2EBBA

Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
b'MRLTEEEVQALLEKADGWKLADERWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISIDYKLITVKLSSWRAKGLTKLDFDLAKQYDEVYNQMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pterin-4-alpha-carbinolamine dehydratase
publication title Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
total genus 31
structure length 96
sequence length 96
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2ebbA00
1F93A 2EBBA 4WILA 4LOWA 3HXAA 1USMA 2V6UA 2V6SA 1DCPA 1RU0A 1DCHA 2V6TA 1DCOA 4C45A 3JSTA 1USOA
chains in the Genus database with same CATH superfamily
1JQWA 3PO2C 4A3DK 3FKIA 1TWCC 3TFIA 3CQZC 4A3JK 3CAGA 2GAHC 1USOA 5C44C 1IBAA 2NVXA 3GEIA 1V5VA 3RZOK 1O2BA 3GTQC 4RMFA 1C0AA 3I4NC 1EH1A 3HOUK 1GE9A 1F7VA 4KC6A 3SZZA 4C3HC 4C3IK 1R9TA 1O29A 2D6FC 1XZQA 2XCOA 1WSRA 5CJ9A 2VUMK 4BY7K 3GTJC 1X31C 3LPXA 1ISEA 3I4MC 2YU9C 4GTEA 3H0GC 3K7AK 3HOZC 4XLPA 1TWFA 5TMFA 1ZXOA 2JA6A 3GTPK 1WCMK 4GTBA 1WQHA 1I3QC 3FKIC 1EK8A 2EBBA 2RGRA 4QJVB 3GTGK 3S15C 4A3BK 3ADAC 3WODA 3HOWC 2JA6K 3GTOC 1RU0A 3HOVC 4Y7NC 1BS2A 5M3MK 4GTLA 1R9TC 2V6UA 1WQGA 4Y52K 3GTMA 2R92A 3GDZA 4BKWA 1IQ0A 4JK1A 2PPBA 3GTLA 1J6VA 1J98A 2GSNA 2NVTK 2PHCB 3VA7A 5FJ8K 4P5BA 1Y1WC 4XSXA 4MQ9A 3S1QK 4A3EK 4OIPA 2XCQA 3BP8C 4KMAA 2E2JC 3S1NK 4A3GC 2NVQC 3OREA 4P9SA 2JA5A 4KB4A 4GTAA 1K83A 3GTLK 4O2DA 3T00A 3HOYC 4GT9A 4BBRK 1DCPA 4ZH4A 4OIOA 5C4XK 5IP9K 4Q4ZA 4WILA 2FQOA 4GTFA 1TWCA 3CQZA 2CW0A 4GTDA 1VGXA 4X6AK 2KWAA 4XLNA 3S1RC 4KAWX 3SZYA 4DDQA 5EGEA 3T02A 3PO2K 1G51A 3CQZK 4ILDA 2O5IA 3GTMC 1I6HC 5C44K 4J3NA 1YX2A 1Y1VK 2BE5A 4FM9A 2W7VA 4BXXC 1O28A 3S2DC 4Q5SA 4AYBD 2R93C 2A69A 4KM8A 3GTQK 5IYCK 3FOEA 3I4NK 3HXAA 4KDDA 2FQTA 3BUEA 4QJVA 4A3FK 2YU9A 4OIRA 2JA8C 2B63A 5M3FK 4C3HK 4AH6A 1TWGC 1K83C 1UV7A 5M5YK 4BLAA 3GTJK 2R7ZK 1I3QA 2YU9K 5FLMC 3I4MK 5IOTA 5IYBC 3H0GK 1PJ5A 5IOQA 4A3KK 3V4GA 1HI9A 3HOZK 4AYBL 3EQLA 3GTOA 5IORA 2V6SA 2E2HC 4OIQA 1I3QK 3FKIK 4A3LK 3PO3K 4KMUA 3AD7C 