2EBBA

Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
MRLTEEEVQALLEKADGWKLADERWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISIDYKLITVKLSSWRAKGLTKLDFDLAKQYDEVYNQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from Geobacillus kaustophilus HTA426
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
molecule keywords Pterin-4-alpha-carbinolamine dehydratase
total genus 31
structure length 96
sequence length 96
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2ebbA00
1DCHA 3HXAA 1USMA 2V6TA 4WILA 2EBBA 4LOWA 1RU0A 1F93A 1USOA 1DCOA 2V6SA 2V6UA 4C45A 1DCPA 3JSTA
chains in the Genus database with same CATH superfamily
2E2IK 2FQTA 5C4JC 4BLAA 3OPFA 1BGWA 3GTKA 2ZUEA 3S2DK 3HXAA 5HL8A 4OIPA 2P5MA 1IS1A 3FOEA 1WOSA 1Y1VK 2CFAB 4A3LC 4BY7K 2E2HK 1O27A 1TWGK 4Y7NC 5M3MK 1WIHA 3CAGA 1K83K 4KASA 5IOTA 4BY1K 3GTMC 3H0GC 3GTPA 2VUMA 4KMDA 3HOUC 5IP7C 2GAGC 1WQHA 5EGHA 4BXXK 3Q3QA 2CFAA 4Q5SA 1PJ7A 1WQGA 4A3DC 4WJ4A 4A3BC 3FKIK 3GTGC 5IYCC 4BBSK 5FJ8K 4A3EC 2PMZL 1JQWA 3AH5A 4GTEA 4KAWX 1XXAA 2Y0SL 1HI9A 5IYBK 2JA6C 4XLNA 2KWAA 3TFIA 3VA7A 3M3YC 4BY1C 3GTMK 4A3CC 5EGEA 4XSZA 5C3EC 2O5JA 3N0BA 4A3MK 2A68A 2NVQC 1Y1WC 2WAQL 4WJ3M 4A3JK 2ZFZA 1EK8A 2R7ZA 4A3IC 1Y1WA 3JSTA 2VUMC 3S1MK 5IP7K 3ERED 3PO3K 2B63A 3TTGA 1O29A 4J3NA 3LAPA 4A3GC 2E2HA 2NVTC 1TWCK 4GTLA 3GTLC 4QIWD 4M1XA 3S15K 1YCLA 1ZBSA 3M3YK 3AD7C 3A8IA 1J98A 2V6SA 4KB2A 1XXBA 1J6VA 2E2IA 2R93K 3EQLA 2PPBA 3CQZA 3S14C 1R9TK 1XPPA 2NVYK 1F93A 5IYDK 5TMFA 2R7ZC 2WB1D 2XCQA 2WB1L 1IE0A 1F7VA 3GTQA 3AQOA 3GEEA 4G0WA 3S0XA 2ZUFA 2JA5K 4A3FK 2E2JK 3GTQC 1SMYA 2EBBA 3S16K 3H0GK 4A3DK 3AD9C 2JA6A 4C3HK 3L4JA 2Y3PA 3GTJA 5JFEA 3GTKK 1TWCC 3GTLK 4JK1A 2JH3A 5IORA 4A3KK 3GTLA 1WCMK 4QJVB 2GSUA 1DCHA 4PAAA 3BP8C 1XZQB 2NVXC 1X31C 4X6AC 1O2FB 3A8JA 5C44C 3PO2C 4Y52K 1XXCA 3GTQK 1K83C 1TWHC 4A3FC 2E2JC 1O24A 4G0VA 3PO2K 2R7ZK 3N3YA 3MMLB 3T01A 3CQZC 3LPXA 3T02A 4KN7A 1EI6A 1J6WA 3HKZD 1YNJA 5IOSA 1TWHA 4BKWA 4C2MK 2JA8K 2E2IC 1ZYRA 2GSOA 