2EBIA

Arabidopsis gt-1 dna-binding domain with t133d phosphomimetic mutation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
b'KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPDMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA binding protein GT-1
publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ebiA01
2P81A 5DS9A 2X48A 2NVTJ 3GTOJ 4A3KJ 3OOUA 3FK7A 4M3EA 3QQAA 4DYQA 1I6HJ 2E19A 3HOVJ 4M3GA 2ECBA 2LY9A 3FIWA 3IH3A 2YU9J 4A3MJ 3IH4A 1POGA 2YUSA 3GTPJ 3RKQA 4JX4A 3Q0UA 5BNGA 3GTQJ 4J19A 4IHYA 3K2AA 3IH2A 1OCPA 2LR8A 3OIOA 4M6VA 2VKEA 1IGNA 2D5VA 2AO9A 2FQ4A 4FE4A 1MBKA 3TEDA 4QTRA 3ZQCA 2O8KA 1NK3P 2L7FP 1JKPC 2LLKA 1UG2A 1IJWC 3S17J 3BQYA 4NDLA 5EEAA 5FKLA 4BY1J 2DA5A 3MKLA 1ETXA 2HYJA 1LE8A 2HI3A 4HNVA 4UUTA 3JRHA 3ZQHA 5F0HA 1IUFA 4BY7J 2R5ZA 1B8IA 5IP6A 4XICA 1VI0A 4V2GA 4FTHA 2E1OA 4I76A 1LE8B 3MN2A 1EF4A 3D1NI 1K61A 2B63J 5K7ZA 1AHDP 3BTLA 3JRGA 2R5ZB 4D7MA 1B8IB 2LFBA 3LSGA 2Y9ZA 2R92J 2M9HA 1BL0A 3ZQFA 2HQ5A 3GTGJ 1VFCA 5E3MA 2DMUA 2M34A 1O4XA 2GM4A 1JKRC 5IYCJ 2XGEA 3ZOBA 2DMTA 4FE7A 1QPIA 3BG3A 5DTDA 1S7EA 1RKTA 2CJJA 4MFDA 2XRLA 2Y9YA 3W6VA 2XPUA 1RPWA 2FJ1A 3SFIA 3HOUJ 1T56A 1Y1WJ 4B3AA 1T33A 4XRSG 5F0FA 2EZKA 2NOGA 4A3DJ 3BR1A 3I4MJ 1ETYA 3TP0A 5M3MJ 2IEKA 1QVTA 2YS9A 4D7NA 3JREA 1SANA 4DYRA 5FKKA 1IRZA 2M2EA 4FISA 1NK2P 2LKXA 2N8GA 1W0UA 1FJLA 2EBIA 2JWTA 5J1YA 5F0CA 5C44J 5M3FJ 3S2DJ 3M3YJ 2ECCA 1QRYA 5IOYA 1F36A 5J1UA 2L7ZA 2GBYA 1MBJA 2DMQA 4MO7A 3WHBA 5M5XJ 3DCFA 4I6ZA 1ZR2A 1TWCJ 2FD5A 5F1JA 4EEFG 1UHSA 3RQIA 1GV2A 4A3IJ 3UKGA 1HLVA 2COBA 1ZTRA 1R9TJ 5C4XJ 4A3EJ 4W97A 1JGGA 2XPVA 3IV5A 3CDLA 1E3OC 4A3LJ 3QPSA 5FLVA 3O8GA 5EG0A 2EZLA 3HB9A 3TW7A 1U78A 3LNQA 3DEWA 1JJ8C 2JMWA 2Y30A 5IYBJ 1APLC 3S1MJ 4C3HJ 5E3NA 1OJLA 2LVSA 5EG0B 3LSJA 1HF0A 3S2HJ 3BT9A 1I3QJ 3K7AJ 2NVXJ 4BXXJ 3HOXJ 5M5WJ 3JRAA 1GDTA 3S1RJ 1XG1A 1AU7A 1TWAJ 3SJMA 3OSGA 1U9NA 4A93J 4DZPA 3HBLA 1JUPA 3A01A 1FEXA 3RZDJ 3S16J 3TP3A 4C3JJ 4D5CA 1PUFA 1JT6A 1TC3C 2KDZA 3JR9A 3HDDA 4RBOA 1WPKA 3BR5A 4D5FA 2DA4A 3JRBA 5C4JJ 1BW6A 3A01B 2HXOA 3NARA 1PUFB 5F08A 1MSFC 5HODA 1JJ6C 4X6AJ 1OCTC 5FLMJ 3ZQIA 1U8BA 4V2FA 1ZR4A 4XRSA 2GLOA 2JN6A 3QPLA 1JUMA 4GFBA 1ETQA 2R93J 4JYKA 2DTZA 1TWGJ 2L0KA 5EYRA 3PO3J 2DA7A 2ELKA 2XSDC 1VNDA 1ENHA 2RAEA 3B6AA 5GP9A 4IHXA 3CQZJ 3BR3A 2Y31A 1RESA 1JKQC 1WGXA 2LP0A 2O9LA 1FTZA 1Z0XA 1MBFA 1ITYA 5F04A 2CUEA 3PO2J 3Q0VA 1MBHA 2JA6J 2MGQA 5F27A 2PMZN 4C3IJ 1G2HA 4ABZA 1H89C 5EZHA 3GBGA 2DA3A 4XIDA 2NVQJ 2JA7J 3LOCA 1IDZA 4M3FA 4QIWN 3HOWJ 2E2HJ 2IBDA 3MVPA 2JJ7A 4DYCA 1GT0C 4XK4A 4A3CJ 4XRMA 4DZJA 4C2MJ 1CQTA 2VUMJ 2H1KA 1MH3A 2CQQA 1NTCA 3SDGA 4A3GJ 1HOMA 2NVYJ 1WCMJ 2K9QA 1IC8A 2HOTA 5EGOA 2ME0A 2XB0X 3BTCA 5E3OA 4AC0A 2WB1N 1TWHJ 4M3BA 5IP9J 1DU6A 5J3LA 3HGGA 2VKVA 2NS7A 2XPWA 2EZIA 1ZK8A 5FKMA 1A6IA 3WHCA 3BR2A 3S1NJ 5M5YJ 3CMYA 3BG9A 1U9OA 2OPTA 1IG7A 1LFBA 3JRFA 3GTLJ 2ID6A 2KT0A 5EGOB 3A03A 5IP7J 1A5JA 2QF7A 4MLOA 4AYBN 3OSFA 1D5YA 3FKIJ 4IHVA 2DA1A 5JLWA 4W1UA 3TW6A 5E3LA 4A69C 3O8HA 1WI3A 1MBGA 1MSEC 3FISA 1RKWA 4MIMA 1JKOC 1IDYA 3HOYJ 2DN0A 1BJZA 2EQRA 1GV5A 4UUSA 5IPAA 2MG4A 3L1PA 3S1QJ 2R7ZJ 2DA2A 1X2MA 3GTMJ 3BR6A 3CCYA 2I10A 5K7HA 1ETVA 2X6OA 1RR7A 2JK3A 4Y52J 2HXIA 1UMQA 4UUSB 3C2BA 3JRCA 4CYCA 1X2NA 5K7FA 1XS9A 2E2IJ 1MNMC 2R0QC 1ZGWA 2ZB9A 1ETWA 1JT0A 1MH4A 4QSHA 1ETKA 2M0CA 2ME6A 4BKXA 9ANTA 3LSPA 3GTKJ 2R5YA 1QVUA 2DMPA 2EH3A 3BQZA 2LK2A 1FIPA 5C3EJ 2XGDA 3BR0A 4CYCB 1TWFJ 3BTJA 1ORKA 5EF6A 1X58A 1ETOA 2EZHA 2LD5A 1SFOJ 2L9RA 2DJNA 5FJ8J 2ID3A 4A3JJ 2Y2ZA 2R5YB 2MSYA 3HKZN 4LOCA 1DU0A 5IYDJ 1AKHA 2K40A 2X9DA 4S0HB 2G0EA 3JRDA 3B6CA 3H3VK 1VF9A 3S14J 1Q1VA 2WV1A 3G1OA 3HM5A 2HOSA 3HGYA 1HDDC 5GPAA 1F43A 1IV6A 2JA8J 2K9SA 4JP0A 3PM1A 3ZQGA 1JTXA 1AKHB 2M8GX 5EDNA 1GVDA 3I4NJ 2QCOA 4RDUA 1JUSA 2WAQN 4JX6A 5J1RA 2E2JJ 3G1MA 1H88C 4BBRJ 2OF7A 3Q3SA 1MBEA 3BTIA 1HCRA 3F0CA 1HDPA 1P7JA 2DMNA 1FIAA 2L7MP 4IEJA 1ZKGA 4M3DA 3FK6A 1RETA 2CU7A 4MFEA 5GPCA 3S15J 4IHWA 2HOAA 1YRNA 3NAUA 2HDDA 4JX5A 1FTTA 1LFUP 4A3FJ 1XC5A 2H8RA 1BW5A 4FCYA 1P7IA 2DA6A 3RZOJ 3VPRA 5FKOA 2VPRA 2TCTA 3A02A 3JRIA 2AHQA 3GTJJ 4L5EA 2NS8A 1YRNB 2LTPA 4BBSJ 4G12A 2O7OA 1Z77A 2IAIA 1H8AC 2JA5J 3BG5A 1Y1VJ 2Y0SN 2FX0A 2VI6A 1W0TA 5IOZA 2W48A 1B72A 5JLXA 1BA5A 2MW8A 4DW6A 4Y7NJ 3HEFA 3H0GJ 3G1LA 5FKNA 4B1RA 1GUUA 2CRGA 3E7LA 2CUFA 4AUXA 1WH5A 1WH7A 1I50J 2TRTA 2XGCA 3M4OJ 2XB5A 1ZQ3P 2CQXA 3HOZJ 1B72B 3ZQLA 4A3BJ 3LSRA 4B4CA 1K83J 1OFCX 1JTYA 4X1EA 5EZGA 3Q0WA 2K9NA
chains in the Genus database with same CATH superfamily
2H6CA 1R36A 3WE2A 2DODA 2XIGA 3HUGB 4OMZA 3TO7A 2LY9A 3R6SA 3WTZA 4FQGA 3GMEA 3ZRGA 3IH3A 2CGPA 2L4MA 2P6SA 3IH4A 3GTPJ 3GTQJ 5DD8A 5BNGA 2IJLA 3SZGA 1ZH5A 3RJPA 4C9YA 2LR8A 4H0EA 3HSFA 4A5MA 4AIHA 1MBKA 1R5HA 5HDGA 3ZQCA 2ETHA 2O8KA 2XAHA 1LJ9A 1YE9A 1IJWC 1WKMA 4MGRA 3S17J 2GXGA 4Y4RA 4D0PA 3ZCOA 4XBFA 1MDMA 3A2KA 2XF6A 4BY1J 2ZBKA 1WJEA 2BY1A 4XONA 4RGUA 2K27A 2Z33A 4H4KC 3HHHA 2IS2A 2R7SA 5ICFA 1RR8C 2JVHA 2KIQA 4KMUX 3ZQHA 5F0HA 2KIMA 2VL8A 4XOTA 3I56I 4RS8A 4RLFA 2R5ZA 2WY7Q 3DPTA 5IP6A 3CCQI 1LKXA 4IRIA 2EFPA 1VI0A 1DPRA 4V2GA 2E1OA 3HL2A 2F48A 1LE8B 1EF4A 3F72A 1DUXC 2IRFG 1EH6A 4J00A 2O8XA 5K7ZA 4IVNA 1JXSA 3BTLA 1I3AA 4F52A 1TTYA 2LFBA 3LSGA 1B8IB 2JUGA 4IL6C 4MHGA 2QA4I 4C2UA 2FMYA 2VQHA 3GTGJ 4HRIA 1VFCA 2HWVA 3TQNA 3RSNA 1QO0D 1O4XA 5DCMA 5IYCJ 3JTGA 1LDKB 4FE7A 1CGPA 1YW9A 3O6BB 2CJJA 4MFDA 2XRLA 4Y17A 1R71A 3W6VA 1R23A 2XPUA 2DU9A 3CUQB 2QSGX 3SFIA 1IXRC 3QAHA 3ZPLA 2ZFWA 2NOGA 5FD5A 5CVIA 1U3EM 1VQ9I 1ETYA 1WJCA 1LDDA 3FX3A 4E7LA 4P96A 1ZN2A 1G3SA 4XMYA 3OWTA 3D5RC 3KX2A 3LSMA 4Q4ZF 1X3ZB 4FISA 2PQ8A 5ICEA 3L2QA 3FHZA 1MIJA 5CVUA 2JWTA 3HJEA 2LOOA 1Z67A 2ESNA 3KP3A 5F0CA 3T8TA 5J1YA 5M3FJ 3S2DJ 1FBUA 3FM3A 5IOYA 1F36A 3OY9A 4KN4X 2HTSA 2E5ZA 5IT9K 5FLXZ 3HOSA 3VB2A 2QQBA 2CUJA 4UVAA 1NG6A 1TWCJ 1HW5A 1U5TA 4XLCA 1FX7A 4YEJA 3OR2C 3L2WA 3CC2I 5GTHC 2IPQX 4GRIA 1VQLI 2V1NA 2BOLA 2HZTA 2LG4A 1XSVA 4A3EJ 4W97A 4YFKF 2J5PA 3IV5A 3LSHA 3P7NA 3GFIA 3JAMK 2LRDA 2IW5A 3QPSA 1J5YA 2O3FA 5FO5A 4DGWB 5H20A 1V5GA 2ZO4A 3ZMSA 1WHUA 3ZP5A 1BOBA 3PSIA 2JMWA 1Y8RB 2I8DA 2Y30A 4QWQA 5IYBJ 4E7IA 1FYKA 1RC9A 1P2FA 2HS5A 1TZLA 5HS9A 3S1MJ 3HRTA 2DOAA 4C3HJ 2X0LA 5E79C 1BOAA 1D3YA 2PEXA 1HF0A 4P55A 3S2HJ 2FNAA 1X1PA 5BQTA 1OCOH 2V79A 2VBYA 3CESA 1IN8A 4ZDLA 1JHHA 3N4MA 4M9SA 2AXLA 4C2TA 5EEHA 3HOXJ 4UB6C 2D2WA 4RMNA 2DCEA 5B1BH 1SC7A 5HLHA 4HX8A 2E1MC 3K70D 3KYCB 2MYSA 2ZJRF 1G3YA 3SJMA 2K86A 1U9NA 1YITI 2IGKA 4I09A 4CZZA 2KP6A 4DBRA 1JUPA 2K9MA 1FEXA 1SFKA 3S16J 3TP3A 4C3JJ 5CKTA 4EM0B 2LYCA 4HPQA 2KDZA 4I0BA 2OUMA 4PK4A 1WPKA 2HFHA 3S3NA 2W7NA 3ZQ7A 5A2QK 3JRBA 3I53A 5GADJ 5C4JJ 1BW6A 4ESBA 1I39A 3GFMA 2EIJH 4RAFA 4NNJA 1FZPB 4LLNA 5FLMJ 1U8BA 1B4AA 1P4AA 4V2FA 1J0RA 1ZR4A 3I59B 4GFBA 1D5VA 2MFZA 3EYIA 2D45A 4JYKA 2L0KA 1TL8A 3H3ZA 3D5LA 4A0XA 2DA7A 2IS6A 1STZA 3BPXA 3TL4X 2R7XA 2F5CA 1IN6A 2ZNYA 4BS9A 1B59A 2E36A 3KEQA 1JKQC 2LP0A 3SFZA 2P6TA 3CDHA 3ABUA 3QOPA 3H35A 1IZ1A 5F04A 2CUEA 1ACIA 1MBHA 1B6AA 1LVKA 3CP2A 4FETA 4I98B 1HA8A 2JZYA 1WJAA 2KRFA 3F8FA 3H3UA 1CF7A 2M8EA 2E2HJ 2M4KA 2CS3A 2FNPA 3DTKA 4YRVA 2BHYA 5GTIC 4A3CJ 4YFNF 4XRMA 2MD5A 2VJ5A 1CQTA 2H1KA 2KZGA 1X3WB 3H5RA 1RRJA 1HOMA 1Z05A 3CJQB 1WCMJ 3FM5A 3J81Z 4Y33A 3AL0B 3JTHA 3AFHA 1N25A 2RGVA 2WB1N 4M3BA 3GZNB 1RI7A 3ASOH 1DU6A 2PN6A 2K4JA 1W7PB 4CCLA 3HGGA 2VKVA 1W5CC 2NS7A 1ZK8A 1P4XA 3DU6A 2XVCA 3WHCA 2L02A 5FFZA 2H27A 3BG9A 1U9OA 1LFBA 3OS1A 2KRCA 1DP3A 2ZMEC 4AWXB 1TW3A 2A5WA 2EV0A 1S6LA 2KT0A 5EGOB 1A5JA 3T8RA 3I4PA 2CUZA 1X4OA 1D5YA 1R1VA 5D5VB 4IHVA 2LC2A 2UWMA 4BNCA 1XSXA 3O8HA 4HX4A 1SVLA 3KP7A 3WGGA 1MSEC 4DNCA 3M8EA 1IF1A 2KL4A 3QPHA 1XB4A 4MIMA 3HOYJ 1I1SA 2DN0A 1BJZA 1WRJA 3K9TA 4BJ6C 3VODA 2K3PA 3OL3A 3BY6A 2HVRA 3WTTC 4OINF 3K10A 2K85A 1QZYA 3LSIA 3S8PA 2HPMA 2HVQA 2OCEA 3I55I 2RNJA 2V7FA 4KNYA 3RCOA 4FHTA 1RR7A 2IT0A 4HNTA 4OIOF 4PSWA 2LY2A 3I58A 1SFUA 1D1AA 3PQJA 3AG1H 4AIDA 2VT3A 1NH3A 1MNMC 2MD0A 3VFZA 1ZGWA 1MH4A 2R7WA 1ETKA 3DWLE 3MFKA 5D8LB 2VIXA 5KAIC 2GIVA 1HSJA 1EA3A 4KN7X 1QBJA 3BQZA 4UY8I 3W2WA 1NG7A 1O3SA 3F23A 3BR0A 1V5EA 2G7HA 3FMSA 1FMWA 1X1BA 1ETOA 3VYUB 4BAYA 2MC4A 3FXUA 3IAM2 3HKZA 5HLTA 2FXAA 3E0JB 3E3VA 1YX5A 2BXYA 2R5YB 2LH9A 2CSOA 5LEKA 3VYSB 3J80Z 1RUNA 1ZAOA 3ZGKA 2X9DA 2HGCA 2EIMH 2G0EA 4PJNA 3JRDA 2VQGA 2JRTA 3Q5FA 1IXCA 2WV1A 3HM5A 5DUKA 2HOSA 3OR1C 1HDDC 4XKVA 1KQ9A 4E7ZA 2VQLA 1K6OA 5E1ZB 2WAQA 4NUBA 1TNSA 4GYGA 4XKCA 2M8GX 1XD7A 2BXZA 3P9KA 5HOOA 4BEHB 4OOIA 3G1MA 3E1SA 4BBRJ 4XNFA 3CMMA 3BZ6A 3CF2A 2V9VA 2MC3A 1OR7A 2EFWA 2HVSA 1W4MA 3F0CA 4PJMA 