2EBIA

Arabidopsis gt-1 dna-binding domain with t133d phosphomimetic mutation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPDMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA binding protein GT-1
publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ebiA01
2E2IJ 3JRBA 3BG5A 2R5YB 1F43A 4W97A 3NARA 4BBRJ 4QTRA 4AYBN 1JUSA 3JRFA 1LE8B 3S16J 3S2DJ 2LY9A 3GTOJ 2E2HJ 3HOUJ 3LNQA 2CJJA 1CQTA 2EQRA 9ANTA 2M2EA 5JLWA 1U9OA 2HI3A 3S2HJ 2B63J 3H3VK 1A5JA 1OCTC 5F0CA 4L5EA 1XS9A 4A3DJ 4XICA 1D5YA 2DA2A 1P7JA 5M3MJ 3JRHA 2JMWA 4B4CA 2R0QC 1HLVA 5JLXA 4IHWA 1FIAA 3GTKJ 2ME0A 1FJLA 1AU7A 3GTGJ 5IOYA 3L1PA 4AC0A 4C3IJ 2XGCA 2NVYJ 5DTDA 2QF7A 1JKQC 3BR1A 1JTXA 1B72A 3B6AA 2XPWA 1UHSA 5FKLA 3S1QJ 5FKMA 2EBIA 1ZGWA 1WI3A 1WH7A 3JRDA 2CUFA 1YRNB 4DYRA 1U8BA 5FLMJ 5F27A 3ZOBA 4M3BA 4UUTA 2GM4A 3TP3A 3G1OA 5GPCA 3JR9A 1K61A 1X2MA 2VUMJ 1JT6A 1UMQA 3HEFA 2K9NA 4D7NA 3M4OJ 2LD5A 2JA7J 4B3AA 1PUFB 4GFBA 2L7MP 3FK7A 5J1UA 1WPKA 4D5FA 4MIMA 1I50J 3A03A 3C2BA 4M3EA 3QPSA 2DMPA 2COBA 2L9RA 4S0HB 1IDYA 1AKHA 1JUPA 2JJ7A 2H1KA 4D5CA 3RKQA 1T33A 2HQ5A 2DA5A 5IYDJ 3OIOA 2JN6A 5K7HA 5J1RA 2NVTJ 1RKWA 2Y2ZA 5C4JJ 1U78A 2DMTA 3ZQLA 2OF7A 3F0CA 3Q0WA 2I10A 2XPVA 5C44J 3OOUA 1I3QJ 3HOYJ 1FTZA 2D5VA 1VNDA 1WCMJ 3CQZJ 1RESA 3CMYA 1MSEC 2R5YA 4A3CJ 1Z0XA 5M5WJ 2G0EA 4X6AJ 2IBDA 1MH4A 4X1EA 4I76A 4A3IJ 2LKXA 2N8GA 1LE8A 2M8GX 3BT9A 4JX4A 2AHQA 4FE4A 2DA4A 2EZKA 2WAQN 4XRMA 2K9QA 3QPLA 4M3FA 1TWAJ 2TRTA 1ETYA 3O8HA 5E3MA 3ZQCA 1TWFJ 2HXOA 1JJ8C 1GDTA 2DA3A 1ZR4A 3Q0VA 3NAUA 1JKRC 2ME6A 1QPIA 3JRIA 2Y0SN 2R5ZB 2CQXA 3K2AA 2O8KA 3GTQJ 2EZHA 1Y1WJ 4ABZA 3QQAA 1IDZA 3MKLA 2K9SA 2LLKA 2DN0A 2ID3A 2CRGA 5EGOB 2EZLA 2HDDA 1G2HA 4CYCB 2W48A 1XG1A 2JWTA 4DW6A 4RDUA 2MSYA 2LVSA 4G12A 1VI0A 2CU7A 3HM5A 4W1UA 2DA6A 4UUSB 1YRNA 3GTPJ 3HDDA 2EZIA 5GP9A 2NVXJ 5FKKA 3S1MJ 3BR5A 4BKXA 3CCYA 3S15J 4D7MA 2MW8A 4Y52J 5C4XJ 4M3GA 1TWCJ 3CDLA 1ZR2A 1RETA 2YU9J 4IEJA 1WH5A 4C3JJ 1IRZA 3S1RJ 3ZQIA 5F1JA 4MFEA 1RKTA 4M6VA 4XRSG 1JJ6C 1PUFA 2MGQA 5E3LA 3ZQGA 1HOMA 1LFBA 1IGNA 3BQZA 1HDPA 4MFDA 2VKVA 4FE7A 5F0FA 4AUXA 1FEXA 3FISA 3RZDJ 1F36A 2WV1A 4A3MJ 4BXXJ 4M3DA 1S7EA 3IH4A 3BR6A 2X9DA 1Y1VJ 3A02A 2XSDC 3GTJJ 2YS9A 2KT0A 4A69C 1W0UA 1JKOC 1MH3A 1TWHJ 1U9NA 5E3NA 3IH3A 4A3GJ 5FLVA 4DYCA 4NDLA 5IP6A 3PO3J 2JA8J 5J1YA 2JK3A 3BR2A 3OSFA 4A3BJ 2ZB9A 3VPRA 3HGGA 2HOSA 2DMUA 4JX5A 2NS8A 1GVDA 1K83J 1ETOA 3GTMJ 1RPWA 1A6IA 3I4MJ 4QSHA 3HB9A 3BR3A 2NVQJ 1FTTA 3GTLJ 1HF0A 3PM1A 2E2JJ 3GBGA 1H88C 3DEWA 5EG0A 1B8IB 1QVTA 3B6CA 1HCRA 2LP0A 1LFUP 5F04A 2VI6A 5IYBJ 4A3EJ 2IEKA 2DA1A 4DZPA 5EF6A 3BTIA 2R93J 4MLOA 3SFIA 1FIPA 4LOCA 2VKEA 4J19A 2LFBA 4HNVA 3HBLA 2E1OA 5K7FA 2CUEA 2DMQA 4XRSA 5EYRA 2X6OA 5HODA 2R5ZA 1OFCX 5IPAA 2ECBA 2NOGA 3IV5A 3FK6A 2VPRA 1ZK8A 1GT0C 2Y9ZA 5EGOA 2L7FP 2L7ZA 5BNGA 3ZQFA 1ZTRA 3BTLA 4CYCA 1NTCA 1E3OC 5C3EJ 3M3YJ 2X48A 3O8GA 1IUFA 1Z77A 1ETXA 1JTYA 2CQQA 4UUSA 2FD5A 2DMNA 2JA5J 4FISA 5EZHA 5K7ZA 3BTJA 1BW6A 2H8RA 3IH2A 5IP9J 3TEDA 4XIDA 1HDDC 2HOTA 1JT0A 3A01B 1X2NA 2M34A 4IHXA 1ZKGA 3G1LA 4BBSJ 1T56A 4I6ZA 4FCYA 2DTZA 3Q0UA 3E7LA 2Y9YA 3HGYA 4DZJA 3BTCA 3SDGA 1SFOJ 5IP7J 1ETWA 3LOCA 1X58A 3MN2A 1WGXA 1MNMC 5DS9A 4DYQA 2ID6A 2PMZN 1O4XA 3MVPA 2XB0X 5E3OA 3RQIA 4EEFG 2QCOA 2NS7A 3G1MA 2KDZA 1JUMA 3D1NI 1SANA 5IYCJ 3LSGA 2JA6J 1QRYA 3W6VA 4RBOA 1VF9A 4B1RA 3WHCA 5EDNA 3BQYA 2LK2A 4C2MJ 3Q3SA 2DJNA 5M5YJ 5F08A 2M0CA 4XK4A 4C3HJ 2HYJA 2HXIA 2Y30A 1IV6A 2R7ZJ 1DU6A 3LSPA 2LR8A 3K7AJ 4Y7NJ 1B8IA 2EH3A 3HOXJ 1R9TJ 1ITYA 3TP0A 3BG9A 3ZQHA 4V2GA 1ENHA 3JREA 1W0TA 2FJ1A 3SJMA 4MO7A 2TCTA 4A3JJ 5FJ8J 1Q1VA 4V2FA 3S17J 1UG2A 4JYKA 1JKPC 2GBYA 3JRGA 2L0KA 3FIWA 1BW5A 4BY7J 2XGDA 5IOZA 1APLC 1MSFC 2DA7A 3BG3A 1MBFA 3OSGA 3S1NJ 2IAIA 2P81A 3PO2J 1OJLA 1JGGA 3RZOJ 2RAEA 2O7OA 1POGA 2AO9A 1B72B 3H0GJ 1BL0A 3TW6A 1MBKA 1ETKA 1H8AC 4A3KJ 2R92J 2OPTA 1ZQ3P 3S14J 2K40A 3HOWJ 1NK2P 3I4NJ 1MBHA 1BA5A 2LTPA 1NK3P 2WB1N 2XB5A 3DCFA 1MBGA 3A01A 1H89C 1DU0A 2FQ4A 5FKOA 1ORKA 1P7IA 4JP0A 1AHDP 1GV2A 5EZGA 1TWGJ 3LSRA 2ELKA 4A3FJ 1TC3C 3BR0A 1RR7A 3LSJA 2MG4A 2M9HA 4JX6A 3JRCA 1IC8A 2XGEA 2E19A 3FKIJ 5FKNA 1IG7A 1I6HJ 1AKHB 3WHBA 5F0HA 2XRLA 1BJZA 3UKGA 2GLOA 1VFCA 1ETVA 5GPAA 1OCPA 1GV5A 5M3FJ 2Y31A 4IHVA 3TW7A 3HKZN 1GUUA 2O9LA 5EG0B 4IHYA 4BY1J 5EEAA 1MBJA 4FTHA 2HOAA 5J3LA 3HOVJ 2XPUA 2YUSA 2FX0A 2ECCA 5M5XJ 3HOZJ 1IJWC 4A3LJ 1EF4A 4QIWN 1QVUA 1ETQA 1XC5A 3JRAA 1MBEA 4A93J
chains in the Genus database with same CATH superfamily
1S8NA 1XGSA 2R7WA 2V6EA 1BOAA 1MD0A 1PYVA 4W97A 1IN5A 2ZXIA 4F93B 3KETA 4UV8A 4RA2A 1P92A 1Z21A 2M8EA 1OR7A 5AIPA 5J4VA 3JAMK 4Y13A 3OY9A 3I53A 1LE8B 2A3SA 3S2DJ 1E3HA 1YW8A 4IRHA 4E7HA 2XKOA 1CQTA 4JK1X 2H09A 5ICFA 3TBIA 3H3VK 2MC4A 1A5JA 3S93A 5DYMA 4A3DJ 3DEEA 2VOOA 4BYYA 5LEKA 2D1VA 1OCZH 2QLZA 1SFUA 1YJNI 4WF2A 3WE2A 4IHWA 3J81K 4I99C 1YFHA 2KJCA 4XSXF 1AU7A 3GFLA 1J5YA 5DV5A 3V7RA 2HPMA 4FX0A 2NVYJ 5DTDA 5GADJ 1DUXC 1FOXA 4ZYAA 2EIKH 2V4JC 3ZQ7A 5DCFA 3KP3A 3U1KA 2QEXI 5D5XB 1HA8A 2DT7B 4LJZF 3IWFA 3LSHA 1JGSA 3M8JA 1QQIA 1U5TB 3SYTA 3IKVA 2P7CB 4DYRA 4RLFA 4EM1A 1P2FA 5DEQA 5F27A 2L54A 4E7KA 1RC9A 1VQ9I 2OCEA 3TP3A 1G59A 2E7WA 4U7BA 1VQ6I 2P8TA 2NS0A 4P55A 3HJEA 3HEFA 2K9NA 3EUAA 3O6BB 4BQAA 2VBYA 3M4OJ 3ONQA 2O3FA 4AIDA 1WJCA 2GZWA 1RUNA 4GFBA 4JOMA 2JPBA 1I50J 2V1XA 3ELKA 1OPCA 2OBPA 2E60A 4S0HB 5BPIA 1AKHA 1JUPA 1SD7A 1T33A 2A69F 5FFXA 2DA5A 1QBJA 3OIOA 1YJWI 5J1RA 2LNBA 2OC6A 2RQPA 3JW4A 4IO9F 3GUDA 4L5JA 2BXZA 4WWCA 2NVTJ 2DAOA 1EJ9A 4ZYEA 2ZXHA 1GHCA 1U78A 3KP2A 4CA0A 4IHSA 3EYIA 1VQLI 3TDZC 1W1WE 2DMTA 2Z2SB 3OS2A 2MFZA 3ZQLA 2CUJA 3TOBA 2OF7A 3F0CA 3FX3A 4ZZLA 2I10A 2COMA 3K69A 2VPLA 3HC7A 3HOYJ 2CW8A 3V8KA 4AU7A 2V1DA 4UUVA 2B9SA 2EFNA 2LC2A 1DP7P 4A3CJ 1J09A 5CVJA 2JTVA 3ZXSA 3CCVI 2OU2A 4X6AJ 2IBDA 1ZRFA 3AAFA 4FETA 1KYWA 2PX9A 3KYDB 3CC2I 2Z99A 4P1WA 2HVRA 2VJJA 4BL0B 4AIHA 2J5PA 4XLPF 3I56I 2IGNA 1MMAA 2V79A 2WAQN 2EZKA 3K4JA 4XRMA 2K9QA 1QNTA 2VN2A 1OISA 4S05A 1TWAJ 4KIFA 2DT5A 3ZQCA 1QPMA 4XLCA 1ZR4A 2XAUA 3Q0VA 2FBKA 4Y33A 5E8IA 2ME6A 1UB9A 4EJUA 1Y0UA 1WHUA 4AYBA 2CQXA 3R0AA 2R5ZB 1RZ4A 4M9ZA 2O8KA 1LDKB 3M7GA 3NEUA 1YLFA 3MKLA 2HTJA 3ZMUA 1SFKA 2CUZA 1BI2A 2MLGA 5EGOB 2EV0A 1R5HA 2HQNA 3ERED 2EZLA 3L7WA 1X1AA 3LSIA 1G8XA 5BMZA 3RPQA 3ZMDA 3ML6A 2E1MC 1FYMA 1XG1A 1YIJI 3M8EA 2E1NA 4G12A 2H6CA 3CMMA 2DA6A 1YRNA 2VOPA 3HDDA 3SXYA 1QA6A 2EZIA 1LNWA 4ENJA 2NVXJ 1LVKA 4IOCF 4BKXA 4U0WA 3S15J 5ICGA 5CKTA 1ACIA 3DBRB 3HSEA 3CDLA 2HYGD 3KFWX 1WH5A 2VIXA 4BJ5C 3ZMVA 4AIKA 1P9QC 5CJ9A 2WWYA 4KMFA 1SC7A 1BI1A 2V1NA 3ZQGA 2DK8A 3H5RA 1LFBA 2EFQA 2OUMA 3BQZA 3PUFA 1HDPA 2HZTA 4HW0A 4FE7A 5F0FA 1GXPA 5DDGA 2M1BA 1R49A 2L02A 5KK1A 3WTUC 3BR6A 1LJ9A 1LFPA 2X9DA 3E5UA 4G6DA 3AG2H 1KU7A 1TTYA 3WGIA 1Y1VJ 3A02A 2ZNYA 3FM3A 2IRFG 3GTJJ 2YX4A 3H3ZA 2YS9A 1U9NA 3K4MA 4Q4ZF 4EGYA 4N0BA 4BJ6C 4DYCA 3NWSA 3PO3J 1YIOA 3L2QA 3BR2A 3F6OA 3AG1H 3PQKA 4RAGA 4YG2F 1UELB 5JHUA 1Y0NA 5LBQA 1R1UA 1W5TA 2STWA 2DDBA 3GMEA 1KA8A 3QP5A 4I7HA 5LLQA 1UHMA 4A5NA 3P9IA 2F5FA 5CVIA 5DCMB 1W36D 2O6GE 3I4MJ 3TDUC 4E4HA 1HF0A 3VWBA 2Q2EA 2E2JJ 2X1CA 1B8IB 1YITI 2MD5A 2LP0A 5F04A 1FWZA 1J9IA 3I59B 2DA1A 4DZPA 3OYNA 3RI4A 4MLOA 4LOCA 3KCCA 2FE3A 4HNVA 5CLSA 4R79A 3DU5A 1VQMI 1K79A 2X6OA 2ADUA 2ECBA 3ECHA 2Y69H 3IV5A 1X3UA 2KRHA 3FK6A 1Y56A 1GT0C 2VE8A 3FXJA 3F23A 2Y9ZA 3F9KA 3L9FA 2L7ZA 4BDYA 2W82A 3IRQA 4CYCA 3M3YJ 2X48A 1WJBA 2DYRH 4E7LA 2LDUA 4LD5A 4XMYA 2GOXB 4LGWA 2CYYA 3W2WA 3W2VA 4HV6A 3ULQB 1NHAA 5J8FA 4FISA 4BEHB 1IF1A 3MZYA 3KLNA 3M07A 2NRAC 4L0ZB 1BW6A 1U8RA 2O5RA 4AD9A 3GZ5A 2KDOA 3SZGA 2VQLA 1XTAA 3OYGA 4BXUA 5J40A 1HDDC 1OMIA 2AQEA 3A01B 4B8XA 2ZXWH 2X51A 3WTZA 2M34A 3ABUA 1MJ9A 1ZKGA 1ZLKA 2VT2A 4I6ZA 4FCYA 3FXRA 4BDZA 1SAUA 2V7FA 4IL6C 4NC6A 3BTCA 2QSGX 3QOEA 1A31A 3DQVC 1SFOJ 2FOKA 2PJRA 4UB6C 3LOCA 3AG4H 1X58A 4CGZA 1T08B 1MNMC 3QYEA 1UZCA 2BVLA 4M9SA 1YG2A 3V8JA 4NQWB 3RSNA 2RDPA 1O4XA 3I0TA 3MVPA 5E3OA 4EEFG 3BZCA 5J6XA 4RGSA 2X1DA 3WG9A 5DUKA 5D4RA 5E18F 4YIFA 1QRYA 4FQGA 1TT5B 3SEZA 3WG7H 3DLLF 3W6VA 3J80K 3K6GA 3E1SA 5DM6F 1ZREA 3BPVA 3QYFA 1A04A 2DCEA 2I8DA 2M0CA 3RIRA 2KHMA 1K4TA 5ILUA 5FB2A 1HW1A 2HXIA 2IVMA 3EQLF 3SEQA 1DU6A 3OWTA 2LR8A 4A6EA 4KITB 2UV1A 2IS4A 3HPGA 4MQVA 3T8TA 1J7KA 3HOXJ 4IRIA 2KIQA 4ZYGA 1HW2A 4LMYA 4II3A 1PP8F 3TMOA 5L3EA 1HBXG 2A61A 1NG6A 5FFZA 3CCLI 4MO7A 1ZGJA 1ZG5A 3GYHX 4CYDA 5EEHA 1UG2A 4I0AA 5AONA 5FRMA 2QGUA 4BY7J 1APLC 1YJ9I 3REOA 3BCBA 3BG3A 2VBXA 2XASA 3L2VA 3OIQA 3R4KA 2P81A 1BIBA 1HKTA 4Z6YA 1OJLA 1JGGA 3RZOJ 2RAEA 2W84A 1MMSA 2O7OA 5JVTA 1XPXA 2VODA 2HWVA 3JTGA 2AO9A 4E7JA 1VZ0A 4WK8F 1BL0A 4CCOA 3TW6A 1DPRA 