3S15K 1VRQC 2NVXK 5TJ3A 2A68A 3GTOK 4A3CC 1WOOA 3LAPA 4KASA 1TWHA 3HOVK 1HQMA 3IPJA 4C2MC 2B63C 4G0UA 4Y7NK 1Y1WA 1R9TK 4P5AA 3GEHA 5L46A 2RH6A 3M3YC 4MEXA 1EFWA 4FZBA 4XSZA 3RZDC 4G7ZA 1Y1WK 1IW7A 1J6WA 4G0WA 5JVOA 1TWFK 3L4JA 2E2JK 4A3GK 2PA8D 2NVQK 3S2HK 2WAQD 1WQFA 5E68A 1SFOA 1F93A 3N0BA 3BP3A 3S1MC 5CHPA 5C3EC 4QIWD 3HOXK 4LK0A 3AH5A 3S1RK 1TWHC 2R93A 4LR2A 2E2IA 1YCLA 3M4OC 3G4CA 4BY7C 4BY1C 3DXJA 2PA8L 3GTMK 2WAQL 1ZVUA 2R92K 1I6HK 1INNA 4A93C 1TWGA 4BXXK 3S2DK 3TFJA 2Y0SD 1O2AA 4OINA 1WCMC 5C4JC 5EGHA 2PMZD 4QIWL 2JA8K 4KMHA 2JA5K 1IL2A 2A6EA 1ZBSA 3GTGC 1K83K 1SFOC 4A3BC 3N0CA 1DD5A 3Q3QA 2XCRB 4A3IK 1BJTA 1I50C 1USMA 3ERED 2E2HA 2GSOA 1TWCK 1PJ7A 5FLMK 5IYBK 2A6HA 3HKZD 4YG2A 4PAAA 1ZYRA 4YFNA 2Y0SL 4KARA 2E2IC 4LOWA 4C3JC 2PMZL 2E2HK 3OEPA 3AD9C 5IP7C 2NVTC 3GTKC 1WORA 1WSVA 1DCOA 1JOEA 1O27A 4A3CK 3GSIA 3S1NC 3A8JA 3LAJA 4C2MK 5TMCA 2B63K 1XXBA 4XCHA 3S14C 3HKZL 4BBRC 1F9NA 4A3MC 3A8IA 2V6TA 4WJ4A 2NVYC 4GZYA 5M5WK 5IYDC 3S17C 4LLGA 5IOSA 4KN7A 4KATA 4KN4A 1DCHA 4LQYA 3A8KA 3NUHA 3L4KA 2CFAB 1O2FB 3RZDK 4BBSC 3HOWK 3S16C 1Y1VC 3GIRA 2Y3PA 3AQOA 3S1MK 2VUMA 5IYCC 4M1XA 4GTCA 1O25A 1SMYA 5C3EK 4A3FC 2ZUFA 3GEEA 1AB4A 1L0WA 1TWAC 1TWHK 1XXCA 1ZQ1C 4G7HA 2JA7C 3PO3C 3M4OK 1WCMA 3GTPA 2R7ZC 4BY1K 4A3DC 3T01A 1XZPB 4A3JC 4A93K 3GTGA 4A3KC 1KQ4A 3HOYK 3RZOC 1BDFA 4KMDA 1I50A 1J6XA 4LJZA 5C4JK 3HOUC 4A3LC 4YFXA 3TFHA 3OPFA 4C3IC 4YFKA 1VJEA 1SFOK 2NVXC 3G4AA 3N3YA 2JH3A 1I50K 1IS1A 2VUMC 4LK1A 3GTKA 3FOFA 4BLBA 3FHZA 4WJ3M 5D4DA 3K7AC 2R93K 2E2IK 1XXAA 4C3JK 2P8TA 1O24A 4G7OA 3GTPC 1PJ6A 2CFAA 3S0XA 5IP7K 2GAGC 3GTKK 1YNNA 1TWGK 1JVIA 2WB1D 1YNJA 2NVYA 1TWFC 5JFEA 2JA6C 2ZFZA 3S2HC 2P5MA 4GFQA 1XZQB 3S14K 4PABA 4A3MK 5M5XK 2NVYK 3S17K 3QX3A 4Y52C 5IYDK 3HOXC 1EI6A 1Y1VA 1WOSA 4MEYA 3H3VD 1F7UA 1VLOA 1B4AA 3GTQA 1VH2A 5HL8A 2WB1L 4BBSK 1XZPA 3S16K 3S1QC 4A3EC 2R92C 1WIHA 1TWAA 3MMLB 1IE0A 3JSTA 1WOPA 3GTLC 1EQRA 2O5JA 1B4BA 3AD8C 1I6VA 2JA7A 5C4XC 1BGWA 4KM9A 5IP9C 3GTJA 2ZUEA 2R7ZA 4NOIA 3H0GA 3TTGA 2JA5C 1TWAK 3M3YK 4X6AC 3H3VL 1O26A 4G0VA 4KB2A 1XPPA 2GSUA 3AQPA 4C45A 4A3IC 2JA7K