4M74A 1KGSA 4KFCA 2R7VA 4TV7A 4LGWA 4G7ZF 2L7MP 1YJ9I 1VTNC 2XF7A 1ZKGA 2L4AA 5BMZA 1S8NA 5D6FA 2XAJA 4HF2A 4PDKA 5JHFA 3MZHA 2CU7A 2EJRA 4IHWA 4ENJA 1YRNA 3NAUA 5ERIA 1ZGAA 4QLCU 2JTVA 4A3FJ 2WB1A 1XC5A 2PBIA 4HEA2 2KJCA 3X2QH 4FCYA 2DA6A 2XGXA 4B48A 2BBYA 3CDIA 3RYPA 4ENNA 3GTJJ 1R5GA 2IS1A 3K1PA 2NS8A 3DQVC 4L5EA 2X1DA 2LTPA 2Y0SA 1EJ9A 3J7YJ 1VQNI 1SD5A 2W4SA 3TMOA 1R00A 3M8JA 1XMXA 3GCMA 4JOMA 4D9JA 2RV8A 2JA5J 2MA3A 4BQQA 2FX0A 2BV6A 2VI6A 2IGMA 2ESHA 1T8IA 1FSEA 1BA5A 1YS6A 2OQRA 1XN7A 5D6EA 1LVAA 3KZIC 5FKNA 1USSA 2L7KA 1UZCA 1FT9A 4L9TA 2F4OB 2BW3B 2VC1A 2XUBA 3MKYB 1Z1DA 2LREA 1ZARA 2HDCA 3HUGA 2OQGA 3HOZJ 1U5TC 1Y0NA 5ILUA 4PGGA 3ABLH 4B4CA 3NWTA 1WJ5A 3TO6A 5HLIA 1LNWA 2ZFUA 3DTIA 5EZGA 3L2RA 2K9NA 3KZZA 3DFGA 2P81A 2X48A 3E97A 3KYLA 3DKXA 1LEAA 4A3KJ 5F1RA 3V7SA 1I6HJ 1Z7LA 5DM6F 5JR3A 1J9IA 1N78A 5ILVA 2YU9J 2A61A 2KPMA 4GO1A 4XLAA 4PJ0C 1OLTA 1XDUA 2GAUA 3BC8A 2YUSA 4EGYA 3FMQA 5GAHJ 3RKQA 2OCCH 1SVOA 4J19A 4HG2A 4IHYA 3BPVA 3HSEA 3DP7A 4CCOA 1BR1A 4E7KA 2IA2A 3CZ6A 2FQ4A 4FE4A 1OPCA 2QVOA 2CWEA 3MD2A 2VBXA 4RAZA 1K7AA 2A05A 1FOWA 1UB9A 5KCMA 3LFUA 5FKLA 1R4MB 5L3FA 4E7JA 5IT3A 1QGPA 3K4MA 3DPLC 1ETXA 3CO6C 4KYWA 2QSHX 1K6YA 1LE8A 5JVGF 2VOOA 4HNVA 2IA0A 5CVVA 2DTRA 1IUFA 4B3XA 5JHUA 4G7OF 2XKOA 1B8IA 5ICCA 1FWZA 3IUOA 4RGSA 1TQIA 6PAXA 2B7EA 4I76A 3W3CA 2LKPA 3MN2A 4BE2A 2DO7A 1TW2A 4R79A 3I3LA 3CC4I 1W7PD 3E6MA 3WTYC 2RN7A 1RNLA 4G6DA 4HLXA 4D7MA 2L54A 3OYBA 1Y0UA 3AG3H 4RLQA 3MZ8A 4LG3A 5CVRA 3CUQA 4HA8A 2F5FA 4G8XA 1XMAA 3OYLA 2ZKZA 4MNUA 2Y48A 2UV1A 4KIFA 2DAOA 2XGEA 5KK1A 1XDSA 3ZXSA 4CCNA 2DMTA 4BXUA 5DTDA 1YX3A 1ZLKA 3FMRA 1ZRDA 1RPWA 3HOUJ 3CJTB 1T56A 4KDPA 3RKYA 1HKTA 4XRSG 1V5FA 5AIQA 4Z6YA 2LDUA 4A3DJ 1WJDA 1GHCA 5B1AH 2DOEA 1YS7A 1YIJI 4O3MA 5FB2A 3TP0A 2PI0A 2YS9A 4O6JA 3KLOA 2AS5F 4DYRA 2Z16A 4D1QA 2LF7A 2M2EA 3K4JA 2LKXA 4OAYA 2EBIA 1KONA 5C44J 5HS8A 1IRFA 1FC3A 2M5WA 2KJBA 2P8TA 2R7RA 2GBYA 3VDXA 3WTVC 3NRVA 5J47A 4I6ZA 4A6EA 3QU6A 2FD5A 1SD6A 1IN7A 1S7OA 3E6DA 4EEFG 2Z99A 3RQIA 2Z3YA 1GV2A 4BGDA 2IA1A 1QHHD 3KFWX 3UKGA 2COBA 3OYDA 2HQRA 4F91B 4B09A 4BUPA 2EA4A 3HXLA 3PIOF 1JGGA 3CDLA 1E3OC 2NYXA 4A3LJ 1ZELA 4M72A 3CC7I 1TQPA 1BI1A 1R22A 3DEUA 4E7SA 3TW7A 1U78A 4ANJA 1O57A 3DEWA 5CYVA 1E3HA 2O61A 3KP6A 3LA3A 3K4CA 2K02A 2AQFA 2QEXI 4CZCA 4WX9A 3B02A 2ZXWH 3NQOA 5E3NA 1OJLA 4OU0A 1ULYA 5DCFA 3TBIA 5EG0B 2KISA 3TOAA 1A6QA 1JGSA 2RQQA 2PMHA 3BT9A 3OYCA 4ZYDA 4LMYA 3K7AJ 5F6FA 3ZMTA 1BR2A 2NVXJ 2W82A 1ZG5A 3RDIA 4BXXJ 5FRNA 3ABTA 3PQKA 2OTJI 2EB7A 3K1NA 3RIRA 3CCLI 1VQ7I 2NRAC 3OIPA 3FXJA 1AU7A 2XSJC 1TWAJ 1FY7A 3GYHX 3N05A 3JSOA 4GYIA 4NC7A 4WXHA 4NB5A 5JI6A 3DEEA 2EFQA 3MEXA 2NOJB 1SMYF 3H9QA 5HVQC 1S3JA 2M1BA 2VC0A 2A6EF 4LITA 1UELB 2V9PA 4N4NB 1UAAA 3HDDA 3DLAA 4RBOA 3I5UA 1X19A 2RNGA 1S9HA 3BR5A 4D5FA 3W2VA 1QA6A 3CJRB 3I59A 1BC7C 2WA0A 3A01B 5EJCA 3H1CA 1MJAA 2XDVA 1ON1A 3HRSA 2NXNB 3HTUA 3KPHA 4IRHA 1XX5A 4NC6A 4U0VA 5BPIA 1MSFC 4P9FA 4I01A 5HODA 1JJ6C 4X6AJ 3FXLA 3PL8A 3ABKH 3SQNA 1OCTC 3MWMA 3A0HC 2X4HA 1O7LA 4PCQA 3JCUC 5CJ9A 1LUJB 1IXSB 2O03A 1ETQA 2DTZA 2F2EA 3PO3J 5CVJA 3BCAA 4EM2A 2XSDC 1VNDA 1D1CA 1MJ9A 3TKYA 4ZYAA 3H9JA 1TLHB 4IHXA 2Z5UA 2DFFA 2M7AA 2EIKH 3BR3A 2Y31A 1RESA 5CLSA 1SEUA 4KISA 4XLNF 1ZGJA 1FTZA 5JFRA 2PMZA 1Z0XA 2QKMB 3OOPA 4G6TB 4PFPA 5EEGA 1A04A 3VYRB 3C7JA 2FEZA 4C3IJ 3A4CA 1H89C 3GBGA 3S93A 4XIDA 2G7UA 3LOCA 4XLFA 4Y3OA 5F64A 1ZG3A 1WJBA 1P6RA 3F8CA 2KDOA 2IBDA 2JJ7A 2WV0A 3GF2A 1DQUA 2NNYA 1GT0C 3J7AY 4XK4A 2DYRH 1W7PA 4DZJA 1OR7C 4E6KG 4XLPF 3C2HA 4RGXA 3QP5A 3V4GA 2CQQA 3OYMA 2NVUB 1SFXA 2OA4A 5J6XA 4KA4A 4XSZF 2ELJA 2VLAA 2XROA 5EGOA 2ME0A 3OMYA 3BTCA 3WTUC 3C2GA 4AC0A 1TWHJ 4G94A 5J3LA 5LD2C 2KZVA 3RYRA 5FKMA 3WGIA 3ELKA 1A6IA 3BR2A 3CMYA 3CP8A 1KA8A 3M9AA 2C6YA 2OAZA 2M7BA 1REPC 2X1EA 2ID6A 3MKWB 3A03A 1N75A 3GZ5A 3BJOA 2QF7A 3OSFA 1OCRH 2DBBA 4LG0B 1S72I 2DA1A 1D0YA 3DV8A 4ENMA 5E18F 1S7AA 4E7HA 1PDNC 2F6CA 3QWLA 4A69C 1WI3A 2FE3A 3IWZA 2CV2A 3QOEA 1KZHA 1WZ2A 1RKWA 2PJRB 5E8GA 1I1GA 1GV5A 2DK8A 4CA0A 4UHTA 5CQEA 5FLXK 2QWWA 3FXQA 4X0GA 1K78B 1HW1A 2R7ZJ 1X2MA 2NS0A 2JPCA 3CCSI 2M0MA 5ICGA 2X6XA 5K7HA 2VN2A 1D1BA 1BN5A 2KIUA 2X6OA 3PFIA 4M6XA 2JK3A 1TBXA 4Y52J 4LB5A 2JSCA 1T0FA 3C1DA 5AIPA 4ESFA 1X1CA 3AG4H 4EV0A 4UUSB 2QQ9A 3C2BA 1YYVA 2H8WA 2IS4A 4I2OA 5A2QZ 1E3PA 2YSRA 1IN5A 1M1EB 5E1XA 1SD4A 5LLQA 2M0CA 4IPAA 2ME6A 4BKXA 4DQ2A 5KNLA 9ANTA 1G3WA 2R5YA 1QVUA 3WU2C 1QQIA 2LK2A 3OYHA 2WAEA 3HYIA 3ZMZA 1FIPA 3E6CC 5DDGA 3O2PE 1TWFJ 4CGZA 4EJUA 3FHNA 5EF6A 2LD5A 1SAXA 2L9RA 2DJNA 5GAEJ 5FJ8J 2M30A 4A3JJ 3RI4A 1HKSA 2VKHA 2L2OA 2L3DA 2MSYA 3HKZN 3GO5A 4S0HB 1EH8A 2OU2A 1VF9A 3IHUA 2OTLI 3S3MA 2YPRA 4IHSA 3I71A 3G1OA 4BEHA 3HHGA 1BIAA 3S2WA 3ERMA 1F43A 3OYAA 1A31A 1YJNI 1ZLJA 1OYWA 3PM1A 4WXDA 3ZQGA 4GXOA 1V3FA 4KT5C 5EDNA 1GVDA 5D4SA 2E1NA 3RPUD 1U2WA 4C30A 2JUCA 2WAQN 2P5VA 5J1RA 3L9FA 1H88C 1XGMA 3KP2A 2RVCA 5L3DA 3F6OA 3Q3SA 1MBEA 2XAQA 1LEBA 2H09A 2QBYB 2LY1A 3C18A 1T2KA 4IEJA 1F1ZA 3OYEA 1H9TA 4M3DA 4ZDOA 1HXDA 2ZSHB 1VQKI 2NNNA 5K1YA 3CUQC 1K4SA 1HQCA 4QPQA 5KAFC 2QGUA 3HZJA 1VQ5I 2H94A 1BW5A 2CYYA 2FRHA 3WODF 1F4KA 1VQOI 5FKOA 3ULQB 3PJRA 3A02A 3FXKA 2CFXA 2ISZA 1VQ8I 1R58A 5J4YA 3A1YA 3ESWB 4II3A 4OMYA 4YELA 4BBSJ 3OYNA 2KRHA 2IAIA 4XLHA 4NQWB 2EPFA 2BW3A 2Y0SN 2FBHA 2DYSH 3I54A 3KEYA 4L0ZB 3OYFA 2BZTA 3EQLF 3GFLA 5IOZA 2W48A 4FX4A 2YX4A 2VJ4A 2R7OA 5JLXA 4HQEA 1GXQA 1O7FA 2ZSIB 1O3TA 3U1DA 2X6YA 4ASNA 3G1LA 1MZBA 2DT5A 2K4BA 2CUFA 3E7LA 3U21A 4AUXA 5DUIA 2DFEA 2QUFA 1WH5A 1WH7A 2HQAA 1T95A 4G6QA 4XL9A 3L2CA 2XGCA 2E60A 3K69A 3WU1B 4BJTA 3EDPA 2XB5A 1ZQ3P 3FKJA 4YFXF 3IRRA 2E1CA 3J81K 1R5ID 1JTYA 5H6RA 1U6GA 3SEZA 2XAGA 4EGZA 2V4JC 1WQ2A 3WE3A 5DS9A 4UNOA 2V9KA 2XAUA 4FASD 1IRXA 3F3XA 3QQAA 3HOVJ 2KFDA 2R7QA 2ECBA 2CW0F 4M3GA 2A5YB 1IAWA 5E1WA 1G8XA 1POGA 3Q0UA 4UVBA 1WFXA 2P7CB 2PJPA 4YIFA 5J8CA 3K2AA 3TDZC 3IH2A 1XTAA 1IN4A 2QSFX 3EUAA 3F8BA 1UHMA 3ERED 1VQ6I 4HF0A 4XSXF 2D5VA 2AO9A 3KEOA 3EYYA 1KQ8A 1KQ0A 2PG4A 3K4KA 1JKPC 2VJJA 4IQ4A 3SYTA 1LDJA 2Y69H 3MKZA 3CO7C 2CQ7A 3GXOA 2M45A 2FF4A 4Y13A 2DA5A 2WY8Q 3HPHA 3MKLA 4LIUA 4P1WA 4BACA 5L3BA 2HYJA 1YIOA 4UUTA 3UNGC 5K5RA 1IRGA 2RDPA 3JRHA 1K4TA 4M9XA 4JQFA 3WGHA 1DGRM 3PSFA 2GOMA 2D1VA 2ZNZA 3OYGA 3BP8A 4EM1A 3LAJA 4LLLA 4XICA 1LFPA 2W25A 2KQRA 4FTHA 1SFEA 4IF4A 3EETA 3H9GA 4JK1X 1K61A 2F4IA 5H6QA 2B63J 2LSOA 1AHDP 5DM7F 1B9NA 1HBXG 3KZYA 1WVRA 1BL0A 3CJNA 4U87A 1H0MA 4IKFA 2W24A 4S04A 2DOFA 2M34A 4HLYA 1AOYA 4O5VA 1JKRC 3ECHA 2STTA 2K9LA 3J80K 1QPIA 3BG3A 2OD5A 1BC8C 2V6EA 1RKTA 1X4PA 2Q2EB 4KT6A 2VBZA 1Z3YA 4BQAA 3ZMVA 2FJ1A 3SXYA 1MW7A 3KP5A 3NWSA 5F0FA 4F3QA 2ZXIA 3BR1A 1X1DA 2PX9A 3I4MJ 2X1CA 3P9IA 4AU7A 3GUDA 2IEKA 1G4DA 5BPDA 3RPUA 5FKKA 1IO2A 3HSRA 3NEUA 1GXPA 4FX0A 2EFNA 4B47A 1XMKA 2MABA 1NK2P 5K5OA 1YOVB 4P9UA 2ELHA 4M73A 1DPUA 4UVCA 3U1KA 3V8JA 3C3WA 2ECCA 1USTA 2L7ZA 1MBJA 3KYDB 3WHBA 2GA1A 3BCBA 3DCFA 1IV8A 1FP2A 3V8KA 3HPGA 2BEOA 3AL0C 1B1BA 3DU5A 5F1JA 3OV8A 4M6YA 4J01A 4A3IJ 1ERDA 1HLVA 3TDUC 1ZTRA 3V8LA 3G2BA 4A5NA 2CQKA 2OV7A 4RGRA 2F4MB 5BOXA 1UHWA 1UFMA 2H6BA 4N9IA 2P4WA 4B8XA 2GXBA 3Q9SA 5EG0A 3QODA 4N0BA 4UXNA 4HF1A 3LQQA 3LNQA 2AXTC 3QYFA 3QU3A 3PUFA 4XOPA 1MGTA 2OZUA 1JJ8C 3KP4A 3CLQA 4LFUA 4ON0A 2WBMA 3W6JB 3P9CA 2OBPA 4HDUA 2MLKA 4RB0A 1F5TA 2E5NA 4DOZA 1TT0A 1MNDA 1BI0A 3LSJA 2GXAA 4EMSA 1T6SA 3DTEA 4YIIA 1I3QJ 1ZYRF 4M9ZA 2Z2SB 2VOPA 2QENA 2DXIA 3ROUA 5M5WJ 3JRAA 2XRNA 3T0YA 4IZZA 3ECOA 4OWRB 1XCBA 2GZWA 3OSGA 4S05A 4ZYGA 4A93J 2DDAA 2ZJQF 1FMVA 3A01A 1NHAA 1OQYA 4D5CA 4CDGA 1JT6A 3H92A 4ZC3A 5LGNA 1TC3C 1T0FC 3KE2A 1MNEA 4KICA 3JR9A 2CV0A 2VODA 2VE8A 1QZEA 1Y8QB 5LGTA 5HDNA 2X51A 1D0ZA 1V54H 2R4GA 4U88A 1PUFB 2R3SA 2M87A 1Z7UA 4R8HA 2JVGA 2O5RA 2K3FA 4CCKA 5LFAA 2A68F 4PUSA 2IP2A 4WWCA 1E2XA 2JN6A 1JUMA 3F22A 3L2VA 1U8RA 2GLOA 3FXOA 5TISC 2GIZA 3KLNA 4RA2A 3LMMA 1TWGJ 3G6EI 5EYRA 5TJJA 5IY5H 4N4OB 3DXJF 4HQMA 3BDDA 2WADA 2VB6A 4I0AA 3V42A 1ENHA 3KIOA 3L00A 2RAEA 3J7ZI 4XM3A 4XKWA 1QZZA 4UB8C 3H5AA 4U0YA 2XASA 3CD6I 1QU3A 4U0WA 2XV4S 1WGXA 3IAS2 1L3LA 3GVAA 4XRFA 4XORA 2YX7A 1MBFA 1XGSA 3LSKA 1YLFA 3Q0VA 4L5JA 1ODDA 2LF8A 3T1BA 2JA6J 2MGQA 5F27A 2PMZN 2X6WA 4ABZA 2GA2A 3I9V2 2HTJA 5EZHA 1MMAA 2F5DA 2DA3A 4NHJA 3Q9VA 4CYDA 2NVQJ 2BHZA 2JA7J 4XQFA 4M3FA 4BDYA 1X1AA 1MMDA 2FBIA 5HNFA 3UR3C 4C2MJ 2VUMJ 1JI8A 1MH3A 3M1CA 1LPQA 1NTCA 2NVYJ 2K9QA 4B44A 1YG2A 2UXXA 1W36D 1WI9A 5E20A 1T98A 3G3ZA 4LG0A 5B5EC 4B43A 3OYJA 1BI3A 3GLLA 4HV5A 1YW8A 5M5YJ 4Q5SF 4AYBA 2OPTA 1IG7A 3DBHB 5BS6A 3JRFA 2DFHA 2PJRA 2VE9A 5IP7J 1TT5B 1P9QC 4MLOA 