1ETKA 2WV0A 4EM0B 2HKXA 4XRFA 4A3KJ 3LWFA 4E7ZA 1MGTA 1CF7A 3BROA 3ECOA 1MBHA 3E5XA 4D1QA 1BA5A 5JFRA 5K5OA 1S72I 2LTPA 3CJTB 3R61A 1XCVA 3ASOH 3DFGA 2FQ4A 1P7IA 4L9NA 1USTA 2ELKA 2LSOA 3AL0C 2WY8Q 4FASD 2DQLA 1O7LA 2KIUA 2XF7A 2DJIA 3DKXA 2JPCA 1OCCH 1OKRA 1XMXA 3CCJI 3MEXA 2P5VA 2DU9A 2E19A 1IG7A 1YTYA 4HF1A 3EETA 1I6HJ 3A0HC 1AKHB 5F0HA 2XRLA 4B44A 5CQGA 1BJZA 3E5QA 3MKZA 1VQ4I 3FMQA 1VFCA 1BI3A 5M3FJ 4L18B 2W25A 3OR2C 1YX3A 1WJEA 2OAZA 3E97A 3HKZN 3TW7A 4RB2C 4EJOA 4EMSA 3NQOA 2O9LA 4CCMA 4IHYA 4XLEA 4XKCA 1LPQA 4L0YB 1XSXA 2XPUA 1R22A 5LGUA 2BV6A 5HNFA 5J4YA 4L9VA 1IJWC 1KQ9A 2NXNB 4QIWN 2STTA 1QVUA 1ETQA 2QM3A 3JRAA 2PMZA 2AS5F 2MH9A 3FXMA 4BHBA 1MW7A 4C9YA 3DV8A 2E2IJ 1XCBA 1TQIA 2M7AA 1F43A 2QENA 5TRDA 2ISZA 2HFHA 3PIPF 3RKWA 2PBIA 4F52A 4KIBA 3WTVC 2EWNA 3ESWB 4NUBA 2E1CA 4AYBN 3JRFA 3DKYA 2DT6A 2BY3A 4M74A 3PJRA 2DLLA 3FBNB 2EQRA 2WAFA 3V7SA 3S2HJ 2PMHA 3IHUA 2PQ8A 2Z33A 2DOFA 1MDMA 1F4KA 5IY5H 4L5EA 1I1GA 1XS9A 1O7FA 1OCTC 2R7UA 2HQRA 4UNOA 1HLVA 2UWMA 1YW9A 1FIAA 3ZGKA 2K9MA 3LA2A 2K9LA 4M9XA 5L3FA 2QZ8A 3W3CA 3MWMA 1XN7A 5IOYA 2V6CA 4AVZA 1I27A 3FKJA 4AC0A 1U2WA 2XGCA 2B7EA 1JKQC 1BOBA 3G3ZA 1JTXA 1B72A 5HLIA 5HDKA 4HV5A 1IXSB 1K7AA 2XPWA 1IRXA 5FKLA 5LGTA 1TQMA 1CGPA 2IGMA 1ZGWA 2KFDA 3K10A 3HOTA 1BJAA 2CUFA 3CJNA 4OWRB 1YRNB 1T38A 1NH3A 4Y3OA 3C2HA 5LD2C 2R7OA 1YE9A 1Z91A 4I2OA 2MD0A 2XSJC 4M73A 2O8XA 3G1OA 4E6KG 1BBYA 2R7VA 1PDNC 5B1BH 5B1AH 3VYTB 1BC8C 1JI8A 1WRJA 2HR3A 3BLYA 4B3AA 4HLYA 1D1BA 4PUSA 5J1UA 2G7HA 3JAMZ 4MIMA 2MH2A 1X1CA 3G6EI 2DMPA 2JJ7A 4P5OA 2EIMH 2JN6A 3HL2A 5IT3A 3M1EA 1FLIA 1W5CC 4I98B 3H3UA 3HRUA 4CZCA 3ROUA 3U2RA 3J81Z 4L5IA 1HC8A 2R7DA 4KISA 1SEUA 2NNYA 2ZKZA 4C2UA 3BDDA 3Q9SA 1Z7LA 4AM3A 2L3DA 3OOUA 2VB6A 2ACJA 3ABTA 5E1WA 2JA2A 1M1EB 3WGGA 5K1YA 2RGVA 4QLCU 1VNDA 1WCMJ 2LG4A 1RESA 2P0WA 1MSEC 2R5YA 4GDFA 2DFFA 3GWZA 4FT8A 4IJAA 3GFMA 5HDGA 3VFZA 2RKHA 5FGMA 3VYRB 3TO7A 4F7ZA 4R8HA 3CCUI 4ESJA 2R7TA 1SVMA 4F3QA 3BJAA 3DKWA 1SVLA 2G9WA 3A4CA 3QU6A 5LEJA 5HOOA 4KNYA 2M8GX 2Q2EB 1H0MA 3BT9A 4XBFA 2MLKA 4JX4A 2AHQA 4FE4A 5DD4A 4YIIA 3KLOA 1G3YA 4B47A 3J7YJ 4GRIA 2VQHA 3QPLA 4CCKA 1LEBA 5E3MA 1R1TA 2Y0SA 5F64A 1JHHA 1FMWA 2KPMA 5GAHJ 1JJ8C 1IUYA 1B4AA 2IS6A 3EYYA 3NAUA 2KP6A 2GOMA 1QPIA 4G7OF 1FPQA 2LKPA 1Y1WJ 3O2PE 3QQAA 1IDZA 2LLKA 3FXOA 2CRGA 2WADA 2BY1A 2IA0A 2RN7A 3J7ZI 2YU3A 4Y15A 1XB4A 4CYCB 2K85A 1W7PA 3HSFA 4EJTA 2LREA 2JWTA 4DW6A 5ICCA 2E34A 3R60A 4YEJA 4HDVA 4W1UA 3HM5A 4U87A 3V7CA 2VBZA 2R7FA 4HRIA 1D1CA 2DODA 1W7PD 2DDAA 4EVIA 1MIJA 2LH9A 3K4BA 3B02A 3DBLB 4D7MA 3CP8A 3KE2A 1R7JA 3MMYB 2A6HF 3MCZA 1R71A 4IEJA 4IKFA 4UV9A 1USSA 3ZQIA 3ZN0A 3TGNA 4PSWA 4XRSG 1DQUA 3VODA 1FX7A 5E3LA 3CESA 1WSUA 1YYVA 3CJQB 1IGNA 5L3BA 1BIAA 4XLAA 1BR2A 2Z3YA 4HF0A 4OIOF 2BHZA 2FMYA 2PJRB 4M3DA 3I54A 2M87A 4HPQA 2A68F 2GWRA 2JT1A 3OYIA 3FBIB 4EM2A 3K70C 2EINH 3F8BA 2XSDC 1XGMA 5E3NA 3CJRB 4A0XA 4A3GJ 1S3JA 2JZYA 2QSFX 1XGNA 2R3SA 1I39A 2JA8J 5J1YA 5IT9K 4P9FA 2JK3A 4P9UA 3OSFA 3QRFF 2ZB9A 4UY8I 1IAWA 2X6YA 2XHKA 1GVJA 2IA2A 2CFXA 2NS8A 5HS9A 2CMPA 3SDBA 1BI0A 3RYRA 3IL2A 1F9NA 3LA3A 5KCMA 4HSRA 1A6IA 4UVAA 3MZHA 3BR3A 1YQAA 2EFPA 2WA0A 2X85A 3GTLJ 2AXLA 3EUHC 4ENNA 2QQ8A 1ZH5A 3DEWA 4RB3C 1UG0A 3ZMSA 1QVTA 4X0GA 2ZXJA 3B6CA 2CS3A 4ZYHA 3RJPA 3CF2A 2PLYA 5HVQC 2IEKA 4GYGA 2XF5A 2ELHA 2L9NA 1TNSA 2E1OA 4U0YA 1O3QA 4XRSA 5EYRA 1T6SA 2XV4S 2NOGA 3QOPA 1T95A 3DF8A 4UVCA 1OQYA 3W2AA 2L7FP 3ZQFA 4EJVA 1Z7UA 1O57A 1Z6RA 4IHTA 2ZFWA 3LMMA 1HSJA 2VE9A 3O8GA 3AG3H 3H36A 3PIOF 4HDUA 3HTSB 2L9SA 2FD5A 4UUSA 2FNPA 1Z9CA 1FSEA 1Z1DA 3LAPA 1ZRDA 4AVPA 2M3AA 4CCJA 3D5SC 1CF7B 2BW3A 3HTUA 2PMUA 2WBMA 2BVMA 2P6SA 4XIDA 2GQQA 2XUBA 5ILSA 5A2QK 2L4MA 1VQPI 1HKQA 1X2NA 4BNCA 3SQNA 2GAUA 4YFNF 3G1LA 4F55A 4BBSJ 2VQCA 4HLXA 2Y9YA 3HGYA 2FBIA 4RAFA 2F2EA 3SDGA 2CFOA 1SD4A 1BN5A 3H9QA 3L2CA 4XLNF 5IP7J 2XRNA 2XF6A 1WJAA 2ID6A 2PEXA 5GAGJ 4A12A 2P7VB 2PMZN 2VBWA 3F8NA 5HDNA 2M30A 5BOXA 4ASNA 2BBYA 1A35A 3RQIA 3ASNH 3QWLA 3WU2C 3G1MA 2QKMB 3PUBA 4ZZDA 2KQRA 4QPQA 4ESBA 3QPHA 5IYCJ 1QU3A 3PSFA 2JA6J 4KUMA 5DM7F 2M4GA 3F22A 4B1RA 3OL4A 3WHCA 3T1BA 4E70A 1IRFA 5EDNA 3OYBA 2L7KA 1LB2A 2EK5A 3Q3SA 5F08A 1IV8A 5JI6A 4XLHA 5EJCA 4C3HJ 3CO6C 1IV6A 2R7ZJ 2KIFA 2E1MB 1J0RA 3BPXA 4QWQA 1ZAOA 3OYJA 1FNNA 3LFUA 1J59A 1RIOH 3WE3A 3BG9A 3ZQHA 2B0LA 6PAXA 1AA7A 5CVVA 3H9GA 4Z2YA 3DPTA 4H0EA 1W0TA 2TCTA 2HYFA 3S2WA 1Q1VA 5E17F 3K1NA 5J47A 2FOWA 4PFPA 4Q48A 1JKPC 5FD6A 1EKEA 3MAJA 3VDXA 2GBYA 3TO9A 3JRGA 4E7IA 1MDMB 2L0KA 3BZKA 2VJ5A 1T2KA 1BW5A 3H92A 4LG0B 2XGDA 1X1BA 4HA8A 2X1EA 1MBFA 3CLOA 5ICEA 2G7UA 4OAYA 4HG2A 1XDSA 3FDYA 1S7AA 2IAIA 3Q5FA 3PO2J 5HS8A 3PQJA 3K1PA 4CCNA 2FRHA 2OZ6A 2YR2A 1I3AA 1B72B 5L3DA 1I6XA 5GTHC 3KP5A 1EH6A 1IZ1A 4LLGF 1MBKA 2OPTA 3S14J 2ZO4A 4M72A 2K40A 1NK2P 1KQ8A 2Y48A 2Q1ZB 2X6XA 2KZVA 3GF2A 3JTHA 3I4NJ 3G73A 2VKHA 3J80Z 5H6QA 2XROA 3HRSA 1IN7A 3RQ4A 1MBGA 1TL8A 1H89C 5FKOA 4KICA 1ZELA 4JP0A 1AHDP 5EZGA 3LSRA 5TISC 4XQFA 3J7AY 2CV1A 3OMYA 1U3EM 5BQTA 4DBRA 3W6JB 3EUKL 1RR7A 4HQMA 3CZ6A 1MKMA 4J01A 3LSJA 4G7ZF 1O3TA 3G2BA 2P5KA 2XAJA 2Q8KA 5FKNA 3OYCA 2BGCA 4G6QA 2D2WA 2YX7A 3BY6A 4F92B 3KZYA 4XL9A 3CO7C 1UHWA 3LFKA 3H9JA 3TKYA 2Y31A 1ODDA 4RB0A 2VT3A 5EG0B 3DLAA 3CTAA 4BY1J 1FBSA 1MBJA 1EH8A 4ZDLA 4PJNA 3HOVJ 3HHHA 1B59A 3AKZA 3I3LA 2ECCA 4A3LJ 2PN6A 2RVCA 4NB5A 3FZVA 2QA4I 1MBEA 4XR6A 3S8PA 1G6NA 5TGTA 4IOAF 1PVEA 3QAHA 4ZJZA 1MMDA 3BG5A 4PGGA 5JR3A 3JRBA 3M1CA 2R5YB 1K78B 3ABKH 4II2A 2VL8A 2QUFA 1ULYA 4BBRJ 2E5NA 4IZZA 4QTRA 3H5AA 1LEAA 2R7XA 3DXJF 3K9TA 2Z5UA 4YFXF 1ZARA 1AWCA 3S16J 2LY9A 3GTOJ 3DPUA 4CH7A 4N9HA 2E2HJ 1ZYRF 2CJJA 4HNUA 2GIVA 9ANTA 5JLWA 2IGKA 1Y39A 1U9OA 2ZMEC 5LFAA 2B63J 5H2FC 1IN6A 1I5ZA 2KIMA 2WC2A 1D5YA 3EDPA 2DA2A 2H1LA 5ERIA 3JSOA 4XN0A 2Y75A 1TZLA 5JLXA 3HXLA 5ILVA 3GTKJ 1K4SA 1FJLA 1E3PA 3KX2A 3ZMZA 2R7RA 4PCQA 3L1PA 2JUCA 3IC7A 4XKVA 3BR1A 4ITVA 4MHGA 3U21A 4ESFA 4PK4A 3B6AA 3E6DA 1UHSA 1W7PB 3S1QJ 2LRDA 1E17A 2CWEA 5FKMA 2EBIA 1RUOA 3QODA 1FYKA 1WI3A 3K4KA 1WH7A 3JRDA 3FXKA 3PSIA 4OIRF 2IGOA 2XKPA 3OYAA 1IXRC 3L2UA 3K70D 2H8WA 1WFXA 2LF8A 4UUTA 2K3FA 2J5OA 2GM4A 4M6XA 4OINF 5GPCA 1XSVA 1X2MA 2VUMJ 2Q0OA 1UMQA 1Z05A 4IQJA 1MJAA 1TP4A 2XGXA 4YIRX 4D7NA 2LD5A 2JA7J 5DD8A 2L7MP 3FK7A 1AOYA 5FRNA 4DJAA 2ZJ2A 1OCRH 3FF5A 1LDJA 3AFHA 2HS5A 3A03A 1OLTA 3C2BA 4M3EA 4CCLA 3EUHA 2COBA 1SMYF 1EV7A 2WB1A 4D5CA 3RKQA 2HQ5A 3L2RA 5IYDJ 3GW2A 2IPQX 2ISYA 2L5QA 3KYLA 3DBHB 2KLOA 4BS9A 1RKWA 2Y2ZA 5C4JJ 5AIQA 3ZQQA 1XGOA 3I4PA 1E2XA 3DEUA 2FMLA 2K27A 2BHYA 3BOQA 3K4NA 2MA3A 3IAS2 1E0EA 3PFYA 2EV5A 2XPVA 1WZ2A 3OS1A 4XOPA 4DGWB 1FTZA 2XAQA 1X4OA 3L09A 4U0VA 4UB8C 4ANJA 2DYSH 3CQZJ 1R1VA 1Z0XA 5M5WJ 4M71A 3P9CA 3V4GA 3KEYA 1DGRM 1V55H 1MH4A 4ENMA 5D8KB 1TNTA 5H6RA 3N97A 4MEYF 1D0YA 4A3IJ 5K5QA 2LKXA 3OYEA 1B1BA 1N78A 2N8GA 2A07F 1V5GA 1DP3A 2DTRA 3Q9VA 4BQQA 2DA4A 2ZNZA 1GLNA 2NOJB 1ETYA 2W1OA 3S3MA 5CVUA 2W85A 1GDTA 3LSKA 3AL0B 4O5VA 3RPUA 1WJFA 2IW5A 3GCMA 3IP4B 3I71A 4LIUA 3JRIA 2R7QA 3K2AA 5JHFA 1N75A 3GFIA 2ID3A 3L00A 2FBHA 3RPUD 1HXDA 2HDDA 2W48A 2HVSA 3HHGA 3GX4X 4HBLA 4S04A 2OD5A 2K4BA 2MSYA 2LVSA 3F8FA 1P6RA 2CU7A 4BUPA 4UUSB 3OYFA 3GTPJ 1R5ID 3H5NA 3U9GA 1SFEA 3ABMH 2AQFA 5FKKA 4LB6B 4LG0A 2EA4A 2UZKA 2RREA 4IF4A 2ESNA 2MW8A 5LHGA 3G71I 3V8LA 5KVRA 2BW3B 2ZC2A 4Y52J 5C4XJ 2FUG2 1NG7A 3DP7A 3DTEA 4BAYA 4C30A 4MFEA 1S7OA 1RKTA 2OJED 1D8JA 4V19K 1A6QA 4BE2A 1PUFA 4BE1A 1HOMA 4O6JA 1FBUA 1WJ5A 3QPTA 1JXSA 1B9NA 4KN7X 3H35A 1D3YA 2GXAA 4A0ZA 4R1HA 1FEXA 1LVAA 3RZDJ 1Z6TA 1H9GA 2GXGA 2O0YA 3KIOA 3A2KA 1F36A 2DW4A 2VJIA 2WV1A 2Z1DA 3X2QH 1S7EA 4CZZA 2V9KA 1PP7U 4FHTA 1ONVA 2F4MB 4BJTA 5BS6A 3KYCB 3SHFA 2KT0A 2EV6A 4A69C 3FMSA 3OIPA 5HLGA 3R0JA 1RNLA 5HS7A 5CPRB 3F8CA 3CP2A 3LL7A 4O3MA 4A3BJ 1A36A 2BYVE 2HOSA 2ZJRF 2DMUA 4JX5A 3K1MA 2ZSHB 4IVNA 3RKXA 2V26A 1MJBA 1LKXA 1GVDA 2ESHA 1K83J 2JVGA 1ETOA 2Y0MA 3I5UA 3GTMJ 3GEZA 4MTEA 3HB9A 2HU9A 1FTTA 3GO5A 3B73A 3ZN1A 3GBGA 2FA5A 5DUIA 5EG0A 3VSKA 4DQ2A 1HCRA 3CUOA 1LFUP 2VI6A 2ZFUA 1W5SA 1P4WA 5IYBJ 4A3EJ 3IUOA 4HOBA 3CDHA 5EF6A 3BTIA 2DK5A 3SFIA 2Z16A 4OIQF 3CMAI 1KGSA 2VKEA 3COAC 4J19A 3T8RA 2EILH 2QQBA 3MKWB 2EJRA 3BCAA 3L2WA 1Y8QB 3HBLA 4HZFA 4HX8A 4DBQA 1U0JA 2L2OA 2BE5F 4Q5SF 2DMQA 5HODA 3BC8A 3NWTA 2CSOA 1K78A 1Z3YA 1IN4A 1IW7F 4ENKA 1WJDA 2DFEA 1ZK8A 2IT0A 5GTIC 4HX7A 4KJZA 3I58A 2ZJPF 2LY2A 1HSTA 3WU0A 3D5LA 1YS7A 5BNGA 4HEA2 1ZTRA 1TW3A 1R5GA 4KDPA 4XOTA 1S5LC 4L9TA 4HYEA 2XC7A 1ETXA 1JTYA 2PJPA 4IX7A 1Y8RB 4GXOA 1L0OC 2CQQA 2NVUB 2HQAA 2DMNA 3WODF 1FOWA 3RTRA 3VEPA 4YRVA 5IT9Z 2LF7A 2FXAA 5EZHA 5B3SH 5K7ZA 3BTJA 2XIGA 1XMAA 4JBAA 