1WCMC 3L4KA 1AB4A 4C3JK 4QIWL 5C4JK 2JA7A 1WCMA 4C3JC 1DCPA 5C3EK 4XCHA 3RZDC 1G51A 4XSXA 5IYBC 2R93C 4A3GK 2CW0A 4WILA 1IQ0A 2A6EA 4AYBD 4FM9A 4P5AA 2YU9K 1BS2A 1SFOC 3GTJC 4KDDA 3I4NC 4NOIA 3GSIA 4LK1A 2JA5A 4YFXA 4A93K 4OIQA 3M4OK 5C44K 5D4DA 4BY7C 1B4AA 5TJ3A 4RMFA 2B63C 2PHCB 5IOQA 1B4BA 2VUMK 1R9TC 1O2BA 3HOWK 1VLOA 1K83A 1J6XA 2Y0SD 2V6TA 3CQZK 1O28A 3HOYK 3S2HK 1SFOA 5M5YK 4C3HC 3GTKC 3A8KA 1Y1VA 2W7VA 3S17C 3S15C 3S2HC 3GTOC 3GIRA 3TFHA 3GTJK 1Y1VC 4A3LK 3FKIA 1WSVA 1WSRA 4BBSC 3SZZA 3V4GA 2B63K 4KMHA 4AH6A 2R92A 4A3JC 1WOPA 2PMZD 5CJ9A 5IYDC 1ZXOA 2NVXA 3T00A 4G7HA 3I4NK 3M4OC 3S1MC 1I3QK 2PA8D 4ILDA 1YNNA 5L46A 4OIOA 2NVQK 4GTCA 1PJ5A 3LAJA 3GTPC 1XZPA 4OIRA 5TMCA 2WAQD 4GFQA 3S2DC 1JOEA 4KC6A 1EH1A 2YU9A 4X6AK 1IBAA 3G4AA 1BDFA 1DCOA 1XZPB 2E2HC 4A3BK 3G4CA 1IL2A 3BP3A 4KARA 1O26A 1TWCA 3S1NK 2A69A 3S14K 2JA7K 1O25A 4YFNA 1Y1WK 4A93C 4FZBA 1F7UA 4YFKA 1TWFK 2D6FC 5E68A 3GTPK 1VGXA 1ISEA 3FOFA 4G7ZA 3HOUK 1C0AA 3HOVK 4OINA 3GTMA 4C3IC 4G7OA 1TWGA 1UV7A 3GEIA 4A3KC 3HOYC 2O5IA 1BJTA 4XLPA 2GAHC 1WOOA 1RU0A 3S16C 4ZH4A 2P8TA 5C4XC 3AQPA 4KN4A 4KM8A 4QJVA 4GZYA 3IPJA 1TWFC 1TWAK 2JA6K 4Y52C 4P5BA 4DDQA 1I50C 1WQFA 1TWHK 1USOA 3RZOC 4KATA 1I3QA 4A3CK 3AD8C 4LQYA 2NVXK 1ZVUA 3K7AK 3FHZA 4KMUA 2V6UA 3HOWC 3OREA 3HOVC 3S1QK 3N0CA 4A3IK 1ZQ1C 2BE5A 3GTGA 4LR2A 4AYBL 2A6HA 1EQRA 1F9NA 4C3IK 3GEHA 2JA8C 2R93A 1I50K 1I50A 4P9SA 3S1RK 1XZQA 2YU9C 3GTOA 1SFOK 1INNA 4GT9A 2FQOA 1EFWA 4G0UA 4C45A 1V5VA 4BBRK 3HOXC 5M3FK 2JA7C 4O2DA 3H0GA 3WODA 2RH6A 3GTGK 3RZDK 1YX2A 4A3EK 4MEXA 4GTFA 4MQ9A 3H3VL 2NVYC 3S1QC 4GTAA 3HOZC 4LK0A 1USMA 4YG2A 2XCRB 4KB4A 1DD5A 5JVOA 3BUEA 1TWFA 2R92C 4BXXC 1VH2A 4LLGA 3OEPA 5FLMK 3S17K 1TWAA 3S1RC 1GE9A 2XCOA 1I6HK 5IP9C 4KMAA 5IYCK 1I6HC 3SZYA 4BBRC 3HOXK 3QX3A 3I4MC 4GTDA 5M5XK 2RGRA 3ADAC 4LJZA 1WORA 3S1NC 4GTBA 1I6VA 4KM9A 3TFJA 3HOZK 1O2AA 1IW7A 1VJEA 5CHPA 3DXJA 4A3MC 1JVIA 1KQ4A 2PA8L 2GSNA 4C2MC 1TWGC 5FLMC 4Y7NK 4MEYA 5IP9K 1VRQC 3K7AC 1PJ6A 1HQMA 5M5WK 2JA5C 3GDZA 3PO3C 3I4MK 2NVYA 5C4XK 3RZOK 2R92K 1R9TA 1I3QC 4Q4ZA 4PABA 3FKIC 3HKZL 4LOWA 4BLBA 3H3VD 1L0WA 2NVTK 3GTOK 1TWAC 3NUHA
