4F3OA 3R9KA 5JRTA 2FPKA 2OHFA 5KT5A 4EELA 3LDAA 1IG6A 3QYPA 1H38A 4DQRA 4OD0A 2M9NA 5ALDA 2M0NA 3PW0A 2LYHA 1D8BA 5F9LA 4B9UA 3OGUA 4P4OA 3SAHA 2KNJA 9ICUA 2K4IA 4FBUA 3KTQA 2GOLA 3G6VA 2IHMA 4ECZA 1NJYA 3WU2U 4DL6A 3ZDAA 4MF2A 5L1MA 1PUZA 5HP4A 4RQMA 4I2FA 3Q8PB 1UCVA 3KZXA 3HX0A 1AQ6A 4RT3A 3RJIA 4Q8EA 4KMUA 2A1JB 4Z6EA 4XQ8A 1L7MA 1A0PA 1BGXT 3NVYA 3DV9A 3ISCA 4UARA 8ICYA 2PI4A 2Y0SF 4ICAA 3MR2A 2YX8A 4F5PA 1TFRA 2F44A 4ECXA 4YMMA 2DWQA 2D8CA 2KE7A 3L5KA 4B9VA 4P0PA 2KFZA 3EW9A 2N1RA 5ALVA 3V6HA 1Q3VA 1A6SA 1PVQA 5AKEA 5KG1A 5AKHA 4KLFA 3OHBA 1F5SA 2B0CA 5ALSA 3QU9A 5KFRA 5KG3A 3UPQA 2HHWA 1Z1VA 4JMUA 2KP7A 2H3FA 4FZMA 3AUOA 2CN1A 4JV1A 2ZIWA 5J29A 1ZQ1C 4QIWF 5KNIA 3T5HA 1QSLA 1RQLA 2HDOA 4Z6CA 3IG5A 4I2JA 3OSNA 8ICZA 1ZJNA 4KN4A 5DDYA 1ZD3A 4F93B 1NKBA 2RP5A 3PMLA 1COKA 4F91B 5KFSA 4QWBA 4F2SA 3AEVA 4F4YA 4CGZA 2NRVA 5AKIA 3QU4A 3F2CA 1QLNA 1RG6A 4TQSA 3HKZF 1SZHA 1ZQHA 2PFOA 1FEZA 3SZ2A 3SV4A 5J0OA 2E1FA 1T94A 5J2FA 3LVVA 3MR6A 4KLSA 2KSOA 1KLNA 4O3MA 3FDSA 2E8NA 1PZNA 3OSPA 4QNLA 4O3SA 4JUZA 2ZTCA 4ZH4A 3N7RC 2J6UA 1WUDA 2NYVA 2DF4B 3B9JA 3PSPA 1T8EA 4NLCA 1MQ2A 5AK4A 4F92B 3AL0B 2C2RA 4F5NA 5E79U 1TK0A 1NK6A 1ZQKA 5AICA 1B0XA 4QZHA 3KHGA 5AKYA 4NV0A 7ICIA 3PO4A 4KLOA 1HJPA 4US9A 2FLNA 3QUCA 2ZXHA 7ICVA 3SAFA 9ICEA 4JV0A 1JROA 1JRPA 3IN5A 5DKWA 2EH9A 1S8OA 2KV2A 1QSYA 2YY6A 1QQ6A 5AM3A 4YR2A 4Q44A 1ZQEA 3K75D 4P2HA 2FLPA 2IOHA 4Z6DA 1RYRA 3ED5A 1Z4NA 2GO7A 3WKBA 4YR3A 2WF5A 1QQ7A 1UHUA 1N62A 1LB2B 4O0IA 4PHAA 2IOFK 4C7ZA 3F2DA 3RB4A 1J97A 3UMCA 3AMZA 2KN7A 2KKPA 1XO0A 3T5KA 5K4LA 9ICVA 5KFXA 2LM4A 2YMLA 2JEIA 5G5GA 1ZQMA 3ICXA 5J2JA 3RF9A 2C22A 5EOZA 3JPOA 1X9MA 4QZDA 2OH2A 1S5LU 2PKEA 1Y88A 5L1LA 5AM5A 1TAUA 2HOQA 3TANA 4CF5A 5CB1A 1TK8A 3V7LA 1ZQDA 2VA8A 1L3SA 3WK9A 5BOLA 4UB4A 4I2AA 3MDCA 1D9FA 2ZIXB 4C7YA 2UVWA 4P0QA 3WKAA 1NJWA 4YVZA 2DL0A 4J9MA 4FE3A 3Q8MA 4CRXA 4C8OA 9ICJA 2QB0A 3PVXA 3B0XA 2LBOA 1ZQAA 3ZDBA 3JPQA 2BQ3A 2F1JA 2HVIA 3AQEA 3HP6A 3HJEA 4BX9C 4QWEA 4LZGA 4XA5A 1RPLA 4YD2A 4UBBA 4GIBA 4ELTA 3KOOA 3TAPA 2JR5A 2KHQA 3OPXA 2UVVA 5AI5A 3UXNA 2KK0A 3DDHA 2A3VA 2BKEA 2KMDA 1U4BA 4RPZA 3UXPA 3E58A 2ZIUA 4UB6U 2JGAA 1Z19A 5AKKA 3C23A 3ETRA 3ZD8A 3HRDD 3WKDA 5J2HA 3TACB 1CI4A 5F3XB 4JB3A 1F0MA 2D6FC 2WAQF 1HEKA 1KFSA 2GWSA 4ELUA 1X2IA 1B43A 1XWLA 3G6YA 3RBDA 3SR6A 4F72A 5AKLA 1NK4A 1Z3EB 4XUSA 1N5WA 2MU2A 2HHUA 9ICSA 1MQ3A 4Y2YA 5CEHA 3T5JA 5KG2A 3H0RB 2IHNA 4JWMA 1WYGA 3GFKB 5L1KA 3C21A 4RQ2A 2ATLA 2B6GA 1C7YA 1UT5A 3C2LA 5J0PA 1X9XA 2BR0A 1UA1A 5AI8A 2J6TA 5AKGA 5KFNA 2JRZA 2G5HB 4QZ8A 3IM1A 4I28A 1PK3A 3BZCA 5AI9A 4ECWA 4QW8A 3RB3A 8ICWA 3EPIA 2KG5A 1ZRMA 4KLQA 3GQCA 2YQEA 4QZGA 2FPLA 2ZXIA 4UAVA 1VDVA 5B66U 7ICPA 4AYBF 4PGXA 4PPXA 4DSJA 4MFCA 1UQVA 2Q0ZX 4M6WB 2ZIUB 2MUTA 4DFKA 3SENA 2IBKA 3C1ZA 4QZCA 5CA7A 4DS4A 1ZQJA 4GFJA 5KTQA 2EZYA 5ALKA 3GIJA 1SKSA 3FYHA 4C4RA 4YD1A 5KFYA 1T7PA 3Q8QB 4IQUA 2PI5A 4DFJA 4FFDA 2W9CB 3RRGA 3NRWA 4IR1A 1SL1A 1L7PA 1X9SA 1K1QA 5ALQA 4EBDA 3SV3A 2EAPA 4R66A 3NASA 8ICTA 1L3UA 1NKCA 3LWMA 4KLEA 2P35A 3TI0A 3WK5A 1HUOA 1KKXA 2E3TA 2K4EA 1Q8KA 5D49A 2EAMA 3BZKA 4R8UA 5DGBA 4US8A 2K8CB 3WKEA 3C2KA 1X40A 4DL4A 1XNSA 1CRXA 2VA2A 2P6UA 2K60A 1P7DA 