2M3AA 2XC7A 2DDBA 2P7VB 4PJLA 5JLWA 4W1UA 4L5IA 3TW6A 4F92B 4IX7A 4ESJA 1K78A 2BE5F 3WTWC 4WK8F 3FISA 4PSXA 1VZ0A 3V7CA 2VXDA 2F5VA 2UUZA 4UUSA 2MG4A 1HW2A 3CMAI 3QYBA 2FQ3A 2R7FA 2DA2A 2JSPA 1RUOA 3BR6A 3CCYA 2I10A 1GVJA 1FLIA 1FP1D 1ETVA 5D5UB 2COMA 1G6NA 2Y0MA 3OYIA 4HZFA 1UMQA 4HDVA 4AIKA 2E1MB 1HKQA 2ZCWA 2H1LA 2FA5A 1OMIA 5K7FA 1SMTA 1SVMA 3S32A 3TO9A 1ETWA 4GCVA 3U9GA 4QSHA 4EJWA 3VSKA 1IUYA 3LSPA 3GTKJ 4AVZA 5JVTA 2DMPA 5FRMA 2EH3A 2W85A 2VJIA 1HSTA 4RB3C 3KCCA 5J8FA 1H9GA 1P4WA 2A07F 2XGDA 2STWA 2VKDA 4CYCB 1FOYA 1DDNA 1SFOJ 3W6KB 3OIQA 3HOTA 2CG4A 2E71A 2ID3A 3B73A 5DYMA 4MTEA 2Y2ZA 2O6GE 3VYTB 2GWRA 1WWXA 4Q48A 5HNHA 1DU0A 1Z6TA 2JT1A 2L5QA 3E6BA 1D8JA 4CHUA 5LHIA 1Q1VA 2W1OA 4UUVA 1A36A 3HGYA 1TQMA 1KYZA 4BJ5C 5D5XB 2JA8J 3F6VA 2K9SA 1KU2A 2OC6A 2QBYA 2KMUA 4IQJA 1JTXA 1AKHB 1MJBA 4RM3A 3BZKA 1UJ8A 5L3GA 4RDUA 1JUSA 3S3OA 4JX6A 2E2JJ 1YFHA 5LHHA 1Z3XA 2E35A 1DGWY 5DEQA 3ISPA 3IL2A 1BJAA 1G59A 4ZZLA 4PFOA 3K70C 2E7WA 4UV8A 1R7JA 1YQAA 1BI2A 5IT9Z 2DMNA 5FGMA 3JSPA 2YR2A 5TRDA 1OISA 3RPQA 2HOEA 1T39A 1ZRFA 2L9NA 5K5QA 2Y75A 2RKHA 3H5NA 3FK6A 1RETA 1UCRA 2DQLA 1PUEE 2J5OA 5DV5A 5GPCA 1J59A 1Q1HA 4KITB 4F55A 4EATA 2HDDA 3K4NA 1Y6IA 4JX5A 1FTTA 4HAMA 3JAMZ 4HX7A 5TGTA 3TOBA 4FT8A 4DJAA 1FSHA 1P7IA 2CQNA 4NQWA 3VEPA 2TDXA 4MQ9F 3K0LA 4BQNA 1ZRCA 4KJZA 2VQCA 1TP4A 2XF5A 2DPUA 2AHQA 2QM3A 3MAJA 2BY0A 5D4RA 1Z91A 4NC8A 1MMGA 1Z77A 3A0BC 3JW4A 4A0ZA 1T08B 1BR4A 2ZMEB 3FXMA 1Y1VJ 1W0TA 2CH0A 1SAUA 3WG7H 2K5CA 3BZCA 3SDBA 3ZMUA 3LA2A 1Z21A 2MW8A 4HV6A 3DLLF 1B9MA 2AQEA 2Z9OA 4Y7NJ 1QNTA 2LBFB 3HEFA 1K79A 3H0GJ 2EK5A 2HKXA 4B1RA 1GUUA 4A2UA 2ZXHA 2W57A 2EILH 2TRTA 3HC7A 1B72B 4LK0F 2EWNA 4A3BJ 1XGNA 3U2RA 3T5XA 1K83J 2Z1DA 1G3TA 4L18B 2NVTJ 3GTOJ 1W5TA 3OOUA 2DJIA 3FK7A 3R61A 4M3EA 4DYQA 1XSDA 2E19A 3FWEA 3CF5F 3FIWA 4UV9A 4AD9A 3GFJA 4A3MJ 4JX4A 4BL0B 3M07A 1OCPA 3BJ6A 5B3SH 2BVMA 3OIOA 2HQNA 3EUHA 4JBAA 5KVRA 4M6VA 2VKEA 2MLGA 1IGNA 1A35A 4Y15A 3LSTA 1YW7A 3GX4X 3PNYA 4QTRA 3TEDA 1PJRA 2X85A 2L7FP 2B9SA 1NK3P 3COAC 2V1UA 2LLKA 1UG2A 3F8NA 4CH7A 2MH9A 3BQYA 4NDLA 3ZN1A 2A6TA 2HU9A 5EEAA 4KIGA 4RB1A 2DK5A 3I64A 2GOXB 3K4LA 2OJED 1E17A 3K4BA 4BHCA 2HI3A 2PMUA 3DF8A 3V7RA 2FOKA 1XCVA 1J09A 4BH9A 1FYLA 2BYVE 4BY7J 1Y39A 1MDMB 3CMEI 2IGNA 4HW0A 4RB2C 2R7UA 2DQRA 2V1DA 4II2A 4BHBA 1FBQA 4I02A 1PYVA 3D1NI 2M4GA 4L9NA 3M1EA 2FU4A 3BLYA 1I27A 2EINH 3CTAA 3JRGA 2R5ZB 2Q2EA 4LK1F 2Y9ZA 2VASA 2M9HA 1KU7A 4OIPF 3K2ZA 3FZVA 3ZN0A 4EJOA 2R92J 1MMSA 3ZQFA 2HQ5A 4RM2A 4ZZDA 5E3MA 2L9SA 2GQQA 3J7AO 4AIJA 2DMUA 4ZTFA 1LQ1A 3VOEA 2GM4A 2KHMA 3ZOBA 4CXFA 2FBKA 3R0AA 1S7EA 5L3CA 3TGNA 5DD4A 2K7LA 1MKMA 2Y9YA 3EPZA 2ZC2A 3GEZA 1Y1WJ 3QPTA 4B3AA 1I5ZA 1T33A 2EZKA 3FXRA 5DCMB 1VQPI 3HG9A 4KIBA 2A6HF 1XGOA 1YTYA 1KU3A 5M3MJ 5HS7A 1QVTA 1FBSA 2IVMA 4D7NA 2CW8A 2Q8KA 1SANA 3JREA 5L3EA 1IRZA 4AM3A 4F7ZA 2QZ8A 3SHFA 2PLYA 2FOWA 2N8GA 2XHKA 1W0UA 1FJLA 1ONVA 4R1HA 3M3YJ 1QRYA 3CCMI 2IXSA 5J1UA 4ZH4F 4CCJA 3L7WA 2DMQA 1Z9CA 4MO7A 5M5XJ 2DT7B 3BJAA 4MEYF 4EQQA 1ZR2A 1ON2A 3IRQA 2F5EA 2KLOA 1F9NA 1UHSA 5LRSA 1FOXA 2VBWA 4A0YA 2UXNA 2KIFA 1UG0A 4HOBA 4EVIA 2ZJPF 1R9TJ 4IJAA 4Q47A 5C4XJ 4KUMA 4BQOA 5LGUA 4XN0A 2XPVA 5FROA 2EV6A 4ENKA 4L9VA 5HLGA 1U5TB 2UZKA 1XPXA 3ZQQA 2ICWG 5FLVA 3O8GA 3DPUA 5CQGA 2EZLA 3HB9A 3SEQA 4ZTJA 3P5JA 4DIQA 2FUG2 1J75A 3SZTA 4IOAF 4ETSA 2LMDA 1SD7A 1I6XA 1R49A 1APLC 4K2EA 5E17F 1JHFA 3ML6A 3PFYA 2LVSA 1ZREA 1FPQA 3CCEI 2ZXJA 1ZG1A 4OAZA 1N77A 4BU2A 4AVPA 3FDYA 3F8MA 3BG6A 3RKWA 1GDTA 2QLZA 2B0LA 2QQAA 3PUBA 3S1RJ 3H0DA 3L2UA 3DBRB 2V6CA 1XG1A 2HPIA 2EA2A 4LJZF 2CW7A 1Y56A 3IP4B 1O3RA 3IWFA 2FSWA 3OYKA 3R0JA 4DZPA 3HBLA 3FBNB 2CV1A 2E34A 2WAFA 4HNUA 4G9YA 3RZDJ 2XKPA 1PUFA 3KETA 1P92A 3LFKA 4HSTA 4RAYA 2R7DA 3WU0A 3OS0A 4BHPA 2DA4A 1S29A 4P5OA 3REOA 1QPMA 2HXOA 1HC8A 3NARA 3ASNH 5F08A 1YHQI 2JQ7A 4F93B 1TNTA 3WG9A 3QRFF 3ZQIA 3PNVA 1WJFA 2BGCA 4XRSA 5FFXA 4ZJZA 3QPLA 2HNHA 3PNTA 4LIVA 2R93J 3I0TA 4PGHA 3D0SA 1W5SA 3G4SI 3ABMH 3M7GA 2ELKA 2Q1ZB 2YU3A 4OIQF 1DP7P 3K6GA 3B6AA 5GP9A 3OS2A 2MBFA 4U7DA 5E8IA 2L01A 3CQZJ 3H36A 3RKXA 3O3KA 4YG2F 2O9LA 4L0YB 1JE8A 1MMNA 2P5LC 1ITYA 5LBQA 3CCRI 2HZDA 1C0WA 3PO2J 1D0XA 1FYMA 4IRGA 5LHGA 2RC4A 5FD6A 2A3SA 4OIRF 1G2HA 3BOQA 1OCCH 2V26A 5CPRB 2O0YA 3M8FA 1IDZA 1R6RA 2WTEA 2JPBA 4M71A 4QIWN 3CCJI 1PP7U 3HOWJ 3MVPA 3ZR8X 2QKLB 4N9HA 2DPDA 3R60A 4DYCA 2WWYA 3OL4A 1BBYA 4XN3A 2LKSA 5B66C 3SDGA 4A3GJ 4ZYEA 2VPLA 1IC8A 4HBLA 2HOTA 1CF7B 1R4NB 2XB0X 4MQVA 5E3OA 3VSLA 5IP9J 1BM9A 2RREA 1J7KA 2OZ6A 2KKOA 3BWGA 1BIBA 3E5UA 3MQ0A 1D8KA 2PFBA 2XPWA 1E0EA 1Z6RA 2EZIA 3AKZA 4PZJA 2ADUA 4Z2YA 4CUGA 3S1NJ 3GWZA 4ZYHA 4GGGA 4IHTA 5LRRA 3IKTA 3GTLJ 3IC7A 2FMLA 4AYBN 3FKIJ 5J4VA 4HSRA 3LQRA 3LL7A 5E3LA 4IOCF 3HRUA 1YO5C 4CSWA 3FBIB 4ZDPA 1MBGA 4YIRX 2CMPA 1OYYA 2VT2A 1U0JA 5KHDA 1JKOC 1IDYA 3ONQA 2EQRA 1QHGA 2ZJ2A 5J40A 1LB2A 5AONA 5IPAA 1KU9A 3L1PA 2D1HA 3S1QJ 1GLNA 3GTMJ 3AG2H 1AWCA 3AAFA 2W84A 1RZ4A 1OKRA 5D5WB 5GAGJ 3K1MA 4WCGA 2E7XA 3GW2A 2IGOA 2HXIA 2HKOA 3CUOA 4BXFA 1VQMI 3LA7A 3JRCA 4CYCA 2LNBA 4PJJA 3R4KA 1X2NA 4CO8A 1W36C 1XS9A 2QQ8A 2E2IJ 3IKVA 3E5QA 2ISYA 2R0QC 2ZB9A 4CCMA 1JT0A 2BY2A 1R1UA 2DI3A 4CICA 1FNNA 3F9KA 1V55H 5C3EJ 4HYEA 5H2FC 3MZYA 3WTXC 3BTJA 1ORKA 1X58A 4BYYA 2EZHA 2DLLA 1V4RA 1MD0A 2NAZA 4U7BA 2BVLA 4ITVA 4XR6A 4LB6B 1R1TA 1X3UA 3EUHC 4LOCA 2XAFA 4BE0A 2K40A 1AKHA 2L9VA 4L9JA 1T38A 1WSUA 5IYDJ 3B6CA 3H3VK 2R7TA 2CO5A 1EV7A 5ILSA 3S14J 2HYFA 1VQ4I 3D5SC 3MCZA 4GDFA 5GPAA 3PIPF 3BG7A 2HEOA 1IV6A 2A69F 3CCVI 4EJVA 1YI2I 4JP0A 3HRMA 4A12A 1W1WE 4I7HA 3BROA 3QP6A 3I4NJ 4IO9F 4WXCA 2QCOA 1OYIA 4MTDA 3GLXA 2QYOA 4BDZA 1YJWI 3DKWA 2OF7A 1FOKA 3QYEA 2VXZA 3BTIA 2JRMA 4RAGA 1HCRA 1AA7A 2BY3A 4WF2A 3GZ6A 5D8KB 1HDPA 1P7JA 3FF5A 4G7HF 1FIAA 2V1XA 2JA2A 4IXAA 2P0WA 4LLGF 2MH2A 3N97A 4DBQA 1EH7A 4E4HA 3F21A 2CFOA 1O3QA 4MFEA 3DBLB 3S15J 2EFOA 2HOAA 4I99C 3SZPA 3CCUI 2HR3A 3E5XA 2Q0OA 1LFUP 4QPOA 3L09A 4BE1A 3DKYA 3MMYB 2I5UA 2H8RA 3LWFA 2ZMEA 4NBQA 1L0OC 3VPRA 4KMFA 3RZOJ 2DW4A 4LD5A 2W00A 1PVEA 5LEJA 5HDKA 2VPRA 2TCTA 4MEXF 2DT6A 1IW7F 3JRIA 1KYWA 3CLOA 1YRNB 2VONA 5ED4A 4EJTA 2LBFA 2HYGD 4G12A 2O7OA 3VWBA 1H8AC 4A6DA 3BG5A 3HIFA 4E70A 2RQPA 1ZHFA 2DFIA 2P5KA 3HTSB 1B72A 4DW6A 4XKBA 2HDWA 3EUKL 3ZMDA 3G73A 2CRGA 1RIOH 3LAPA 3WTSC 1I50J 3M4OJ 1S5LC 2G9WA 3RTRA 2EV5A 2WC2A 3G71I 2CQXA 4V19K 4XLEA 3RQ4A 3ZQLA 1EKEA 3LSRA 1J2XA 1OFCX 1OCZH 1PP8F 4X1EA 3Q0WA 3W2AA 2ACJA
chains in the Genus database with same CATH topology
2P81A 5DS9A 2X48A 2NVTJ 3GTOJ 4A3KJ 3OOUA 3FK7A 4M3EA 3QQAA 4DYQA 1I6HJ 2E19A 3HOVJ 4M3GA 2ECBA 2LY9A 3FIWA 3IH3A 2YU9J 4A3MJ 3IH4A 1POGA 2YUSA 3GTPJ 3RKQA 4JX4A 3Q0UA 5BNGA 3GTQJ 4J19A 4IHYA 3K2AA 3IH2A 1OCPA 2LR8A 3OIOA 4M6VA 2VKEA 1IGNA 2D5VA 2AO9A 2FQ4A 4FE4A 1MBKA 3TEDA 4QTRA 3ZQCA 2O8KA 1NK3P 2L7FP 1JKPC 2LLKA 1UG2A 1IJWC 3S17J 3BQYA 4NDLA 5EEAA 5FKLA 4BY1J 2DA5A 3MKLA 1ETXA 2HYJA 1LE8A 2HI3A 4HNVA 4UUTA 3JRHA 3ZQHA 5F0HA 1IUFA 4BY7J 2R5ZA 1B8IA 5IP6A 4XICA 1VI0A 4V2GA 4FTHA 2E1OA 4I76A 1LE8B 3MN2A 1EF4A 3D1NI 1K61A 2B63J 5K7ZA 1AHDP 3BTLA 3JRGA 2R5ZB 4D7MA 1B8IB 2LFBA 3LSGA 2Y9ZA 2R92J 2M9HA 1BL0A 3ZQFA 2HQ5A 3GTGJ 1VFCA 5E3MA 2DMUA 2M34A 1O4XA 2GM4A 1JKRC 5IYCJ 2XGEA 3ZOBA 2DMTA 4FE7A 1QPIA 3BG3A 5DTDA 1S7EA 1RKTA 2CJJA 4MFDA 2XRLA 2Y9YA 3W6VA 2XPUA 1RPWA 2FJ1A 3SFIA 3HOUJ 1T56A 1Y1WJ 4B3AA 1T33A 4XRSG 5F0FA 2EZKA 2NOGA 4A3DJ 3BR1A 3I4MJ 1ETYA 3TP0A 5M3MJ 2IEKA 1QVTA 2YS9A 4D7NA 3JREA 1SANA 4DYRA 5FKKA 1IRZA 2M2EA 4FISA 1NK2P 2LKXA 2N8GA 1W0UA 1FJLA 2EBIA 2JWTA 5J1YA 5F0CA 5C44J 5M3FJ 3S2DJ 3M3YJ 2ECCA 1QRYA 5IOYA 1F36A 5J1UA 2L7ZA 2GBYA 1MBJA 2DMQA 4MO7A 3WHBA 5M5XJ 3DCFA 4I6ZA 1ZR2A 1TWCJ 2FD5A 5F1JA 4EEFG 1UHSA 3RQIA 1GV2A 4A3IJ 3UKGA 1HLVA 2COBA 1ZTRA 1R9TJ 5C4XJ 4A3EJ 4W97A 1JGGA 2XPVA 3IV5A 3CDLA 1E3OC 4A3LJ 3QPSA 5FLVA 3O8GA 5EG0A 2EZLA 3HB9A 3TW7A 1U78A 3LNQA 3DEWA 1JJ8C 2JMWA 2Y30A 5IYBJ 1APLC 3S1MJ 4C3HJ 5E3NA 1OJLA 2LVSA 5EG0B 3LSJA 1HF0A 3S2HJ 3BT9A 1I3QJ 3K7AJ 2NVXJ 4BXXJ 3HOXJ 5M5WJ 3JRAA 1GDTA 3S1RJ 1XG1A 1AU7A 1TWAJ 3SJMA 3OSGA 1U9NA 4A93J 4DZPA 3HBLA 1JUPA 3A01A 1FEXA 3RZDJ 3S16J 3TP3A 4C3JJ 4D5CA 1PUFA 1JT6A 1TC3C 2KDZA 3JR9A 3HDDA 4RBOA 1WPKA 3BR5A 4D5FA 2DA4A 3JRBA 5C4JJ 1BW6A 3A01B 2HXOA 3NARA 1PUFB 5F08A 1MSFC 5HODA 1JJ6C 4X6AJ 1OCTC 5FLMJ 3ZQIA 1U8BA 4V2FA 1ZR4A 4XRSA 2GLOA 2JN6A 3QPLA 1JUMA 4GFBA 1ETQA 2R93J 4JYKA 2DTZA 1TWGJ 2L0KA 5EYRA 3PO3J 2DA7A 2ELKA 2XSDC 1VNDA 1ENHA 2RAEA 3B6AA 5GP9A 4IHXA 3CQZJ 3BR3A 2Y31A 1RESA 1JKQC 1WGXA 2LP0A 2O9LA 1FTZA 1Z0XA 1MBFA 1ITYA 5F04A 2CUEA 3PO2J 3Q0VA 1MBHA 2JA6J 2MGQA 