3ZMTA 5IP9J 2CV0A 3TEDA 3PNYA 1TQPA 2WY7Q 4MEXF 3WTWC 2QYOA 1T8IA 2PG4A 3DPLC 4PJLA 4IHXA 3HUGA 1T56A 3Q0UA 1BR4A 4D9JA 4DZJA 5HLHA 2H6BA 2FNAA 5D5WB 1ETWA 3OOPA 1K6YA 3CCRI 4OIPF 1IRGA 3MN2A 1R23A 1WGXA 2OTLI 1G3WA 4DYQA 3RCOA 1ZN2A 1MNDA 1U5TC 2HKOA 2ZMEA 2CQ7A 3K2ZA 1VTNC 1QZEA 2QCOA 3GZNB 2EIJH 3GXOA 2O03A 3D1NI 1JUMA 2C6YA 1SD5A 3HIFA 5FD5A 1D0ZA 4OU0A 2F5VA 1V5EA 2HEOA 2F6CA 3FHNA 3LSGA 4LB5A 2M45A 4BQOA 1G3TA 3GLXA 1VF9A 4XKBA 1IXCA 4B09A 1LDDA 3BG6A 4I02A 3CCEI 4C2MJ 1G3SA 2OCCH 2VC1A 5FLXK 2K5CA 4XK4A 2QSHX 1BM9A 1KYZA 2Y30A 3DU6A 3LSPA 4Y7NJ 2OQGA 1O3RA 3LAJA 3KEOA 2EH3A 2H27A 5D8LB 5JVGF 3OYKA 1R9TJ 2NAZA 3E6MA 2AXTC 2JVHA 2KRFA 2RNGA 1ENHA 2JUGA 3KP6A 2LBFA 5A2QZ 2FJ1A 4PJJA 5KAFC 3JREA 3SJMA 5J8CA 3KP4A 3P9KA 2JSPA 1FP2A 2RQQA 2GXBA 3IRRA 1YHQI 3FXUA 3S17J 4LFUA 4IPAA 1ERDA 2W57A 4JYKA 3MD2A 3GZ6A 2A5WA 2HTSA 2JSCA 1MSFC 3S3NA 4DOZA 1K6OA 1T98A 3ZPLA 3S1NJ 1F5TA 1P4XA 1R00A 1UJ8A 2K7LA 3N05A 5TJJA 1O3SA 2EB7A 2RC4A 1QZZA 3H0GJ 3PNTA 3QP6A 4RM2A 3KZIC 3W6KB 4BH9A 1UAAA 2A5YB 1X3WB 1Z3XA 1ZQ3P 3HOWJ 3E3VA 2IP2A 3RDIA 2P5LC 4NC7A 4MGRA 2WB1N 1LUJB 2MC3A 3F72A 3I64A 3DCFA 2LMDA 4Y4RA 2F5EA 4I01A 4CICA 2UXXA 1DU0A 2HDCA 3IKTA 1TWGJ 2M0MA 4I09A 1TLHB 4KT6A 2Z9OA 4A3FJ 4AWXB 4ETSA 4CHUA 4YELA 3C1DA 1TC3C 2KKOA 4G6TB 3BR0A 4XN3A 1D0XA 1WI9A 2A05A 5D6EA 4CUGA 4LLLA 2HZDA 3HZJA 1V54H 5GAEJ 3S3OA 5LHHA 1VQ5I 4BGDA 2KL4A 3JRCA 1EH7A 2E7XA 2OA4A 3WHBA 3IWZA 2QVOA 3HKZA 1QHGA 3A0BC 4BE0A 1ETVA 5GPAA 3BP8A 1KQ0A 3KZZA 3NRVA 2M7BA 3UNGC 3LSTA 2H94A 4NNJA 2IXSA 3N4MA 1D8KA 2OQRA 5H20A 1GXQA 4FTHA 2VJ4A 1YI2I 2HOAA 3LQRA 3D5RC 2DFIA 2YUSA 2ZJQF 4LK1F 5CYVA 1EF4A 3QYBA 5LRRA 1XC5A 3KP7A 4A93J 2VLAA 1FY7A 1SMTA 1Z67A 2XAGA 2ELJA 4EQQA 1QGPA 2LKSA 3QU3A 5LGNA 1OYWA 3E6BA 2D1HA 3NARA 3OYHA 3JCUC 4NHJA 1JUSA 2CW7A 4BACA 1I1SA 3HOUJ 5HNHA 1YW7A 4N4OB 3LNQA 2M2EA 3K0LA 3HPHA 1W4MA 2HI3A 1S29A 2K02A 3DTKA 4Y17A 1BR1A 3MQ0A 5F0CA 4XICA 2R0QC 1P7JA 5M3MJ 3JRHA 2JMWA 4B4CA 4RM3A 2ZCWA 3CD6I 2ME0A 2V9VA 2DPDA 2BY2A 3GTGJ 1JHFA 2W24A 2E5ZA 3RKYA 4C3IJ 1VQ8I 3C18A 2QF7A 4DNCA 3WTTC 2VXDA 4EATA 4EV0A 1MMGA 2KRCA 4GCVA 3OS0A 2E35A 1OYYA 2W4SA 1X4PA 4HF2A 5HLTA 1V4RA 2VKDA 3ISPA 2X4HA 4N9IA 1U8BA 5FLMJ 2IS1A 3ZOBA 1T39A 4M3BA 1R6RA 2L9VA 2OTJI 2OV7A 3CUQC 4B48A 1RI7A 2F48A 3JR9A 1YOVB 1K61A 4RGUA 4GYIA 1JT6A 4WX9A 5D6FA 1JE8A 2DXIA 4AIJA 5LHIA 1PUFB 2RV8A 1YO5C 1WPKA 4D5FA 4M6YA 3I9V2 2E71A 3WGHA 4UVBA 3QPSA 3MZ8A 4A0YA 5KNLA 2O61A 1FSHA 2PFBA 2L9RA 2X0LA 1IDYA 4LIVA 2H1KA 3WTYC 1TW2A 2GIZA 2QBYB 2K3PA 3LQQA 2VONA 4XM3A 1WKMA 4OMZA 4EGZA 3CLQA 5K7HA 4L9JA 2RNJA 3BWGA 4U88A 2E36A 3PL8A 1RRJA 4RLQA 2QKLB 4IRGA 3CCQI 4GGGA 4PJMA 1T0FC 2DOEA 1SFXA 3M9AA 4HSTA 2ICWG 3FXQA 2P4WA 3ABLH 3Q0WA 4RMNA 3SFZA 4B3XA 5C44J 1IN8A 1I3QJ 1KU9A 1SD6A 1U6GA 1XDUA 3CUQB 4FX4A 2D5VA 4HNTA 3CMYA 3F3XA 2BOLA 3E0JB 2W00A 2G0EA 2UXNA 4X1EA 2HGCA 2GA2A 4I76A 3VYUB 1LE8A 2MABA 1FMVA 1VQKI 1R36A 1QZYA 3H1CA 4BHCA 1FP1D 5E1XA 2MYSA 3PNVA 4CSWA 4M3FA 4PDKA 1OYIA 2TRTA 3O8HA 4EJWA 4KMUX 1TWFJ 2HXOA 2HNHA 2QWWA 2DA3A 2GA1A 1V5FA 4CDGA 1Y6IA 2QQAA 4OOIA 1JKRC 2D45A 1REPC 4LITA 4XKWA 3GTQJ 2Y0SN 1R58A 2IA1A 2EZHA 3HSRA 4OAZA 4ABZA 4OMYA 3VSLA 2K9SA 3LA7A 3HG9A 2DN0A 2X6WA 2EFOA 2FSWA 1BC7C 4A5MA 1G2HA 4KT5C 4XONA 4U7DA 2CV2A 4RDUA 3CMEI 1U5TA 1VI0A 1S9HA 2NNNA 1PJRA 3GFJA 2FQ3A 3BJ6A 1OR7C 2OZUA 5GP9A 3LSMA 1FYLA 3BR5A 3S1MJ 1KONA 3F8MA 1STZA 2ETHA 3CCYA 4J00A 4WXCA 3V42A 4M3GA 1TWCJ 1ZR2A 1RETA 4RAZA 2YU9J 4KA4A 1FZPB 4C3JJ 3VYSB 1IRZA 1V3FA 3S1RJ 5F1JA 4M6VA 1JJ6C 3J7AO 2HDWA 2MGQA 1ZLJA 2VQGA 2VASA 4LK0F 5D5UB 3CF5F 4XNFA 1XMKA 3I55I 1ZG3A 2LY1A 3HUGB 4MFDA 3CCSI 5FROA 2VKVA 3VB2A 1ZRCA 2WAEA 4AUXA 2VXZA 3FISA 1J2XA 5K5RA 4G7HF 4A3MJ 4BXXJ 3IH4A 2YSRA 4IXAA 5BPDA 2XAFA 2ZSIB 2V9PA 4A2UA 1N77A 3FHZA 2BXYA 2ZMEB 1D5VA 1W0UA 4IQ4A 1JKOC 1MH3A 1TWHJ 1X1DA 3IH3A 3ZR8X 2F4IA 5FLVA 4NDLA 5IP6A 4MNUA 2CO5A 3F21A 3CC7I 4YFKF 1XSDA 3VPRA 3HGGA 2KMUA 5FO5A 1ZGAA 3A1YA 3M8FA 2I5UA 4PGHA 3BZ6A 4PZJA 2IS2A 2CQKA 4DIQA 1RPWA 3TOAA 4MTDA 1H9TA 2YPRA 4QSHA 5ED4A 2NVQJ 2BY0A 2CW0F 3PM1A 4WCGA 1H88C 1X1PA 1DDNA 4KFCA 2F5DA 1C0WA 2V1UA 1LQ1A 4TV7A 4ZC3A 3ERMA 2R93J 4UHTA 2DFHA 1FIPA 4N4NB 2LBFB 1EA3A 2LFBA 1WVRA 2K4JA 3K4LA 1DPUA 2WTEA 2M5WA 5D4SA 5K7FA 4WXHA 1Q1HA 2CUEA 3H0DA 2R5ZA 1OFCX 5IPAA 2CG4A 1L3LA 2VPRA 3SZTA 1FOYA 3ZRGA 5EGOA 2EFWA 2CH0A 1HW5A 1B6AA 1SAXA 2NYXA 4G94A 3BTLA 4HX4A 2F5CA 1NTCA 3K4CA 2WAQA 2HVQA 1IO2A 3O3KA 5C3EJ 1E3OC 4QPOA 1N25A 1IUFA 3FM5A 3PFIA 1Z77A 3P5JA 3KEQA 3SZPA 1WWXA 4RAYA 1MNEA 4PSXA 2DO7A 2XAHA 3BJOA 3WTSC 2JA5J 2DBBA 2M4KA 3CC4I 3G4SI 4BQNA 4ZH4F 2HPIA 2H8RA 2PI0A 1ON2A 3IH2A 3T0YA 5E20A 4F91B 4RGRA 2HOTA 1F1ZA 2TDXA 3WTXC 1JT0A 4A6DA 2W7NA 2VC0A 3KPHA 3RYPA 4C2TA 5KHDA 2LYCA 1WQ2A 1D1AA 2JQ7A 2DTZA 4HAMA 3E7LA 4P96A 4JQFA 3TQNA 3DTIA 3IAM2 2FEZA 3GVAA 3C3WA 4XSZF 1VQ7I 5DS9A 1QO0D 2F4OB 4NC8A 2A6TA 1J75A 3OYLA 2FF4A 4UXNA 1DGWY 2UUZA 4RGXA 4ZDOA 3S32A 2XB0X 3TL4X 2JRMA 4ZDPA 4I0BA 1P4AA 1FT9A 2NS7A 3HRTA 2KDZA 2KJBA 1SANA 3FMRA 2EPFA 1HKSA 3EPZA 3ZP5A 3FXLA 3MKYB 4RBOA 1VQOI 5L3CA 3OYDA 1ZHFA 5DCMA 3BQYA 2A6EF 2LK2A 2QBYA 1YX5A 2DJNA 4MQ9F 5M5YJ 3D0SA 5B5EC 3MFKA 2HYJA 5D5VB 4G9YA 3K7AJ 1PUEE 4PJ0C 4PFOA 1B8IA 3WU1B 3OYMA 4BHPA 3VOEA 4RB1A 5EEGA 2FU4A 2MBFA 1TT0A 3OL3A 1ITYA 5KAIC 3TP0A 3I59A 4GO1A 4V2GA 1KU2A 4ZTFA 1FBQA 1UFMA 1XD7A 4A3JJ 5FJ8J 3CUQA 2HOEA 1VQNI 4H4KC 4V2FA 1ZG1A 3TO6A 3C7JA 4B43A 2KZGA 1TBXA 2DPUA 2ZBKA 1X3ZB 4ON0A 3FIWA 3FWEA 4Q47A 1R4MB 3R6SA 3CCMI 5IOZA 1W36C 2XVCA 2DA7A 3HRMA 4D0PA 1FOKA 1R4NB 3OSGA 3U1DA 1S6LA 3BG7A 2L4AA 4RS8A 3ZCOA 3T5XA 5CQEA 4KYWA 1X19A 2QQ9A 5L3GA 3JSPA 4E7SA 1OCOH 2DQRA 1POGA 1ON1A 2XDVA 3P7NA 3DWLE 3OR1C 2BZTA 4XLFA 1H8AC 2R92J 4BEHA 1T0FA 5E79C 3HYIA 4BU2A 3CDIA 4NBQA 5F6FA 1NK3P 2XB5A 5F1RA 1XX5A 5LRSA 3A01A 1ORKA 5FLXZ 1GV2A 1UCRA 2DI3A 2LOOA 1SVOA 1YS6A 2P6TA 2R4GA 3HOSA 3GLLA 2CQNA 1KZHA 2MG4A 3F6VA 4HQEA 2M9HA 4JX6A 1QHHD 3UR3C 1HQCA 1IC8A 2XGEA 2CGPA 3FKIJ 5B66C 2DOAA 2IJLA 2EA2A 4NQWA 1MZBA 2K86A 4CXFA 3UKGA 4LLNA 3OV8A 2GLOA 3C2GA 4KN4X 1OCPA 1GV5A 4KIGA 4IHVA 4XORA 3E6CC 1MMNA 4BXFA 1GUUA 4CO8A 4WXDA 1KU3A 4LG3A 5CVRA 2JRTA 5EEAA 4ZTJA 1B9MA 4G8XA 1RR8C 2R7SA 4ZYDA 5J3LA 2L01A 2KISA 5E8GA 4K2EA 2FX0A 5E1ZB 5M5XJ 2BEOA 3HOZJ 1G4DA 1FC3A
chains in the Genus database with same CATH topology
2E2IJ 3JRBA 3BG5A 2R5YB 1F43A 4W97A 3NARA 4BBRJ 4QTRA 4AYBN 1JUSA 3JRFA 1LE8B 3S16J 3S2DJ 2LY9A 3GTOJ 2E2HJ 3HOUJ 3LNQA 2CJJA 1CQTA 2EQRA 9ANTA 2M2EA 5JLWA 1U9OA 2HI3A 3S2HJ 2B63J 3H3VK 1A5JA 1OCTC 5F0CA 4L5EA 1XS9A 4A3DJ 4XICA 1D5YA 2DA2A 1P7JA 5M3MJ 3JRHA 2JMWA 4B4CA 2R0QC 1HLVA 5JLXA 4IHWA 1FIAA 3GTKJ 2ME0A 1FJLA 1AU7A 3GTGJ 5IOYA 3L1PA 4AC0A 4C3IJ 2XGCA 2NVYJ 5DTDA 2QF7A 1JKQC 3BR1A 1JTXA 1B72A 3B6AA 2XPWA 1UHSA 5FKLA 3S1QJ 5FKMA 2EBIA 1ZGWA 1WI3A 1WH7A 3JRDA 2CUFA 1YRNB 4DYRA 1U8BA 5FLMJ 5F27A 3ZOBA 4M3BA 4UUTA 2GM4A 3TP3A 3G1OA 5GPCA 3JR9A 1K61A 1X2MA 2VUMJ 1JT6A 1UMQA 3HEFA 2K9NA 4D7NA 3M4OJ 2LD5A 2JA7J 4B3AA 1PUFB 4GFBA 2L7MP 3FK7A 5J1UA 1WPKA 4D5FA 4MIMA 1I50J 3A03A 3C2BA 4M3EA 3QPSA 2DMPA 2COBA 2L9RA 4S0HB 1IDYA 1AKHA 1JUPA 2JJ7A 2H1KA 4D5CA 3RKQA 1T33A 2HQ5A 2DA5A 5IYDJ 3OIOA 2JN6A 5K7HA 5J1RA 2NVTJ 1RKWA 2Y2ZA 5C4JJ 1U78A 2DMTA 3ZQLA 2OF7A 3F0CA 3Q0WA 2I10A 2XPVA 5C44J 3OOUA 1I3QJ 3HOYJ 1FTZA 2D5VA 1VNDA 1WCMJ 3CQZJ 1RESA 3CMYA 1MSEC 2R5YA 4A3CJ 1Z0XA 5M5WJ 2G0EA 4X6AJ 2IBDA 1MH4A 4X1EA 4I76A 4A3IJ 2LKXA 2N8GA 1LE8A 2M8GX 3BT9A 4JX4A 2AHQA 4FE4A 2DA4A 2EZKA 2WAQN 4XRMA 2K9QA 3QPLA 4M3FA 1TWAJ 2TRTA 1ETYA 3O8HA 5E3MA 3ZQCA 1TWFJ 2HXOA 1JJ8C 1GDTA 2DA3A 1ZR4A 3Q0VA 3NAUA 1JKRC 2ME6A 1QPIA 3JRIA 2Y0SN 2R5ZB 2CQXA 3K2AA 2O8KA 3GTQJ 2EZHA 1Y1WJ 4ABZA 3QQAA 1IDZA 3MKLA 2K9SA 2LLKA 2DN0A 2ID3A 2CRGA 5EGOB 2EZLA 2HDDA 1G2HA 4CYCB 2W48A 1XG1A 2JWTA 4DW6A 4RDUA 2MSYA 2LVSA 4G12A 1VI0A 2CU7A 3HM5A 4W1UA 2DA6A 4UUSB 1YRNA 3GTPJ 3HDDA 2EZIA 5GP9A 2NVXJ 5FKKA 3S1MJ 3BR5A 4BKXA 3CCYA 3S15J 4D7MA 2MW8A 4Y52J 5C4XJ 4M3GA 1TWCJ 3CDLA 1ZR2A 1RETA 2YU9J 4IEJA 1WH5A 4C3JJ 1IRZA 3S1RJ 3ZQIA 5F1JA 4MFEA 1RKTA 4M6VA 4XRSG 1JJ6C 1PUFA 2MGQA 5E3LA 3ZQGA 1HOMA 1LFBA 1IGNA 3BQZA 1HDPA 4MFDA 2VKVA 4FE7A 5F0FA 4AUXA 1FEXA 3FISA 3RZDJ 1F36A 2WV1A 4A3MJ 4BXXJ 4M3DA 1S7EA 3IH4A 3BR6A 2X9DA 1Y1VJ 3A02A 2XSDC 3GTJJ 2YS9A 2KT0A 4A69C 1W0UA 1JKOC 1MH3A 1TWHJ 1U9NA 5E3NA 3IH3A 4A3GJ 5FLVA 4DYCA 4NDLA 5IP6A 3PO3J 2JA8J 5J1YA 2JK3A 3BR2A 3OSFA 4A3BJ 2ZB9A 3VPRA 3HGGA 2HOSA 2DMUA 4JX5A 2NS8A 1GVDA 1K83J 1ETOA 3GTMJ 1RPWA 1A6IA 3I4MJ 4QSHA 3HB9A 3BR3A 2NVQJ 1FTTA 3GTLJ 1HF0A 3PM1A 2E2JJ 3GBGA 1H88C 3DEWA 5EG0A 1B8IB 1QVTA 3B6CA 1HCRA 