3RH5A 1ZQCA 2WHEA 1JIHA 2BCQA 3A0BU 2IA6A 4ECYA 3SYZA 4RQ1A 4DLGA 5ALTA 4ED0A 1U9LA 2KZZA 4RU9A 4QZBA 1U49A 4ACOA 3Q8KA 2NRZA 5IIOA 4M2YA 5KFZA 7ICEA 5KFKA 1SZPA 7ICFA 2AH5A 3NVZA 3GV7B 4UB5A 4K4HA 5AIBA 4DLEA 4DCCA 5KFJA 3RJKA 5J2DA 3TARA 3SQIA 5AK6A 2HHSA 1PVPA 4ED8A 4J9RA 4M9JA 4FS2A 1NJZA 4Y2PA 1TV9A 2OEHA 4RQ3A 2Q4TA 1FIQA 3ORYA 1ZETA 1N5XA 3PW7A 3ALRA 3BS5B 5ALJA 1N2XA 2OXOA 4IRKA 1BNOA 1SXEA 2EAOA 4PGQA 4UQGA 3M1YA 9ICWA 9ICFA 4MEXA 1NZBA 3RBEA 5KT7A 2ZG6A 1KBUA 9ICCA 2NO5A 4ECTA 4GXKA 3TQ1A 4RT2A 1D8LA 3FC4A 2FI1A 4NY8A 4M0AA 2KD1A 1X6IA 4HYKA 2K8AA 2ZUBA 2K4HA 3KD3A 1TE2A 1J2MA 5B5EU 1ZQLA 3Q8SB 4I29A 1COOA 4RUAA 2WF8A 3MGIA 5JTIA 4IS7A 4GXJA 3V7KA 3C1YA 1S77D 3RH6A 2HHVA 2KVSA 3IHQB 4QZ9A 5DB9A 2EZZA 4QZAA 4F4KA 5HNKA 4NL9A 4MEYA 2FMPA 3PX6A 4R65A 1S97A 2XGPA 4UASA 4I2DA 2XY6A 2ZIWB 5DG8A 2R8KA 2ZJ5A 5AI4A 2GH1A 3PR4A 1ZD4A 3E0FA 4I2EA 3C5GA 1DXSA 3PO5A 1ZRNA 2P66A 8ICFA 2FMSA 4YMOA 2ZUCA 5DB7A 2F76X 8ICQA 8ICEA 2PFQA 3H40A 3M6ZA 4OCZA 5DLFA 1PK1A 4OJPA 3OTQA 5HHIA 2AHOB 4UB8U 2AGQA 1RZTA 1L5UA 3PV8A 2RDJA 2JZBB 3K4GA 3HWTA 4F4ZA 2KHVA 4EX7A 2JXJA 2O6KA 2E1EA 4M6WA 5DG7A 4NLZA 3K1RB 4DFMA 5J2BA 2JMGA 1ZQRA 3TFSA 2W7OA 1KTQA 4RQ4A 4LJXA 3C2MA 3CW2C 2HMXA 3D2NA 3JPPA 2ASJA 4EYIB 3PW2A 3PSTA 5KFWA 3H4DA 4BDPA 5J0RA 3QXGA 2E8PA 3JPRA 4Y2UA 4EBEA 9ICGA 2BHNA 1TAMA 4F5RA 1S10A 5DQGA 3M8RA 3QUTA 1L7NA 3D6JA 3QNMA 3UMBA 5IIMA 5KFFA 3PSIA 3PSFA 2W03A 5ALGA 1Z00A 1KSPA 3VC8A 5KAFU 4UB1A 4G3IA 5AKJA 3KFUF 4DSLA 1C20A 2HHQA 5L1JA 2GLEA 4KLTA 2R18A 3QZ8A 3U26A 1ZQWA 4KLHA 4DFDA 5AKZA 3WK6A 3ZDDA 7ICNA 1NJXA 1RYSA 3UQ0A 1TAQA 4ECVA 5KG5A 5FP0A 2KVCA 1NK5A 1KEJA 1X6JA 4LVSA 9ICMA 4TUQA 1A77A 4J9PA 5G5HA 5EE3A 1O08A 1KRPA 3PX4A 2G0AA 2QARB 3D2QA 4Y2JA 4DF4A 5ALUA 3ZD9A 4F4WA 4IRDA 2I6XA 1TVAA 5HR6A 2BDPA 3EPGA 1NI3A 1SGGA 4JK1A 2W3SA 2KTQA 5J2IA 2H3IA 1ZQQA 4YN4A 4DOAA 5DDMA 1LKYB 3RAXA 4PJ0U 2HHXA 4FO6A 3TFRA 7ICRA 5KFLA 4KX3A 1L3VA 5ALYA 7ICJA 4KN7A 5ALWA 2WF9A 4GXIA 4DSKA 3UMGA 5KFOA 5H2FU 2YB4A 7ICOA 1JXLA 2RHFA 4QIWC 1DOQA 5GTHU 3GIIA 3H4BA 2XCAA 3WK4A 3MFIA 4JWNA 1K1SA 5J2GA 4DL2A 4YXJA 3MGVA 1ZYQA 1DGJA 2B21A 9ICAA 4F5OA 2E5SA 7ICMA 4RNNA 2G08A 4NLKA 2PMZC 5EWEA 2NRXA 2LMRA 5KG0A 5JU5A 2VKQA 2EZXA 2LI6A 2XCPA 3RTVA 1ZQFA 4KTQA 4DL3A 4YP3A 2LHTA 5ALLA 2NRTA 5L9XA 3PY8A 3GV8B 2BDUA 3BQTA 3SD7A 2DFLA 8ICMA 5ALNA 4I2CA 2JH1A 3MDAA 4NWIA 3EWAA 4J9KA 4FS1A 2YB1A 4OJOA 5ALPA 2P6RA 5J2CA 5DBAA 1BPZA 7ICQA 3N97B 5GTIU 2F77X 4PGYA 1FFVA 1WCNA 3N7PD 3LVWA 4O3NA 8ICHA
chains in the Genus database with same CATH topology
3K1RB 2KIVA 2EAMA 4MHVA 1SV4A 1SGGA 2ES6A 1X40A 5J8YA 2B6GA 2K60A 3SEIA 2F44A 1X66A 1V85A 1SV0C 1X9XA 2Y9TA 3H8MA 1JI7A 5JTIA 1B4FA 2F8KA 2E8PA 1LKYB 1SV0A 4IS7A 2DKZA 2D8CA 2DL0A 2KE7A 5J8YC 2Y9UA 1B0XA 2LPEA 1PK3A 2K4PA 2QB0A 1KW4A 1PK1B 2DKXA 2KG5A 2QB0B 4NL9A 3BQ7A 2KSOB 3TADA 3BS7A 1Z1VA 2FE9A 4NL9C 1OXJA 2F3NA 2QKQA 1UQVA 2GLEA 5KNIA 2ESEA 1OW5A 3KKAC 2D3DA 3SENA 2YTUA 2KMDA 1V38A 4NJ8A 3HILA 3KKAA 1DXSA 1LKYA 1WWUA 1COKA 5JRTA 3BS5B 4PZNA 2LMRA 5JU5A 2JV3A 1WWVA 2L5YA 1SXEA 2EAOA 3TACB 2QB1A 5F3XB 1RG6A 3TADC 1PK1A 1F0MA 2EANA 2E8MA 3BS5A 4PZOA 2E8OA 1SXDA 2EAPA 3IDWA 2QARB 2KSOA 