5F27A 2PMZN 4C3IJ 1G2HA 4ABZA 1H89C 5EZHA 3GBGA 2DA3A 4XIDA 2NVQJ 2JA7J 3LOCA 1IDZA 4M3FA 4QIWN 3HOWJ 2E2HJ 2IBDA 3MVPA 2JJ7A 4DYCA 1GT0C 4XK4A 4A3CJ 4XRMA 4DZJA 4C2MJ 1CQTA 2VUMJ 2H1KA 1MH3A 2CQQA 1NTCA 3SDGA 4A3GJ 1HOMA 2NVYJ 1WCMJ 2K9QA 1IC8A 2HOTA 5EGOA 2ME0A 2XB0X 3BTCA 5E3OA 4AC0A 2WB1N 1TWHJ 4M3BA 5IP9J 1DU6A 5J3LA 3HGGA 2VKVA 2NS7A 2XPWA 2EZIA 1ZK8A 5FKMA 1A6IA 3WHCA 3BR2A 3S1NJ 5M5YJ 3CMYA 3BG9A 1U9OA 2OPTA 1IG7A 1LFBA 3JRFA 3GTLJ 2ID6A 2KT0A 5EGOB 3A03A 5IP7J 1A5JA 2QF7A 4MLOA 4AYBN 3OSFA 1D5YA 3FKIJ 4IHVA 2DA1A 5JLWA 4W1UA 3TW6A 5E3LA 4A69C 3O8HA 1WI3A 1MBGA 1MSEC 3FISA 1RKWA 4MIMA 1JKOC 1IDYA 3HOYJ 2DN0A 1BJZA 2EQRA 1GV5A 4UUSA 5IPAA 2MG4A 3L1PA 3S1QJ 2R7ZJ 2DA2A 1X2MA 3GTMJ 3BR6A 3CCYA 2I10A 5K7HA 1ETVA 2X6OA 1RR7A 2JK3A 4Y52J 2HXIA 1UMQA 4UUSB 3C2BA 3JRCA 4CYCA 1X2NA 5K7FA 1XS9A 2E2IJ 1MNMC 2R0QC 1ZGWA 2ZB9A 1ETWA 1JT0A 1MH4A 4QSHA 1ETKA 2M0CA 2ME6A 4BKXA 9ANTA 3LSPA 3GTKJ 2R5YA 1QVUA 2DMPA 2EH3A 3BQZA 2LK2A 1FIPA 5C3EJ 2XGDA 3BR0A 4CYCB 1TWFJ 3BTJA 1ORKA 5EF6A 1X58A 1ETOA 2EZHA 2LD5A 1SFOJ 2L9RA 2DJNA 5FJ8J 2ID3A 4A3JJ 2Y2ZA 2R5YB 2MSYA 3HKZN 4LOCA 1DU0A 5IYDJ 1AKHA 2K40A 2X9DA 4S0HB 2G0EA 3JRDA 3B6CA 3H3VK 1VF9A 3S14J 1Q1VA 2WV1A 3G1OA 3HM5A 2HOSA 3HGYA 1HDDC 5GPAA 1F43A 1IV6A 2JA8J 2K9SA 4JP0A 3PM1A 3ZQGA 1JTXA 1AKHB 2M8GX 5EDNA 1GVDA 3I4NJ 2QCOA 4RDUA 1JUSA 2WAQN 4JX6A 5J1RA 2E2JJ 3G1MA 1H88C 4BBRJ 2OF7A 3Q3SA 1MBEA 3BTIA 1HCRA 3F0CA 1HDPA 1P7JA 2DMNA 1FIAA 2L7MP 4IEJA 1ZKGA 4M3DA 3FK6A 1RETA 2CU7A 4MFEA 5GPCA 3S15J 4IHWA 2HOAA 1YRNA 3NAUA 2HDDA 4JX5A 1FTTA 1LFUP 4A3FJ 1XC5A 2H8RA 1BW5A 4FCYA 1P7IA 2DA6A 3RZOJ 3VPRA 5FKOA 2VPRA 2TCTA 3A02A 3JRIA 2AHQA 3GTJJ 4L5EA 2NS8A 1YRNB 2LTPA 4BBSJ 4G12A 2O7OA 1Z77A 2IAIA 1H8AC 2JA5J 3BG5A 1Y1VJ 2Y0SN 2FX0A 2VI6A 1W0TA 5IOZA 2W48A 1B72A 5JLXA 1BA5A 2MW8A 4DW6A 4Y7NJ 3HEFA 3H0GJ 3G1LA 5FKNA 4B1RA 1GUUA 2CRGA 3E7LA 2CUFA 4AUXA 1WH5A 1WH7A 1I50J 2TRTA 2XGCA 3M4OJ 2XB5A 1ZQ3P 2CQXA 3HOZJ 1B72B 3ZQLA 4A3BJ 3LSRA 4B4CA 1K83J 1OFCX 1JTYA 4X1EA 5EZGA 3Q0WA 2K9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P81 A;  5DS9 A;  2X48 A;  2NVT J;  3GTO J;  4A3K J;  3OOU A;  3FK7 A;  4M3E A;  3QQA A;  4DYQ A;  1I6H J;  2E19 A;  3HOV J;  4M3G A;  2ECB A;  2LY9 A;  3FIW A;  3IH3 A;  2YU9 J;  4A3M J;  3IH4 A;  1POG A;  2YUS A;  3GTP J;  3RKQ A;  4JX4 A;  3Q0U A;  5BNG A;  3GTQ J;  4J19 A;  4IHY A;  3K2A A;  3IH2 A;  1OCP A;  2LR8 A;  3OIO A;  4M6V A;  2VKE A;  1IGN A;  2D5V A;  2AO9 A;  2FQ4 A;  4FE4 A;  1MBK A;  3TED A;  4QTR A;  3ZQC A;  2O8K A;  1NK3 P;  2L7F P;  1JKP C;  2LLK A;  1UG2 A;  1IJW C;  3S17 J;  3BQY A;  4NDL A;  5EEA A;  5FKL A;  4BY1 J;  2DA5 A;  3MKL A;  1ETX A;  2HYJ A;  1LE8 A;  2HI3 A;  4HNV A;  4UUT A;  3JRH A;  3ZQH A;  5F0H A;  1IUF A;  4BY7 J;  2R5Z A;  1B8I A;  5IP6 A;  4XIC A;  1VI0 A;  4V2G A;  4FTH A;  2E1O A;  4I76 A;  1LE8 B;  3MN2 A;  1EF4 A;  3D1N I;  1K61 A;  2B63 J;  5K7Z A;  1AHD P;  3BTL A;  3JRG A;  2R5Z B;  4D7M A;  1B8I B;  2LFB A;  3LSG A;  2Y9Z A;  2R92 J;  2M9H A;  1BL0 A;  3ZQF A;  2HQ5 A;  3GTG J;  1VFC A;  5E3M A;  2DMU A;  2M34 A;  1O4X A;  2GM4 A;  1JKR C;  5IYC J;  2XGE A;  3ZOB A;  2DMT A;  4FE7 A;  1QPI A;  3BG3 A;  5DTD A;  1S7E A;  1RKT A;  2CJJ A;  4MFD A;  2XRL A;  2Y9Y A;  3W6V A;  2XPU A;  1RPW A;  2FJ1 A;  3SFI A;  3HOU J;  1T56 A;  1Y1W J;  4B3A A;  1T33 A;  4XRS G;  5F0F A;  2EZK A;  2NOG A;  4A3D J;  3BR1 A;  3I4M J;  1ETY A;  3TP0 A;  5M3M J;  2IEK A;  1QVT A;  2YS9 A;  4D7N A;  3JRE A;  1SAN A;  4DYR A;  5FKK A;  1IRZ A;  2M2E A;  4FIS A;  1NK2 P;  2LKX A;  2N8G A;  1W0U A;  1FJL A;  2EBI A;  2JWT A;  5J1Y A;  5F0C A;  5C44 J;  5M3F J;  3S2D J;  3M3Y J;  2ECC A;  1QRY A;  5IOY A;  1F36 A;  5J1U A;  2L7Z A;  2GBY A;  1MBJ A;  2DMQ A;  4MO7 A;  3WHB A;  5M5X J;  3DCF A;  4I6Z A;  1ZR2 A;  1TWC J;  2FD5 A;  5F1J A;  4EEF G;  1UHS A;  3RQI A;  1GV2 A;  4A3I J;  3UKG A;  1HLV A;  2COB A;  1ZTR A;  1R9T J;  5C4X J;  4A3E J;  4W97 A;  1JGG A;  2XPV A;  3IV5 A;  3CDL A;  1E3O C;  4A3L J;  3QPS A;  5FLV A;  3O8G A;  5EG0 A;  2EZL A;  3HB9 A;  3TW7 A;  1U78 A;  3LNQ A;  3DEW A;  1JJ8 C;  2JMW A;  2Y30 A;  5IYB J;  1APL C;  3S1M J;  4C3H J;  5E3N A;  1OJL A;  2LVS A;  5EG0 B;  3LSJ A;  1HF0 A;  3S2H J;  3BT9 A;  1I3Q J;  3K7A J;  2NVX J;  4BXX J;  3HOX J;  5M5W J;  3JRA A;  1GDT A;  3S1R J;  1XG1 A;  1AU7 A;  1TWA J;  3SJM A;  3OSG A;  1U9N A;  4A93 J;  4DZP A;  3HBL A;  1JUP A;  3A01 A;  1FEX A;  3RZD J;  3S16 J;  3TP3 A;  4C3J J;  4D5C A;  1PUF A;  1JT6 A;  1TC3 C;  2KDZ A;  3JR9 A;  3HDD A;  4RBO A;  1WPK A;  3BR5 A;  4D5F A;  2DA4 A;  3JRB A;  5C4J J;  1BW6 A;  3A01 B;  2HXO A;  3NAR A;  1PUF B;  5F08 A;  1MSF C;  5HOD A;  1JJ6 C;  4X6A J;  1OCT C;  5FLM J;  3ZQI A;  1U8B A;  4V2F A;  1ZR4 A;  4XRS A;  2GLO A;  2JN6 A;  3QPL A;  1JUM A;  4GFB A;  1ETQ A;  2R93 J;  4JYK A;  2DTZ A;  1TWG J;  2L0K A;  5EYR A;  3PO3 J;  2DA7 A;  2ELK A;  2XSD C;  1VND A;  1ENH A;  2RAE A;  3B6A A;  5GP9 A;  4IHX A;  3CQZ J;  3BR3 A;  2Y31 A;  1RES A;  1JKQ C;  1WGX A;  2LP0 A;  2O9L A;  1FTZ A;  1Z0X A;  1MBF A;  1ITY A;  5F04 A;  2CUE A;  3PO2 J;  3Q0V A;  1MBH A;  2JA6 J;  2MGQ A;  5F27 A;  2PMZ N;  4C3I J;  1G2H A;  4ABZ A;  1H89 C;  5EZH A;  3GBG A;  2DA3 A;  4XID A;  2NVQ J;  2JA7 J;  3LOC A;  1IDZ A;  4M3F A;  4QIW N;  3HOW J;  2E2H J;  2IBD A;  3MVP A;  2JJ7 A;  4DYC A;  1GT0 C;  4XK4 A;  4A3C J;  4XRM A;  4DZJ A;  4C2M J;  1CQT A;  2VUM J;  2H1K A;  1MH3 A;  2CQQ A;  1NTC A;  3SDG A;  4A3G J;  1HOM A;  2NVY J;  1WCM J;  2K9Q A;  1IC8 A;  2HOT A;  5EGO A;  2ME0 A;  2XB0 X;  3BTC A;  5E3O A;  4AC0 A;  2WB1 N;  1TWH J;  4M3B A;  5IP9 J;  1DU6 A;  5J3L A;  3HGG A;  2VKV A;  2NS7 A;  2XPW A;  2EZI A;  1ZK8 A;  5FKM A;  1A6I A;  3WHC A;  3BR2 A;  3S1N J;  5M5Y J;  3CMY A;  3BG9 A;  1U9O A;  2OPT A;  1IG7 A;  1LFB A;  3JRF A;  3GTL J;  2ID6 A;  2KT0 A;  5EGO B;  3A03 A;  5IP7 J;  1A5J A;  2QF7 A;  4MLO A;  4AYB N;  3OSF A;  1D5Y A;  3FKI J;  4IHV A;  2DA1 A;  5JLW A;  4W1U A;  3TW6 A;  5E3L A;  4A69 C;  3O8H A;  1WI3 A;  1MBG A;  1MSE C;  3FIS A;  1RKW A;  4MIM A;  1JKO C;  1IDY A;  3HOY J;  2DN0 A;  1BJZ A;  2EQR A;  1GV5 A;  4UUS A;  5IPA A;  2MG4 A;  3L1P A;  3S1Q J;  2R7Z J;  2DA2 A;  1X2M A;  3GTM J;  3BR6 A;  3CCY A;  2I10 A;  5K7H A;  1ETV A;  2X6O A;  1RR7 A;  2JK3 A;  4Y52 J;  2HXI A;  1UMQ A;  4UUS B;  3C2B A;  3JRC A;  4CYC A;  1X2N A;  5K7F A;  1XS9 A;  2E2I J;  1MNM C;  2R0Q C;  1ZGW A;  2ZB9 A;  1ETW A;  1JT0 A;  1MH4 A;  4QSH A;  1ETK A;  2M0C A;  2ME6 A;  4BKX A;  9ANT A;  3LSP A;  3GTK J;  2R5Y A;  1QVU A;  2DMP A;  2EH3 A;  3BQZ A;  2LK2 A;  1FIP A;  5C3E J;  2XGD A;  3BR0 A;  4CYC B;  1TWF J;  3BTJ A;  1ORK A;  5EF6 A;  1X58 A;  1ETO A;  2EZH A;  2LD5 A;  1SFO J;  2L9R A;  2DJN A;  5FJ8 J;  2ID3 A;  4A3J J;  2Y2Z A;  2R5Y B;  2MSY A;  3HKZ N;  4LOC A;  1DU0 A;  5IYD J;  1AKH A;  2K40 A;  2X9D A;  4S0H B;  2G0E A;  3JRD A;  3B6C A;  3H3V K;  1VF9 A;  3S14 J;  1Q1V A;  2WV1 A;  3G1O A;  3HM5 A;  2HOS A;  3HGY A;  1HDD C;  5GPA A;  1F43 A;  1IV6 A;  2JA8 J;  2K9S A;  4JP0 A;  3PM1 A;  3ZQG A;  1JTX A;  1AKH B;  2M8G X;  5EDN A;  1GVD A;  3I4N J;  2QCO A;  4RDU A;  1JUS A;  2WAQ N;  4JX6 A;  5J1R A;  2E2J J;  3G1M A;  1H88 C;  4BBR J;  2OF7 A;  3Q3S A;  1MBE A;  3BTI A;  1HCR A;  3F0C A;  1HDP A;  1P7J A;  2DMN A;  1FIA A;  2L7M P;  4IEJ A;  1ZKG A;  4M3D A;  3FK6 A;  1RET A;  2CU7 A;  4MFE A;  5GPC A;  3S15 J;  4IHW A;  2HOA A;  1YRN A;  3NAU A;  2HDD A;  4JX5 A;  1FTT A;  1LFU P;  4A3F J;  1XC5 A;  2H8R A;  1BW5 A;  4FCY A;  1P7I A;  2DA6 A;  3RZO J;  3VPR A;  5FKO A;  2VPR A;  2TCT A;  3A02 A;  3JRI A;  2AHQ A;  3GTJ J;  4L5E A;  2NS8 A;  1YRN B;  2LTP A;  4BBS J;  4G12 A;  2O7O A;  1Z77 A;  2IAI A;  1H8A C;  2JA5 J;  3BG5 A;  1Y1V J;  2Y0S N;  2FX0 A;  2VI6 A;  1W0T A;  5IOZ A;  2W48 A;  1B72 A;  5JLX A;  1BA5 A;  2MW8 A;  4DW6 A;  4Y7N J;  3HEF A;  3H0G J;  3G1L A;  5FKN A;  4B1R A;  1GUU A;  2CRG A;  3E7L A;  2CUF A;  4AUX A;  1WH5 A;  1WH7 A;  1I50 J;  2TRT A;  2XGC A;  3M4O J;  2XB5 A;  1ZQ3 P;  2CQX A;  3HOZ J;  1B72 B;  3ZQL A;  4A3B J;  3LSR A;  4B4C A;  1K83 J;  1OFC X;  1JTY A;  4X1E A;  5EZG A;  3Q0W A;  2K9N A; 
#chains in the Genus database with same CATH topology