2LP0A 1LFUP 5F04A 2VI6A 5IYBJ 4A3EJ 2IEKA 2DA1A 4DZPA 5EF6A 3BTIA 2R93J 4MLOA 3SFIA 1FIPA 4LOCA 2VKEA 4J19A 2LFBA 4HNVA 3HBLA 2E1OA 5K7FA 2CUEA 2DMQA 4XRSA 5EYRA 2X6OA 5HODA 2R5ZA 1OFCX 5IPAA 2ECBA 2NOGA 3IV5A 3FK6A 2VPRA 1ZK8A 1GT0C 2Y9ZA 5EGOA 2L7FP 2L7ZA 5BNGA 3ZQFA 1ZTRA 3BTLA 4CYCA 1NTCA 1E3OC 5C3EJ 3M3YJ 2X48A 3O8GA 1IUFA 1Z77A 1ETXA 1JTYA 2CQQA 4UUSA 2FD5A 2DMNA 2JA5J 4FISA 5EZHA 5K7ZA 3BTJA 1BW6A 2H8RA 3IH2A 5IP9J 3TEDA 4XIDA 1HDDC 2HOTA 1JT0A 3A01B 1X2NA 2M34A 4IHXA 1ZKGA 3G1LA 4BBSJ 1T56A 4I6ZA 4FCYA 2DTZA 3Q0UA 3E7LA 2Y9YA 3HGYA 4DZJA 3BTCA 3SDGA 1SFOJ 5IP7J 1ETWA 3LOCA 1X58A 3MN2A 1WGXA 1MNMC 5DS9A 4DYQA 2ID6A 2PMZN 1O4XA 3MVPA 2XB0X 5E3OA 3RQIA 4EEFG 2QCOA 2NS7A 3G1MA 2KDZA 1JUMA 3D1NI 1SANA 5IYCJ 3LSGA 2JA6J 1QRYA 3W6VA 4RBOA 1VF9A 4B1RA 3WHCA 5EDNA 3BQYA 2LK2A 4C2MJ 3Q3SA 2DJNA 5M5YJ 5F08A 2M0CA 4XK4A 4C3HJ 2HYJA 2HXIA 2Y30A 1IV6A 2R7ZJ 1DU6A 3LSPA 2LR8A 3K7AJ 4Y7NJ 1B8IA 2EH3A 3HOXJ 1R9TJ 1ITYA 3TP0A 3BG9A 3ZQHA 4V2GA 1ENHA 3JREA 1W0TA 2FJ1A 3SJMA 4MO7A 2TCTA 4A3JJ 5FJ8J 1Q1VA 4V2FA 3S17J 1UG2A 4JYKA 1JKPC 2GBYA 3JRGA 2L0KA 3FIWA 1BW5A 4BY7J 2XGDA 5IOZA 1APLC 1MSFC 2DA7A 3BG3A 1MBFA 3OSGA 3S1NJ 2IAIA 2P81A 3PO2J 1OJLA 1JGGA 3RZOJ 2RAEA 2O7OA 1POGA 2AO9A 1B72B 3H0GJ 1BL0A 3TW6A 1MBKA 1ETKA 1H8AC 4A3KJ 2R92J 2OPTA 1ZQ3P 3S14J 2K40A 3HOWJ 1NK2P 3I4NJ 1MBHA 1BA5A 2LTPA 1NK3P 2WB1N 2XB5A 3DCFA 1MBGA 3A01A 1H89C 1DU0A 2FQ4A 5FKOA 1ORKA 1P7IA 4JP0A 1AHDP 1GV2A 5EZGA 1TWGJ 3LSRA 2ELKA 4A3FJ 1TC3C 3BR0A 1RR7A 3LSJA 2MG4A 2M9HA 4JX6A 3JRCA 1IC8A 2XGEA 2E19A 3FKIJ 5FKNA 1IG7A 1I6HJ 1AKHB 3WHBA 5F0HA 2XRLA 1BJZA 3UKGA 2GLOA 1VFCA 1ETVA 5GPAA 1OCPA 1GV5A 5M3FJ 2Y31A 4IHVA 3TW7A 3HKZN 1GUUA 2O9LA 5EG0B 4IHYA 4BY1J 5EEAA 1MBJA 4FTHA 2HOAA 5J3LA 3HOVJ 2XPUA 2YUSA 2FX0A 2ECCA 5M5XJ 3HOZJ 1IJWC 4A3LJ 1EF4A 4QIWN 1QVUA 1ETQA 1XC5A 3JRAA 1MBEA 4A93J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I J;  3JRB A;  3BG5 A;  2R5Y B;  1F43 A;  4W97 A;  3NAR A;  4BBR J;  4QTR A;  4AYB N;  1JUS A;  3JRF A;  1LE8 B;  3S16 J;  3S2D J;  2LY9 A;  3GTO J;  2E2H J;  3HOU J;  3LNQ A;  2CJJ A;  1CQT A;  2EQR A;  9ANT A;  2M2E A;  5JLW A;  1U9O A;  2HI3 A;  3S2H J;  2B63 J;  3H3V K;  1A5J A;  1OCT C;  5F0C A;  4L5E A;  1XS9 A;  4A3D J;  4XIC A;  1D5Y A;  2DA2 A;  1P7J A;  5M3M J;  3JRH A;  2JMW A;  4B4C A;  2R0Q C;  1HLV A;  5JLX A;  4IHW A;  1FIA A;  3GTK J;  2ME0 A;  1FJL A;  1AU7 A;  3GTG J;  5IOY A;  3L1P A;  4AC0 A;  4C3I J;  2XGC A;  2NVY J;  5DTD A;  2QF7 A;  1JKQ C;  3BR1 A;  1JTX A;  1B72 A;  3B6A A;  2XPW A;  1UHS A;  5FKL A;  3S1Q J;  5FKM A;  2EBI A;  1ZGW A;  1WI3 A;  1WH7 A;  3JRD A;  2CUF A;  1YRN B;  4DYR A;  1U8B A;  5FLM J;  5F27 A;  3ZOB A;  4M3B A;  4UUT A;  2GM4 A;  3TP3 A;  3G1O A;  5GPC A;  3JR9 A;  1K61 A;  1X2M A;  2VUM J;  1JT6 A;  1UMQ A;  3HEF A;  2K9N A;  4D7N A;  3M4O J;  2LD5 A;  2JA7 J;  4B3A A;  1PUF B;  4GFB A;  2L7M P;  3FK7 A;  5J1U A;  1WPK A;  4D5F A;  4MIM A;  1I50 J;  3A03 A;  3C2B A;  4M3E A;  3QPS A;  2DMP A;  2COB A;  2L9R A;  4S0H B;  1IDY A;  1AKH A;  1JUP A;  2JJ7 A;  2H1K A;  4D5C A;  3RKQ A;  1T33 A;  2HQ5 A;  2DA5 A;  5IYD J;  3OIO A;  2JN6 A;  5K7H A;  5J1R A;  2NVT J;  1RKW A;  2Y2Z A;  5C4J J;  1U78 A;  2DMT A;  3ZQL A;  2OF7 A;  3F0C A;  3Q0W A;  2I10 A;  2XPV A;  5C44 J;  3OOU A;  1I3Q J;  3HOY J;  1FTZ A;  2D5V A;  1VND A;  1WCM J;  3CQZ J;  1RES A;  3CMY A;  1MSE C;  2R5Y A;  4A3C J;  1Z0X A;  5M5W J;  2G0E A;  4X6A J;  2IBD A;  1MH4 A;  4X1E A;  4I76 A;  4A3I J;  2LKX A;  2N8G A;  1LE8 A;  2M8G X;  3BT9 A;  4JX4 A;  2AHQ A;  4FE4 A;  2DA4 A;  2EZK A;  2WAQ N;  4XRM A;  2K9Q A;  3QPL A;  4M3F A;  1TWA J;  2TRT A;  1ETY A;  3O8H A;  5E3M A;  3ZQC A;  1TWF J;  2HXO A;  1JJ8 C;  1GDT A;  2DA3 A;  1ZR4 A;  3Q0V A;  3NAU A;  1JKR C;  2ME6 A;  1QPI A;  3JRI A;  2Y0S N;  2R5Z B;  2CQX A;  3K2A A;  2O8K A;  3GTQ J;  2EZH A;  1Y1W J;  4ABZ A;  3QQA A;  1IDZ A;  3MKL A;  2K9S A;  2LLK A;  2DN0 A;  2ID3 A;  2CRG A;  5EGO B;  2EZL A;  2HDD A;  1G2H A;  4CYC B;  2W48 A;  1XG1 A;  2JWT A;  4DW6 A;  4RDU A;  2MSY A;  2LVS A;  4G12 A;  1VI0 A;  2CU7 A;  3HM5 A;  4W1U A;  2DA6 A;  4UUS B;  1YRN A;  3GTP J;  3HDD A;  2EZI A;  5GP9 A;  2NVX J;  5FKK A;  3S1M J;  3BR5 A;  4BKX A;  3CCY A;  3S15 J;  4D7M A;  2MW8 A;  4Y52 J;  5C4X J;  4M3G A;  1TWC J;  3CDL A;  1ZR2 A;  1RET A;  2YU9 J;  4IEJ A;  1WH5 A;  4C3J J;  1IRZ A;  3S1R J;  3ZQI A;  5F1J A;  4MFE A;  1RKT A;  4M6V A;  4XRS G;  1JJ6 C;  1PUF A;  2MGQ A;  5E3L A;  3ZQG A;  1HOM A;  1LFB A;  1IGN A;  3BQZ A;  1HDP A;  4MFD A;  2VKV A;  4FE7 A;  5F0F A;  4AUX A;  1FEX A;  3FIS A;  3RZD J;  1F36 A;  2WV1 A;  4A3M J;  4BXX J;  4M3D A;  1S7E A;  3IH4 A;  3BR6 A;  2X9D A;  1Y1V J;  3A02 A;  2XSD C;  3GTJ J;  2YS9 A;  2KT0 A;  4A69 C;  1W0U A;  1JKO C;  1MH3 A;  1TWH J;  1U9N A;  5E3N A;  3IH3 A;  4A3G J;  5FLV A;  4DYC A;  4NDL A;  5IP6 A;  3PO3 J;  2JA8 J;  5J1Y A;  2JK3 A;  3BR2 A;  3OSF A;  4A3B J;  2ZB9 A;  3VPR A;  3HGG A;  2HOS A;  2DMU A;  4JX5 A;  2NS8 A;  1GVD A;  1K83 J;  1ETO A;  3GTM J;  1RPW A;  1A6I A;  3I4M J;  4QSH A;  3HB9 A;  3BR3 A;  2NVQ J;  1FTT A;  3GTL J;  1HF0 A;  3PM1 A;  2E2J J;  3GBG A;  1H88 C;  3DEW A;  5EG0 A;  1B8I B;  1QVT A;  3B6C A;  1HCR A;  2LP0 A;  1LFU P;  5F04 A;  2VI6 A;  5IYB J;  4A3E J;  2IEK A;  2DA1 A;  4DZP A;  5EF6 A;  3BTI A;  2R93 J;  4MLO A;  3SFI A;  1FIP A;  4LOC A;  2VKE A;  4J19 A;  2LFB A;  4HNV A;  3HBL A;  2E1O A;  5K7F A;  2CUE A;  2DMQ A;  4XRS A;  5EYR A;  2X6O A;  5HOD A;  2R5Z A;  1OFC X;  5IPA A;  2ECB A;  2NOG A;  3IV5 A;  3FK6 A;  2VPR A;  1ZK8 A;  1GT0 C;  2Y9Z A;  5EGO A;  2L7F P;  2L7Z A;  5BNG A;  3ZQF A;  1ZTR A;  3BTL A;  4CYC A;  1NTC A;  1E3O C;  5C3E J;  3M3Y J;  2X48 A;  3O8G A;  1IUF A;  1Z77 A;  1ETX A;  1JTY A;  2CQQ A;  4UUS A;  2FD5 A;  2DMN A;  2JA5 J;  4FIS A;  5EZH A;  5K7Z A;  3BTJ A;  1BW6 A;  2H8R A;  3IH2 A;  5IP9 J;  3TED A;  4XID A;  1HDD C;  2HOT A;  1JT0 A;  3A01 B;  1X2N A;  2M34 A;  4IHX A;  1ZKG A;  3G1L A;  4BBS J;  1T56 A;  4I6Z A;  4FCY A;  2DTZ A;  3Q0U A;  3E7L A;  2Y9Y A;  3HGY A;  4DZJ A;  3BTC A;  3SDG A;  1SFO J;  5IP7 J;  1ETW A;  3LOC A;  1X58 A;  3MN2 A;  1WGX A;  1MNM C;  5DS9 A;  4DYQ A;  2ID6 A;  2PMZ N;  1O4X A;  3MVP A;  2XB0 X;  5E3O A;  3RQI A;  4EEF G;  2QCO A;  2NS7 A;  3G1M A;  2KDZ A;  1JUM A;  3D1N I;  1SAN A;  5IYC J;  3LSG A;  2JA6 J;  1QRY A;  3W6V A;  4RBO A;  1VF9 A;  4B1R A;  3WHC A;  5EDN A;  3BQY A;  2LK2 A;  4C2M J;  3Q3S A;  2DJN A;  5M5Y J;  5F08 A;  2M0C A;  4XK4 A;  4C3H J;  2HYJ A;  2HXI A;  2Y30 A;  1IV6 A;  2R7Z J;  1DU6 A;  3LSP A;  2LR8 A;  3K7A J;  4Y7N J;  1B8I A;  2EH3 A;  3HOX J;  1R9T J;  1ITY A;  3TP0 A;  3BG9 A;  3ZQH A;  4V2G A;  1ENH A;  3JRE A;  1W0T A;  2FJ1 A;  3SJM A;  4MO7 A;  2TCT A;  4A3J J;  5FJ8 J;  1Q1V A;  4V2F A;  3S17 J;  1UG2 A;  4JYK A;  1JKP C;  2GBY A;  3JRG A;  2L0K A;  3FIW A;  1BW5 A;  4BY7 J;  2XGD A;  5IOZ A;  1APL C;  1MSF C;  2DA7 A;  3BG3 A;  1MBF A;  3OSG A;  3S1N J;  2IAI A;  2P81 A;  3PO2 J;  1OJL A;  1JGG A;  3RZO J;  2RAE A;  2O7O A;  1POG A;  2AO9 A;  1B72 B;  3H0G J;  1BL0 A;  3TW6 A;  1MBK A;  1ETK A;  1H8A C;  4A3K J;  2R92 J;  2OPT A;  1ZQ3 P;  3S14 J;  2K40 A;  3HOW J;  1NK2 P;  3I4N J;  1MBH A;  1BA5 A;  2LTP A;  1NK3 P;  2WB1 N;  2XB5 A;  3DCF A;  1MBG A;  3A01 A;  1H89 C;  1DU0 A;  2FQ4 A;  5FKO A;  1ORK A;  1P7I A;  4JP0 A;  1AHD P;  1GV2 A;  5EZG A;  1TWG J;  3LSR A;  2ELK A;  4A3F J;  1TC3 C;  3BR0 A;  1RR7 A;  3LSJ A;  2MG4 A;  2M9H A;  4JX6 A;  3JRC A;  1IC8 A;  2XGE A;  2E19 A;  3FKI J;  5FKN A;  1IG7 A;  1I6H J;  1AKH B;  3WHB A;  5F0H A;  2XRL A;  1BJZ A;  3UKG A;  2GLO A;  1VFC A;  1ETV A;  5GPA A;  1OCP A;  1GV5 A;  5M3F J;  2Y31 A;  4IHV A;  3TW7 A;  3HKZ N;  1GUU A;  2O9L A;  5EG0 B;  4IHY A;  4BY1 J;  5EEA A;  1MBJ A;  4FTH A;  2HOA A;  5J3L A;  3HOV J;  2XPU A;  2YUS A;  2FX0 A;  2ECC A;  5M5X J;  3HOZ J;  1IJW C;  4A3L J;  1EF4 A;  4QIW N;  1QVU A;  1ETQ A;  1XC5 A;  3JRA A;  1MBE A;  4A93 J; 
#chains in the Genus database with same CATH topology