5L1MA 4RQMA 2QARA 1UCVA 2E8NA 4RQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  2KIV A;  2EAM A;  4MHV A;  1SV4 A;  1SGG A;  2ES6 A;  1X40 A;  5J8Y A;  2B6G A;  2K60 A;  3SEI A;  2F44 A;  1X66 A;  1V85 A;  1SV0 C;  1X9X A;  2Y9T A;  3H8M A;  1JI7 A;  5JTI A;  1B4F A;  2F8K A;  2E8P A;  1LKY B;  1SV0 A;  4IS7 A;  2DKZ A;  2D8C A;  2DL0 A;  2KE7 A;  5J8Y C;  2Y9U A;  1B0X A;  2LPE A;  1PK3 A;  2K4P A;  2QB0 A;  1KW4 A;  1PK1 B;  2DKX A;  2KG5 A;  2QB0 B;  4NL9 A;  3BQ7 A;  2KSO B;  3TAD A;  3BS7 A;  1Z1V A;  2FE9 A;  4NL9 C;  1OXJ A;  2F3N A;  2QKQ A;  1UQV A;  2GLE A;  5KNI A;  2ESE A;  1OW5 A;  3KKA C;  2D3D A;  3SEN A;  2YTU A;  2KMD A;  1V38 A;  4NJ8 A;  3HIL A;  3KKA A;  1DXS A;  1LKY A;  1WWU A;  1COK A;  5JRT A;  3BS5 B;  4PZN A;  2LMR A;  5JU5 A;  2JV3 A;  1WWV A;  2L5Y A;  1SXE A;  2EAO A;  3TAC B;  2QB1 A;  5F3X B;  1RG6 A;  3TAD C;  1PK1 A;  1F0M A;  2EAN A;  2E8M A;  3BS5 A;  4PZO A;  2E8O A;  1SXD A;  2EAP A;  3IDW A;  2QAR B;  2KSO A;  5L1M A;  4RQM A;  2QAR A;  1UCV A;  2E8N A;  4RQN A; 
#chains in the Genus database with same CATH topology
 4MFA A;  2MAX A;  3RJF A;  3QU2 A;  7ICS A;  4EZ9 A;  5KG6 A;  3THV A;  3MFH A;  3SAG A;  1MA7 A;  5J8Y A;  4K4I A;  1X66 A;  4ECS A;  4O5C A;  2ZUD A;  2Y9T A;  3RJE A;  4UAT A;  1IXR A;  2EDU A;  4J03 A;  5ALO A;  2PFN A;  4DEZ A;  1K5O A;  5AM4 A;  4CCH A;  5KT2 A;  8ICV A;  4E0D A;  3BQ7 A;  3BQ2 A;  2OM6 A;  4EBC A;  2KSO B;  2MUT B;  5JUM A;  4YR0 A;  2G07 A;  1U45 A;  2QKQ A;  2HW3 A;  9ICI A;  2WF7 A;  3H8S A;  3OHA A;  4F5Q A;  4DQS A;  3V72 A;  3CNH A;  2DPI A;  9ICO A;  3KKA C;  4DQQ A;  1N63 A;  2DPJ A;  5CR0 A;  1A76 A;  4NLB A;  3G6X A;  2LYB A;  1LVH A;  2VJ5 A;  2AGO A;  2A19 A;  3KBB A;  2DUY A;  3I28 A;  2WAQ C;  4M47 A;  4B9L A;  4QWA A;  5AM1 A;  4I2I A;  3TAD C;  1T3Q A;  5KFQ A;  2EAN A;  3VCB A;  2ZJ8 A;  1KFD A;  3GU3 A;  4MFF A;  5DBB A;  1SXD A;  4PHP A;  3N7S C;  1VJ5 A;  1CEZ A;  4RUC A;  5KT4 A;  1N60 A;  1SL0 A;  2Y1J A;  4YG2 A;  8ICS A;  2G09 A;  4C8M A;  1SL2 A;  4CDG A;  4DWI A;  3SMV A;  1NNL A;  1MN8 A;  3IP4 B;  3QZ7 A;  4KLM A;  4MHV A;  2Z7J A;  2ZTE A;  5DGA A;  1U47 A;  4KIT B;  4JV2 A;  3BQ0 A;  4O9M A;  5DB8 A;  3QEA Z;  1XSP A;  2PXI A;  3OJS A;  3UQ2 A;  3HPO A;  4Y2T A;  1SV0 C;  1GO3 F;  1MC8 A;  3ISD A;  2F8K A;  2F8L A;  1KQQ A;  4ED2 A;  2DKZ A;  2XIC A;  5J8Y C;  1MSW D;  3MR3 A;  4YCX A;  1RYU A;  4BWJ A;  1LV5 A;  1ZQP A;  5CRX A;  4Z6F A;  2HCF A;  1KW4 A;  4C8K A;  3ZI4 A;  2JEG A;  2QB0 B;  8ICI A;  4Y2Q A;  5HHH A;  5C0Y A;  9ICH A;  1S0O A;  5DQH A;  3WKC A;  4BWM A;  4GC6 A;  2YMQ A;  3GIM A;  4IR9 A;  1U48 A;  3CP8 A;  4NL9 C;  4ED6 A;  4O5K A;  2WB1 F;  4I27 A;  5EE1 A;  4B6J A;  1NKE A;  4O3O A;  3M6K A;  1NZP A;  3GDX A;  3AM9 A;  2YTU A;  8ICA A;  2ASD A;  1YT3 A;  1NOM A;  5DQI A;  2FMQ A;  4IQW A;  4F2R A;  4NJ8 A;  4TQR A;  1BPB A;  3LK9 A;  4K4G A;  1L6N A;  4C80 A;  2KFN A;  3NVW A;  2XY7 A;  4PZN A;  4TUS A;  1ZQS A;  3I76 A;  3GV5 B;  3C5F A;  4O3Q A;  2FDR A;  2DQN B;  3CYM A;  4AYB C;  4DS5 A;  5L1I A;  5DBC A;  1N61 A;  8ICJ A;  2WB1 C;  1NK9 A;  3MAB A;  2E8O