 2H6C A;  1R36 A;  3WE2 A;  2DOD A;  2XIG A;  3HUG B;  4OMZ A;  3TO7 A;  2LY9 A;  3R6S A;  3WTZ A;  4FQG A;  3GME A;  3ZRG A;  3IH3 A;  2CGP A;  2L4M A;  2P6S A;  3IH4 A;  3GTP J;  3GTQ J;  5DD8 A;  5BNG A;  2IJL A;  3SZG A;  1ZH5 A;  3RJP A;  4C9Y A;  2LR8 A;  4H0E A;  3HSF A;  4A5M A;  4AIH A;  1MBK A;  1R5H A;  5HDG A;  3ZQC A;  2ETH A;  2O8K A;  2XAH A;  1LJ9 A;  1YE9 A;  1IJW C;  1WKM A;  4MGR A;  3S17 J;  2GXG A;  4Y4R A;  4D0P A;  3ZCO A;  4XBF A;  1MDM A;  3A2K A;  2XF6 A;  4BY1 J;  2ZBK A;  1WJE A;  2BY1 A;  4XON A;  4RGU A;  2K27 A;  2Z33 A;  4H4K C;  3HHH A;  2IS2 A;  2R7S A;  5ICF A;  1RR8 C;  2JVH A;  2KIQ A;  4KMU X;  3ZQH A;  5F0H A;  2KIM A;  2VL8 A;  4XOT A;  3I56 I;  4RS8 A;  4RLF A;  2R5Z A;  2WY7 Q;  3DPT A;  5IP6 A;  3CCQ I;  1LKX A;  4IRI A;  2EFP A;  1VI0 A;  1DPR A;  4V2G A;  2E1O A;  3HL2 A;  2F48 A;  1LE8 B;  1EF4 A;  3F72 A;  1DUX C;  2IRF G;  1EH6 A;  4J00 A;  2O8X A;  5K7Z A;  4IVN A;  1JXS A;  3BTL A;  1I3A A;  4F52 A;  1TTY A;  2LFB A;  3LSG A;  1B8I B;  2JUG A;  4IL6 C;  4MHG A;  2QA4 I;  4C2U A;  2FMY A;  2VQH A;  3GTG J;  4HRI A;  1VFC A;  2HWV A;  3TQN A;  3RSN A;  1QO0 D;  1O4X A;  5DCM A;  5IYC J;  3JTG A;  1LDK B;  4FE7 A;  1CGP A;  1YW9 A;  3O6B B;  2CJJ A;  4MFD A;  2XRL A;  4Y17 A;  1R71 A;  3W6V A;  1R23 A;  2XPU A;  2DU9 A;  3CUQ B;  2QSG X;  3SFI A;  1IXR C;  3QAH A;  3ZPL A;  2ZFW A;  2NOG A;  5FD5 A;  5CVI A;  1U3E M;  1VQ9 I;  1ETY A;  1WJC A;  1LDD A;  3FX3 A;  4E7L A;  4P96 A;  1ZN2 A;  1G3S A;  4XMY A;  3OWT A;  3D5R C;  3KX2 A;  3LSM A;  4Q4Z F;  1X3Z B;  4FIS A;  2PQ8 A;  5ICE A;  3L2Q A;  3FHZ A;  1MIJ A;  5CVU A;  2JWT A;  3HJE A;  2LOO A;  1Z67 A;  2ESN A;  3KP3 A;  5F0C A;  3T8T A;  5J1Y A;  5M3F J;  3S2D J;  1FBU A;  3FM3 A;  5IOY A;  1F36 A;  3OY9 A;  4KN4 X;  2HTS A;  2E5Z A;  5IT9 K;  5FLX Z;  3HOS A;  3VB2 A;  2QQB A;  2CUJ A;  4UVA A;  1NG6 A;  1TWC J;  1HW5 A;  1U5T A;  4XLC A;  1FX7 A;  4YEJ A;  3OR2 C;  3L2W A;  3CC2 I;  5GTH C;  2IPQ X;  4GRI A;  1VQL I;  2V1N A;  2BOL A;  2HZT A;  2LG4 A;  1XSV A;  4A3E J;  4W97 A;  4YFK F;  2J5P A;  3IV5 A;  3LSH A;  3P7N A;  3GFI A;  3JAM K;  2LRD A;  2IW5 A;  3QPS A;  1J5Y A;  2O3F A;  5FO5 A;  4DGW B;  5H20 A;  1V5G A;  2ZO4 A;  3ZMS A;  1WHU A;  3ZP5 A;  1BOB A;  3PSI A;  2JMW A;  1Y8R B;  2I8D A;  2Y30 A;  4QWQ A;  5IYB J;  4E7I A;  1FYK A;  1RC9 A;  1P2F A;  2HS5 A;  1TZL A;  5HS9 A;  3S1M J;  3HRT A;  2DOA A;  4C3H J;  2X0L A;  5E79 C;  1BOA A;  1D3Y A;  2PEX A;  1HF0 A;  4P55 A;  3S2H J;  2FNA A;  1X1P A;  5BQT A;  1OCO H;  2V79 A;  2VBY A;  3CES A;  1IN8 A;  4ZDL A;  1JHH A;  3N4M A;  4M9S A;  2AXL A;  4C2T A;  5EEH A;  3HOX J;  4UB6 C;  2D2W A;  4RMN A;  2DCE A;  5B1B H;  1SC7 A;  5HLH A;  4HX8 A;  2E1M C;  3K70 D;  3KYC B;  2MYS A;  2ZJR F;  1G3Y A;  3SJM A;  2K86 A;  1U9N A;  1YIT I;  2IGK A;  4I09 A;  4CZZ A;  2KP6 A;  4DBR A;  1JUP A;  2K9M A;  1FEX A;  1SFK A;  3S16 J;  3TP3 A;  4C3J J;  5CKT A;  4EM0 B;  2LYC A;  4HPQ A;  2KDZ A;  4I0B A;  2OUM A;  4PK4 A;  1WPK A;  2HFH A;  3S3N A;  2W7N A;  3ZQ7 A;  5A2Q K;  3JRB A;  3I53 A;  5GAD J;  5C4J J;  1BW6 A;  4ESB A;  1I39 A;  3GFM A;  2EIJ H;  4RAF A;  4NNJ A;  1FZP B;  4LLN A;  5FLM J;  1U8B A;  1B4A A;  1P4A A;  4V2F A;  1J0R A;  1ZR4 A;  3I59 B;  4GFB A;  1D5V A;  2MFZ A;  3EYI A;  2D45 A;  4JYK A;  2L0K A;  1TL8 A;  3H3Z A;  3D5L A;  4A0X A;  2DA7 A;  2IS6 A;  1STZ A;  3BPX A;  3TL4 X;  2R7X A;  2F5C A;  1IN6 A;  2ZNY A;  4BS9 A;  1B59 A;  2E36 A;  3KEQ A;  1JKQ C;  2LP0 A;  3SFZ A;  2P6T A;  3CDH A;  3ABU A;  3QOP A;  3H35 A;  1IZ1 A;  5F04 A;  2CUE A;  1ACI A;  1MBH A;  1B6A A;  1LVK A;  3CP2 A;  4FET A;  4I98 B;  1HA8 A;  2JZY A;  1WJA A;  2KRF A;  3F8F A;  3H3U A;  1CF7 A;  2M8E A;  2E2H J;  2M4K A;  2CS3 A;  2FNP A;  3DTK A;  4YRV A;  2BHY A;  5GTI C;  4A3C J;  4YFN F;  4XRM A;  2MD5 A;  2VJ5 A;  1CQT A;  2H1K A;  2KZG A;  1X3W B;  3H5R A;  1RRJ A;  1HOM A;  1Z05 A;  3CJQ B;  1WCM J;  3FM5 A;  3J81 Z;  4Y33 A;  3AL0 B;  3JTH A;  3AFH A;  1N25 A;  2RGV A;  2WB1 N;  4M3B A;  3GZN B;  1RI7 A;  3ASO H;  1DU6 A;  2PN6 A;  2K4J A;  1W7P B;  4CCL A;  3HGG A;  2VKV A;  1W5C C;  2NS7 A;  1ZK8 A;  1P4X A;  3DU6 A;  2XVC A;  3WHC A;  2L02 A;  5FFZ A;  2H27 A;  3BG9 A;  1U9O A;  1LFB A;  3OS1 A;  2KRC A;  1DP3 A;  2ZME C;  4AWX B;  1TW3 A;  2A5W A;  2EV0 A;  1S6L A;  2KT0 A;  5EGO B;  1A5J A;  3T8R A;  3I4P A;  2CUZ A;  1X4O A;  1D5Y A;  1R1V A;  5D5V B;  4IHV A;  2LC2 A;  2UWM A;  4BNC A;  1XSX A;  3O8H A;  4HX4 A;  1SVL A;  3KP7 A;  3WGG A;  1MSE C;  4DNC A;  3M8E A;  1IF1 A;  2KL4 A;  3QPH A;  1XB4 A;  4MIM A;  3HOY J;  1I1S A;  2DN0 A;  1BJZ A;  1WRJ A;  3K9T A;  4BJ6 C;  3VOD A;  2K3P A;  3OL3 A;  3BY6 A;  2HVR A;  3WTT C;  4OIN F;  3K10 A;  2K85 A;  1QZY A;  3LSI A;  3S8P A;  2HPM A;  2HVQ A;  2OCE A;  3I55 I;  2RNJ A;  2V7F A;  4KNY A;  3RCO A;  4FHT A;  1RR7 A;  2IT0 A;  4HNT A;  4OIO F;  4PSW A;  2LY2 A;  3I58 A;  1SFU A;  1D1A A;  3PQJ A;  3AG1 H;  4AID A;  2VT3 A;  1NH3 A;  1MNM C;  2MD0 A;  3VFZ A;  1ZGW A;  1MH4 A;  2R7W A;  1ETK A;  3DWL E;  3MFK A;  5D8L B;  2VIX A;  5KAI C;  2GIV A;  1HSJ A;  1EA3 A;  4KN7 X;  1QBJ A;  3BQZ A;  4UY8 I;  3W2W A;  1NG7 A;  1O3S A;  3F23 A;  3BR0 A;  1V5E A;  2G7H A;  3FMS A;  1FMW A;  1X1B A;  1ETO A;  3VYU B;  4BAY A;  2MC4 A;  3FXU A;  3IAM 2;  3HKZ A;  5HLT A;  2FXA A;  3E0J B;  3E3V A;  1YX5 A;  2BXY A;  2R5Y B;  2LH9 A;  2CSO A;  5LEK A;  3VYS B;  3J80 Z;  1RUN A;  1ZAO A;  3ZGK A;  2X9D A;  2HGC A;  2EIM H;  2G0E A;  4PJN A;  3JRD A;  2VQG A;  2JRT A;  3Q5F A;  1IXC A;  2WV1 A;  3HM5 A;  5DUK A;  2HOS A;  3OR1 C;  1HDD C;  4XKV A;  1KQ9 A;  4E7Z A;  2VQL A;  1K6O A;  5E1Z B;  2WAQ A;  4NUB A;  1TNS A;  4GYG A;  4XKC A;  2M8G X;  1XD7 A;  2BXZ A;  3P9K A;  5HOO A;  4BEH B;  4OOI A;  3G1M A;  3E1S A;  4BBR J;  4XNF A;  3CMM A;  3BZ6 A;  3CF2 A;  2V9V A;  2MC3 A;  1OR7 A;  2EFW A;  2HVS A;  1W4M A;  3F0C A;  4PJM A;  4M74 A;  1KGS A;  4KFC A;  2R7V A;  4TV7 A;  4LGW A;  4G7Z F;  2L7M P;  1YJ9 I;  1VTN C;  2XF7 A;  1ZKG A;  2L4A A;  5BMZ A;  1S8N A;  5D6F A;  2XAJ A;  4HF2 A;  4PDK A;  5JHF A;  3MZH A;  2CU7 A;  2EJR A;  4IHW A;  4ENJ A;  1YRN A;  3NAU A;  5ERI A;  1ZGA A;  4QLC U;  2JTV A;  4A3F J;  2WB1 A;  1XC5 A;  2PBI A;  4HEA 2;  2KJC A;  3X2Q H;  4FCY A;  2DA6 A;  2XGX A;  4B48 A;  2BBY A;  3CDI A;  3RYP A;  4ENN A;  3GTJ J;  1R5G A;  2IS1 A;  3K1P A;  2NS8 A;  3DQV C;  4L5E A;  2X1D A;  2LTP A;  2Y0S A;  1EJ9 A;  3J7Y J;  1VQN I;  1SD5 A;  2W4S A;  3TMO A;  1R00 A;  3M8J A;  1XMX A;  3GCM A;  4JOM A;  4D9J A;  2RV8 A;  2JA5 J;  2MA3 A;  4BQQ A;  2FX0 A;  2BV6 A;  2VI6 A;  2IGM A;  2ESH A;  1T8I A;  1FSE A;  1BA5 A;  1YS6 A;  2OQR A;  1XN7 A;  5D6E A;  1LVA A;  3KZI C;  5FKN A;  1USS A;  2L7K A;  1UZC A;  1FT9 A;  4L9T A;  2F4O B;  2BW3 B;  2VC1 A;  2XUB A;  3MKY B;  1Z1D A;  2LRE A;  1ZAR A;  2HDC A;  3HUG A;  2OQG A;  3HOZ J;  1U5T C;  1Y0N A;  5ILU A;  4PGG A;  3ABL H;  4B4C A;  3NWT A;  1WJ5 A;  3TO6 A;  5HLI A;  1LNW A;  2ZFU A;  3DTI A;  5EZG A;  3L2R A;  2K9N A;  3KZZ A;  3DFG A;  2P81 A;  2X48 A;  3E97 A;  3KYL A;  3DKX A;  1LEA A;  4A3K J;  5F1R A;  3V7S A;  1I6H J;  1Z7L A;  5DM6 F;  5JR3 A;  1J9I A;  1N78 A;  5ILV A;  2YU9 J;  2A61 A;  2KPM A;  4GO1 A;  4XLA A;  4PJ0 C;  1OLT A;  1XDU A;  2GAU A;  3BC8 A;  2YUS A;  4EGY A;  3FMQ A;  5GAH J;  3RKQ A;  2OCC H;  1SVO A;  4J19 A;  4HG2 A;  4IHY A;  3BPV A;  3HSE A;  3DP7 A;  4CCO A;  1BR1 A;  4E7K A;  2IA2 A;  3CZ6 A;  2FQ4 A;  4FE4 A;  1OPC A;  2QVO A;  2CWE A;  3MD2 A;  2VBX A;  4RAZ A;  1K7A A;  2A05 A;  1FOW A;  1UB9 A;  5KCM A;  3LFU A;  5FKL A;  1R4M B;  5L3F A;  4E7J A;  5IT3 A;  1QGP A;  3K4M A;  3DPL C;  1ETX A;  3CO6 C;  4KYW A;  2QSH X;  1K6Y A;  1LE8 A;  5JVG F;  2VOO A;  4HNV A;  2IA0 A;  5CVV A;  2DTR A;  1IUF A;  4B3X A;  5JHU A;  4G7O F;  2XKO A;  1B8I A;  5ICC A;  1FWZ A;  3IUO A;  4RGS A;  1TQI A;  6PAX A;  2B7E A;  4I76 A;  3W3C A;  2LKP A;  3MN2 A;  4BE2 A;  2DO7 A;  1TW2 A;  4R79 A;  3I3L A;  3CC4 I;  1W7P D;  3E6M A;  3WTY C;  2RN7 A;  1RNL A;  4G6D A;  4HLX A;  4D7M A;  2L54 A;  3OYB A;  1Y0U A;  3AG3 H;  4RLQ A;  3MZ8 A;  4LG3 A;  5CVR A;  3CUQ A;  4HA8 A;  2F5F A;  4G8X A;  1XMA A;  3OYL A;  2ZKZ A;  4MNU A;  2Y48 A;  2UV1 A;  4KIF A;  2DAO A;  2XGE A;  5KK1 A;  1XDS A;  3ZXS A;  4CCN A;  2DMT A;  4BXU A;  5DTD A;  1YX3 A;  1ZLK A;  3FMR A;  1ZRD A;  1RPW A;  3HOU J;  3CJT B;  1T56 A;  4KDP A;  3RKY A;  1HKT A;  4XRS G;  1V5F A;  5AIQ A;  4Z6Y A;  2LDU A;  4A3D J;  1WJD A;  1GHC A;  5B1A H;  2DOE A;  1YS7 A;  1YIJ I;  4O3M A;  5FB2 A;  3TP0 A;  2PI0 A;  2YS9 A;  4O6J A;  3KLO A;  