chains in the Genus database with same CATH topology
1DCHA 3HXAA 1USMA 2V6TA 4WILA 2EBBA 4LOWA 1RU0A 1F93A 1USOA 1DCOA 2V6SA 2V6UA 4C45A 1DCPA 3JSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCH A;  3HXA A;  1USM A;  2V6T A;  4WIL A;  2EBB A;  4LOW A;  1RU0 A;  1F93 A;  1USO A;  1DCO A;  2V6S A;  2V6U A;  4C45 A;  1DCP A;  3JST A; 
#chains in the Genus database with same CATH topology
 2E2I K;  2FQT A;  5C4J C;  4BLA A;  3OPF A;  1BGW A;  3GTK A;  2ZUE A;  3S2D K;  3HXA A;  5HL8 A;  4OIP A;  2P5M A;  1IS1 A;  3FOE A;  1WOS A;  1Y1V K;  2CFA B;  4A3L C;  4BY7 K;  2E2H K;  1O27 A;  1TWG K;  4Y7N C;  5M3M K;  1WIH A;  3CAG A;  1K83 K;  4KAS A;  5IOT A;  4BY1 K;  3GTM C;  3H0G C;  3GTP A;  2VUM A;  4KMD A;  3HOU C;  5IP7 C;  2GAG C;  1WQH A;  5EGH A;  4BXX K;  3Q3Q A;  2CFA A;  4Q5S A;  1PJ7 A;  1WQG A;  4A3D C;  4WJ4 A;  4A3B C;  3FKI K;  3GTG C;  5IYC C;  4BBS K;  5FJ8 K;  4A3E C;  2PMZ L;  1JQW A;  3AH5 A;  4GTE A;  4KAW X;  1XXA A;  2Y0S L;  1HI9 A;  5IYB K;  2JA6 C;  4XLN A;  2KWA A;  3TFI A;  3VA7 A;  3M3Y C;  4BY1 C;  3GTM K;  4A3C C;  5EGE A;  4XSZ A;  5C3E C;  2O5J A;  3N0B A;  4A3M K;  2A68 A;  2NVQ C;  1Y1W C;  2WAQ L;  4WJ3 M;  4A3J K;  2ZFZ A;  1EK8 A;  2R7Z A;  4A3I C;  1Y1W A;  3JST A;  2VUM C;  3S1M K;  5IP7 K;  3ERE D;  3PO3 K;  2B63 A;  3TTG A;  1O29 A;  4J3N A;  3LAP A;  4A3G C;  2E2H A;  2NVT C;  1TWC K;  4GTL A;  3GTL C;  4QIW D;  4M1X A;  3S15 K;  1YCL A;  1ZBS A;  3M3Y K;  3AD7 C;  3A8I A;  1J98 A;  2V6S A;  4KB2 A;  1XXB A;  1J6V A;  2E2I A;  2R93 K;  3EQL A;  2PPB A;  3CQZ A;  3S14 C;  1R9T K;  1XPP A;  2NVY K;  1F93 A;  5IYD K;  5TMF A;  2R7Z C;  2WB1 D;  2XCQ A;  2WB1 L;  1IE0 A;  1F7V A;  3GTQ A;  3AQO A;  3GEE A;  4G0W A;  3S0X A;  2ZUF A;  2JA5 K;  4A3F K;  2E2J K;  3GTQ C;  1SMY A;  2EBB A;  3S16 K;  3H0G K;  4A3D K;  3AD9 C;  2JA6 