 1S8N A;  1XGS A;  2R7W A;  2V6E A;  1BOA A;  1MD0 A;  1PYV A;  4W97 A;  1IN5 A;  2ZXI A;  4F93 B;  3KET A;  4UV8 A;  4RA2 A;  1P92 A;  1Z21 A;  2M8E A;  1OR7 A;  5AIP A;  5J4V A;  3JAM K;  4Y13 A;  3OY9 A;  3I53 A;  1LE8 B;  2A3S A;  3S2D J;  1E3H A;  1YW8 A;  4IRH A;  4E7H A;  2XKO A;  1CQT A;  4JK1 X;  2H09 A;  5ICF A;  3TBI A;  3H3V K;  2MC4 A;  1A5J A;  3S93 A;  5DYM A;  4A3D J;  3DEE A;  2VOO A;  4BYY A;  5LEK A;  2D1V A;  1OCZ H;  2QLZ A;  1SFU A;  1YJN I;  4WF2 A;  3WE2 A;  4IHW A;  3J81 K;  4I99 C;  1YFH A;  2KJC A;  4XSX F;  1AU7 A;  3GFL A;  1J5Y A;  5DV5 A;  3V7R A;  2HPM A;  4FX0 A;  2NVY J;  5DTD A;  5GAD J;  1DUX C;  1FOX A;  4ZYA A;  2EIK H;  2V4J C;  3ZQ7 A;  5DCF A;  3KP3 A;  3U1K A;  2QEX I;  5D5X B;  1HA8 A;  2DT7 B;  4LJZ F;  3IWF A;  3LSH A;  1JGS A;  3M8J A;  1QQI A;  1U5T B;  3SYT A;  3IKV A;  2P7C B;  4DYR A;  4RLF A;  4EM1 A;  1P2F A;  5DEQ A;  5F27 A;  2L54 A;  4E7K A;  1RC9 A;  1VQ9 I;  2OCE A;  3TP3 A;  1G59 A;  2E7W A;  4U7B A;  1VQ6 I;  2P8T A;  2NS0 A;  4P55 A;  3HJE A;  3HEF A;  2K9N A;  3EUA A;  3O6B B;  4BQA A;  2VBY A;  3M4O J;  3ONQ A;  2O3F A;  4AID A;  1WJC A;  2GZW A;  1RUN A;  4GFB A;  4JOM A;  2JPB A;  1I50 J;  2V1X A;  3ELK A;  1OPC A;  2OBP A;  2E60 A;  4S0H B;  5BPI A;  1AKH A;  1JUP A;  1SD7 A;  1T33 A;  2A69 F;  5FFX A;  2DA5 A;  1QBJ A;  3OIO A;  1YJW I;  5J1R A;  2LNB A;  2OC6 A;  2RQP A;  3JW4 A;  4IO9 F;  3GUD A;  4L5J A;  2BXZ A;  4WWC A;  2NVT J;  2DAO A;  1EJ9 A;  4ZYE A;  2ZXH A;  1GHC A;  1U78 A;  3KP2 A;  4CA0 A;  4IHS A;  3EYI A;  1VQL I;  3TDZ C;  1W1W E;  2DMT A;  2Z2S B;  3OS2 A;  2MFZ A;  3ZQL A;  2CUJ A;  3TOB A;  2OF7 A;  3F0C A;  3FX3 A;  4ZZL A;  2I10 A;  2COM A;  3K69 A;  2VPL A;  3HC7 A;  3HOY J;  2CW8 A;  3V8K A;  4AU7 A;  2V1D A;  4UUV A;  2B9S A;  2EFN A;  2LC2 A;  1DP7 P;  4A3C J;  1J09 A;  5CVJ A;  2JTV A;  3ZXS A;  3CCV I;  2OU2 A;  4X6A J;  2IBD A;  1ZRF A;  3AAF A;  4FET A;  1KYW A;  2PX9 A;  3KYD B;  3CC2 I;  2Z99 A;  4P1W A;  2HVR A;  2VJJ A;  4BL0 B;  4AIH A;  2J5P A;  4XLP F;  3I56 I;  2IGN A;  1MMA A;  2V79 A;  2WAQ N;  2EZK A;  3K4J A;  4XRM A;  2K9Q A;  1QNT A;  2VN2 A;  1OIS A;  4S05 A;  1TWA J;  4KIF A;  2DT5 A;  3ZQC A;  1QPM A;  4XLC A;  1ZR4 A;  2XAU A;  3Q0V A;  2FBK A;  4Y33 A;  5E8I A;  2ME6 A;  1UB9 A;  4EJU A;  1Y0U A;  1WHU A;  4AYB A;  2CQX A;  3R0A A;  2R5Z B;  1RZ4 A;  4M9Z A;  2O8K A;  1LDK B;  3M7G A;  3NEU A;  1YLF A;  3MKL A;  2HTJ A;  3ZMU A;  1SFK A;  2CUZ A;  1BI2 A;  2MLG A;  5EGO B;  2EV0 A;  1R5H A;  2HQN A;  3ERE D;  2EZL A;  3L7W A;  1X1A A;  3LSI A;  1G8X A;  5BMZ A;  3RPQ A;  3ZMD A;  3ML6 A;  2E1M C;  1FYM A;  1XG1 A;  1YIJ I;  3M8E A;  2E1N A;  4G12 A;  2H6C A;  3CMM A;  2DA6 A;  1YRN A;  2VOP A;  3HDD A;  3SXY A;  1QA6 A;  2EZI A;  1LNW A;  4ENJ A;  2NVX J;  1LVK A;  4IOC F;  4BKX A;  4U0W A;  3S15 J;  5ICG A;  5CKT A;  1ACI A;  3DBR B;  3HSE A;  3CDL A;  2HYG D;  3KFW X;  1WH5 A;  2VIX A;  4BJ5 C;  3ZMV A;  4AIK A;  1P9Q C;  5CJ9 A;  2WWY A;  4KMF A;  1SC7 A;  1BI1 A;  2V1N A;  3ZQG A;  2DK8 A;  3H5R A;  1LFB A;  2EFQ A;  2OUM A;  3BQZ A;  3PUF A;  1HDP A;  2HZT A;  4HW0 A;  4FE7 A;  5F0F A;  1GXP A;  5DDG A;  2M1B A;  1R49 A;  2L02 A;  5KK1 A;  3WTU C;  3BR6 A;  1LJ9 A;  1LFP A;  2X9D A;  3E5U A;  4G6D A;  3AG2 H;  1KU7 A;  1TTY A;  3WGI A;  1Y1V J;  3A02 A;  2ZNY A;  3FM3 A;  2IRF G;  3GTJ J;  2YX4 A;  3H3Z A;  2YS9 A;  1U9N A;  3K4M A;  4Q4Z F;  4EGY A;  4N0B A;  4BJ6 C;  4DYC A;  3NWS A;  3PO3 J;  1YIO A;  3L2Q A;  3BR2 A;  3F6O A;  3AG1 H;  3PQK A;  4RAG A;  4YG2 F;  1UEL B;  5JHU A;  1Y0N A;  5LBQ A;  1R1U A;  1W5T A;  2STW A;  2DDB A;  3GME A;  1KA8 A;  3QP5 A;  4I7H A;  5LLQ A;  1UHM A;  4A5N A;  3P9I A;  2F5F A;  5CVI A;  5DCM B;  1W36 D;  2O6G E;  3I4M J;  3TDU C;  4E4H A;  1HF0 A;  3VWB A;  2Q2E A;  2E2J J;  2X1C A;  1B8I B;  1YIT I;  2MD5 A;  2LP0 A;  5F04 A;  1FWZ A;  1J9I A;  3I59 B;  2DA1 A;  4DZP A;  3OYN A;  3RI4 A;  4MLO A;  4LOC A;  3KCC A;  2FE3 A;  4HNV A;  5CLS A;  4R79 A;  3DU5 A;  1VQM I;  1K79 A;  2X6O A;  2ADU A;  2ECB A;  3ECH A;  2Y69 H;  3IV5 A;  1X3U A;  2KRH A;  3FK6 A;  1Y56 A;  1GT0 C;  2VE8 A;  3FXJ A;  3F23 A;  2Y9Z A;  3F9K A;  3L9F A;  2L7Z A;  4BDY A;  2W82 A;  3IRQ A;  4CYC A;  3M3Y J;  2X48 A;  1WJB A;  2DYR H;  4E7L A;  2LDU A;  4LD5 A;  4XMY A;  2GOX B;  4LGW A;  2CYY A;  3W2W A;  3W2V A;  4HV6 A;  3ULQ B;  1NHA A;  5J8F A;  4FIS A;  4BEH B;  1IF1 A;  3MZY A;  3KLN A;  3M07 A;  2NRA C;  4L0Z B;  1BW6 A;  1U8R A;  2O5R A;  4AD9 A;  3GZ5 A;  2KDO A;  3SZG A;  2VQL A;  1XTA A;  3OYG A;  4BXU A;  5J40 A;  1HDD C;  1OMI A;  2AQE A;  3A01 B;  4B8X A;  2ZXW H;  2X51 A;  3WTZ A;  2M34 A;  3ABU A;  1MJ9 A;  1ZKG A;  1ZLK A;  2VT2 A;  4I6Z A;  4FCY A;  3FXR A;  4BDZ A;  1SAU A;  2V7F A;  4IL6 C;  4NC6 A;  3BTC A;  2QSG X;  3QOE A;  1A31 A;  3DQV C;  1SFO J;  2FOK A;  2PJR A;  4UB6 C;  3LOC A;  3AG4 H;  1X58 A;  4CGZ A;  1T08 B;  1MNM C;  3QYE A;  1UZC A;  2BVL A;  4M9S A;  1YG2 A;  3V8J A;  4NQW B;  3RSN A;  2RDP A;  1O4X A;  3I0T A;  3MVP A;  5E3O A;  4EEF G;  3BZC A;  5J6X A;  4RGS A;  2X1D A;  3WG9 A;  5DUK A;  5D4R A;  5E18 F;  4YIF A;  1QRY A;  4FQG A;  1TT5 B;  3SEZ A;  3WG7 H;  3DLL F;  3W6V A;  3J80 K;  3K6G A;  3E1S A;  5DM6 F;  1ZRE A;  3BPV A;  3QYF A;  1A04 A;  2DCE A;  2I8D A;  2M0C A;  3RIR A;  2KHM A;  1K4T A;  5ILU A;  5FB2 A;  1HW1 A;  2HXI A;  2IVM A;  3EQL F;  3SEQ A;  1DU6 A;  3OWT A;  2LR8 A;  4A6E A;  4KIT B;  2UV1 A;  2IS4 A;  3HPG A;  4MQV A;  3T8T A;  1J7K A;  3HOX J;  4IRI A;  2KIQ A;  4ZYG A;  1HW2 A;  4LMY A;  4II3 A;  1PP8 F;  3TMO A;  5L3E A;  1HBX G;  2A61 A;  1NG6 A;  5FFZ A;  3CCL I;  4MO7 A;  1ZGJ A;  1ZG5 A;  3GYH X;  4CYD A;  5EEH A;  1UG2 A;  4I0A A;  5AON A;  5FRM A;  2QGU A;  4BY7 J;  1APL C;  1YJ9 I;  3REO A;  3BCB A;  3BG3 A;  2VBX A;  2XAS A;  3L2V A;  3OIQ A;  3R4K A;  2P81 A;  1BIB A;  1HKT A;  4Z6Y A;  1OJL A;  1JGG A;  3RZO J;  2RAE A;  2W84 A;  1MMS A;  2O7O A;  5JVT A;  1XPX A;  2VOD A;  2HWV A;  3JTG A;  2AO9 A;  4E7J A;  1VZ0 A;  4WK8 F;  1BL0 A;  4CCO A;  3TW6 A;  1DPR A;  1ETK A;  2WV0 A;  4EM0 B;  2HKX A;  4XRF A;  4A3K J;  3LWF A;  4E7Z A;  1MGT A;  1CF7 A;  3BRO A;  3ECO A;  1MBH A;  3E5X A;  4D1Q A;  1BA5 A;  5JFR A;  5K5O A;  1S72 I;  2LTP A;  3CJT B;  3R61 A;  1XCV A;  3ASO H;  3DFG A;  2FQ4 A;  1P7I A;  4L9N A;  1UST A;  2ELK A;  2LSO A;  3AL0 C;  2WY8 Q;  4FAS D;  2DQL A;  1O7L A;  2KIU A;  2XF7 A;  2DJI A;  3DKX A;  2JPC A;  1OCC H;  1OKR A;  1XMX A;  3CCJ I;  3MEX A;  2P5V A;  2DU9 A;  2E19 A;  1IG7 A;  1YTY A;  4HF1 A;  3EET A;  1I6H J;  3A0H C;  1AKH B;  5F0H A;  2XRL A;  4B44 A;  5CQG A;  1BJZ A;  3E5Q A;  3MKZ A;  1VQ4 I;  3FMQ A;  1VFC A;  1BI3 A;  5M3F J;  4L18 B;  2W25 A;  3OR2 C;  1YX3 A;  1WJE A;  2OAZ A;  3E97 A;  3HKZ N;  3TW7 A;  4RB2 C;  4EJO A;  4EMS A;  3NQO A;  2O9L A;  4CCM A;  4IHY A;  4XLE A;  4XKC A;  1LPQ A;  4L0Y B;  1XSX A;  2XPU A;  1R22 A;  5LGU A;  2BV6 A;  5HNF A;  5J4Y A;  4L9V A;  1IJW C;  1KQ9 A;  2NXN B;  4QIW N;  2STT A;  1QVU A;  1ETQ A;  2QM3 A;  3JRA A;  2PMZ A;  2AS5 F;  2MH9 A;  3FXM A;  4BHB A;  1MW7 A;  4C9Y A;  3DV8 A;  2E2I J;  1XCB A;  1TQI A;  2M7A A;  1F43 A;  2QEN A;  5TRD A;  2ISZ A;  2HFH A;  3PIP F;  3RKW A;  2PBI A;  4F52 A;  4KIB A;  3WTV C;  2EWN A;  3ESW B;  4NUB A;  2E1C A;  4AYB N;  3JRF A;  3DKY A;  2DT6 A;  2BY3 A;  4M74 A;  3PJR A;  2DLL A;  3FBN B;  2EQR A;  2WAF A;  3V7S A;  3S2H J;  2PMH A;  3IHU A;  2PQ8 A;  2Z33 A;  2DOF A;  1MDM A;  1F4K A;  5IY5 H;  4L5E A;  1I1G A;  1XS9 A;  1O7F A;  1OCT C;  2R7U A;  2HQR A;  4UNO A;  1HLV A;  2UWM A;  1YW9 A;  1FIA A;  3ZGK A;  2K9M A;  3LA2 A;  2K9L A;  4M9X A;  5L3F A;  2QZ8 A;  3W3C A;  3MWM A;  1XN7 A;  5IOY A;  2V6C A;  4AVZ A;  1I27 A;  3FKJ A;  4AC0 A;  1U2W A;  2XGC A;  2B7E A;  1JKQ C;  1BOB A;  3G3Z A;  1JTX A;  1B72 A;  5HLI A;  5HDK A;  4HV5 A;  1IXS B;  1K7A A;  2XPW A;  1IRX A;  5FKL A;  5LGT A;  1TQM A;  1CGP A;  2IGM A;  1ZGW A;  2KFD A;  3K10 A;  3HOT A;  1BJA A;  2CUF A;  3CJN A;  4OWR B;  1YRN B;  1T38 A;  1NH3 A;  4Y3O A;  3C2H A;  5LD2 C;  2R7O A;  1YE9 A;  1Z91 A;  4I2O A;  2MD0 A;  2XSJ C;  4M73 A;  2O8X A;  3G1O A;  4E6K G;  1BBY A;  2R7V A;  1PDN C;  5B1B H;  5B1A H;  3VYT B;  1BC8 C;  1JI8 A;  1WRJ A;  2HR3 A;  3BLY A;  4B3A A;  4HLY A;  1D1B A;  4PUS A;  5J1U A;  2G7H A;  3JAM Z;  4MIM A;  2MH2 A;  1X1C A;  3G6E I;  2DMP A;  2JJ7 A;  4P5O A;  2EIM H;  2JN6 A;  3HL2 A;  5IT3 A;  3M1E A;  1FLI A;  1W5C C;  4I98 B;  3H3U A;  3HRU A;  4CZC A;  3ROU A;  3U2R A;  3J81 Z;  4L5I A;  1HC8 A;  2R7D A;  4KIS A;  1SEU A;  2NNY A;  2ZKZ A;  4C2U A;  3BDD A;  3Q9S A;  1Z7L A;  4AM3 A;  2L3D A;  3OOU A;  2VB6 A;  2ACJ A;  3ABT A;  5E1W A;  2JA2 A;  1M1E B;  3WGG A;  5K1Y A;  2RGV A;  4QLC U;  1VND A;  1WCM J;  2LG4 A;  1RES A;  2P0W A;  1MSE C;  2R5Y A;  4GDF A;  2DFF A;  3GWZ A;  4FT8 A;  4IJA