2EBBA

Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
MRLTEEEVQALLEKADGWKLADERWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISIDYKLITVKLSSWRAKGLTKLDFDLAKQYDEVYNQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pterin-4-alpha-carbinolamine dehydratase
publication title Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
total genus 31
structure length 96
sequence length 96
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2ebbA00
1USMA 1F93A 3JSTA 1USOA 1DCOA 2V6TA 4WILA 1RU0A 4LOWA 2EBBA 4C45A 3HXAA 2V6UA 1DCHA 2V6SA 1DCPA
chains in the Genus database with same CATH superfamily
1TWHA 2RH6A 3M4OK 4WJ4A 4BLAA 2XCQA 4QJVA 4C3IK 4C2MC 4X6AC 4KAWX 3S1QC 4OIQA 4A3IC 1R9TK 3LPXA 1PJ7A 4LR2A 3I4NK 3M4OC 1DD5A 4C3IC 3TFJA 1I6HC 3S1RK 1VH2A 1R9TC 1O26A 3HXAA 1SMYA 4A3JK 1EFWA 1USMA 4KMHA 1TWFK 3RZDK 3TTGA 3FKIA 5IP9K 3S1RC 3HOZC 4LQYA 1ZXOA 3GTMA 3RZOK 2WB1D 2A6HA 3S16K 1VJEA 1ZQ1C 5IP7C 3RZDC 1WQGA 2E2HA 4OINA 4GTDA 2R93K 4AYBD 3RZOC 3S16C 3PO3K 3M3YK 2P8TA 4KM9A 1WCMK 1O27A 3PO2K 1O2BA 3GTOA 2R93C 3GEHA 4LK1A 3ERED 4MQ9A 2JA7A 3AD7C 2ZFZA 3FOEA 5M3MK 3QX3A 1G51A 2GSOA 4KARA 2JA5K 1C0AA 3GSIA 2YU9A 4GTCA 4GT9A 2Y0SD 4A3KK 1J6XA 4OIRA 1WIHA 1VLOA 4BY7K 2V6SA 1GE9A 4LK0A 1TWHC 4LLGA 1XZQA 4QIWD 1BS2A 3HOXC 4A3KC 1ZYRA 4BBSK 4A3CC 3SZZA 3BP8C 4BY7C 5E68A 4KMDA 3I4MC 4FZBA 4XLPA 4YFXA 1WOOA 2E2JK 1TWFA 4A3BK 1B4BA 3GTKK 3Q3QA 2NVYA 1JOEA 3FKIK 3A8JA 3GTQK 3GTMK 5M3FK 3S2HK 2PPBA 4YFKA 4XSXA 1J98A 4A3GK 2E2JC 3GTLA 4BY1K 4NOIA 3GEIA 4BBRK 5IYBK 4WJ3M 3T00A 3FKIC 2E2HK 3S0XA 3GTMC 3S2HC 4A3GC 4ILDA 1SFOA 1WCMA 5IYBC 2E2HC 3AH5A 3GTOK 2XCOA 4LOWA 1O2FB 5IOSA 3G4CA 3GTGK 4KMAA 4MEYA 5CJ9A 3HOYK 5C4XK 2R7ZA 3GTOC 3HKZD 3GIRA 3GTGC 2JA5A 5JFEA 3CAGA 2JA7C 4A3LC 3SZYA 3HOYC 2YU9K 2NVTC 1WOSA 5JVOA 1JQWA 4O2DA 4BKWA 3N0BA 4C45A 1B4AA 1I6VA 4KB2A 3L4JA 2O5IA 2D6FC 2YU9C 4XLNA 1BDFA 3S2DK 5IORA 3IPJA 2PHCB 3I4NC 5IOQA 1F9NA 3GTKA 5IYDK 4XSZA 2NVYK 3GTQA 3N3YA 1J6WA 3AQPA 4A3JC 2E2IA 