2AS5 F;  4DYR A;  2Z16 A;  4D1Q A;  2LF7 A;  2M2E A;  3K4J A;  2LKX A;  4OAY A;  2EBI A;  1KON A;  5C44 J;  5HS8 A;  1IRF A;  1FC3 A;  2M5W A;  2KJB A;  2P8T A;  2R7R A;  2GBY A;  3VDX A;  3WTV C;  3NRV A;  5J47 A;  4I6Z A;  4A6E A;  3QU6 A;  2FD5 A;  1SD6 A;  1IN7 A;  1S7O A;  3E6D A;  4EEF G;  2Z99 A;  3RQI A;  2Z3Y A;  1GV2 A;  4BGD A;  2IA1 A;  1QHH D;  3KFW X;  3UKG A;  2COB A;  3OYD A;  2HQR A;  4F91 B;  4B09 A;  4BUP A;  2EA4 A;  3HXL A;  3PIO F;  1JGG A;  3CDL A;  1E3O C;  2NYX A;  4A3L J;  1ZEL A;  4M72 A;  3CC7 I;  1TQP A;  1BI1 A;  1R22 A;  3DEU A;  4E7S A;  3TW7 A;  1U78 A;  4ANJ A;  1O57 A;  3DEW A;  5CYV A;  1E3H A;  2O61 A;  3KP6 A;  3LA3 A;  3K4C A;  2K02 A;  2AQF A;  2QEX I;  4CZC A;  4WX9 A;  3B02 A;  2ZXW H;  3NQO A;  5E3N A;  1OJL A;  4OU0 A;  1ULY A;  5DCF A;  3TBI A;  5EG0 B;  2KIS A;  3TOA A;  1A6Q A;  1JGS A;  2RQQ A;  2PMH A;  3BT9 A;  3OYC A;  4ZYD A;  4LMY A;  3K7A J;  5F6F A;  3ZMT A;  1BR2 A;  2NVX J;  2W82 A;  1ZG5 A;  3RDI A;  4BXX J;  5FRN A;  3ABT A;  3PQK A;  2OTJ I;  2EB7 A;  3K1N A;  3RIR A;  3CCL I;  1VQ7 I;  2NRA C;  3OIP A;  3FXJ A;  1AU7 A;  2XSJ C;  1TWA J;  1FY7 A;  3GYH X;  3N05 A;  3JSO A;  4GYI A;  4NC7 A;  4WXH A;  4NB5 A;  5JI6 A;  3DEE A;  2EFQ A;  3MEX A;  2NOJ B;  1SMY F;  3H9Q A;  5HVQ C;  1S3J A;  2M1B A;  2VC0 A;  2A6E F;  4LIT A;  1UEL B;  2V9P A;  4N4N B;  1UAA A;  3HDD A;  3DLA A;  4RBO A;  3I5U A;  1X19 A;  2RNG A;  1S9H A;  3BR5 A;  4D5F A;  3W2V A;  1QA6 A;  3CJR B;  3I59 A;  1BC7 C;  2WA0 A;  3A01 B;  5EJC A;  3H1C A;  1MJA A;  2XDV A;  1ON1 A;  3HRS A;  2NXN B;  3HTU A;  3KPH A;  4IRH A;  1XX5 A;  4NC6 A;  4U0V A;  5BPI A;  1MSF C;  4P9F A;  4I01 A;  5HOD A;  1JJ6 C;  4X6A J;  3FXL A;  3PL8 A;  3ABK H;  3SQN A;  1OCT C;  3MWM A;  3A0H C;  2X4H A;  1O7L A;  4PCQ A;  3JCU C;  5CJ9 A;  1LUJ B;  1IXS B;  2O03 A;  1ETQ A;  2DTZ A;  2F2E A;  3PO3 J;  5CVJ A;  3BCA A;  4EM2 A;  2XSD C;  1VND A;  1D1C A;  1MJ9 A;  3TKY A;  4ZYA A;  3H9J A;  1TLH B;  4IHX A;  2Z5U A;  2DFF A;  2M7A A;  2EIK H;  3BR3 A;  2Y31 A;  1RES A;  5CLS A;  1SEU A;  4KIS A;  4XLN F;  1ZGJ A;  1FTZ A;  5JFR A;  2PMZ A;  1Z0X A;  2QKM B;  3OOP A;  4G6T B;  4PFP A;  5EEG A;  1A04 A;  3VYR B;  3C7J A;  2FEZ A;  4C3I J;  3A4C A;  1H89 C;  3GBG A;  3S93 A;  4XID A;  2G7U A;  3LOC A;  4XLF A;  4Y3O A;  5F64 A;  1ZG3 A;  1WJB A;  1P6R A;  3F8C A;  2KDO A;  2IBD A;  2JJ7 A;  2WV0 A;  3GF2 A;  1DQU A;  2NNY A;  1GT0 C;  3J7A Y;  4XK4 A;  2DYR H;  1W7P A;  4DZJ A;  1OR7 C;  4E6K G;  4XLP F;  3C2H A;  4RGX A;  3QP5 A;  3V4G A;  2CQQ A;  3OYM A;  2NVU B;  1SFX A;  2OA4 A;  5J6X A;  4KA4 A;  4XSZ F;  2ELJ A;  2VLA A;  2XRO A;  5EGO A;  2ME0 A;  3OMY A;  3BTC A;  3WTU C;  3C2G A;  4AC0 A;  1TWH J;  4G94 A;  5J3L A;  5LD2 C;  2KZV A;  3RYR A;  5FKM A;  3WGI A;  3ELK A;  1A6I A;  3BR2 A;  3CMY A;  3CP8 A;  1KA8 A;  3M9A A;  2C6Y A;  2OAZ A;  2M7B A;  1REP C;  2X1E A;  2ID6 A;  3MKW B;  3A03 A;  1N75 A;  3GZ5 A;  3BJO A;  2QF7 A;  3OSF A;  1OCR H;  2DBB A;  4LG0 B;  1S72 I;  2DA1 A;  1D0Y A;  3DV8 A;  4ENM A;  5E18 F;  1S7A A;  4E7H A;  1PDN C;  2F6C A;  3QWL A;  4A69 C;  1WI3 A;  2FE3 A;  3IWZ A;  2CV2 A;  3QOE A;  1KZH A;  1WZ2 A;  1RKW A;  2PJR B;  5E8G A;  1I1G A;  1GV5 A;  2DK8 A;  4CA0 A;  4UHT A;  5CQE A;  5FLX K;  2QWW A;  3FXQ A;  4X0G A;  1K78 B;  1HW1 A;  2R7Z J;  1X2M A;  2NS0 A;  2JPC A;  3CCS I;  2M0M A;  5ICG A;  2X6X A;  5K7H A;  2VN2 A;  1D1B A;  1BN5 A;  2KIU A;  2X6O A;  3PFI A;  4M6X A;  2JK3 A;  1TBX A;  4Y52 J;  4LB5 A;  2JSC A;  1T0F A;  3C1D A;  5AIP A;  4ESF A;  1X1C A;  3AG4 H;  4EV0 A;  4UUS B;  2QQ9 A;  3C2B A;  1YYV A;  2H8W A;  2IS4 A;  4I2O A;  5A2Q Z;  1E3P A;  2YSR A;  1IN5 A;  1M1E B;  5E1X A;  1SD4 A;  5LLQ A;  2M0C A;  4IPA A;  2ME6 A;  4BKX A;  4DQ2 A;  5KNL A;  9ANT A;  1G3W A;  2R5Y A;  1QVU A;  3WU2 C;  1QQI A;  2LK2 A;  3OYH A;  2WAE A;  3HYI A;  3ZMZ A;  1FIP A;  3E6C C;  5DDG A;  3O2P E;  1TWF J;  4CGZ A;  4EJU A;  3FHN A;  5EF6 A;  2LD5 A;  1SAX A;  2L9R A;  2DJN A;  5GAE J;  5FJ8 J;  2M30 A;  4A3J J;  3RI4 A;  1HKS A;  2VKH A;  2L2O A;  2L3D A;  2MSY A;  3HKZ N;  3GO5 A;  4S0H B;  1EH8 A;  2OU2 A;  1VF9 A;  3IHU A;  2OTL I;  3S3M A;  2YPR A;  4IHS A;  3I71 A;  3G1O A;  4BEH A;  3HHG A;  1BIA A;  3S2W A;  3ERM A;  1F43 A;  3OYA A;  1A31 A;  1YJN I;  1ZLJ A;  1OYW A;  3PM1 A;  4WXD A;  3ZQG A;  4GXO A;  1V3F A;  4KT5 C;  5EDN A;  1GVD A;  5D4S A;  2E1N A;  3RPU D;  1U2W A;  4C30 A;  2JUC A;  2WAQ N;  2P5V A;  5J1R A;  3L9F A;  1H88 C;  1XGM A;  3KP2 A;  2RVC A;  5L3D A;  3F6O A;  3Q3S A;  1MBE A;  2XAQ A;  1LEB A;  2H09 A;  2QBY B;  2LY1 A;  3C18 A;  1T2K A;  4IEJ A;  1F1Z A;  3OYE A;  1H9T A;  4M3D A;  4ZDO A;  1HXD A;  2ZSH B;  1VQK I;  2NNN A;  5K1Y A;  3CUQ C;  1K4S A;  1HQC A;  4QPQ A;  5KAF C;  2QGU A;  3HZJ A;  1VQ5 I;  2H94 A;  1BW5 A;  2CYY A;  2FRH A;  3WOD F;  1F4K A;  1VQO I;  5FKO A;  3ULQ B;  3PJR A;  3A02 A;  3FXK A;  2CFX A;  2ISZ A;  1VQ8 I;  1R58 A;  5J4Y A;  3A1Y A;  3ESW B;  4II3 A;  4OMY A;  4YEL A;  4BBS J;  3OYN A;  2KRH A;  2IAI A;  4XLH A;  4NQW B;  2EPF A;  2BW3 A;  2Y0S N;  2FBH A;  2DYS H;  3I54 A;  3KEY A;  4L0Z B;  3OYF A;  2BZT A;  3EQL F;  3GFL A;  5IOZ A;  2W48 A;  4FX4 A;  2YX4 A;  2VJ4 A;  2R7O A;  5JLX A;  4HQE A;  1GXQ A;  1O7F A;  2ZSI B;  1O3T A;  3U1D A;  2X6Y A;  4ASN A;  3G1L A;  1MZB A;  2DT5 A;  2K4B A;  2CUF A;  3E7L A;  3U21 A;  4AUX A;  5DUI A;  2DFE A;  2QUF A;  1WH5 A;  1WH7 A;  2HQA A;  1T95 A;  4G6Q A;  4XL9 A;  3L2C A;  2XGC A;  2E60 A;  3K69 A;  3WU1 B;  4BJT A;  3EDP A;  2XB5 A;  1ZQ3 P;  3FKJ A;  4YFX F;  3IRR A;  2E1C A;  3J81 K;  1R5I D;  1JTY A;  5H6R A;  1U6G A;  3SEZ A;  2XAG A;  4EGZ A;  2V4J C;  1WQ2 A;  3WE3 A;  5DS9 A;  4UNO A;  2V9K A;  2XAU A;  4FAS D;  1IRX A;  3F3X A;  3QQA A;  3HOV J;  2KFD A;  2R7Q A;  2ECB A;  2CW0 F;  4M3G A;  2A5Y B;  1IAW A;  5E1W A;  1G8X A;  1POG A;  3Q0U A;  4UVB A;  1WFX A;  2P7C B;  2PJP A;  4YIF A;  5J8C A;  3K2A A;  3TDZ C;  3IH2 A;  1XTA A;  1IN4 A;  2QSF X;  3EUA A;  3F8B A;  1UHM A;  3ERE D;  1VQ6 I;  4HF0 A;  4XSX F;  2D5V A;  2AO9 A;  3KEO A;  3EYY A;  1KQ8 A;  1KQ0 A;  2PG4 A;  3K4K A;  1JKP C;  2VJJ A;  4IQ4 A;  3SYT A;  1LDJ A;  2Y69 H;  3MKZ A;  3CO7 C;  2CQ7 A;  3GXO A;  2M45 A;  2FF4 A;  4Y13 A;  2DA5 A;  2WY8 Q;  3HPH A;  3MKL A;  4LIU A;  4P1W A;  4BAC A;  5L3B A;  2HYJ A;  1YIO A;  4UUT A;  3UNG C;  5K5R A;  1IRG A;  2RDP A;  3JRH A;  1K4T A;  4M9X A;  4JQF A;  3WGH A;  1DGR M;  3PSF A;  2GOM A;  2D1V A;  2ZNZ A;  3OYG A;  3BP8 A;  4EM1 A;  3LAJ A;  4LLL A;  4XIC A;  1LFP A;  2W25 A;  2KQR A;  4FTH A;  1SFE A;  4IF4 A;  3EET A;  3H9G A;  4JK1 X;  1K61 A;  2F4I A;  5H6Q A;  2B63 J;  2LSO A;  1AHD P;  5DM7 F;  1B9N A;  1HBX G;  3KZY A;  1WVR A;  1BL0 A;  3CJN A;  4U87 A;  1H0M A;  4IKF A;  2W24 A;  4S04 A;  2DOF A;  2M34 A;  4HLY A;  1AOY A;  4O5V A;  1JKR C;  3ECH A;  2STT A;  2K9L A;  3J80 K;  1QPI A;  3BG3 A;  2OD5 A;  1BC8 C;  2V6E A;  1RKT A;  1X4P A;  2Q2E B;  4KT6 A;  2VBZ A;  1Z3Y A;  4BQA A;  3ZMV A;  2FJ1 A;  3SXY A;  1MW7 A;  3KP5 A;  3NWS A;  5F0F A;  4F3Q A;  2ZXI A;  3BR1 A;  1X1D A;  2PX9 A;  3I4M J;  2X1C A;  3P9I A;  4AU7 A;  3GUD A;  2IEK A;  1G4D A;  5BPD A;  3RPU A;  5FKK A;  1IO2 A;  3HSR A;  3NEU A;  1GXP A;  4FX0 A;  2EFN A;  4B47 A;  1XMK A;  2MAB A;  1NK2 P;  5K5O A;  1YOV B;  4P9U A;  2ELH A;  4M73 A;  1DPU A;  4UVC A;  3U1K A;  3V8J A;  3C3W A;  2ECC A;  1UST A;  2L7Z A;  1MBJ A;  3KYD B;  3WHB A;  2GA1 A;  3BCB A;  3DCF A;  1IV8 A;  1FP2 A;  3V8K A;  3HPG A;  2BEO A;  3AL0 C;  1B1B A;  3DU5 A;  5F1J A;  3OV8 A;  4M6Y A;  4J01 A;  4A3I J;  1ERD A;  1HLV A;  3TDU C;  1ZTR A;  3V8L A;  3G2B A;  4A5N A;  2CQK A;  2OV7 A;  4RGR A;  2F4M B;  5BOX A;  1UHW A;  1UFM A;  2H6B A;  4N9I A;  2P4W A;  4B8X A;  2GXB A;  3Q9S A;  5EG0 A;  3QOD A;  4N0B A;  4UXN A;  4HF1 A;  3LQQ A;  3LNQ A;  2AXT C;  3QYF A;  3QU3 A;  3PUF A;  4XOP A;  1MGT A;  2OZU A;  1JJ8 C;  3KP4 A;  3CLQ A;  4LFU A;  4ON0 A;  2WBM A;  3W6J B;  3P9C A;  2OBP A;  4HDU A;  2MLK A;  4RB0 A;  1F5T A;  2E5N A;  4DOZ A;  1TT0 A;  1MND A;  1BI0 A;  3LSJ A;  2GXA A;  4EMS A;  1T6S A;  3DTE A;  4YII A;  1I3Q J;  1ZYR F;  4M9Z A;  2Z2S B;  2VOP A;  2QEN A;  2DXI A;  3ROU A;  5M5W J;  3JRA A;  2XRN A;  3T0Y A;  4IZZ A;  3ECO A;  4OWR B;  1XCB A;  2GZW A;  3OSG A;  4S05 A;  4ZYG A;  4A93 J;  2DDA A;  2ZJQ F;  1FMV A;  3A01 A;  1NHA A;  1OQY A;  4D5C