chains in the Genus database with same CATH topology
1F93A 2EBBA 4WILA 4LOWA 3HXAA 1USMA 2V6UA 2V6SA 1DCPA 1RU0A 1DCHA 2V6TA 1DCOA 4C45A 3JSTA 1USOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F93 A;  2EBB A;  4WIL A;  4LOW A;  3HXA A;  1USM A;  2V6U A;  2V6S A;  1DCP A;  1RU0 A;  1DCH A;  2V6T A;  1DCO A;  4C45 A;  3JST A;  1USO A; 
#chains in the Genus database with same CATH topology
 1JQW A;  3PO2 C;  4A3D K;  3FKI A;  1TWC C;  3TFI A;  3CQZ C;  4A3J K;  3CAG A;  2GAH C;  1USO A;  5C44 C;  1IBA A;  2NVX A;  3GEI A;  1V5V A;  3RZO K;  1O2B A;  3GTQ C;  4RMF A;  1C0A A;  3I4N C;  1EH1 A;  3HOU K;  1GE9 A;  1F7V A;  4KC6 A;  3SZZ A;  4C3H C;  4C3I K;  1R9T A;  1O29 A;  2D6F C;  1XZQ A;  2XCO A;  1WSR A;  5CJ9 A;  2VUM K;  4BY7 K;  3GTJ C;  1X31 C;  3LPX A;  1ISE A;  3I4M C;  2YU9 C;  4GTE A;  3H0G C;  3K7A K;  3HOZ C;  4XLP A;  1TWF A;  5TMF A;  1ZXO A;  2JA6 A;  3GTP K;  1WCM K;  4GTB A;  1WQH A;  1I3Q C;  3FKI C;  1EK8 A;  2EBB A;  2RGR A;  4QJV B;  3GTG K;  3S15 C;  4A3B K;  3ADA C;  3WOD A;  3HOW C;  2JA6 K;  3GTO C;  1RU0 A;  3HOV C;  4Y7N C;  1BS2 A;  5M3M K;  4GTL A;  1R9T C;  2V6U A;  1WQG A;  4Y52 K;  3GTM A;  2R92 A;  3GDZ A;  4BKW A;  1IQ0 A;  4JK1 A;  2PPB A;  3GTL A;  1J6V A;  1J98 A;  2GSN A;  2NVT K;  2PHC B;  3VA7 A;  5FJ8 K;  4P5B A;  1Y1W C;  4XSX A;  4MQ9 A;  3S1Q K;  4A3E K;  4OIP A;  2XCQ A;  3BP8 C;  4KMA A;  2E2J C;  3S1N K;  4A3G C;  2NVQ C;  3ORE A;  4P9S A;  2JA5 A;  4KB4 A;  4GTA A;  1K83 A;  3GTL K;  4O2D A;  3T00 A;  3HOY C;  4GT9 A;  4BBR K;  1DCP A;  4ZH4 A;  4OIO A;  5C4X K;  5IP9 K;  4Q4Z A;  4WIL A;  2FQO A;  4GTF A;  1TWC A;  3CQZ A;  2CW0 A;  4GTD A;  1VGX A;  4X6A K;  2KWA A;  4XLN A;  3S1R C;  4KAW X;  3SZY A;  4DDQ A;  5EGE A;  3T02 A;  3PO2 K;  1G51 A;  3CQZ K;  4ILD A;  2O5I A;  3GTM C;  1I6H C;  5C44 K;  4J3N A;  1YX2 A;  1Y1V K;  