A;  4P4M A;  2I1Q A;  3TKA A;  1DRG A;  1BPY A;  3FM9 A;  4KLJ A;  1BNP A;  5ALZ A;  1YZ7 A;  3D2S A;  3PW5 A;  1V97 A;  3T5L A;  5D46 A;  4RPY A;  4YMN A;  4C8N A;  4ZOH C;  4FBT A;  1DK3 A;  2IOF A;  4EX6 A;  4P0P B;  3H0M B;  2AQ4 A;  4M9N A;  4QZE A;  2W7P A;  1SWW A;  2BPF A;  4UB3 A;  1URJ A;  1JI7 A;  7ICK A;  8ICC A;  1B4F A;  4J9S A;  3KZI U;  3AU2 A;  5CHG A;  2HHT A;  4EEN A;  4QW9 A;  4PH5 A;  2LPE A;  5KFT A;  4UAW A;  5CP2 A;  5IIN A;  2DGZ A;  1ED1 A;  3BDP A;  2V9W A;  1V9P A;  2W8L A;  4NLN A;  4KX5 A;  2ALZ A;  1VLB A;  3RRH A;  4BXO B;  2HBK A;  2F1H A;  4NM1 A;  3I1Y A;  2AQ0 A;  3QU7 A;  5AM2 A;  1YZ6 A;  3ISB A;  2AGP A;  3Q8R B;  4J9N A;  3C28 A;  3PZP A;  5J0X A;  2BZF A;  4R8U B;  2YMM A;  4UW9 A;  5TZV A;  2UVR A;  4B9T A;  1IV8 A;  5F9N A;  3ZDE A;  3AU6 A;  1RXW A;  2ISO A;  1L3T A;  2HBM A;  2BPG A;  4YFK A;  2H3Q A;  3PR5 B;  5BOM A;  4KLI A;  3QU5 A;  2QB1 A;  4P0Q B;  4CF3 A;  1SWV A;  4EZ6 A;  3BS5 A;  3AQF A;  2XID A;  3ETL A;  1ZD2 P;  7ICH A;  3N4M B;  1Q3U A;  1UT8 A;  3MGH A;  5DB6 A;  4DSI A;  3L3F X;  3EZ5 A;  5IIL A;  4O5E A;  2BCU A;  2HI0 A;  3JPS A;  5TIS U;  1T4G A;  4O3R A;  4F71 A;  2KEY A;  5AIA A;  4X5V A;  4B9M A;  5IIK A;  8ICX A;  2W54 A;  2DBY A;  5KT6 A;  8ICN A;  4C8L A;  2CPR A;  4IC9 A;  3HKZ C;  2I5H A;  8ICR A;  3H7I A;  4A8E A;  3SEI A;  5EE9 A;  3KHH A;  1QSS A;  1JXE A;  3L4P A;  3IG8 A;  2Y0S C;  5KFE A;  3EYZ A;  1ZQN A;  2R8I A;  8ICP A;  3BQ1 A;  2VAN A;  3ZDC A;  9ICT A;  5AM0 A;  4B9N A;  3QX7 A;  2FPM A;  1KDH A;  1QH9 A;  2JEJ A;  2JZB A;  3A0H U;  5J0Q A;  3BS7 A;  1OXJ A;  5KFG A;  9ICN A;  4NLG A;  3UXO A;  2NV3 A;  2ESE A;  4ED3 A;  1ZQB A;  1M6Y A;  3WK7 A;  2ISP A;  4C4T A;  2HVH A;  9ICR A;  1S76 D;  8ICU A;  4RPX A;  3RAQ A;  4IQT A;  3Q8L A;  4DQP A;  2BQU A;  9ICB A;  1SIJ A;  4TUR A;  3F5A A;  5ALH A;  2KJ8 A;  5J0Y A;  3ONN A;  1WWV A;  3GZF A;  5J0S A;  3MBY A;  3NRZ A;  5AHX A;  4EEK A;  3QEB Z;  2H3V A;  1XS9 D;  2W9C A;  4OJ6 A;  3RFA A;  4UAY A;  1ZOL A;  3NGD A;  4USA A;  3RR7 A;  1S0M A;  5HMM A;  3AN1 A;  3E2E A;  3M7D A;  7ICU A;  3M8S A;  3IDW A;  1EXN A;  1S0V A;  2ZIV A;  4RQ6 A;  1L8L A;  1RXV A;  5KFI A;  4PHE A;  1RQN A;  2HBJ A;  1D8Y A;  3BJY A;  2KKV A;  1Z4O A;  2AXT U;  2PMZ F;  4I2B A;  2CXY A;  5CWR A;  4FZL A;  1L7O A;  2V4R A;  1XC9 A;  2KZ3 A;  2BCS A;  1ZXI A;  5KFH A;  1JUD A;  8ICL A;  4DOC A;  4U6P A;  1KFT A;  5KFU A;  3TAQ A;  1S0N A;  4QWC A;  1X9W A;  4IQV A;  1BVS A;  1NK7 A;  2FLL A;  1ZQI A;  1FO4 A;  2YN4 A;  3MR5 A;  1PK1 B;  1XO1 A;  4ECQ A;  1S9F A;  4BJQ A;  2W9B B;  3IV6 A;  1OUQ A;  2OWO A;  2NO4 A;  4Q43 A;  1ZQZ A;  1BPE A;  4P4P A;  7ICT A;  4KLL A;  2F3N A;  5KFB A;  4NM2 A;  1ZJM A;  2PFP A;  3RJJ A;  4DL5 A;  4I2H A;  4IL6 U;  2D3D A;  3QE9 Y;  4OO1 J;  2OYY A;  2J6S A;  4F50 A;  2V4Q A;  3V6J A;  3JPN A;  2FJ6 A;  1HUZ A;  4MF8 A;  1T3N A;  3K1Z A;  4RNO A;  1QCK A;  2A1J A;  5J0T A;  1WWU A;  2QLT A;  4DFP A;  1NK0 A;  4DOB A;  3CRX A;  4U7C A;  1B22 A;  2RDI A;  5AK5 A;  3JPT A;  3LWL A;  3V6K A;  3GIL A;  3RJH A;  5KT3 A;  1SB3 C;  4F8R A;  2OCE A;  3OJU A;  