1O28A 1TWCK 5IYDC 1WSVA 1IL2A 3GTLK 1TWFC 4QJVB 5IP9C 2NVYC 4KM8A 1WOPA 5FJ8K 1YNNA 2A68A 3GTLC 1SFOK 4KC6A 2WAQL 1IE0A 4Q4ZA 1UV7A 4GTLA 1ISEA 1TWAK 3ADAC 3GTGA 2B63K 3PO3C 2VUMA 3M3YC 3H3VL 5EGHA 1SFOC 1WCMC 1F7UA 3PO2C 2RGRA 3GDZA 4WILA 4KN4A 2R7ZK 2ZUFA 3LAJA 4FM9A 1RU0A 1DCHA 3L4KA 4GTBA 1HI9A 4PABA 2R7ZC 4GTAA 4Q5SA 2GAHC 5C3EK 2PMZL 4GTEA 2JA5C 1XZPA 4C3HK 1HQMA 2GAGC 2CFAA 1DCPA 1XPPA 4G7HA 3BP3A 2JA6K 1O25A 3FOFA 2JA8K 4C3HC 2V6TA 2NVXA 2KWAA 4BBSC 4G7OA 3AD8C 5D4DA 1IW7A 2JA8C 1TWCA 2E2IK 1WORA 1WSRA 3S1MK 4GFQA 4KASA 1WQFA 4A3BC 3GTKC 2O5JA 3GTQC 4KB4A 2E2IC 5TMFA 3S1MC 3H0GK 4BY1C 4BBRC 1L0WA 4KDDA 1TWAA 1AB4A 2FQTA 2B63A 3OEPA 4M1XA 4A93K 3OREA 2VUMK 3WODA 5C44K 4JK1A 3DXJA 4Y7NK 4A93C 1PJ6A 2VUMC 5C44C 1YX2A 2FQOA 5C4XC 3K7AK 2NVQK 1O24A 5EGEA 4Y7NC 4A3FK 4DDQA 1ZBSA 1XXBA 4P9SA 3K7AC 3AQOA 2XCRB 2NVQC 1TWGA 1YNJA 3T01A 3HOWK 1VRQC 2JA6A 1BGWA 1I3QK 1EI6A 1EK8A 3FHZA 4XCHA 4A3FC 4BXXK 4A3IK 3GTJK 5IYCK 3VA7A 1Y1VA 3AD9C 1V5VA 3A8KA 3HOWC 1O29A 2NVXK 2PA8L 3S2DC 4A3DK 4GTFA 4A3MK 1I6HK 1I3QC 3JSTA 4BXXC 4A3EK 5M5XK 5M5WK 3GTJC 2WB1L 5IYCC 3S14K 1K83A 1BJTA 2NVXC 4A3DC 1EQRA 1JVIA 4A3MC 4Y52K 1INNA 4AH6A 3OPFA 4A3EC 3HOZK 4AYBL 1XXCA 3S14C 4KATA 1TWCC 4OIOA 3H0GA 1IBAA 2CW0A 2R92K 5IP7K 3TFHA 4Y52C 2PA8D 4ZH4A 1I50A 4BLBA 3BUEA 3MMLB 4YG2A 2JH3A 5M5YK 2R92C 1WQHA 4P5AA 2W7VA 3CQZA 5CHPA 1TWAC 1J6VA 3N0CA 2B63C 3TFIA 3S15K 4RMFA 2Y0SL 1X31C 5TJ3A 2WAQD 3GTPK 2V6UA 4J3NA 1Y1WA 1KQ4A 2P5MA 2GSUA 1F7VA 3S15C 3H3VD 4QIWL 3GTPC 1TWGK 1I3QA 4GZYA 5C3EC 3GTJA 1IQ0A 1ZVUA 3T02A 1TWHK 1Y1VK 3S17K 5TMCA 1TWGC 1O2AA 3HOXK 2JA6C 4A3CK 2A69A 1YCLA 4MEXA 4P5BA 1R9TA 3I4MK 2PMZD 1VGXA 1PJ5A 1Y1VC 1K83K 3S17C 1EH1A 5L46A 1F93A 4C3JK 3S1NK 1DCOA 1K83C 2R92A 1XZPB 1IS1A 5C4JK 1XZQB 2CFAB 4LJZA 3EQLA 2GSNA 1XXAA 4G0WA 2EBBA 2ZUEA 1I50K 4C3JC 5FLMK 4PAAA 3S1NC 4KMUA 2Y3PA 5HL8A 3H0GC 4G0VA 5C4JC 3V4GA 2A6EA 4G0UA 4OIPA 3HOVK 4YFNA 1I50C 3CQZK 1USOA 3NUHA 3HKZL 5FLMC 4G7ZA 2R93A 3GEEA 3G4AA 4KN7A 2BE5A 3HOVC 3GTPA 3CQZC 3LAPA 1Y1WK 3HOUK 2JA7K 4A3LK 3A8IA 2NVTK 1Y1WC 4C2MK 5IOTA 4X6AK 3HOUC 3S1QK