A;  4C3H K;  3L4J A;  2Y3P A;  3GTJ A;  5JFE A;  3GTK K;  1TWC C;  3GTL K;  4JK1 A;  2JH3 A;  5IOR A;  4A3K K;  3GTL A;  1WCM K;  4QJV B;  2GSU A;  1DCH A;  4PAA A;  3BP8 C;  1XZQ B;  2NVX C;  1X31 C;  4X6A C;  1O2F B;  3A8J A;  5C44 C;  3PO2 C;  4Y52 K;  1XXC A;  3GTQ K;  1K83 C;  1TWH C;  4A3F C;  2E2J C;  1O24 A;  4G0V A;  3PO2 K;  2R7Z K;  3N3Y A;  3MML B;  3T01 A;  3CQZ C;  3LPX A;  3T02 A;  4KN7 A;  1EI6 A;  1J6W A;  3HKZ D;  1YNJ A;  5IOS A;  1TWH A;  4BKW A;  4C2M K;  2JA8 K;  2E2I C;  1ZYR A;  2GSO A;  1WCM C;  3L4K A;  1AB4 A;  4C3J K;  4QIW L;  5C4J K;  2JA7 A;  1WCM A;  4C3J C;  1DCP A;  5C3E K;  4XCH A;  3RZD C;  1G51 A;  4XSX A;  5IYB C;  2R93 C;  4A3G K;  2CW0 A;  4WIL A;  1IQ0 A;  2A6E A;  4AYB D;  4FM9 A;  4P5A A;  2YU9 K;  1BS2 A;  1SFO C;  3GTJ C;  4KDD A;  3I4N C;  4NOI A;  3GSI A;  4LK1 A;  2JA5 A;  4YFX A;  4A93 K;  4OIQ A;  3M4O K;  5C44 K;  5D4D A;  4BY7 C;  1B4A A;  5TJ3 A;  4RMF A;  2B63 C;  2PHC B;  5IOQ A;  1B4B A;  2VUM K;  1R9T C;  1O2B A;  3HOW K;  1VLO A;  1K83 A;  1J6X A;  2Y0S D;  2V6T A;  3CQZ K;  1O28 A;  3HOY K;  3S2H K;  1SFO A;  5M5Y K;  4C3H C;  3GTK C;  3A8K A;  1Y1V A;  2W7V A;  3S17 C;  3S15 C;  3S2H C;  3GTO C;  3GIR A;  3TFH A;  3GTJ K;  1Y1V C;  4A3L K;  3FKI A;  1WSV A;  1WSR A;  4BBS C;  3SZZ A;  3V4G A;  2B63 K;  4KMH A;  4AH6 A;  2R92 A;  4A3J C;  1WOP A;  2PMZ D;  5CJ9 A;  5IYD C;  1ZXO A;  2NVX A;  3T00 A;  4G7H A;  3I4N K;  3M4O C;  3S1M C;  1I3Q K;  2PA8 D;  4ILD A;  1YNN A;  5L46 A;  4OIO A;  2NVQ K;  4GTC A;  1PJ5 A;  3LAJ A;  3GTP C;  1XZP A;  4OIR A;  5TMC A;  2WAQ D;  4GFQ A;  3S2D C;  1JOE A;  4KC6 A;  1EH1 A;  2YU9 A;  4X6A K;  1IBA A;  3G4A A;  1BDF A;  1DCO A;  1XZP B;  2E2H C;  4A3B K;  3G4C A;  1IL2 A;  3BP3 A;  4KAR A;  1O26 A;  1TWC A;  3S1N K;  2A69 A;  3S14 K;  2JA7 K;  1O25 A;  4YFN A;  1Y1W K;  4A93 C;  4FZB A;  1F7U A;  4YFK A;  1TWF K;  2D6F C;  5E68 A;  3GTP K;  1VGX A;  1ISE A;  3FOF A;  4G7Z A;  3HOU K;  1C0A A;  