A;  4CDG A;  1JT6 A;  3H92 A;  4ZC3 A;  5LGN A;  1TC3 C;  1T0F C;  3KE2 A;  1MNE A;  4KIC A;  3JR9 A;  2CV0 A;  2VOD A;  2VE8 A;  1QZE A;  1Y8Q B;  5LGT A;  5HDN A;  2X51 A;  1D0Z A;  1V54 H;  2R4G A;  4U88 A;  1PUF B;  2R3S A;  2M87 A;  1Z7U A;  4R8H A;  2JVG A;  2O5R A;  2K3F A;  4CCK A;  5LFA A;  2A68 F;  4PUS A;  2IP2 A;  4WWC A;  1E2X A;  2JN6 A;  1JUM A;  3F22 A;  3L2V A;  1U8R A;  2GLO A;  3FXO A;  5TIS C;  2GIZ A;  3KLN A;  4RA2 A;  3LMM A;  1TWG J;  3G6E I;  5EYR A;  5TJJ A;  5IY5 H;  4N4O B;  3DXJ F;  4HQM A;  3BDD A;  2WAD A;  2VB6 A;  4I0A A;  3V42 A;  1ENH A;  3KIO A;  3L00 A;  2RAE A;  3J7Z I;  4XM3 A;  4XKW A;  1QZZ A;  4UB8 C;  3H5A A;  4U0Y A;  2XAS A;  3CD6 I;  1QU3 A;  4U0W A;  2XV4 S;  1WGX A;  3IAS 2;  1L3L A;  3GVA A;  4XRF A;  4XOR A;  2YX7 A;  1MBF A;  1XGS A;  3LSK A;  1YLF A;  3Q0V A;  4L5J A;  1ODD A;  2LF8 A;  3T1B A;  2JA6 J;  2MGQ A;  5F27 A;  2PMZ N;  2X6W A;  4ABZ A;  2GA2 A;  3I9V 2;  2HTJ A;  5EZH A;  1MMA A;  2F5D A;  2DA3 A;  4NHJ A;  3Q9V A;  4CYD A;  2NVQ J;  2BHZ A;  2JA7 J;  4XQF A;  4M3F A;  4BDY A;  1X1A A;  1MMD A;  2FBI A;  5HNF A;  3UR3 C;  4C2M J;  2VUM J;  1JI8 A;  1MH3 A;  3M1C A;  1LPQ A;  1NTC A;  2NVY J;  2K9Q A;  4B44 A;  1YG2 A;  2UXX A;  1W36 D;  1WI9 A;  5E20 A;  1T98 A;  3G3Z A;  4LG0 A;  5B5E C;  4B43 A;  3OYJ A;  1BI3 A;  3GLL A;  4HV5 A;  1YW8 A;  5M5Y J;  4Q5S F;  4AYB A;  2OPT A;  1IG7 A;  3DBH B;  5BS6 A;  3JRF A;  2DFH A;  2PJR A;  2VE9 A;  5IP7 J;  1TT5 B;  1P9Q C;  4MLO A;  2M3A A;  2XC7 A;  2DDB A;  2P7V B;  4PJL A;  5JLW A;  4W1U A;  4L5I A;  3TW6 A;  4F92 B;  4IX7 A;  4ESJ A;  1K78 A;  2BE5 F;  3WTW C;  4WK8 F;  3FIS A;  4PSX A;  1VZ0 A;  3V7C A;  2VXD A;  2F5V A;  2UUZ A;  4UUS A;  2MG4 A;  1HW2 A;  3CMA I;  3QYB A;  2FQ3 A;  2R7F A;  2DA2 A;  2JSP A;  1RUO A;  3BR6 A;  3CCY A;  2I10 A;  1GVJ A;  1FLI A;  1FP1 D;  1ETV A;  5D5U B;  2COM A;  1G6N A;  2Y0M A;  3OYI A;  4HZF A;  1UMQ A;  4HDV A;  4AIK A;  2E1M B;  1HKQ A;  2ZCW A;  2H1L A;  2FA5 A;  1OMI A;  5K7F A;  1SMT A;  1SVM A;  3S32 A;  3TO9 A;  1ETW A;  4GCV A;  3U9G A;  4QSH A;  4EJW A;  3VSK A;  1IUY A;  3LSP A;  3GTK J;  4AVZ A;  5JVT A;  2DMP A;  5FRM A;  2EH3 A;  2W85 A;  2VJI A;  1HST A;  4RB3 C;  3KCC A;  5J8F A;  1H9G A;  1P4W A;  2A07 F;  2XGD A;  2STW A;  2VKD A;  4CYC B;  1FOY A;  1DDN A;  1SFO J;  3W6K B;  3OIQ A;  3HOT A;  2CG4 A;  2E71 A;  2ID3 A;  3B73 A;  5DYM A;  4MTE A;  2Y2Z A;  2O6G E;  3VYT B;  2GWR A;  1WWX A;  4Q48 A;  5HNH A;  1DU0 A;  1Z6T A;  2JT1 A;  2L5Q A;  3E6B A;  1D8J A;  4CHU A;  5LHI A;  1Q1V A;  2W1O A;  4UUV A;  1A36 A;  3HGY A;  1TQM A;  1KYZ A;  4BJ5 C;  5D5X B;  2JA8 J;  3F6V A;  2K9S A;  1KU2 A;  2OC6 A;  2QBY A;  2KMU A;  4IQJ A;  1JTX A;  1AKH B;  1MJB A;  4RM3 A;  3BZK A;  1UJ8 A;  5L3G A;  4RDU A;  1JUS A;  3S3O A;  4JX6 A;  2E2J J;  1YFH A;  5LHH A;  1Z3X A;  2E35 A;  1DGW Y;  5DEQ A;  3ISP A;  3IL2 A;  1BJA A;  1G59 A;  4ZZL A;  4PFO A;  3K70 C;  2E7W A;  4UV8 A;  1R7J A;  1YQA A;  1BI2 A;  5IT9 Z;  2DMN A;  5FGM A;  3JSP A;  2YR2 A;  5TRD A;  1OIS A;  3RPQ A;  2HOE A;  1T39 A;  1ZRF A;  2L9N A;  5K5Q A;  2Y75 A;  2RKH A;  3H5N A;  3FK6 A;  1RET A;  1UCR A;  2DQL A;  1PUE E;  2J5O A;  5DV5 A;  5GPC A;  1J59 A;  1Q1H A;  4KIT B;  4F55 A;  4EAT A;  2HDD A;  3K4N A;  1Y6I A;  4JX5 A;  1FTT A;  4HAM A;  3JAM Z;  4HX7 A;  5TGT A;  3TOB A;  4FT8 A;  4DJA A;  1FSH A;  1P7I A;  2CQN A;  4NQW A;  3VEP A;  2TDX A;  4MQ9 F;  3K0L A;  4BQN A;  1ZRC A;  4KJZ A;  2VQC A;  1TP4 A;  2XF5 A;  2DPU A;  2AHQ A;  2QM3 A;  3MAJ A;  2BY0 A;  5D4R A;  1Z91 A;  4NC8 A;  1MMG A;  1Z77 A;  3A0B C;  3JW4 A;  4A0Z A;  1T08 B;  1BR4 A;  2ZME B;  3FXM A;  1Y1V J;  1W0T A;  2CH0 A;  1SAU A;  3WG7 H;  2K5C A;  3BZC A;  3SDB A;  3ZMU A;  3LA2 A;  1Z21 A;  2MW8 A;  4HV6 A;  3DLL F;  1B9M A;  2AQE A;  2Z9O A;  4Y7N J;  1QNT A;  2LBF B;  3HEF A;  1K79 A;  3H0G J;  2EK5 A;  2HKX A;  4B1R A;  1GUU A;  4A2U A;  2ZXH A;  2W57 A;  2EIL H;  2TRT A;  3HC7 A;  1B72 B;  4LK0 F;  2EWN A;  4A3B J;  1XGN A;  3U2R A;  3T5X A;  1K83 J;  2Z1D A;  1G3T A;  4L18 B;  2NVT J;  3GTO J;  1W5T A;  3OOU A;  2DJI A;  3FK7 A;  3R61 A;  4M3E A;  4DYQ A;  1XSD A;  2E19 A;  3FWE A;  3CF5 F;  3FIW A;  4UV9 A;  4AD9 A;  3GFJ A;  4A3M J;  4JX4 A;  4BL0 B;  3M07 A;  1OCP A;  3BJ6 A;  5B3S H;  2BVM A;  3OIO A;  2HQN A;  3EUH A;  4JBA A;  5KVR A;  4M6V A;  2VKE A;  2MLG A;  1IGN A;  1A35 A;  4Y15 A;  3LST A;  1YW7 A;  3GX4 X;  3PNY A;  4QTR A;  3TED A;  1PJR A;  2X85 A;  2L7F P;  2B9S A;  1NK3 P;  3COA C;  2V1U A;  2LLK A;  1UG2 A;  3F8N A;  4CH7 A;  2MH9 A;  3BQY A;  4NDL A;  3ZN1 A;  2A6T A;  2HU9 A;  5EEA A;  4KIG A;  4RB1 A;  2DK5 A;  3I64 A;  2GOX B;  3K4L A;  2OJE D;  1E17 A;  3K4B A;  4BHC A;  2HI3 A;  2PMU A;  3DF8 A;  3V7R A;  2FOK A;  1XCV A;  1J09 A;  4BH9 A;  1FYL A;  2BYV E;  4BY7 J;  1Y39 A;  1MDM B;  3CME I;  2IGN A;  4HW0 A;  4RB2 C;  2R7U A;  2DQR A;  2V1D A;  4II2 A;  4BHB A;  1FBQ A;  4I02 A;  1PYV A;  3D1N I;  2M4G A;  4L9N A;  3M1E A;  2FU4 A;  3BLY A;  1I27 A;  2EIN H;  3CTA A;  3JRG A;  2R5Z B;  2Q2E A;  4LK1 F;  2Y9Z A;  2VAS A;  2M9H A;  1KU7 A;  4OIP F;  3K2Z A;  3FZV A;  3ZN0 A;  4EJO A;  2R92 J;  1MMS A;  3ZQF A;  2HQ5 A;  4RM2 A;  4ZZD A;  5E3M A;  2L9S A;  2GQQ A;  3J7A O;  4AIJ A;  2DMU A;  4ZTF A;  1LQ1 A;  3VOE A;  2GM4 A;  2KHM A;  3ZOB A;  4CXF A;  2FBK A;  3R0A A;  1S7E A;  5L3C A;  3TGN A;  5DD4 A;  2K7L A;  1MKM A;  2Y9Y A;  3EPZ A;  2ZC2 A;  3GEZ A;  1Y1W J;  3QPT A;  4B3A A;  1I5Z A;  1T33 A;  2EZK A;  3FXR A;  5DCM B;  1VQP I;  3HG9 A;  4KIB A;  2A6H F;  1XGO A;  1YTY A;  1KU3 A;  5M3M J;  5HS7 A;  1QVT A;  1FBS A;  2IVM A;  4D7N A;  2CW8 A;  2Q8K A;  1SAN A;  3JRE A;  5L3E A;  1IRZ A;  4AM3 A;  4F7Z A;  2QZ8 A;  3SHF A;  2PLY A;  2FOW A;  2N8G A;  2XHK A;  1W0U A;  1FJL A;  1ONV A;  4R1H A;  3M3Y J;  1QRY A;  3CCM I;  2IXS A;  5J1U A;  4ZH4 F;  4CCJ A;  3L7W A;  2DMQ A;  1Z9C A;  4MO7 A;  5M5X J;  2DT7 B;  3BJA A;  4MEY F;  4EQQ A;  1ZR2 A;  1ON2 A;  3IRQ A;  2F5E A;  2KLO A;  1F9N A;  1UHS A;  5LRS A;  1FOX A;  2VBW A;  4A0Y A;  2UXN A;  2KIF A;  1UG0 A;  4HOB A;  4EVI A;  2ZJP F;  1R9T J;  4IJA A;  4Q47 A;  5C4X J;  4KUM A;  4BQO A;  5LGU A;  4XN0 A;  2XPV A;  5FRO A;  2EV6 A;  4ENK A;  4L9V A;  5HLG A;  1U5T B;  2UZK A;  1XPX A;  3ZQQ A;  2ICW G;  5FLV A;  3O8G A;  3DPU A;  5CQG A;  2EZL A;  3HB9 A;  3SEQ A;  4ZTJ A;  3P5J A;  4DIQ A;  2FUG 2;  1J75 A;  3SZT A;  4IOA F;  4ETS A;  2LMD A;  1SD7 A;  1I6X A;  1R49 A;  1APL C;  4K2E A;  5E17 F;  1JHF A;  3ML6 A;  3PFY A;  2LVS A;  1ZRE A;  1FPQ A;  3CCE I;  2ZXJ A;  1ZG1 A;  4OAZ A;  1N77 A;  4BU2 A;  4AVP A;  3FDY A;  3F8M A;  3BG6 A;  3RKW A;  1GDT A;  2QLZ A;  2B0L A;  2QQA A;  3PUB A;  3S1R J;  3H0D A;  3L2U A;  3DBR B;  2V6C A;  1XG1 A;  2HPI A;  2EA2 A;  4LJZ F;  2CW7 A;  1Y56 A;  3IP4 B;  1O3R A;  3IWF A;  2FSW A;  3OYK A;  3R0J A;  4DZP A;  3HBL A;  3FBN B;  2CV1 A;  2E34 A;  2WAF A;  4HNU A;  4G9Y A;  3RZD J;  2XKP A;  1PUF A;  3KET A;  1P92 A;  3LFK A;  4HST A;  4RAY A;  2R7D A;  3WU0 A;  3OS0 A;  4BHP A;  2DA4 A;  1S29 A;  4P5O A;  3REO A;  1QPM A;  2HXO A;  1HC8 A;  3NAR A;  3ASN H;  5F08 A;  1YHQ I;  2JQ7 A;  4F93 B;  1TNT A;  3WG9 A;  3QRF F;  3ZQI A;  3PNV A;  1WJF A;  2BGC A;  4XRS A;  5FFX A;  4ZJZ A;  3QPL A;  2HNH A;  3PNT A;  4LIV A;  2R93 J;  3I0T A;  4PGH A;  3D0S A;  1W5S A;  3G4S I;  3ABM H;  3M7G A;  2ELK A;  2Q1Z B;  2YU3 A;  4OIQ F;  1DP7 P;  3K6G A;  3B6A A;  5GP9 A;  3OS2 A;  2MBF A;  4U7D A;  5E8I A;  2L01 A;  3CQZ J;  3H36 A;  3RKX A;  3O3K A;  4YG2 F;  2O9L A;  4L0Y B;  1JE8 A;  1MMN A;  2P5L C;  1ITY A;  5LBQ A;  3CCR I;  2HZD A;  1C0W A;  3PO2 J;  1D0X A;  1FYM A;  4IRG A;  5LHG A;  2RC4 A;  5FD6 A;  2A3S A;  4OIR F;  1G2H A;  3BOQ A;  1OCC H;  2V26 A;  5CPR B;  2O0Y A;  3M8F A;  1IDZ A;  1R6R A;  2WTE A;  2JPB A;  4M71 A;  4QIW N;  3CCJ I;  1PP7 U;  3HOW J;  3MVP A;  3ZR8 X;  2QKL B;  4N9H A;  2DPD A;  3R60 A;  4DYC A;  2WWY A;  3OL4 A;  1BBY A;  4XN3 A;  2LKS A;  5B66 C;  3SDG A;  4A3G J;  4ZYE A;  2VPL A;  1IC8 A;  4HBL A;  2HOT A;  1CF7 B;  1R4N B;  2XB0 X;  4MQV A;  5E3O A;  3VSL A;  5IP9 J;  1BM9 A;  2RRE A;  1J7K A;  2OZ6 A;  2KKO A;  3BWG A;  1BIB A;  3E5U A;  3MQ0 A;  1D8K A;  2PFB A;  2XPW A;  1E0E A;  1Z6R A;  2EZI A;  3AKZ A;  4PZJ A;  2ADU A;  4Z2Y A;  4CUG A;  3S1N J;  3GWZ A;  4ZYH A;  4GGG A;  4IHT A;  5LRR A;  3IKT A;  3GTL J;  3IC7 