chains in the Genus database with same CATH topology
1USMA 1F93A 3JSTA 1USOA 1DCOA 2V6TA 4WILA 1RU0A 4LOWA 2EBBA 4C45A 3HXAA 2V6UA 1DCHA 2V6SA 1DCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USM A;  1F93 A;  3JST A;  1USO A;  1DCO A;  2V6T A;  4WIL A;  1RU0 A;  4LOW A;  2EBB A;  4C45 A;  3HXA A;  2V6U A;  1DCH A;  2V6S A;  1DCP A; 
#chains in the Genus database with same CATH topology
 1TWH A;  2RH6 A;  3M4O K;  4WJ4 A;  4BLA A;  2XCQ A;  4QJV A;  4C3I K;  4C2M C;  4X6A C;  4KAW X;  3S1Q C;  4OIQ A;  4A3I C;  1R9T K;  3LPX A;  1PJ7 A;  4LR2 A;  3I4N K;  3M4O C;  1DD5 A;  4C3I C;  3TFJ A;  1I6H C;  3S1R K;  1VH2 A;  1R9T C;  1O26 A;  3HXA A;  1SMY A;  4A3J K;  1EFW A;  1USM A;  4KMH A;  1TWF K;  3RZD K;  3TTG A;  3FKI A;  5IP9 K;  3S1R C;  3HOZ C;  4LQY A;  1ZXO A;  3GTM A;  3RZO K;  2WB1 D;  2A6H A;  3S16 K;  1VJE A;  1ZQ1 C;  5IP7 C;  3RZD C;  1WQG A;  2E2H A;  4OIN A;  4GTD A;  2R93 K;  4AYB D;  3RZO C;  3S16 C;  3PO3 K;  3M3Y K;  2P8T A;  4KM9 A;  1WCM K;  1O27 A;  3PO2 K;  1O2B A;  3GTO A;  2R93 C;  3GEH A;  4LK1 A;  3ERE D;  4MQ9 A;  2JA7 A;  3AD7 C;  2ZFZ A;  3FOE A;  5M3M K;  3QX3 A;  1G51 A;  2GSO A;  4KAR A;  2JA5 K;  1C0A A;  3GSI A;  2YU9 A;  4GTC A;  4GT9 A;  2Y0S D;  4A3K K;  1J6X A;  4OIR A;  1WIH A;  1VLO A;  4BY7 K;  2V6S A;  1GE9 A;  4LK0 A;  1TWH C;  4LLG A;  1XZQ A;  4QIW D;  1BS2 A;  3HOX C;  4A3K C;  1ZYR A;  4BBS K;  4A3C C;  3SZZ A;  3BP8 C;  4BY7 C;  5E68 A;  4KMD A;  3I4M C;  4FZB A;  4XLP A;  4YFX A;  1WOO A;  2E2J K;  1TWF A;  4A3B K;  1B4B A;  3GTK K;  3Q3Q A;  2NVY A;  1JOE A;  3FKI K;  3A8J A;  3GTQ K;  3GTM K;  5M3F K;  3S2H K;  2PPB A;  4YFK A;  4XSX A;  1J98 A;  4A3G K;  2E2J C;  3GTL A;  4BY1 K;  4NOI A;  3GEI A;  4BBR K;  5IYB K;  4WJ3 M;  3T00 A;  3FKI C;  2E2H K;  3S0X A;  3GTM C;  3S2H C;  4A3G C;  4ILD A;  1SFO A;  1WCM A;  5IYB C;  