2BE5 A;  4FM9 A;  2W7V A;  4BXX C;  1O28 A;  3S2D C;  4Q5S A;  4AYB D;  2R93 C;  2A69 A;  4KM8 A;  3GTQ K;  5IYC K;  3FOE A;  3I4N K;  3HXA A;  4KDD A;  2FQT A;  3BUE A;  4QJV A;  4A3F K;  2YU9 A;  4OIR A;  2JA8 C;  2B63 A;  5M3F K;  4C3H K;  4AH6 A;  1TWG C;  1K83 C;  1UV7 A;  5M5Y K;  4BLA A;  3GTJ K;  2R7Z K;  1I3Q A;  2YU9 K;  5FLM C;  3I4M K;  5IOT A;  5IYB C;  3H0G K;  1PJ5 A;  5IOQ A;  4A3K K;  3V4G A;  1HI9 A;  3HOZ K;  4AYB L;  3EQL A;  3GTO A;  5IOR A;  2V6S A;  2E2H C;  4OIQ A;  1I3Q K;  3FKI K;  4A3L K;  3PO3 K;  4KMU A;  3AD7 C;  3S15 K;  1VRQ C;  2NVX K;  5TJ3 A;  2A68 A;  3GTO K;  4A3C C;  1WOO A;  3LAP A;  4KAS A;  1TWH A;  3HOV K;  1HQM A;  3IPJ A;  4C2M C;  2B63 C;  4G0U A;  4Y7N K;  1Y1W A;  1R9T K;  4P5A A;  3GEH A;  5L46 A;  2RH6 A;  3M3Y C;  4MEX A;  1EFW A;  4FZB A;  4XSZ A;  3RZD C;  4G7Z A;  1Y1W K;  1IW7 A;  1J6W A;  4G0W A;  5JVO A;  1TWF K;  3L4J A;  2E2J K;  4A3G K;  2PA8 D;  2NVQ K;  3S2H K;  2WAQ D;  1WQF A;  5E68 A;  1SFO A;  1F93 A;  3N0B A;  3BP3 A;  3S1M C;  5CHP A;  5C3E C;  4QIW D;  3HOX K;  4LK0 A;  3AH5 A;  3S1R K;  1TWH C;  2R93 A;  4LR2 A;  2E2I A;  1YCL A;  3M4O C;  3G4C A;  4BY7 C;  4BY1 C;  3DXJ A;  2PA8 L;  3GTM K;  2WAQ L;  1ZVU A;  2R92 K;  1I6H K;  1INN A;  4A93 C;  1TWG A;  4BXX K;  3S2D K;  3TFJ A;  2Y0S D;  1O2A A;  4OIN A;  1WCM C;  5C4J C;  5EGH A;  2PMZ D;  4QIW L;  2JA8 K;  4KMH A;  2JA5 K;  1IL2 A;  2A6E A;  1ZBS A;  3GTG C;  1K83 K;  1SFO C;  4A3B C;  3N0C A;  1DD5 A;  3Q3Q A;  2XCR B;  4A3I K;  1BJT A;  1I50 C;  1USM A;  3ERE D;  2E2H A;  2GSO A;  1TWC K;  1PJ7 A;  5FLM K;  5IYB K;  2A6H A;  3HKZ D;  4YG2 A;  4PAA A;  1ZYR A;  4YFN A;  2Y0S L;  4KAR A;  2E2I C;  4LOW A;  4C3J C;  2PMZ L;  2E2H K;  3OEP A;  3AD9 C;  5IP7 C;  2NVT C;  3GTK C;  1WOR A;  1WSV A;  1DCO A;  1JOE A;  1O27 A;  4A3C K;  3GSI A;  3S1N C;  3A8J A;  3LAJ A;  4C2M K;  5TMC A;  2B63 K;  1XXB A;  4XCH A;  3S14 C;  3HKZ L;  4BBR C;  1F9N A;  4A3M C;  3A8I A;  