3HOV K;  4OIN A;  3GTM A;  4C3I C;  4G7O A;  1TWG A;  1UV7 A;  3GEI A;  4A3K C;  3HOY C;  2O5I A;  1BJT A;  4XLP A;  2GAH C;  1WOO A;  1RU0 A;  3S16 C;  4ZH4 A;  2P8T A;  5C4X C;  3AQP A;  4KN4 A;  4KM8 A;  4QJV A;  4GZY A;  3IPJ A;  1TWF C;  1TWA K;  2JA6 K;  4Y52 C;  4P5B A;  4DDQ A;  1I50 C;  1WQF A;  1TWH K;  1USO A;  3RZO C;  4KAT A;  1I3Q A;  4A3C K;  3AD8 C;  4LQY A;  2NVX K;  1ZVU A;  3K7A K;  3FHZ A;  4KMU A;  2V6U A;  3HOW C;  3ORE A;  3HOV C;  3S1Q K;  3N0C A;  4A3I K;  1ZQ1 C;  2BE5 A;  3GTG A;  4LR2 A;  4AYB L;  2A6H A;  1EQR A;  1F9N A;  4C3I K;  3GEH A;  2JA8 C;  2R93 A;  1I50 K;  1I50 A;  4P9S A;  3S1R K;  1XZQ A;  2YU9 C;  3GTO A;  1SFO K;  1INN A;  4GT9 A;  2FQO A;  1EFW A;  4G0U A;  4C45 A;  1V5V A;  4BBR K;  3HOX C;  5M3F K;  2JA7 C;  4O2D A;  3H0G A;  3WOD A;  2RH6 A;  3GTG K;  3RZD K;  1YX2 A;  4A3E K;  4MEX A;  4GTF A;  4MQ9 A;  3H3V L;  2NVY C;  3S1Q C;  4GTA A;  3HOZ C;  4LK0 A;  1USM A;  4YG2 A;  2XCR B;  4KB4 A;  1DD5 A;  5JVO A;  3BUE A;  1TWF A;  2R92 C;  4BXX C;  1VH2 A;  4LLG A;  3OEP A;  5FLM K;  3S17 K;  1TWA A;  3S1R C;  1GE9 A;  2XCO A;  1I6H K;  5IP9 C;  4KMA A;  5IYC K;  1I6H C;  3SZY A;  4BBR C;  3HOX K;  3QX3 A;  3I4M C;  4GTD A;  5M5X K;  2RGR A;  3ADA C;  4LJZ A;  1WOR A;  3S1N C;  4GTB A;  1I6V A;  4KM9 A;  3TFJ A;  3HOZ K;  1O2A A;  1IW7 A;  1VJE A;  5CHP A;  3DXJ A;  4A3M C;  1JVI A;  1KQ4 A;  2PA8 L;  2GSN A;  4C2M C;  1TWG C;  5FLM C;  4Y7N K;  4MEY A;  5IP9 K;  1VRQ C;  3K7A C;  1PJ6 A;  1HQM A;  5M5W K;  2JA5 C;  3GDZ A;  3PO3 C;  3I4M K;  2NVY A;  5C4X K;  3RZO K;  2R92 K;  1R9T A;  1I3Q C;  4Q4Z A;  4PAB A;  3FKI C;  3HKZ L;  4LOW A;  4BLB A;  3H3V D;  1L0W A;  2NVT K;  3GTO K;  1TWA C;  3NUH A; 
#chains in the Genus database with same CATH homology
 1DCH A;  3HXA A;  1USM A;  2V6T A;  4WIL A;  2EBB A;  4LOW A;  1RU0 A;  1F93 A;  1USO A;  1DCO A;  2V6S A;  2V6U A;  4C45 A;  1DCP A;  3JST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...