A;  3GFM A;  5HDG A;  3VFZ A;  2RKH A;  5FGM A;  3VYR B;  3TO7 A;  4F7Z A;  4R8H A;  3CCU I;  4ESJ A;  2R7T A;  1SVM A;  4F3Q A;  3BJA A;  3DKW A;  1SVL A;  2G9W A;  3A4C A;  3QU6 A;  5LEJ A;  5HOO A;  4KNY A;  2M8G X;  2Q2E B;  1H0M A;  3BT9 A;  4XBF A;  2MLK A;  4JX4 A;  2AHQ A;  4FE4 A;  5DD4 A;  4YII A;  3KLO A;  1G3Y A;  4B47 A;  3J7Y J;  4GRI A;  2VQH A;  3QPL A;  4CCK A;  1LEB A;  5E3M A;  1R1T A;  2Y0S A;  5F64 A;  1JHH A;  1FMW A;  2KPM A;  5GAH J;  1JJ8 C;  1IUY A;  1B4A A;  2IS6 A;  3EYY A;  3NAU A;  2KP6 A;  2GOM A;  1QPI A;  4G7O F;  1FPQ A;  2LKP A;  1Y1W J;  3O2P E;  3QQA A;  1IDZ A;  2LLK A;  3FXO A;  2CRG A;  2WAD A;  2BY1 A;  2IA0 A;  2RN7 A;  3J7Z I;  2YU3 A;  4Y15 A;  1XB4 A;  4CYC B;  2K85 A;  1W7P A;  3HSF A;  4EJT A;  2LRE A;  2JWT A;  4DW6 A;  5ICC A;  2E34 A;  3R60 A;  4YEJ A;  4HDV A;  4W1U A;  3HM5 A;  4U87 A;  3V7C A;  2VBZ A;  2R7F A;  4HRI A;  1D1C A;  2DOD A;  1W7P D;  2DDA A;  4EVI A;  1MIJ A;  2LH9 A;  3K4B A;  3B02 A;  3DBL B;  4D7M A;  3CP8 A;  3KE2 A;  1R7J A;  3MMY B;  2A6H F;  3MCZ A;  1R71 A;  4IEJ A;  4IKF A;  4UV9 A;  1USS A;  3ZQI A;  3ZN0 A;  3TGN A;  4PSW A;  4XRS G;  1DQU A;  3VOD A;  1FX7 A;  5E3L A;  3CES A;  1WSU A;  1YYV A;  3CJQ B;  1IGN A;  5L3B A;  1BIA A;  4XLA A;  1BR2 A;  2Z3Y A;  4HF0 A;  4OIO F;  2BHZ A;  2FMY A;  2PJR B;  4M3D A;  3I54 A;  2M87 A;  4HPQ A;  2A68 F;  2GWR A;  2JT1 A;  3OYI A;  3FBI B;  4EM2 A;  3K70 C;  2EIN H;  3F8B A;  2XSD C;  1XGM A;  5E3N A;  3CJR B;  4A0X A;  4A3G J;  1S3J A;  2JZY A;  2QSF X;  1XGN A;  2R3S A;  1I39 A;  2JA8 J;  5J1Y A;  5IT9 K;  4P9F A;  2JK3 A;  4P9U A;  3OSF A;  3QRF F;  2ZB9 A;  4UY8 I;  1IAW A;  2X6Y A;  2XHK A;  1GVJ A;  2IA2 A;  2CFX A;  2NS8 A;  5HS9 A;  2CMP A;  3SDB A;  1BI0 A;  3RYR A;  3IL2 A;  1F9N A;  3LA3 A;  5KCM A;  4HSR A;  1A6I A;  4UVA A;  3MZH A;  3BR3 A;  1YQA A;  2EFP A;  2WA0 A;  2X85 A;  3GTL J;  2AXL A;  3EUH C;  4ENN A;  2QQ8 A;  1ZH5 A;  3DEW A;  4RB3 C;  1UG0 A;  3ZMS A;  1QVT A;  4X0G A;  2ZXJ A;  3B6C A;  2CS3 A;  4ZYH A;  3RJP A;  3CF2 A;  2PLY A;  5HVQ C;  2IEK A;  4GYG A;  2XF5 A;  2ELH A;  2L9N A;  1TNS A;  2E1O A;  4U0Y A;  1O3Q A;  4XRS A;  5EYR A;  1T6S A;  2XV4 S;  2NOG A;  3QOP A;  1T95 A;  3DF8 A;  4UVC A;  1OQY A;  3W2A A;  2L7F P;  3ZQF A;  4EJV A;  1Z7U A;  1O57 A;  1Z6R A;  4IHT A;  2ZFW A;  3LMM A;  1HSJ A;  2VE9 A;  3O8G A;  3AG3 H;  3H36 A;  3PIO F;  4HDU A;  3HTS B;  2L9S A;  2FD5 A;  4UUS A;  2FNP A;  1Z9C A;  1FSE A;  1Z1D A;  3LAP A;  1ZRD A;  4AVP A;  2M3A A;  4CCJ A;  3D5S C;  1CF7 B;  2BW3 A;  3HTU A;  2PMU A;  2WBM A;  2BVM A;  2P6S A;  4XID A;  2GQQ A;  2XUB A;  5ILS A;  5A2Q K;  2L4M A;  1VQP I;  1HKQ A;  1X2N A;  4BNC A;  3SQN A;  2GAU A;  4YFN F;  3G1L A;  4F55 A;  4BBS J;  2VQC A;  4HLX A;  2Y9Y A;  3HGY A;  2FBI A;  4RAF A;  2F2E A;  3SDG A;  2CFO A;  1SD4 A;  1BN5 A;  3H9Q A;  3L2C A;  4XLN F;  5IP7 J;  2XRN A;  2XF6 A;  1WJA A;  2ID6 A;  2PEX A;  5GAG J;  4A12 A;  2P7V B;  2PMZ N;  2VBW A;  3F8N A;  5HDN A;  2M30 A;  5BOX A;  4ASN A;  2BBY A;  1A35 A;  3RQI A;  3ASN H;  3QWL A;  3WU2 C;  3G1M A;  2QKM B;  3PUB A;  4ZZD A;  2KQR A;  4QPQ A;  4ESB A;  3QPH A;  5IYC J;  1QU3 A;  3PSF A;  2JA6 J;  4KUM A;  5DM7 F;  2M4G A;  3F22 A;  4B1R A;  3OL4 A;  3WHC A;  3T1B A;  4E70 A;  1IRF A;  5EDN A;  3OYB A;  2L7K A;  1LB2 A;  2EK5 A;  3Q3S A;  5F08 A;  1IV8 A;  5JI6 A;  4XLH A;  5EJC A;  4C3H J;  3CO6 C;  1IV6 A;  2R7Z J;  2KIF A;  2E1M B;  1J0R A;  3BPX A;  4QWQ A;  1ZAO A;  3OYJ A;  1FNN A;  3LFU A;  1J59 A;  1RIO H;  3WE3 A;  3BG9 A;  3ZQH A;  2B0L A;  6PAX A;  1AA7 A;  5CVV A;  3H9G A;  4Z2Y A;  3DPT A;  4H0E A;  1W0T A;  2TCT A;  2HYF A;  3S2W A;  1Q1V A;  5E17 F;  3K1N A;  5J47 A;  2FOW A;  4PFP A;  4Q48 A;  1JKP C;  5FD6 A;  1EKE A;  3MAJ A;  3VDX A;  2GBY A;  3TO9 A;  3JRG A;  4E7I A;  1MDM B;  2L0K A;  3BZK A;  2VJ5 A;  1T2K A;  1BW5 A;  3H92 A;  4LG0 B;  2XGD A;  1X1B A;  4HA8 A;  2X1E A;  1MBF A;  3CLO A;  5ICE A;  2G7U A;  4OAY A;  4HG2 A;  1XDS A;  3FDY A;  1S7A A;  2IAI A;  3Q5F A;  3PO2 J;  5HS8 A;  3PQJ A;  3K1P A;  4CCN A;  2FRH A;  2OZ6 A;  2YR2 A;  1I3A A;  1B72 B;  5L3D A;  1I6X A;  5GTH C;  3KP5 A;  1EH6 A;  1IZ1 A;  4LLG F;  1MBK A;  2OPT A;  3S14 J;  2ZO4 A;  4M72 A;  2K40 A;  1NK2 P;  1KQ8 A;  2Y48 A;  2Q1Z B;  2X6X A;  2KZV A;  3GF2 A;  3JTH A;  3I4N J;  3G73 A;  2VKH A;  3J80 Z;  5H6Q A;  2XRO A;  3HRS A;  1IN7 A;  3RQ4 A;  1MBG A;  1TL8 A;  1H89 C;  5FKO A;  4KIC A;  1ZEL A;  4JP0 A;  1AHD P;  5EZG A;  3LSR A;  5TIS C;  4XQF A;  3J7A Y;  2CV1 A;  3OMY A;  1U3E M;  5BQT A;  4DBR A;  3W6J B;  3EUK L;  1RR7 A;  4HQM A;  3CZ6 A;  1MKM A;  4J01 A;  3LSJ A;  4G7Z F;  1O3T A;  3G2B A;  2P5K A;  2XAJ A;  2Q8K A;  5FKN A;  3OYC A;  2BGC A;  4G6Q A;  2D2W A;  2YX7 A;  3BY6 A;  4F92 B;  3KZY A;  4XL9 A;  3CO7 C;  1UHW A;  3LFK A;  3H9J A;  3TKY A;  2Y31 A;  1ODD A;  4RB0 A;  2VT3 A;  5EG0 B;  3DLA A;  3CTA A;  4BY1 J;  1FBS A;  1MBJ A;  1EH8 A;  4ZDL A;  4PJN A;  3HOV J;  3HHH A;  1B59 A;  3AKZ A;  3I3L A;  2ECC A;  4A3L J;  2PN6 A;  2RVC A;  4NB5 A;  3FZV A;  2QA4 I;  1MBE A;  4XR6 A;  3S8P A;  1G6N A;  5TGT A;  4IOA F;  1PVE A;  3QAH A;  4ZJZ A;  1MMD A;  3BG5 A;  4PGG A;  5JR3 A;  3JRB A;  3M1C A;  2R5Y B;  1K78 B;  3ABK H;  4II2 A;  2VL8 A;  2QUF A;  1ULY A;  4BBR J;  2E5N A;  4IZZ A;  4QTR A;  3H5A A;  1LEA A;  2R7X A;  3DXJ F;  3K9T A;  2Z5U A;  4YFX F;  1ZAR A;  1AWC A;  3S16 J;  2LY9 A;  3GTO J;  3DPU A;  4CH7 A;  4N9H A;  2E2H J;  1ZYR F;  2CJJ A;  4HNU A;  2GIV A;  9ANT A;  5JLW A;  2IGK A;  1Y39 A;  1U9O A;  2ZME C;  5LFA A;  2B63 J;  5H2F C;  1IN6 A;  1I5Z A;  2KIM A;  2WC2 A;  1D5Y A;  3EDP A;  2DA2 A;  2H1L A;  5ERI A;  3JSO A;  4XN0 A;  2Y75 A;  1TZL A;  5JLX A;  3HXL A;  5ILV A;  3GTK J;  1K4S A;  1FJL A;  1E3P A;  3KX2 A;  3ZMZ A;  2R7R A;  4PCQ A;  3L1P A;  2JUC A;  3IC7 A;  4XKV A;  3BR1 A;  4ITV A;  4MHG A;  3U21 A;  4ESF A;  4PK4 A;  3B6A A;  3E6D A;  1UHS A;  1W7P B;  3S1Q J;  2LRD A;  1E17 A;  2CWE A;  5FKM A;  2EBI A;  1RUO A;  3QOD A;  1FYK A;  1WI3 A;  3K4K A;  1WH7 A;  3JRD A;  3FXK A;  3PSI A;  4OIR F;  2IGO A;  2XKP A;  3OYA A;  1IXR C;  3L2U A;  3K70 D;  2H8W A;  1WFX A;  2LF8 A;  4UUT A;  2K3F A;  2J5O A;  2GM4 A;  4M6X A;  4OIN F;  5GPC A;  1XSV A;  1X2M A;  2VUM J;  2Q0O A;  1UMQ A;  1Z05 A;  4IQJ A;  1MJA A;  1TP4 A;  2XGX A;  4YIR X;  4D7N A;  2LD5 A;  2JA7 J;  5DD8 A;  2L7M P;  3FK7 A;  1AOY A;  5FRN A;  4DJA A;  2ZJ2 A;  1OCR H;  3FF5 A;  1LDJ A;  3AFH A;  2HS5 A;  3A03 A;  1OLT A;  3C2B A;  4M3E A;  4CCL A;  3EUH A;  2COB A;  1SMY F;  1EV7 A;  2WB1 A;  4D5C A;  3RKQ A;  2HQ5 A;  3L2R A;  5IYD J;  3GW2 A;  2IPQ X;  2ISY A;  2L5Q A;  3KYL A;  3DBH B;  2KLO A;  4BS9 A;  1RKW A;  2Y2Z A;  5C4J J;  5AIQ A;  3ZQQ A;  1XGO A;  3I4P A;  1E2X A;  3DEU A;  2FML A;  2K27 A;  2BHY A;  3BOQ A;  3K4N A;  2MA3 A;  3IAS 2;  1E0E A;  3PFY A;  2EV5 A;  2XPV A;  1WZ2 A;  3OS1 A;  4XOP A;  4DGW B;  1FTZ A;  2XAQ A;  1X4O A;  3L09 A;  4U0V A;  4UB8 C;  4ANJ A;  2DYS H;  3CQZ J;  1R1V A;  1Z0X A;  5M5W J;  4M71 A;  3P9C A;  3V4G A;  3KEY A;  1DGR M;  1V55 H;  1MH4 A;  4ENM A;  5D8K B;  1TNT A;  5H6R A;  3N97 A;  4MEY F;  1D0Y A;  4A3I J;  5K5Q A;  2LKX A;  3OYE A;  1B1B A;  1N78 A;  2N8G A;  2A07 F;  1V5G A;  1DP3 A;  2DTR A;  3Q9V A;  4BQQ A;  2DA4 A;  2ZNZ A;  1GLN A;  2NOJ B;  1ETY A;  2W1O A;  3S3M A;  5CVU A;  2W85 A;  1GDT A;  3LSK A;  3AL0 B;  4O5V A;  3RPU A;  1WJF A;  2IW5 A;  3GCM A;  3IP4 B;  3I71 A;  4LIU A;  3JRI A;  2R7Q A;  3K2A A;  5JHF A;  1N75 A;  3GFI A;  2ID3 A;  3L00 A;  2FBH A;  3RPU D;  1HXD A;  2HDD A;  2W48 A;  2HVS A;  3HHG A;  3GX4 X;  4HBL A;  4S04 A;  2OD5 A;  2K4B A;  2MSY A;  2LVS A;  3F8F A;  1P6R A;  2CU7 A;  4BUP A;  4UUS B;  3OYF A;  3GTP J;  1R5I D;  3H5N A;  3U9G A;  1SFE A;  3ABM H;  2AQF A;  5FKK A;  4LB6 B;  4LG0 A;  2EA4 A;  2UZK A;  2RRE A;  4IF4 A;  2ESN A;  2MW8 A;  5LHG A;  3G71 I;  3V8L A;  5KVR A;  2BW3 B;  2ZC2 A;  4Y52 J;  5C4X J;  2FUG 2;  1NG7 A;  3DP7 A;  3DTE A;  4BAY A;  4C30 A;  4MFE A;  1S7O A;  1RKT A;  2OJE D;  1D8J A;  4V19 K;  1A6Q A;  4BE2 A;  1PUF A;  4BE1 A;  1HOM A;  4O6J A;  1FBU A;  1WJ5 A;  3QPT A;  1JXS A;  1B9N A;  4KN7 X;  3H35 A;  1D3Y A;  2GXA A;  4A0Z A;  4R1H A;  1FEX A;  1LVA A;  3RZD J;  1Z6T A;  1H9G A;  2GXG A;  2O0Y A;  3KIO A;  3A2K A;  1F36 A;  2DW4 A;  2VJI A;  2WV1 A;  2Z1D A;  3X2Q H;  1S7E A;  4CZZ A;  2V9K A;  1PP7 U;  4FHT A;  1ONV A;  2F4M