2V6T A;  4WJ4 A;  2NVY C;  4GZY A;  5M5W K;  5IYD C;  3S17 C;  4LLG A;  5IOS A;  4KN7 A;  4KAT A;  4KN4 A;  1DCH A;  4LQY A;  3A8K A;  3NUH A;  3L4K A;  2CFA B;  1O2F B;  3RZD K;  4BBS C;  3HOW K;  3S16 C;  1Y1V C;  3GIR A;  2Y3P A;  3AQO A;  3S1M K;  2VUM A;  5IYC C;  4M1X A;  4GTC A;  1O25 A;  1SMY A;  5C3E K;  4A3F C;  2ZUF A;  3GEE A;  1AB4 A;  1L0W A;  1TWA C;  1TWH K;  1XXC A;  1ZQ1 C;  4G7H A;  2JA7 C;  3PO3 C;  3M4O K;  1WCM A;  3GTP A;  2R7Z C;  4BY1 K;  4A3D C;  3T01 A;  1XZP B;  4A3J C;  4A93 K;  3GTG A;  4A3K C;  1KQ4 A;  3HOY K;  3RZO C;  1BDF A;  4KMD A;  1I50 A;  1J6X A;  4LJZ A;  5C4J K;  3HOU C;  4A3L C;  4YFX A;  3TFH A;  3OPF A;  4C3I C;  4YFK A;  1VJE A;  1SFO K;  2NVX C;  3G4A A;  3N3Y A;  2JH3 A;  1I50 K;  1IS1 A;  2VUM C;  4LK1 A;  3GTK A;  3FOF A;  4BLB A;  3FHZ A;  4WJ3 M;  5D4D A;  3K7A C;  2R93 K;  2E2I K;  1XXA A;  4C3J K;  2P8T A;  1O24 A;  4G7O A;  3GTP C;  1PJ6 A;  2CFA A;  3S0X A;  5IP7 K;  2GAG C;  3GTK K;  1YNN A;  1TWG K;  1JVI A;  2WB1 D;  1YNJ A;  2NVY A;  1TWF C;  5JFE A;  2JA6 C;  2ZFZ A;  3S2H C;  2P5M A;  4GFQ A;  1XZQ B;  3S14 K;  4PAB A;  4A3M K;  5M5X K;  2NVY K;  3S17 K;  3QX3 A;  4Y52 C;  5IYD K;  3HOX C;  1EI6 A;  1Y1V A;  1WOS A;  4MEY A;  3H3V D;  1F7U A;  1VLO A;  1B4A A;  3GTQ A;  1VH2 A;  5HL8 A;  2WB1 L;  4BBS K;  1XZP A;  3S16 K;  3S1Q C;  4A3E C;  2R92 C;  1WIH A;  1TWA A;  3MML B;  1IE0 A;  3JST A;  1WOP A;  3GTL C;  1EQR A;  2O5J A;  1B4B A;  3AD8 C;  1I6V A;  2JA7 A;  5C4X C;  1BGW A;  4KM9 A;  5IP9 C;  3GTJ A;  2ZUE A;  2R7Z A;  4NOI A;  3H0G A;  3TTG A;  2JA5 C;  1TWA K;  3M3Y K;  4X6A C;  3H3V L;  1O26 A;  4G0V A;  4KB2 A;  1XPP A;  2GSU A;  3AQP A;  4C45 A;  4A3I C;  2JA7 K; 
#chains in the Genus database with same CATH homology
 1F93 A;  2EBB A;  4WIL A;  4LOW A;  3HXA A;  1USM A;  2V6U A;  2V6S A;  1DCP A;  1RU0 A;  1DCH A;  2V6T A;  1DCO A;  4C45 A;  3JST A;  1USO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...