2EB1A

Crystal structure of the c-terminal rnase iii domain of human dicer
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
191
structure length
171
Chain Sequence
b'NHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease Dicer
publication title Homodimeric Structure and Double-stranded RNA Cleavage Activity of the C-terminal RNase III Domain of Human Dicer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 171
sequence length 191
chains with identical sequence B, C
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2eb1A00
2NUEA 2GSLA 1JFZA 3RV0A 1YYWA 2EB1A 2QVWA 2FFLA 1YZ9A 1YYKA 1YYOA 3C4BA 3O2RA 4OUNA 4OOGC 4M30A 2A11A 2NUFA 1I4SA 1RC5A 4M2ZA 1O0WA 2NUGA 1U61A 2EZ6A 3O2RB 3N3WA 3C4TA 3RV1A 1RC7A
chains in the Genus database with same CATH superfamily
2NUEA 2GSLA 1JFZA 3RV0A 1YYWA 2EB1A 2QVWA 2FFLA 1YZ9A 1YYKA 1YYOA 3C4BA 3O2RA 4OUNA 4OOGC 4M30A 2A11A 1ZTDA 1I4SA 1RC5A 2NUFA 4M2ZA 1O0WA 2NUGA 1U61A 2EZ6A 3O2RB 3N3WA 3C4TA 3RV1A 1RC7A
chains in the Genus database with same CATH topology
2NUEA 2GSLA 1JFZA 3RV0A 1YYWA 2EB1A 2QVWA 2FFLA 1YZ9A 1YYKA 1YYOA 3C4BA 3O2RA 4OUNA 4OOGC 4M30A 2A11A 2NUFA 1I4SA 1RC5A 4M2ZA 1O0WA 2NUGA 1U61A 2EZ6A 3O2RB 3N3WA 3C4TA 3RV1A 1RC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUE A;  2GSL A;  1JFZ A;  3RV0 A;  1YYW A;  2EB1 A;  2QVW A;  2FFL A;  1YZ9 A;  1YYK A;  1YYO A;  3C4B A;  3O2R A;  4OUN A;  4OOG C;  4M30 A;  2A11 A;  2NUF A;  1I4S A;  1RC5 A;  4M2Z A;  1O0W A;  2NUG A;  1U61 A;  2EZ6 A;  3O2R B;  3N3W A;  3C4T A;  3RV1 A;  1RC7 A; 
#chains in the Genus database with same CATH topology
 2NUE A;  2GSL A;  1JFZ A;  3RV0 A;  1YYW A;  2EB1 A;  2QVW A;  2FFL A;  1YZ9 A;  1YYK A;  1YYO A;  3C4B A;  3O2R A;  4OUN A;  4OOG C;  4M30 A;  2A11 A;  1ZTD A;  1I4S A;  1RC5 A;  2NUF A;  4M2Z A;  1O0W A;  2NUG A;  1U61 A;  2EZ6 A;  3O2R B;  3N3W A;  3C4T A;  3RV1 A;  1RC7 A; 
#chains in the Genus database with same CATH homology
 2NUE A;  2GSL A;  1JFZ A;  3RV0 A;  1YYW A;  2EB1 A;  2QVW A;  2FFL A;  1YZ9 A;  1YYK A;  1YYO A;  3C4B A;  3O2R A;  4OUN A;  4OOG C;  4M30 A;  2A11 A;  2NUF A;  1I4S A;  1RC5 A;  4M2Z A;  1O0W A;  2NUG A;  1U61 A;  2EZ6 A;  3O2R B;  3N3W A;  3C4T A;  3RV1 A;  1RC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...