2E2H C;  3AH5 A;  3GTO K;  2XCO A;  4LOW A;  1O2F B;  5IOS A;  3G4C A;  3GTG K;  4KMA A;  4MEY A;  5CJ9 A;  3HOY K;  5C4X K;  2R7Z A;  3GTO C;  3HKZ D;  3GIR A;  3GTG C;  2JA5 A;  5JFE A;  3CAG A;  2JA7 C;  4A3L C;  3SZY A;  3HOY C;  2YU9 K;  2NVT C;  1WOS A;  5JVO A;  1JQW A;  4O2D A;  4BKW A;  3N0B A;  4C45 A;  1B4A A;  1I6V A;  4KB2 A;  3L4J A;  2O5I A;  2D6F C;  2YU9 C;  4XLN A;  1BDF A;  3S2D K;  5IOR A;  3IPJ A;  2PHC B;  3I4N C;  5IOQ A;  1F9N A;  3GTK A;  5IYD K;  4XSZ A;  2NVY K;  3GTQ A;  3N3Y A;  1J6W A;  3AQP A;  4A3J C;  2E2I A;  1O28 A;  1TWC K;  5IYD C;  1WSV A;  1IL2 A;  3GTL K;  1TWF C;  4QJV B;  5IP9 C;  2NVY C;  4KM8 A;  1WOP A;  5FJ8 K;  1YNN A;  2A68 A;  3GTL C;  1SFO K;  4KC6 A;  2WAQ L;  1IE0 A;  4Q4Z A;  1UV7 A;  4GTL A;  1ISE A;  1TWA K;  3ADA C;  3GTG A;  2B63 K;  3PO3 C;  2VUM A;  3M3Y C;  3H3V L;  5EGH A;  1SFO C;  1WCM C;  1F7U A;  3PO2 C;  2RGR A;  3GDZ A;  4WIL A;  4KN4 A;  2R7Z K;  2ZUF A;  3LAJ A;  4FM9 A;  1RU0 A;  1DCH A;  3L4K A;  4GTB A;  1HI9 A;  4PAB A;  2R7Z C;  4GTA A;  4Q5S A;  2GAH C;  5C3E K;  2PMZ L;  4GTE A;  2JA5 C;  1XZP A;  4C3H K;  1HQM A;  2GAG C;  2CFA A;  1DCP A;  1XPP A;  4G7H A;  3BP3 A;  2JA6 K;  1O25 A;  3FOF A;  2JA8 K;  4C3H C;  2V6T A;  2NVX A;  2KWA A;  4BBS C;  4G7O A;  3AD8 C;  5D4D A;  1IW7 A;  2JA8 C;  1TWC A;  2E2I K;  1WOR A;  1WSR A;  3S1M K;  4GFQ A;  4KAS A;  1WQF A;  4A3B C;  3GTK C;  2O5J A;  3GTQ C;  4KB4 A;  2E2I C;  5TMF A;  3S1M C;  3H0G K;  4BY1 C;  4BBR C;  1L0W A;  4KDD A;  1TWA A;  1AB4 A;  2FQT A;  2B63 A;  3OEP A;  4M1X A;  4A93 K;  3ORE A;  2VUM K;  3WOD A;  5C44 K;  4JK1 A;  3DXJ A;  4Y7N K;  4A93 C;  1PJ6 A;  2VUM C;  5C44 C;  1YX2 A;  2FQO A;  5C4X C;  3K7A K;  2NVQ K;  1O24 A;  5EGE A;  4Y7N C;  4A3F K;  4DDQ A;  1ZBS A;  1XXB A;  4P9S A;  3K7A C;  3AQO A;  2XCR B;  2NVQ C;  1TWG A;  1YNJ A;  3T01 A;  3HOW K;  1VRQ C;  2JA6 A;  1BGW A;  1I3Q K;  1EI6 A;  1EK8 A;  3FHZ A;  4XCH A;  4A3F C;  4BXX K;  