B;  4BJT A;  5BS6 A;  3KYC B;  3SHF A;  2KT0 A;  2EV6 A;  4A69 C;  3FMS A;  3OIP A;  5HLG A;  3R0J A;  1RNL A;  5HS7 A;  5CPR B;  3F8C A;  3CP2 A;  3LL7 A;  4O3M A;  4A3B J;  1A36 A;  2BYV E;  2HOS A;  2ZJR F;  2DMU A;  4JX5 A;  3K1M A;  2ZSH B;  4IVN A;  3RKX A;  2V26 A;  1MJB A;  1LKX A;  1GVD A;  2ESH A;  1K83 J;  2JVG A;  1ETO A;  2Y0M A;  3I5U A;  3GTM J;  3GEZ A;  4MTE A;  3HB9 A;  2HU9 A;  1FTT A;  3GO5 A;  3B73 A;  3ZN1 A;  3GBG A;  2FA5 A;  5DUI A;  5EG0 A;  3VSK A;  4DQ2 A;  1HCR A;  3CUO A;  1LFU P;  2VI6 A;  2ZFU A;  1W5S A;  1P4W A;  5IYB J;  4A3E J;  3IUO A;  4HOB A;  3CDH A;  5EF6 A;  3BTI A;  2DK5 A;  3SFI A;  2Z16 A;  4OIQ F;  3CMA I;  1KGS A;  2VKE A;  3COA C;  4J19 A;  3T8R A;  2EIL H;  2QQB A;  3MKW B;  2EJR A;  3BCA A;  3L2W A;  1Y8Q B;  3HBL A;  4HZF A;  4HX8 A;  4DBQ A;  1U0J A;  2L2O A;  2BE5 F;  4Q5S F;  2DMQ A;  5HOD A;  3BC8 A;  3NWT A;  2CSO A;  1K78 A;  1Z3Y A;  1IN4 A;  1IW7 F;  4ENK A;  1WJD A;  2DFE A;  1ZK8 A;  2IT0 A;  5GTI C;  4HX7 A;  4KJZ A;  3I58 A;  2ZJP F;  2LY2 A;  1HST A;  3WU0 A;  3D5L A;  1YS7 A;  5BNG A;  4HEA 2;  1ZTR A;  1TW3 A;  1R5G A;  4KDP A;  4XOT A;  1S5L C;  4L9T A;  4HYE A;  2XC7 A;  1ETX A;  1JTY A;  2PJP A;  4IX7 A;  1Y8R B;  4GXO A;  1L0O C;  2CQQ A;  2NVU B;  2HQA A;  2DMN A;  3WOD F;  1FOW A;  3RTR A;  3VEP A;  4YRV A;  5IT9 Z;  2LF7 A;  2FXA A;  5EZH A;  5B3S H;  5K7Z A;  3BTJ A;  2XIG A;  1XMA A;  4JBA A;  3ZMT A;  5IP9 J;  2CV0 A;  3TED A;  3PNY A;  1TQP A;  2WY7 Q;  4MEX F;  3WTW C;  2QYO A;  1T8I A;  2PG4 A;  3DPL C;  4PJL A;  4IHX A;  3HUG A;  1T56 A;  3Q0U A;  1BR4 A;  4D9J A;  4DZJ A;  5HLH A;  2H6B A;  2FNA A;  5D5W B;  1ETW A;  3OOP A;  1K6Y A;  3CCR I;  4OIP F;  1IRG A;  3MN2 A;  1R23 A;  1WGX A;  2OTL I;  1G3W A;  4DYQ A;  3RCO A;  1ZN2 A;  1MND A;  1U5T C;  2HKO A;  2ZME A;  2CQ7 A;  3K2Z A;  1VTN C;  1QZE A;  2QCO A;  3GZN B;  2EIJ H;  3GXO A;  2O03 A;  3D1N I;  1JUM A;  2C6Y A;  1SD5 A;  3HIF A;  5FD5 A;  1D0Z A;  4OU0 A;  2F5V A;  1V5E A;  2HEO A;  2F6C A;  3FHN A;  3LSG A;  4LB5 A;  2M45 A;  4BQO A;  1G3T A;  3GLX A;  1VF9 A;  4XKB A;  1IXC A;  4B09 A;  1LDD A;  3BG6 A;  4I02 A;  3CCE I;  4C2M J;  1G3S A;  2OCC H;  2VC1 A;  5FLX K;  2K5C A;  4XK4 A;  2QSH X;  1BM9 A;  1KYZ A;  2Y30 A;  3DU6 A;  3LSP A;  4Y7N J;  2OQG A;  1O3R A;  3LAJ A;  3KEO A;  2EH3 A;  2H27 A;  5D8L B;  5JVG F;  3OYK A;  1R9T J;  2NAZ A;  3E6M A;  2AXT C;  2JVH A;  2KRF A;  2RNG A;  1ENH A;  2JUG A;  3KP6 A;  2LBF A;  5A2Q Z;  2FJ1 A;  4PJJ A;  5KAF C;  3JRE A;  3SJM A;  5J8C A;  3KP4 A;  3P9K A;  2JSP A;  1FP2 A;  2RQQ A;  2GXB A;  3IRR A;  1YHQ I;  3FXU A;  3S17 J;  4LFU A;  4IPA A;  1ERD A;  2W57 A;  4JYK A;  3MD2 A;  3GZ6 A;  2A5W A;  2HTS A;  2JSC A;  1MSF C;  3S3N A;  4DOZ A;  1K6O A;  1T98 A;  3ZPL A;  3S1N J;  1F5T A;  1P4X A;  1R00 A;  1UJ8 A;  2K7L A;  3N05 A;  5TJJ A;  1O3S A;  2EB7 A;  2RC4 A;  1QZZ A;  3H0G J;  3PNT A;  3QP6 A;  4RM2 A;  3KZI C;  3W6K B;  4BH9 A;  1UAA A;  2A5Y B;  1X3W B;  1Z3X A;  1ZQ3 P;  3HOW J;  3E3V A;  2IP2 A;  3RDI A;  2P5L C;  4NC7 A;  4MGR A;  2WB1 N;  1LUJ B;  2MC3 A;  3F72 A;  3I64 A;  3DCF A;  2LMD A;  4Y4R A;  2F5E A;  4I01 A;  4CIC A;  2UXX A;  1DU0 A;  2HDC A;  3IKT A;  1TWG J;  2M0M A;  4I09 A;  1TLH B;  4KT6 A;  2Z9O A;  4A3F J;  4AWX B;  4ETS A;  4CHU A;  4YEL A;  3C1D A;  1TC3 C;  2KKO A;  4G6T B;  3BR0 A;  4XN3 A;  1D0X A;  1WI9 A;  2A05 A;  5D6E A;  4CUG A;  4LLL A;  2HZD A;  3HZJ A;  1V54 H;  5GAE J;  3S3O A;  5LHH A;  1VQ5 I;  4BGD A;  2KL4 A;  3JRC A;  1EH7 A;  2E7X A;  2OA4 A;  3WHB A;  3IWZ A;  2QVO A;  3HKZ A;  1QHG A;  3A0B C;  4BE0 A;  1ETV A;  5GPA A;  3BP8 A;  1KQ0 A;  3KZZ A;  3NRV A;  2M7B A;  3UNG C;  3LST A;  2H94 A;  4NNJ A;  2IXS A;  3N4M A;  1D8K A;  2OQR A;  5H20 A;  1GXQ A;  4FTH A;  2VJ4 A;  1YI2 I;  2HOA A;  3LQR A;  3D5R C;  2DFI A;  2YUS A;  2ZJQ F;  4LK1 F;  5CYV A;  1EF4 A;  3QYB A;  5LRR A;  1XC5 A;  3KP7 A;  4A93 J;  2VLA A;  1FY7 A;  1SMT A;  1Z67 A;  2XAG A;  2ELJ A;  4EQQ A;  1QGP A;  2LKS A;  3QU3 A;  5LGN A;  1OYW A;  3E6B A;  2D1H A;  3NAR A;  3OYH A;  3JCU C;  4NHJ A;  1JUS A;  2CW7 A;  4BAC A;  1I1S A;  3HOU J;  5HNH A;  1YW7 A;  4N4O B;  3LNQ A;  2M2E A;  3K0L A;  3HPH A;  1W4M A;  2HI3 A;  1S29 A;  2K02 A;  3DTK A;  4Y17 A;  1BR1 A;  3MQ0 A;  5F0C A;  4XIC A;  2R0Q C;  1P7J A;  5M3M J;  3JRH A;  2JMW A;  4B4C A;  4RM3 A;  2ZCW A;  3CD6 I;  2ME0 A;  2V9V A;  2DPD A;  2BY2 A;  3GTG J;  1JHF A;  2W24 A;  2E5Z A;  3RKY A;  4C3I J;  1VQ8 I;  3C18 A;  2QF7 A;  4DNC A;  3WTT C;  2VXD A;  4EAT A;  4EV0 A;  1MMG A;  2KRC A;  4GCV A;  3OS0 A;  2E35 A;  1OYY A;  2W4S A;  1X4P A;  4HF2 A;  5HLT A;  1V4R A;  2VKD A;  3ISP A;  2X4H A;  4N9I A;  1U8B A;  5FLM J;  2IS1 A;  3ZOB A;  1T39 A;  4M3B A;  1R6R A;  2L9V A;  2OTJ I;  2OV7 A;  3CUQ C;  4B48 A;  1RI7 A;  2F48 A;  3JR9 A;  1YOV B;  1K61 A;  4RGU A;  4GYI A;  1JT6 A;  4WX9 A;  5D6F A;  1JE8 A;  2DXI A;  4AIJ A;  5LHI A;  1PUF B;  2RV8 A;  1YO5 C;  1WPK A;  4D5F A;  4M6Y A;  3I9V 2;  2E71 A;  3WGH A;  4UVB A;  3QPS A;  3MZ8 A;  4A0Y A;  5KNL A;  2O61 A;  1FSH A;  2PFB A;  2L9R A;  2X0L A;  1IDY A;  4LIV A;  2H1K A;  3WTY C;  1TW2 A;  2GIZ A;  2QBY B;  2K3P A;  3LQQ A;  2VON A;  4XM3 A;  1WKM A;  4OMZ A;  4EGZ A;  3CLQ A;  5K7H A;  4L9J A;  2RNJ A;  3BWG A;  4U88 A;  2E36 A;  3PL8 A;  1RRJ A;  4RLQ A;  2QKL B;  4IRG A;  3CCQ I;  4GGG A;  4PJM A;  1T0F C;  2DOE A;  1SFX A;  3M9A A;  4HST A;  2ICW G;  3FXQ A;  2P4W A;  3ABL H;  3Q0W A;  4RMN A;  3SFZ A;  4B3X A;  5C44 J;  1IN8 A;  1I3Q J;  1KU9 A;  1SD6 A;  1U6G A;  1XDU A;  3CUQ B;  4FX4 A;  2D5V A;  4HNT A;  3CMY A;  3F3X A;  2BOL A;  3E0J B;  2W00 A;  2G0E A;  2UXN A;  4X1E A;  2HGC A;  2GA2 A;  4I76 A;  3VYU B;  1LE8 A;  2MAB A;  1FMV A;  1VQK I;  1R36 A;  1QZY A;  3H1C A;  4BHC A;  1FP1 D;  5E1X A;  2MYS A;  3PNV A;  4CSW A;  4M3F A;  4PDK A;  1OYI A;  2TRT A;  3O8H A;  4EJW A;  4KMU X;  1TWF J;  2HXO A;  2HNH A;  2QWW A;  2DA3 A;  2GA1 A;  1V5F A;  4CDG A;  1Y6I A;  2QQA A;  4OOI A;  1JKR C;  2D45 A;  1REP C;  4LIT A;  4XKW A;  3GTQ J;  2Y0S N;  1R58 A;  2IA1 A;  2EZH A;  3HSR A;  4OAZ A;  4ABZ A;  4OMY A;  3VSL A;  2K9S A;  3LA7 A;  3HG9 A;  2DN0 A;  2X6W A;  2EFO A;  2FSW A;  1BC7 C;  4A5M A;  1G2H A;  4KT5 C;  4XON A;  4U7D A;  2CV2 A;  4RDU A;  3CME I;  1U5T A;  1VI0 A;  1S9H A;  2NNN A;  1PJR A;  3GFJ A;  2FQ3 A;  3BJ6 A;  1OR7 C;  2OZU A;  5GP9 A;  3LSM A;  1FYL A;  3BR5 A;  3S1M J;  1KON A;  3F8M A;  1STZ A;  2ETH A;  3CCY A;  4J00 A;  4WXC A;  3V42 A;  4M3G A;  1TWC J;  1ZR2 A;  1RET A;  4RAZ A;  2YU9 J;  4KA4 A;  1FZP B;  4C3J J;  3VYS B;  1IRZ A;  1V3F A;  3S1R J;  5F1J A;  4M6V A;  1JJ6 C;  3J7A O;  2HDW A;  2MGQ A;  1ZLJ A;  2VQG A;  2VAS A;  4LK0 F;  5D5U B;  3CF5 F;  4XNF A;  1XMK A;  3I55 I;  1ZG3 A;  2LY1 A;  3HUG B;  4MFD A;  3CCS I;  5FRO A;  2VKV A;  3VB2 A;  1ZRC A;  2WAE A;  4AUX A;  2VXZ A;  3FIS A;  1J2X A;  5K5R A;  4G7H F;  4A3M J;  4BXX J;  3IH4 A;  2YSR A;  4IXA A;  5BPD A;  2XAF A;  2ZSI B;  2V9P A;  4A2U A;  1N77 A;  3FHZ A;  2BXY A;  2ZME B;  1D5V A;  1W0U A;  4IQ4 A;  1JKO C;  1MH3 A;  1TWH J;  1X1D A;  3IH3 A;  3ZR8 X;  2F4I A;  5FLV A;  4NDL A;  5IP6 A;  4MNU A;  2CO5 A;  3F21 A;  3CC7 I;  4YFK F;  1XSD A;  3VPR A;  3HGG A;  2KMU A;  5FO5 A;  1ZGA A;  3A1Y A;  3M8F A;  2I5U A;  4PGH A;  3BZ6 A;  4PZJ A;  2IS2 A;  2CQK A;  4DIQ A;  1RPW A;  3TOA A;  4MTD A;  1H9T A;  2YPR A;  4QSH A;  5ED4 A;  2NVQ J;  2BY0 A;  2CW0 F;  3PM1 A;  4WCG A;  1H88 C;  1X1P A;  1DDN A;  4KFC A;  2F5D A;  1C0W A;  2V1U A;  1LQ1 A;  4TV7 A;  4ZC3 A;  3ERM A;  2R93 J;  4UHT A;  2DFH A;  1FIP A;  4N4N B;  2LBF B;  1EA3 A;  2LFB A;  1WVR A;  2K4J A;  3K4L A;  1DPU A;  2WTE A;  2M5W A;  5D4S A;  5K7F A;  4WXH A;  1Q1H A;  2CUE A;  3H0D A;  2R5Z A;  1OFC X;  5IPA A;  2CG4 A;  1L3L A;  2VPR A;  3SZT A;  1FOY A;  3ZRG A;  5EGO A;  2EFW A;  2CH0 A;  1HW5 A;  1B6A A;  1SAX A;  2NYX A;  4G94 A;  3BTL A;  4HX4 A;  2F5C A;  1NTC A;  3K4C A;  2WAQ A;  2HVQ A;  1IO2 A;  3O3K A;  5C3E J;  1E3O C;  4QPO A;  1N25 A;  1IUF A;  3FM5 A;  3PFI A;  1Z77 A;  3P5J A;  3KEQ A;  3SZP A;  1WWX A;  4RAY A;  1MNE A;  4PSX A;  2DO7 A;  2XAH A;  3BJO A;  3WTS C;  2JA5 J;  2DBB A;  2M4K A;  3CC4 I;  3G4S I;  4BQN A;  4ZH4 F;  2HPI A;  2H8R A;  2PI0 A;  1ON2 A;  3IH2 A;  3T0Y A;  5E20 A;  4F91 B;  4RGR A;  2HOT A;  1F1Z A;  2TDX A;  3WTX C;  1JT0 A;  4A6D A;  2W7N A;  2VC0 A;  3KPH A;  3RYP A;  4C2T A;  5KHD