2RRD A;  2XGQ A;  4BXO A;  2HBL A;  2JHD A;  4RQ0 A;  4RZR A;  3NVV A;  5EE0 A;  1BPX A;  4BGD A;  2W43 A;  2C2E A;  1Q46 A;  2JH7 A;  3T79 A;  2W3R A;  3PW4 A;  1HIW A;  1SKR A;  1SV4 A;  4PL2 A;  3PNC A;  3KHR A;  4M9L A;  3RJG A;  2W8K A;  2WTF A;  3V7J A;  4KLD A;  1V85 A;  1Z1B A;  4UBC A;  4CNQ A;  2H5X A;  9ICQ A;  2ASL A;  2Y9U A;  3N28 A;  1NK8 A;  4G9B A;  3H8W A;  3NUQ A;  1ARO P;  2XO7 A;  3EUB 2;  5T14 A;  4Y2X A;  5HML A;  4M9H A;  4ECU A;  2HSZ A;  3H0L B;  4DSE A;  4RQ8 A;  2HOF A;  4DF8 A;  2R8G A;  3O0F A;  4CF4 A;  4CE6 A;  4TUP A;  4RQ7 A;  1ZQT A;  5ALI A;  4M9G A;  9ICK A;  5KFC A;  3KKA A;  1XSN A;  1LKY A;  1JAL A;  4QZF A;  2BQR A;  4ED7 A;  3RR8 A;  1DGS A;  2WFA A;  4XRH A;  5HR7 A;  5ALR A;  4IRC A;  2XI9 A;  2KJ9 A;  1JX4 A;  1BPD A;  4UAZ A;  2JV3 A;  4O3P A;  5D4B A;  5J0U A;  2L5Y A;  2MSN A;  2UVU A;  3GIK A;  5ALX A;  2R8J A;  1D9D A;  1F44 A;  3M9N B;  3FAH A;  5III A;  4YQW A;  4R63 A;  3DEE A;  2NRW A;  3LYS A;  2Y1I A;  4PZO A;  2AU0 A;  2LYA A;  5ALF A;  4J9O A;  1RDF A;  3UM9 A;  3HW8 A;  3B0Y A;  1UPH A;  2F1I A;  2C28 A;  1QTM A;  1CUK A;  3SI8 A;  5AI6 A;  2RQ5 A;  2KIC A;  2K89 A;  2ZTD A;  2KOB A;  1ZD5 A;  4RQN A;  2KIV A;  1UA0 A;  5DG9 A;  2VA3 A;  3J81 j;  3RH4 A;  5AK3 A;  3HT3 A;  4Q8F A;  5ALE A;  2ES6 A;  8ICB A;  3QUQ A;  3PX0 A;  1DK2 A;  1KN5 A;  3T3F A;  2G5I B;  1SV0 A;  2W9B A;  4EYH B;  2IMW P;  2MA1 A;  5EWF A;  3C29 A;  5KFD A;  4I2G A;  9ICX A;  1IIP A;  2K4P A;  5EWG A;  2H3Z A;  2VIX A;  2W04 A;  4RNM A;  5ALM A;  1TKD A;  1Z00 B;  5J0W A;  3F5E A;  2W9M A;  1N48 A;  7ICG A;  4KLU A;  4GLX A;  2JEF A;  1RM6 C;  5J2A A;  4Q45 A;  5CJ7 A;  4EEY A;  5KFP A;  1IM4 A;  2ZIV B;  2C2D A;  4C4S A;  1X42 A;  1ZQU A;  2YMP A;  2KZM A;  5IIJ A;  1SKW A;  1ZQO A;  9ICP A;  3RB0 A;  2F2A B;  5AI0 A;  2BGW A;  1V38 A;  2W55 A;  5KG4 A;  4KLG A;  5C5J A;  2AJQ A;  3HIL A;  1FFU A;  2W9A A;  4F4X A;  4PL1 A;  1WG8 A;  3M9O B;  1ZQG A;  1L8O A;  3H8J A;  2XC9 A;  2R8H A;  2RLT A;  2KJ5 A;  1ZQY A;  4DSF A;  9ICL A;  4KMO B;  1ZQV A;  2E8M A;  4DO9 A;  4Y2S A;  5DLG A;  3WK8 A;  2HOI A;  1O03 A;  3NS1 A;  2WF6 A;  4RQ5 A;  4QJF B;  4UB2 A;  5KFV A;  3RB6 A;  4QZI A;  2EQY A;  4ED1 A;  3IRU A;  4HAI A;  4GC7 A;  2MRL A;  3F2B A;  4NXZ A;  2QAR A;  8ICG A;  2BCR A;  2LM1 A;  3F53 A;  8ICK A;  4PHD A;  2CRX A;  2LKY A;  1KL9 A;  3PMN A;  1JMS A;  2G06 A;  4Y2V A;  5KFA A;  3M9M B;  2VJ4 A;  4QWD A;  5KG7 A;  5A0L A;  1WCL A;  4J9L A;  2W11 A;  1J2N A;  4UAU A;  4R64 A;  2ODG A;  2K8B B;  3H8M A;  1ZQX A;  5J2E A;  2BCV A;  4ELV A;  5AKX A;  1QQ5 A;  3S6J A;  2KIW A;  4Y2R A;  4BUG A;  3NTU A;  2DKX A;  4OJ5 A;  1N56 A;  2BPC A;  4C0Z A;  2XY5 A;  4DL7 A;  4OJL A;  3MC1 A;  3TAD A;  7ICL A;  3KHL A;  8ICO A;  5J2K A;  4WJ3 B;  4DQI A;  1TK5 A;  5BPC A;  5KAI U;  4FZN A;  2XVT A;  5KL8 B;  2FE9 A;  2ZJA A;  5KFM A;  4AP9 A;  1JN3 A;  4ECR A;  1PVR A;  1OW5 A;  2A1A A;  5KL1 B;  1XU4 A;  4YXM A;  4J9Q A;  1XSL A;  4LZD A;  4B9S A;  2I9G A;  3QUB A;  4M04 A;  1ECW A;  2ZIX A;  4F3O A;  3R9K A;  5JRT A;  2FPK A;  2OHF A;  5KT5 A;  4EEL A;  3LDA A;  1IG6 A;  