2EB1A

Crystal structure of the c-terminal rnase iii domain of human dicer
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
191
structure length
171
Chain Sequence
NHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease Dicer
publication title Homodimeric Structure and Double-stranded RNA Cleavage Activity of the C-terminal RNase III Domain of Human Dicer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 171
sequence length 191
chains with identical sequence B, C
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2eb1A00
3C4BA 2A11A 2FFLA 1JFZA 2EB1A 2GSLA 1YYKA 1I4SA 1YYOA 1U61A 2NUFA 4OUNA 4OOGC 2NUGA 3O2RB 1O0WA 3C4TA 2NUEA 1RC5A 1YYWA 1YZ9A 3O2RA 4M2ZA 2QVWA 2EZ6A 3RV1A 1RC7A 3N3WA 3RV0A 4M30A
chains in the Genus database with same CATH superfamily
3C4BA 1ZTDA 2A11A 2FFLA 1JFZA 2EB1A 2GSLA 1YYKA 1I4SA 1YYOA 1U61A 2NUFA 4OUNA 4OOGC 2NUGA 3O2RB 1O0WA 3C4TA 2NUEA 1RC5A 1YYWA 1YZ9A 3O2RA 4M2ZA 2QVWA 2EZ6A 3RV1A 1RC7A 3N3WA 3RV0A 4M30A
chains in the Genus database with same CATH topology
3C4BA 2A11A 2FFLA 1JFZA 2EB1A 2GSLA 1YYKA 1I4SA 1YYOA 1U61A 2NUFA 4OUNA 4OOGC 2NUGA 3O2RB 1O0WA 3C4TA 2NUEA 1RC5A 1YYWA 1YZ9A 3O2RA 4M2ZA 2QVWA 2EZ6A 3RV1A 1RC7A 3N3WA 3RV0A 4M30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4B A;  2A11 A;  2FFL A;  1JFZ A;  2EB1 A;  2GSL A;  1YYK A;  1I4S A;  1YYO A;  1U61 A;  2NUF A;  4OUN A;  4OOG C;  2NUG A;  3O2R B;  1O0W A;  3C4T A;  2NUE A;  1RC5 A;  1YYW A;  1YZ9 A;  3O2R A;  4M2Z A;  2QVW A;  2EZ6 A;  3RV1 A;  1RC7 A;  3N3W A;  3RV0 A;  4M30 A; 
#chains in the Genus database with same CATH topology
 3C4B A;  1ZTD A;  2A11 A;  2FFL A;  1JFZ A;  2EB1 A;  2GSL A;  1YYK A;  1I4S A;  1YYO A;  1U61 A;  2NUF A;  4OUN A;  4OOG C;  2NUG A;  3O2R B;  1O0W A;  3C4T A;  2NUE A;  1RC5 A;  1YYW A;  1YZ9 A;  3O2R A;  4M2Z A;  2QVW A;  2EZ6 A;  3RV1 A;  1RC7 A;  3N3W A;  3RV0 A;  4M30 A; 
#chains in the Genus database with same CATH homology
 3C4B A;  2A11 A;  2FFL A;  1JFZ A;  2EB1 A;  2GSL A;  1YYK A;  1I4S A;  1YYO A;  1U61 A;  2NUF A;  4OUN A;  4OOG C;  2NUG A;  3O2R B;  1O0W A;  3C4T A;  2NUE A;  1RC5 A;  1YYW A;  1YZ9 A;  3O2R A;  4M2Z A;  2QVW A;  2EZ6 A;  3RV1 A;  1RC7 A;  3N3W A;  3RV0 A;  4M30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...