4A3I K;  3GTJ K;  5IYC K;  3VA7 A;  1Y1V A;  3AD9 C;  1V5V A;  3A8K A;  3HOW C;  1O29 A;  2NVX K;  2PA8 L;  3S2D C;  4A3D K;  4GTF A;  4A3M K;  1I6H K;  1I3Q C;  3JST A;  4BXX C;  4A3E K;  5M5X K;  5M5W K;  3GTJ C;  2WB1 L;  5IYC C;  3S14 K;  1K83 A;  1BJT A;  2NVX C;  4A3D C;  1EQR A;  1JVI A;  4A3M C;  4Y52 K;  1INN A;  4AH6 A;  3OPF A;  4A3E C;  3HOZ K;  4AYB L;  1XXC A;  3S14 C;  4KAT A;  1TWC C;  4OIO A;  3H0G A;  1IBA A;  2CW0 A;  2R92 K;  5IP7 K;  3TFH A;  4Y52 C;  2PA8 D;  4ZH4 A;  1I50 A;  4BLB A;  3BUE A;  3MML B;  4YG2 A;  2JH3 A;  5M5Y K;  2R92 C;  1WQH A;  4P5A A;  2W7V A;  3CQZ A;  5CHP A;  1TWA C;  1J6V A;  3N0C A;  2B63 C;  3TFI A;  3S15 K;  4RMF A;  2Y0S L;  1X31 C;  5TJ3 A;  2WAQ D;  3GTP K;  2V6U A;  4J3N A;  1Y1W A;  1KQ4 A;  2P5M A;  2GSU A;  1F7V A;  3S15 C;  3H3V D;  4QIW L;  3GTP C;  1TWG K;  1I3Q A;  4GZY A;  5C3E C;  3GTJ A;  1IQ0 A;  1ZVU A;  3T02 A;  1TWH K;  1Y1V K;  3S17 K;  5TMC A;  1TWG C;  1O2A A;  3HOX K;  2JA6 C;  4A3C K;  2A69 A;  1YCL A;  4MEX A;  4P5B A;  1R9T A;  3I4M K;  2PMZ D;  1VGX A;  1PJ5 A;  1Y1V C;  1K83 K;  3S17 C;  1EH1 A;  5L46 A;  1F93 A;  4C3J K;  3S1N K;  1DCO A;  1K83 C;  2R92 A;  1XZP B;  1IS1 A;  5C4J K;  1XZQ B;  2CFA B;  4LJZ A;  3EQL A;  2GSN A;  1XXA A;  4G0W A;  2EBB A;  2ZUE A;  1I50 K;  4C3J C;  5FLM K;  4PAA A;  3S1N C;  4KMU A;  2Y3P A;  5HL8 A;  3H0G C;  4G0V A;  5C4J C;  3V4G A;  2A6E A;  4G0U A;  4OIP A;  3HOV K;  4YFN A;  1I50 C;  3CQZ K;  1USO A;  3NUH A;  3HKZ L;  5FLM C;  4G7Z A;  2R93 A;  3GEE A;  3G4A A;  4KN7 A;  2BE5 A;  3HOV C;  3GTP A;  3CQZ C;  3LAP A;  1Y1W K;  3HOU K;  2JA7 K;  4A3L K;  3A8I A;  2NVT K;  1Y1W C;  4C2M K;  5IOT A;  4X6A K;  3HOU C;  3S1Q K; 
#chains in the Genus database with same CATH homology
 1USM A;  1F93 A;  3JST A;  1USO A;  1DCO A;  2V6T A;  4WIL A;  1RU0 A;  4LOW A;  2EBB A;  4C45 A;  3HXA A;  2V6U A;  1DCH A;  2V6S A;  1DCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...