3QYP A;  1H38 A;  4DQR A;  4OD0 A;  2M9N A;  5ALD A;  2M0N A;  3PW0 A;  2LYH A;  1D8B A;  5F9L A;  4B9U A;  3OGU A;  4P4O A;  3SAH A;  2KNJ A;  9ICU A;  2K4I A;  4FBU A;  3KTQ A;  2GOL A;  3G6V A;  2IHM A;  4ECZ A;  1NJY A;  3WU2 U;  4DL6 A;  3ZDA A;  4MF2 A;  5L1M A;  1PUZ A;  5HP4 A;  4RQM A;  4I2F A;  3Q8P B;  1UCV A;  3KZX A;  3HX0 A;  1AQ6 A;  4RT3 A;  3RJI A;  4Q8E A;  4KMU A;  2A1J B;  4Z6E A;  4XQ8 A;  1L7M A;  1A0P A;  1BGX T;  3NVY A;  3DV9 A;  3ISC A;  4UAR A;  8ICY A;  2PI4 A;  2Y0S F;  4ICA A;  3MR2 A;  2YX8 A;  4F5P A;  1TFR A;  2F44 A;  4ECX A;  4YMM A;  2DWQ A;  2D8C A;  2KE7 A;  3L5K A;  4B9V A;  4P0P A;  2KFZ A;  3EW9 A;  2N1R A;  5ALV A;  3V6H A;  1Q3V A;  1A6S A;  1PVQ A;  5AKE A;  5KG1 A;  5AKH A;  4KLF A;  3OHB A;  1F5S A;  2B0C A;  5ALS A;  3QU9 A;  5KFR A;  5KG3 A;  3UPQ A;  2HHW A;  1Z1V A;  4JMU A;  2KP7 A;  2H3F A;  4FZM A;  3AUO A;  2CN1 A;  4JV1 A;  2ZIW A;  5J29 A;  1ZQ1 C;  4QIW F;  5KNI A;  3T5H A;  1QSL A;  1RQL A;  2HDO A;  4Z6C A;  3IG5 A;  4I2J A;  3OSN A;  8ICZ A;  1ZJN A;  4KN4 A;  5DDY A;  1ZD3 A;  4F93 B;  1NKB A;  2RP5 A;  3PML A;  1COK A;  4F91 B;  5KFS A;  4QWB A;  4F2S A;  3AEV A;  4F4Y A;  4CGZ A;  2NRV A;  5AKI A;  3QU4 A;  3F2C A;  1QLN A;  1RG6 A;  4TQS A;  3HKZ F;  1SZH A;  1ZQH A;  2PFO A;  1FEZ A;  3SZ2 A;  3SV4 A;  5J0O A;  2E1F A;  1T94 A;  5J2F A;  3LVV A;  3MR6 A;  4KLS A;  2KSO A;  1KLN A;  4O3M A;  3FDS A;  2E8N A;  1PZN A;  3OSP A;  4QNL A;  4O3S A;  4JUZ A;  2ZTC A;  4ZH4 A;  3N7R C;  2J6U A;  1WUD A;  2NYV A;  2DF4 B;  3B9J A;  3PSP A;  1T8E A;  4NLC A;  1MQ2 A;  5AK4 A;  4F92 B;  3AL0 B;  2C2R A;  4F5N A;  5E79 U;  1TK0 A;  1NK6 A;  1ZQK A;  5AIC A;  1B0X A;  4QZH A;  3KHG A;  5AKY A;  4NV0 A;  7ICI A;  3PO4 A;  4KLO A;  1HJP A;  4US9 A;  2FLN A;  3QUC A;  2ZXH A;  7ICV A;  3SAF A;  9ICE A;  4JV0 A;  1JRO A;  1JRP A;  3IN5 A;  5DKW A;  2EH9 A;  1S8O A;  2KV2 A;  1QSY A;  2YY6 A;  1QQ6 A;  5AM3 A;  4YR2 A;  4Q44 A;  1ZQE A;  3K75 D;  4P2H A;  2FLP A;  2IOH A;  4Z6D A;  1RYR A;  3ED5 A;  1Z4N A;  2GO7 A;  3WKB A;  4YR3 A;  2WF5 A;  1QQ7 A;  1UHU A;  1N62 A;  1LB2 B;  4O0I A;  4PHA A;  2IOF K;  4C7Z A;  3F2D A;  3RB4 A;  1J97 A;  3UMC A;  3AMZ A;  2KN7 A;  2KKP A;  1XO0 A;  3T5K A;  5K4L A;  9ICV A;  5KFX A;  2LM4 A;  2YML A;  2JEI A;  5G5G A;  1ZQM A;  3ICX A;  5J2J A;  3RF9 A;  2C22 A;  5EOZ A;  3JPO A;  1X9M A;  4QZD A;  2OH2 A;  1S5L U;  2PKE A;  1Y88 A;  5L1L A;  5AM5 A;  1TAU A;  2HOQ A;  3TAN A;  4CF5 A;  5CB1 A;  1TK8 A;  3V7L A;  1ZQD A;  2VA8 A;  1L3S A;  3WK9 A;  5BOL A;  4UB4 A;  4I2A A;  3MDC A;  1D9F A;  2ZIX B;  4C7Y A;  2UVW A;  4P0Q A;  3WKA A;  1NJW A;  4YVZ A;  2DL0 A;  4J9M A;  4FE3 A;  3Q8M A;  4CRX A;  4C8O A;  9ICJ A;  2QB0 A;  3PVX A;  3B0X A;  2LBO A;  1ZQA A;  3ZDB A;  3JPQ A;  2BQ3 A;  2F1J A;  2HVI A;  3AQE A;  3HP6 A;  3HJE A;  4BX9 C;  4QWE A;  4LZG A;  4XA5 A;  1RPL A;  4YD2 A;  4UBB A;  4GIB A;  4ELT A;  3KOO A;  3TAP A;  2JR5 A;  2KHQ A;  3OPX A;  2UVV A;  5AI5 A;  3UXN A;  2KK0 A;  3DDH A;  2A3V A;  2BKE A;  2KMD A;  1U4B A;  4RPZ A;  3UXP A;  3E58 A;  2ZIU A;  4UB6 U;  2JGA A;  1Z19 A;  5AKK A;  3C23 