A;  2LYC A;  1WQ2 A;  1D1A A;  2JQ7 A;  2DTZ A;  4HAM A;  3E7L A;  4P96 A;  4JQF A;  3TQN A;  3DTI A;  3IAM 2;  2FEZ A;  3GVA A;  3C3W A;  4XSZ F;  1VQ7 I;  5DS9 A;  1QO0 D;  2F4O B;  4NC8 A;  2A6T A;  1J75 A;  3OYL A;  2FF4 A;  4UXN A;  1DGW Y;  2UUZ A;  4RGX A;  4ZDO A;  3S32 A;  2XB0 X;  3TL4 X;  2JRM A;  4ZDP A;  4I0B A;  1P4A A;  1FT9 A;  2NS7 A;  3HRT A;  2KDZ A;  2KJB A;  1SAN A;  3FMR A;  2EPF A;  1HKS A;  3EPZ A;  3ZP5 A;  3FXL A;  3MKY B;  4RBO A;  1VQO I;  5L3C A;  3OYD A;  1ZHF A;  5DCM A;  3BQY A;  2A6E F;  2LK2 A;  2QBY A;  1YX5 A;  2DJN A;  4MQ9 F;  5M5Y J;  3D0S A;  5B5E C;  3MFK A;  2HYJ A;  5D5V B;  4G9Y A;  3K7A J;  1PUE E;  4PJ0 C;  4PFO A;  1B8I A;  3WU1 B;  3OYM A;  4BHP A;  3VOE A;  4RB1 A;  5EEG A;  2FU4 A;  2MBF A;  1TT0 A;  3OL3 A;  1ITY A;  5KAI C;  3TP0 A;  3I59 A;  4GO1 A;  4V2G A;  1KU2 A;  4ZTF A;  1FBQ A;  1UFM A;  1XD7 A;  4A3J J;  5FJ8 J;  3CUQ A;  2HOE A;  1VQN I;  4H4K C;  4V2F A;  1ZG1 A;  3TO6 A;  3C7J A;  4B43 A;  2KZG A;  1TBX A;  2DPU A;  2ZBK A;  1X3Z B;  4ON0 A;  3FIW A;  3FWE A;  4Q47 A;  1R4M B;  3R6S A;  3CCM I;  5IOZ A;  1W36 C;  2XVC A;  2DA7 A;  3HRM A;  4D0P A;  1FOK A;  1R4N B;  3OSG A;  3U1D A;  1S6L A;  3BG7 A;  2L4A A;  4RS8 A;  3ZCO A;  3T5X A;  5CQE A;  4KYW A;  1X19 A;  2QQ9 A;  5L3G A;  3JSP A;  4E7S A;  1OCO H;  2DQR A;  1POG A;  1ON1 A;  2XDV A;  3P7N A;  3DWL E;  3OR1 C;  2BZT A;  4XLF A;  1H8A C;  2R92 J;  4BEH A;  1T0F A;  5E79 C;  3HYI A;  4BU2 A;  3CDI A;  4NBQ A;  5F6F A;  1NK3 P;  2XB5 A;  5F1R A;  1XX5 A;  5LRS A;  3A01 A;  1ORK A;  5FLX Z;  1GV2 A;  1UCR A;  2DI3 A;  2LOO A;  1SVO A;  1YS6 A;  2P6T A;  2R4G A;  3HOS A;  3GLL A;  2CQN A;  1KZH A;  2MG4 A;  3F6V A;  4HQE A;  2M9H A;  4JX6 A;  1QHH D;  3UR3 C;  1HQC A;  1IC8 A;  2XGE A;  2CGP A;  3FKI J;  5B66 C;  2DOA A;  2IJL A;  2EA2 A;  4NQW A;  1MZB A;  2K86 A;  4CXF A;  3UKG A;  4LLN A;  3OV8 A;  2GLO A;  3C2G A;  4KN4 X;  1OCP A;  1GV5 A;  4KIG A;  4IHV A;  4XOR A;  3E6C C;  1MMN A;  4BXF A;  1GUU A;  4CO8 A;  4WXD A;  1KU3 A;  4LG3 A;  5CVR A;  2JRT A;  5EEA A;  4ZTJ A;  1B9M A;  4G8X A;  1RR8 C;  2R7S A;  4ZYD A;  5J3L A;  2L01 A;  2KIS A;  5E8G A;  4K2E A;  2FX0 A;  5E1Z B;  5M5X J;  2BEO A;  3HOZ J;  1G4D A;  1FC3 A; 
#chains in the Genus database with same CATH homology
 2E2I J;  3JRB A;  3BG5 A;  2R5Y B;  1F43 A;  4W97 A;  3NAR A;  4BBR J;  4QTR A;  4AYB N;  1JUS A;  3JRF A;  1LE8 B;  3S16 J;  3S2D J;  2LY9 A;  3GTO J;  2E2H J;  3HOU J;  3LNQ A;  2CJJ A;  1CQT A;  2EQR A;  9ANT A;  2M2E A;  5JLW A;  1U9O A;  2HI3 A;  3S2H J;  2B63 J;  3H3V K;  1A5J A;  1OCT C;  5F0C A;  4L5E A;  1XS9 A;  4A3D J;  4XIC A;  1D5Y A;  2DA2 A;  1P7J A;  5M3M J;  3JRH A;  2JMW A;  4B4C A;  2R0Q C;  1HLV A;  5JLX A;  4IHW A;  1FIA A;  3GTK J;  2ME0 A;  1FJL A;  1AU7 A;  3GTG J;  5IOY A;  3L1P A;  4AC0 A;  4C3I J;  2XGC A;  2NVY J;  5DTD A;  2QF7 A;  1JKQ C;  3BR1 A;  1JTX A;  1B72 A;  3B6A A;  2XPW A;  1UHS A;  5FKL A;  3S1Q J;  5FKM A;  2EBI A;  1ZGW A;  1WI3 A;  1WH7 A;  3JRD A;  2CUF A;  1YRN B;  4DYR A;  1U8B A;  5FLM J;  5F27 A;  3ZOB A;  4M3B A;  4UUT A;  2GM4 A;  3TP3 A;  3G1O A;  5GPC A;  3JR9 A;  1K61 A;  1X2M A;  2VUM J;  1JT6 A;  1UMQ A;  3HEF A;  2K9N A;  4D7N A;  3M4O J;  2LD5 A;  2JA7 J;  4B3A A;  1PUF B;  4GFB A;  2L7M P;  3FK7 A;  5J1U A;  1WPK A;  4D5F A;  4MIM A;  1I50 J;  3A03 A;  3C2B A;  4M3E A;  3QPS A;  2DMP A;  2COB A;  2L9R A;  4S0H B;  1IDY A;  1AKH A;  1JUP A;  2JJ7 A;  2H1K A;  4D5C A;  3RKQ A;  1T33 A;  2HQ5 A;  2DA5 A;  5IYD J;  3OIO A;  2JN6 A;  5K7H A;  5J1R A;  2NVT J;  1RKW A;  2Y2Z A;  5C4J J;  1U78 A;  2DMT A;  3ZQL A;  2OF7 A;  3F0C A;  3Q0W A;  2I10 A;  2XPV A;  5C44 J;  3OOU A;  1I3Q J;  3HOY J;  1FTZ A;  2D5V A;  1VND A;  1WCM J;  3CQZ J;  1RES A;  3CMY A;  1MSE C;  2R5Y A;  4A3C J;  1Z0X A;  5M5W J;  2G0E A;  4X6A J;  2IBD A;  1MH4 A;  4X1E A;  4I76 A;  4A3I J;  2LKX A;  2N8G A;  1LE8 A;  2M8G X;  3BT9 A;  4JX4 A;  2AHQ A;  4FE4 A;  2DA4 A;  2EZK A;  2WAQ N;  4XRM A;  2K9Q A;  3QPL A;  4M3F A;  1TWA J;  2TRT A;  1ETY A;  3O8H A;  5E3M A;  3ZQC A;  1TWF J;  2HXO A;  1JJ8 C;  1GDT A;  2DA3 A;  1ZR4 A;  3Q0V A;  3NAU A;  1JKR C;  2ME6 A;  1QPI A;  3JRI A;  2Y0S N;  2R5Z B;  2CQX A;  3K2A A;  2O8K A;  3GTQ J;  2EZH A;  1Y1W J;  4ABZ A;  3QQA A;  1IDZ A;  3MKL A;  2K9S A;  2LLK A;  2DN0 A;  2ID3 A;  2CRG A;  5EGO B;  2EZL A;  2HDD A;  1G2H A;  4CYC B;  2W48 A;  1XG1 A;  2JWT A;  4DW6 A;  4RDU A;  2MSY A;  2LVS A;  4G12 A;  1VI0 A;  2CU7 A;  3HM5 A;  4W1U A;  2DA6 A;  4UUS B;  1YRN A;  3GTP J;  3HDD A;  2EZI A;  5GP9 A;  2NVX J;  5FKK A;  3S1M J;  3BR5 A;  4BKX A;  3CCY A;  3S15 J;  4D7M A;  2MW8 A;  4Y52 J;  5C4X J;  4M3G A;  1TWC J;  3CDL A;  1ZR2 A;  1RET A;  2YU9 J;  4IEJ A;  1WH5 A;  4C3J J;  1IRZ A;  3S1R J;  3ZQI A;  5F1J A;  4MFE A;  1RKT A;  4M6V A;  4XRS G;  1JJ6 C;  1PUF A;  2MGQ A;  5E3L A;  3ZQG A;  1HOM A;  1LFB A;  1IGN A;  3BQZ A;  1HDP A;  4MFD A;  2VKV A;  4FE7 A;  5F0F A;  4AUX A;  1FEX A;  3FIS A;  3RZD J;  1F36 A;  2WV1 A;  4A3M J;  4BXX J;  4M3D A;  1S7E A;  3IH4 A;  3BR6 A;  2X9D A;  1Y1V J;  3A02 A;  2XSD C;  3GTJ J;  2YS9 A;  2KT0 A;  4A69 C;  1W0U A;  1JKO C;  1MH3 A;  1TWH J;  1U9N A;  5E3N A;  3IH3 A;  4A3G J;  5FLV A;  4DYC A;  4NDL A;  5IP6 A;  3PO3 J;  2JA8 J;  5J1Y A;  2JK3 A;  3BR2 A;  3OSF A;  4A3B J;  2ZB9 A;  3VPR A;  3HGG A;  2HOS A;  2DMU A;  4JX5 A;  2NS8 A;  1GVD A;  1K83 J;  1ETO A;  3GTM J;  1RPW A;  1A6I A;  3I4M J;  4QSH A;  3HB9 A;  3BR3 A;  2NVQ J;  1FTT A;  3GTL J;  1HF0 A;  3PM1 A;  2E2J J;  3GBG A;  1H88 C;  3DEW A;  5EG0 A;  1B8I B;  1QVT A;  3B6C A;  1HCR A;  2LP0 A;  1LFU P;  5F04 A;  2VI6 A;  5IYB J;  4A3E J;  2IEK A;  2DA1 A;  4DZP A;  5EF6 A;  3BTI A;  2R93 J;  4MLO A;  3SFI A;  1FIP A;  4LOC A;  2VKE A;  4J19 A;  2LFB A;  4HNV A;  3HBL A;  2E1O A;  5K7F A;  2CUE A;  2DMQ A;  4XRS A;  5EYR A;  2X6O A;  5HOD A;  2R5Z A;  1OFC X;  5IPA A;  2ECB A;  2NOG A;  3IV5 A;  3FK6 A;  2VPR A;  1ZK8 A;  1GT0 C;  2Y9Z A;  5EGO A;  2L7F P;  2L7Z A;  5BNG A;  3ZQF A;  1ZTR A;  3BTL A;  4CYC A;  1NTC A;  1E3O C;  5C3E J;  3M3Y J;  2X48 A;  3O8G A;  1IUF A;  1Z77 A;  1ETX A;  1JTY A;  2CQQ A;  4UUS A;  2FD5 A;  2DMN A;  2JA5 J;  4FIS A;  5EZH A;  5K7Z A;  3BTJ A;  1BW6 A;  2H8R A;  3IH2 A;  5IP9 J;  3TED A;  4XID A;  1HDD C;  2HOT A;  1JT0 A;  3A01 B;  1X2N A;  2M34 A;  4IHX A;  1ZKG A;  3G1L A;  4BBS J;  1T56 A;  4I6Z A;  4FCY A;  2DTZ A;  3Q0U A;  3E7L A;  2Y9Y A;  3HGY A;  4DZJ A;  3BTC A;  3SDG A;  1SFO J;  5IP7 J;  1ETW A;  3LOC A;  1X58 A;  3MN2 A;  1WGX A;  1MNM C;  5DS9 A;  4DYQ A;  2ID6 A;  2PMZ N;  1O4X A;  3MVP A;  2XB0 X;  5E3O A;  3RQI A;  4EEF G;  2QCO A;  2NS7 A;  3G1M A;  2KDZ A;  1JUM A;  3D1N I;  1SAN A;  5IYC J;  3LSG A;  2JA6 J;  1QRY A;  3W6V A;  4RBO A;  1VF9 A;  4B1R A;  3WHC A;  5EDN A;  3BQY A;  2LK2 A;  4C2M J;  3Q3S A;  2DJN A;  5M5Y J;  5F08 A;  2M0C A;  4XK4 A;  4C3H J;  2HYJ A;  2HXI A;  2Y30 A;  1IV6 A;  2R7Z J;  1DU6 A;  3LSP A;  2LR8 A;  3K7A J;  4Y7N J;  1B8I A;  2EH3 A;  3HOX J;  1R9T J;  1ITY A;  3TP0 A;  3BG9 A;  3ZQH A;  4V2G A;  1ENH A;  3JRE A;  1W0T A;  2FJ1 A;  3SJM A;  4MO7 A;  2TCT A;  4A3J J;  5FJ8 J;  1Q1V A;  4V2F A;  3S17 J;  1UG2 A;  4JYK A;  1JKP C;  2GBY A;  3JRG A;  2L0K A;  3FIW A;  1BW5 A;  4BY7 J;  2XGD A;  5IOZ A;  1APL C;  1MSF C;  2DA7 A;  3BG3 A;  1MBF A;  3OSG A;  3S1N J;  2IAI A;  2P81 A;  3PO2 J;  1OJL A;  1JGG A;  3RZO J;  2RAE A;  2O7O A;  1POG A;  2AO9 A;  1B72 B;  3H0G J;  1BL0 A;  3TW6 A;  1MBK A;  1ETK A;  1H8A C;  4A3K J;  2R92 J;  2OPT A;  1ZQ3 P;  3S14 J;  2K40 A;  3HOW J;  1NK2 P;  3I4N J;  1MBH A;  1BA5 A;  2LTP A;  1NK3 P;  2WB1 N;  2XB5 A;  3DCF A;  1MBG A;  3A01 A;  1H89 C;  1DU0 A;  2FQ4 A;  5FKO A;  1ORK A;  1P7I A;  4JP0 A;  1AHD P;  1GV2 A;  5EZG A;  1TWG J;  3LSR A;  2ELK A;  4A3F J;  1TC3 C;  3BR0 A;  1RR7 A;  3LSJ A;  2MG4 A;  2M9H A;  4JX6 A;  3JRC A;  1IC8 A;  2XGE A;  2E19 A;  3FKI J;  5FKN A;  1IG7 A;  1I6H J;  1AKH B;  3WHB A;  5F0H A;  2XRL A;  1BJZ A;  3UKG A;  2GLO A;  1VFC A;  1ETV A;  5GPA A;  1OCP A;  1GV5 A;  5M3F J;  2Y31 A;  4IHV A;  3TW7 A;  3HKZ N;  1GUU A;  2O9L A;  5EG0 B;  4IHY A;  4BY1 J;  5EEA A;  1MBJ A;  4FTH A;  2HOA A;  5J3L A;  3HOV J;  2XPU A;  2YUS A;  2FX0 A;  2ECC A;  5M5X J;  3HOZ J;  1IJW C;  4A3L J;  1EF4 A;  4QIW N;  1QVU A;  1ETQ A;  1XC5 A;  3JRA A;  1MBE A;  4A93 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...