A;  3ETR A;  3ZD8 A;  3HRD D;  3WKD A;  5J2H A;  3TAC B;  1CI4 A;  5F3X B;  4JB3 A;  1F0M A;  2D6F C;  2WAQ F;  1HEK A;  1KFS A;  2GWS A;  4ELU A;  1X2I A;  1B43 A;  1XWL A;  3G6Y A;  3RBD A;  3SR6 A;  4F72 A;  5AKL A;  1NK4 A;  1Z3E B;  4XUS A;  1N5W A;  2MU2 A;  2HHU A;  9ICS A;  1MQ3 A;  4Y2Y A;  5CEH A;  3T5J A;  5KG2 A;  3H0R B;  2IHN A;  4JWM A;  1WYG A;  3GFK B;  5L1K A;  3C21 A;  4RQ2 A;  2ATL A;  2B6G A;  1C7Y A;  1UT5 A;  3C2L A;  5J0P A;  1X9X A;  2BR0 A;  1UA1 A;  5AI8 A;  2J6T A;  5AKG A;  5KFN A;  2JRZ A;  2G5H B;  4QZ8 A;  3IM1 A;  4I28 A;  1PK3 A;  3BZC A;  5AI9 A;  4ECW A;  4QW8 A;  3RB3 A;  8ICW A;  3EPI A;  2KG5 A;  1ZRM A;  4KLQ A;  3GQC A;  2YQE A;  4QZG A;  2FPL A;  2ZXI A;  4UAV A;  1VDV A;  5B66 U;  7ICP A;  4AYB F;  4PGX A;  4PPX A;  4DSJ A;  4MFC A;  1UQV A;  2Q0Z X;  4M6W B;  2ZIU B;  2MUT A;  4DFK A;  3SEN A;  2IBK A;  3C1Z A;  4QZC A;  5CA7 A;  4DS4 A;  1ZQJ A;  4GFJ A;  5KTQ A;  2EZY A;  5ALK A;  3GIJ A;  1SKS A;  3FYH A;  4C4R A;  4YD1 A;  5KFY A;  1T7P A;  3Q8Q B;  4IQU A;  2PI5 A;  4DFJ A;  4FFD A;  2W9C B;  3RRG A;  3NRW A;  4IR1 A;  1SL1 A;  1L7P A;  1X9S A;  1K1Q A;  5ALQ A;  4EBD A;  3SV3 A;  2EAP A;  4R66 A;  3NAS A;  8ICT A;  1L3U A;  1NKC A;  3LWM A;  4KLE A;  2P35 A;  3TI0 A;  3WK5 A;  1HUO A;  1KKX A;  2E3T A;  2K4E A;  1Q8K A;  5D49 A;  2EAM A;  3BZK A;  4R8U A;  5DGB A;  4US8 A;  2K8C B;  3WKE A;  3C2K A;  1X40 A;  4DL4 A;  1XNS A;  1CRX A;  2VA2 A;  2P6U A;  2K60 A;  1P7D A;  3RH5 A;  1ZQC A;  2WHE A;  1JIH A;  2BCQ A;  3A0B U;  2IA6 A;  4ECY A;  3SYZ A;  4RQ1 A;  4DLG A;  5ALT A;  4ED0 A;  1U9L A;  2KZZ A;  4RU9 A;  4QZB A;  1U49 A;  4ACO A;  3Q8K A;  2NRZ A;  5IIO A;  4M2Y A;  5KFZ A;  7ICE A;  5KFK A;  1SZP A;  7ICF A;  2AH5 A;  3NVZ A;  3GV7 B;  4UB5 A;  4K4H A;  5AIB A;  4DLE A;  4DCC A;  5KFJ A;  3RJK A;  5J2D A;  3TAR A;  3SQI A;  5AK6 A;  2HHS A;  1PVP A;  4ED8 A;  4J9R A;  4M9J A;  4FS2 A;  1NJZ A;  4Y2P A;  1TV9 A;  2OEH A;  4RQ3 A;  2Q4T A;  1FIQ A;  3ORY A;  1ZET A;  1N5X A;  3PW7 A;  3ALR A;  3BS5 B;  5ALJ A;  1N2X A;  2OXO A;  4IRK A;  1BNO A;  1SXE A;  2EAO A;  4PGQ A;  4UQG A;  3M1Y A;  9ICW A;  9ICF A;  4MEX A;  1NZB A;  3RBE A;  5KT7 A;  2ZG6 A;  1KBU A;  9ICC A;  2NO5 A;  4ECT A;  4GXK A;  3TQ1 A;  4RT2 A;  1D8L A;  3FC4 A;  2FI1 A;  4NY8 A;  4M0A A;  2KD1 A;  1X6I A;  4HYK A;  2K8A A;  2ZUB A;  2K4H A;  3KD3 A;  1TE2 A;  1J2M A;  5B5E U;  1ZQL A;  3Q8S B;  4I29 A;  1COO A;  4RUA A;  2WF8 A;  3MGI A;  5JTI A;  4IS7 A;  4GXJ A;  3V7K A;  3C1Y A;  1S77 D;  3RH6 A;  2HHV A;  2KVS A;  3IHQ B;  4QZ9 A;  5DB9 A;  2EZZ A;  4QZA A;  4F4K A;  5HNK A;  4NL9 A;  4MEY A;  2FMP A;  3PX6 A;  4R65 A;  1S97 A;  2XGP A;  4UAS A;  4I2D A;  2XY6 A;  2ZIW B;  5DG8 A;  2R8K A;  2ZJ5 A;  5AI4 A;  2GH1 A;  3PR4 A;  1ZD4 A;  3E0F A;  4I2E A;  3C5G A;  1DXS A;  3PO5 A;  1ZRN A;  2P66 A;  8ICF A;  2FMS A;  4YMO A;  2ZUC A;  5DB7 A;  2F76 X;  8ICQ A;  8ICE A;  2PFQ A;  3H40 A;  3M6Z A;  4OCZ A;  5DLF A;  1PK1 A;  4OJP A;  3OTQ A;  5HHI A;  2AHO B;  4UB8 U;  2AGQ A;  1RZT A;  1L5U A;  3PV8 A;  2RDJ A;  2JZB B;  3K4G A;  3HWT A;  4F4Z A;  2KHV A;  4EX7 A;  2JXJ A;  2O6K A;  2E1E A;  4M6W A;  5DG7 A;  4NLZ A;  3K1R B;  4DFM A;  5J2B A;  2JMG A;  1ZQR A;  3TFS A;  2W7O A;  1KTQ A;  4RQ4 A;  4LJX A;  3C2M A;  3CW2 C;  2HMX A;  3D2N A;  3JPP A;  2ASJ A;  4EYI B;  3PW2 A;  3PST A;  5KFW A;  3H4D A;  4BDP A;  5J0R A;  3QXG A;  2E8P A;  3JPR A;  4Y2U A;  4EBE A;  9ICG A;  2BHN A;  1TAM A;  4F5R A;  1S10 A;  5DQG A;  3M8R A;  3QUT A;  1L7N A;  3D6J A;  3QNM A;  3UMB A;  5IIM A;  5KFF A;  3PSI A;  3PSF A;  2W03 A;  5ALG A;  1Z00 A;  1KSP A;  3VC8 A;  5KAF U;  4UB1 A;  4G3I A;  5AKJ A;  3KFU F;  4DSL A;  1C20 A;  2HHQ A;  5L1J A;  2GLE A;  4KLT A;  2R18 A;  3QZ8 A;  3U26 A;  1ZQW A;  4KLH A;  4DFD A;  5AKZ A;  3WK6 A;  3ZDD A;  7ICN A;  1NJX A;  1RYS A;  3UQ0 A;  1TAQ A;  4ECV A;  5KG5 A;  5FP0 A;  2KVC A;  1NK5 A;  1KEJ A;  1X6J A;  4LVS A;  9ICM A;  4TUQ A;  1A77 A;  4J9P A;  5G5H A;  5EE3 A;  1O08 A;  1KRP A;  3PX4 A;  2G0A A;  2QAR B;  3D2Q A;  4Y2J A;  4DF4 A;  5ALU A;  3ZD9 A;  4F4W A;  4IRD A;  2I6X A;  1TVA A;  5HR6 A;  2BDP A;  3EPG A;  1NI3 A;  1SGG A;  4JK1 A;  2W3S A;  2KTQ A;  5J2I A;  2H3I A;  1ZQQ A;  4YN4 A;  4DOA A;  5DDM A;  1LKY B;  3RAX A;  4PJ0 U;  2HHX A;  4FO6 A;  3TFR A;  7ICR A;  5KFL A;  4KX3 A;  1L3V A;  5ALY A;  7ICJ A;  4KN7 A;  5ALW A;  2WF9 A;  4GXI A;  4DSK A;  3UMG A;  5KFO A;  5H2F U;  2YB4 A;  7ICO A;  1JXL A;  2RHF A;  4QIW C;  1DOQ A;  5GTH U;  3GII A;  3H4B A;  2XCA A;  3WK4 A;  3MFI A;  4JWN A;  1K1S A;  5J2G A;  4DL2 A;  4YXJ A;  3MGV A;  1ZYQ A;  1DGJ A;  2B21 A;  9ICA A;  4F5O A;  2E5S A;  7ICM A;  4RNN A;  2G08 A;  4NLK A;  2PMZ C;  5EWE A;  2NRX A;  2LMR A;  5KG0 A;  5JU5 A;  2VKQ A;  2EZX A;  2LI6 A;  2XCP A;  3RTV A;  1ZQF A;  4KTQ A;  4DL3 A;  4YP3 A;  2LHT A;  5ALL A;  2NRT A;  5L9X A;  3PY8 A;  3GV8 B;  2BDU A;  3BQT A;  3SD7 A;  2DFL A;  8ICM A;  5ALN A;  4I2C A;  2JH1 A;  3MDA A;  4NWI A;  3EWA A;  4J9K A;  4FS1 A;  2YB1 A;  4OJO A;  5ALP A;  2P6R A;  5J2C A;  5DBA A;  1BPZ A;  7ICQ A;  3N97 B;  5GTI U;  2F77 X;  4PGY A;  1FFV A;  1WCN A;  3N7P D;  3LVW A;  4O3N A;  8ICH A; 
#chains in the Genus database with same CATH homology
 3K1R B;  2KIV A;  2EAM A;  4MHV A;  1SV4 A;  1SGG A;  2ES6 A;  1X40 A;  5J8Y A;  2B6G A;  2K60 A;  3SEI A;  2F44 A;  1X66 A;  1V85 A;  1SV0 C;  1X9X A;  2Y9T A;  3H8M A;  1JI7 A;  5JTI A;  1B4F A;  2F8K A;  2E8P A;  1LKY B;  1SV0 A;  4IS7 A;  2DKZ A;  2D8C A;  2DL0 A;  2KE7 A;  5J8Y C;  2Y9U A;  1B0X A;  2LPE A;  1PK3 A;  2K4P A;  2QB0 A;  1KW4 A;  1PK1 B;  2DKX A;  2KG5 A;  2QB0 B;  4NL9 A;  3BQ7 A;  2KSO B;  3TAD A;  3BS7 A;  1Z1V A;  2FE9 A;  4NL9 C;  1OXJ A;  2F3N A;  2QKQ A;  1UQV A;  2GLE A;  5KNI A;  2ESE A;  1OW5 A;  3KKA C;  2D3D A;  3SEN A;  2YTU A;  2KMD A;  1V38 A;  4NJ8 A;  3HIL A;  3KKA A;  1DXS A;  1LKY A;  1WWU A;  1COK A;  5JRT A;  3BS5 B;  4PZN A;  2LMR A;  5JU5 A;  2JV3 A;  1WWV A;  2L5Y A;  1SXE A;  2EAO A;  3TAC B;  2QB1 A;  5F3X B;  1RG6 A;  3TAD C;  1PK1 A;  1F0M A;  2EAN A;  2E8M A;  3BS5 A;  4PZO A;  2E8O A;  1SXD A;  2EAP A;  3IDW A;  2QAR B;  2KSO A;  5L1M A;  4RQM A;  2QAR A;  1UCV A;  2E8N A;  4RQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...