A;  2FML A;  4AYB N;  3FKI J;  5J4V A;  4HSR A;  3LQR A;  3LL7 A;  5E3L A;  4IOC F;  3HRU A;  1YO5 C;  4CSW A;  3FBI B;  4ZDP A;  1MBG A;  4YIR X;  2CMP A;  1OYY A;  2VT2 A;  1U0J A;  5KHD A;  1JKO C;  1IDY A;  3ONQ A;  2EQR A;  1QHG A;  2ZJ2 A;  5J40 A;  1LB2 A;  5AON A;  5IPA A;  1KU9 A;  3L1P A;  2D1H A;  3S1Q J;  1GLN A;  3GTM J;  3AG2 H;  1AWC A;  3AAF A;  2W84 A;  1RZ4 A;  1OKR A;  5D5W B;  5GAG J;  3K1M A;  4WCG A;  2E7X A;  3GW2 A;  2IGO A;  2HXI A;  2HKO A;  3CUO A;  4BXF A;  1VQM I;  3LA7 A;  3JRC A;  4CYC A;  2LNB A;  4PJJ A;  3R4K A;  1X2N A;  4CO8 A;  1W36 C;  1XS9 A;  2QQ8 A;  2E2I J;  3IKV A;  3E5Q A;  2ISY A;  2R0Q C;  2ZB9 A;  4CCM A;  1JT0 A;  2BY2 A;  1R1U A;  2DI3 A;  4CIC A;  1FNN A;  3F9K A;  1V55 H;  5C3E J;  4HYE A;  5H2F C;  3MZY A;  3WTX C;  3BTJ A;  1ORK A;  1X58 A;  4BYY A;  2EZH A;  2DLL A;  1V4R A;  1MD0 A;  2NAZ A;  4U7B A;  2BVL A;  4ITV A;  4XR6 A;  4LB6 B;  1R1T A;  1X3U A;  3EUH C;  4LOC A;  2XAF A;  4BE0 A;  2K40 A;  1AKH A;  2L9V A;  4L9J A;  1T38 A;  1WSU A;  5IYD J;  3B6C A;  3H3V K;  2R7T A;  2CO5 A;  1EV7 A;  5ILS A;  3S14 J;  2HYF A;  1VQ4 I;  3D5S C;  3MCZ A;  4GDF A;  5GPA A;  3PIP F;  3BG7 A;  2HEO A;  1IV6 A;  2A69 F;  3CCV I;  4EJV A;  1YI2 I;  4JP0 A;  3HRM A;  4A12 A;  1W1W E;  4I7H A;  3BRO A;  3QP6 A;  3I4N J;  4IO9 F;  4WXC A;  2QCO A;  1OYI A;  4MTD A;  3GLX A;  2QYO A;  4BDZ A;  1YJW I;  3DKW A;  2OF7 A;  1FOK A;  3QYE A;  2VXZ A;  3BTI A;  2JRM A;  4RAG A;  1HCR A;  1AA7 A;  2BY3 A;  4WF2 A;  3GZ6 A;  5D8K B;  1HDP A;  1P7J A;  3FF5 A;  4G7H F;  1FIA A;  2V1X A;  2JA2 A;  4IXA A;  2P0W A;  4LLG F;  2MH2 A;  3N97 A;  4DBQ A;  1EH7 A;  4E4H A;  3F21 A;  2CFO A;  1O3Q A;  4MFE A;  3DBL B;  3S15 J;  2EFO A;  2HOA A;  4I99 C;  3SZP A;  3CCU I;  2HR3 A;  3E5X A;  2Q0O A;  1LFU P;  4QPO A;  3L09 A;  4BE1 A;  3DKY A;  3MMY B;  2I5U A;  2H8R A;  3LWF A;  2ZME A;  4NBQ A;  1L0O C;  3VPR A;  4KMF A;  3RZO J;  2DW4 A;  4LD5 A;  2W00 A;  1PVE A;  5LEJ A;  5HDK A;  2VPR A;  2TCT A;  4MEX F;  2DT6 A;  1IW7 F;  3JRI A;  1KYW A;  3CLO A;  1YRN B;  2VON A;  5ED4 A;  4EJT A;  2LBF A;  2HYG D;  4G12 A;  2O7O A;  3VWB A;  1H8A C;  4A6D A;  3BG5 A;  3HIF A;  4E70 A;  2RQP A;  1ZHF A;  2DFI A;  2P5K A;  3HTS B;  1B72 A;  4DW6 A;  4XKB A;  2HDW A;  3EUK L;  3ZMD A;  3G73 A;  2CRG A;  1RIO H;  3LAP A;  3WTS C;  1I50 J;  3M4O J;  1S5L C;  2G9W A;  3RTR A;  2EV5 A;  2WC2 A;  3G71 I;  2CQX A;  4V19 K;  4XLE A;  3RQ4 A;  3ZQL A;  1EKE A;  3LSR A;  1J2X A;  1OFC X;  1OCZ H;  1PP8 F;  4X1E A;  3Q0W A;  3W2A A;  2ACJ A; 
#chains in the Genus database with same CATH homology
 2P81 A;  5DS9 A;  2X48 A;  2NVT J;  3GTO J;  4A3K J;  3OOU A;  3FK7 A;  4M3E A;  3QQA A;  4DYQ A;  1I6H J;  2E19 A;  3HOV J;  4M3G A;  2ECB A;  2LY9 A;  3FIW A;  3IH3 A;  2YU9 J;  4A3M J;  3IH4 A;  1POG A;  2YUS A;  3GTP J;  3RKQ A;  4JX4 A;  3Q0U A;  5BNG A;  3GTQ J;  4J19 A;  4IHY A;  3K2A A;  3IH2 A;  1OCP A;  2LR8 A;  3OIO A;  4M6V A;  2VKE A;  1IGN A;  2D5V A;  2AO9 A;  2FQ4 A;  4FE4 A;  1MBK A;  3TED A;  4QTR A;  3ZQC A;  2O8K A;  1NK3 P;  2L7F P;  1JKP C;  2LLK A;  1UG2 A;  1IJW C;  3S17 J;  3BQY A;  4NDL A;  5EEA A;  5FKL A;  4BY1 J;  2DA5 A;  3MKL A;  1ETX A;  2HYJ A;  1LE8 A;  2HI3 A;  4HNV A;  4UUT A;  3JRH A;  3ZQH A;  5F0H A;  1IUF A;  4BY7 J;  2R5Z A;  1B8I A;  5IP6 A;  4XIC A;  1VI0 A;  4V2G A;  4FTH A;  2E1O A;  4I76 A;  1LE8 B;  3MN2 A;  1EF4 A;  3D1N I;  1K61 A;  2B63 J;  5K7Z A;  1AHD P;  3BTL A;  3JRG A;  2R5Z B;  4D7M A;  1B8I B;  2LFB A;  3LSG A;  2Y9Z A;  2R92 J;  2M9H A;  1BL0 A;  3ZQF A;  2HQ5 A;  3GTG J;  1VFC A;  5E3M A;  2DMU A;  2M34 A;  1O4X A;  2GM4 A;  1JKR C;  5IYC J;  2XGE A;  3ZOB A;  2DMT A;  4FE7 A;  1QPI A;  3BG3 A;  5DTD A;  1S7E A;  1RKT A;  2CJJ A;  4MFD A;  2XRL A;  2Y9Y A;  3W6V A;  2XPU A;  1RPW A;  2FJ1 A;  3SFI A;  3HOU J;  1T56 A;  1Y1W J;  4B3A A;  1T33 A;  4XRS G;  5F0F A;  2EZK A;  2NOG A;  4A3D J;  3BR1 A;  3I4M J;  1ETY A;  3TP0 A;  5M3M J;  2IEK A;  1QVT A;  2YS9 A;  4D7N A;  3JRE A;  1SAN A;  4DYR A;  5FKK A;  1IRZ A;  2M2E A;  4FIS A;  1NK2 P;  2LKX A;  2N8G A;  1W0U A;  1FJL A;  2EBI A;  2JWT A;  5J1Y A;  5F0C A;  5C44 J;  5M3F J;  3S2D J;  3M3Y J;  2ECC A;  1QRY A;  5IOY A;  1F36 A;  5J1U A;  2L7Z A;  2GBY A;  1MBJ A;  2DMQ A;  4MO7 A;  3WHB A;  5M5X J;  3DCF A;  4I6Z A;  1ZR2 A;  1TWC J;  2FD5 A;  5F1J A;  4EEF G;  1UHS A;  3RQI A;  1GV2 A;  4A3I J;  3UKG A;  1HLV A;  2COB A;  1ZTR A;  1R9T J;  5C4X J;  4A3E J;  4W97 A;  1JGG A;  2XPV A;  3IV5 A;  3CDL A;  1E3O C;  4A3L J;  3QPS A;  5FLV A;  3O8G A;  5EG0 A;  2EZL A;  3HB9 A;  3TW7 A;  1U78 A;  3LNQ A;  3DEW A;  1JJ8 C;  2JMW A;  2Y30 A;  5IYB J;  1APL C;  3S1M J;  4C3H J;  5E3N A;  1OJL A;  2LVS A;  5EG0 B;  3LSJ A;  1HF0 A;  3S2H J;  3BT9 A;  1I3Q J;  3K7A J;  2NVX J;  4BXX J;  3HOX J;  5M5W J;  3JRA A;  1GDT A;  3S1R J;  1XG1 A;  1AU7 A;  1TWA J;  3SJM A;  3OSG A;  1U9N A;  4A93 J;  4DZP A;  3HBL A;  1JUP A;  3A01 A;  1FEX A;  3RZD J;  3S16 J;  3TP3 A;  4C3J J;  4D5C A;  1PUF A;  1JT6 A;  1TC3 C;  2KDZ A;  3JR9 A;  3HDD A;  4RBO A;  1WPK A;  3BR5 A;  4D5F A;  2DA4 A;  3JRB A;  5C4J J;  1BW6 A;  3A01 B;  2HXO A;  3NAR A;  1PUF B;  5F08 A;  1MSF C;  5HOD A;  1JJ6 C;  4X6A J;  1OCT C;  5FLM J;  3ZQI A;  1U8B A;  4V2F A;  1ZR4 A;  4XRS A;  2GLO A;  2JN6 A;  3QPL A;  1JUM A;  4GFB A;  1ETQ A;  2R93 J;  4JYK A;  2DTZ A;  1TWG J;  2L0K A;  5EYR A;  3PO3 J;  2DA7 A;  2ELK A;  2XSD C;  1VND A;  1ENH A;  2RAE A;  3B6A A;  5GP9 A;  4IHX A;  3CQZ J;  3BR3 A;  2Y31 A;  1RES A;  1JKQ C;  1WGX A;  2LP0 A;  2O9L A;  1FTZ A;  1Z0X A;  1MBF A;  1ITY A;  5F04 A;  2CUE A;  3PO2 J;  3Q0V A;  1MBH A;  2JA6 J;  2MGQ A;  5F27 A;  2PMZ N;  4C3I J;  1G2H A;  4ABZ A;  1H89 C;  5EZH A;  3GBG A;  2DA3 A;  4XID A;  2NVQ J;  2JA7 J;  3LOC A;  1IDZ A;  4M3F A;  4QIW N;  3HOW J;  2E2H J;  2IBD A;  3MVP A;  2JJ7 A;  4DYC A;  1GT0 C;  4XK4 A;  4A3C J;  4XRM A;  4DZJ A;  4C2M J;  1CQT A;  2VUM J;  2H1K A;  1MH3 A;  2CQQ A;  1NTC A;  3SDG A;  4A3G J;  1HOM A;  2NVY J;  1WCM J;  2K9Q A;  1IC8 A;  2HOT A;  5EGO A;  2ME0 A;  2XB0 X;  3BTC A;  5E3O A;  4AC0 A;  2WB1 N;  1TWH J;  4M3B A;  5IP9 J;  1DU6 A;  5J3L A;  3HGG A;  2VKV A;  2NS7 A;  2XPW A;  2EZI A;  1ZK8 A;  5FKM A;  1A6I A;  3WHC A;  3BR2 A;  3S1N J;  5M5Y J;  3CMY A;  3BG9 A;  1U9O A;  2OPT A;  1IG7 A;  1LFB A;  3JRF A;  3GTL J;  2ID6 A;  2KT0 A;  5EGO B;  3A03 A;  5IP7 J;  1A5J A;  2QF7 A;  4MLO A;  4AYB N;  3OSF A;  1D5Y A;  3FKI J;  4IHV A;  2DA1 A;  5JLW A;  4W1U A;  3TW6 A;  5E3L A;  4A69 C;  3O8H A;  1WI3 A;  1MBG A;  1MSE C;  3FIS A;  1RKW A;  4MIM A;  1JKO C;  1IDY A;  3HOY J;  2DN0 A;  1BJZ A;  2EQR A;  1GV5 A;  4UUS A;  5IPA A;  2MG4 A;  3L1P A;  3S1Q J;  2R7Z J;  2DA2 A;  1X2M A;  3GTM J;  3BR6 A;  3CCY A;  2I10 A;  5K7H A;  1ETV A;  2X6O A;  1RR7 A;  2JK3 A;  4Y52 J;  2HXI A;  1UMQ A;  4UUS B;  3C2B A;  3JRC A;  4CYC A;  1X2N A;  5K7F A;  1XS9 A;  2E2I J;  1MNM C;  2R0Q C;  1ZGW A;  2ZB9 A;  1ETW A;  1JT0 A;  1MH4 A;  4QSH A;  1ETK A;  2M0C A;  2ME6 A;  4BKX A;  9ANT A;  3LSP A;  3GTK J;  2R5Y A;  1QVU A;  2DMP A;  2EH3 A;  3BQZ A;  2LK2 A;  1FIP A;  5C3E J;  2XGD A;  3BR0 A;  4CYC B;  1TWF J;  3BTJ A;  1ORK A;  5EF6 A;  1X58 A;  1ETO A;  2EZH A;  2LD5 A;  1SFO J;  2L9R A;  2DJN A;  5FJ8 J;  2ID3 A;  4A3J J;  2Y2Z A;  2R5Y B;  2MSY A;  3HKZ N;  4LOC A;  1DU0 A;  5IYD J;  1AKH A;  2K40 A;  2X9D A;  4S0H B;  2G0E A;  3JRD A;  3B6C A;  3H3V K;  1VF9 A;  3S14 J;  1Q1V A;  2WV1 A;  3G1O A;  3HM5 A;  2HOS A;  3HGY A;  1HDD C;  5GPA A;  1F43 A;  1IV6 A;  2JA8 J;  2K9S A;  4JP0 A;  3PM1 A;  3ZQG A;  1JTX A;  1AKH B;  2M8G X;  5EDN A;  1GVD A;  3I4N J;  2QCO A;  4RDU A;  1JUS A;  2WAQ N;  4JX6 A;  5J1R A;  2E2J J;  3G1M A;  1H88 C;  4BBR J;  2OF7 A;  3Q3S A;  1MBE A;  3BTI A;  1HCR A;  3F0C A;  1HDP A;  1P7J A;  2DMN A;  1FIA A;  2L7M P;  4IEJ A;  1ZKG A;  4M3D A;  3FK6 A;  1RET A;  2CU7 A;  4MFE A;  5GPC A;  3S15 J;  4IHW A;  2HOA A;  1YRN A;  3NAU A;  2HDD A;  4JX5 A;  1FTT A;  1LFU P;  4A3F J;  1XC5 A;  2H8R A;  1BW5 A;  4FCY A;  1P7I A;  2DA6 A;  3RZO J;  3VPR A;  5FKO A;  2VPR A;  2TCT A;  3A02 A;  3JRI A;  2AHQ A;  3GTJ J;  4L5E A;  2NS8 A;  1YRN B;  2LTP A;  4BBS J;  4G12 A;  2O7O A;  1Z77 A;  2IAI A;  1H8A C;  2JA5 J;  3BG5 A;  1Y1V J;  2Y0S N;  2FX0 A;  2VI6 A;  1W0T A;  5IOZ A;  2W48 A;  1B72 A;  5JLX A;  1BA5 A;  2MW8 A;  4DW6 A;  4Y7N J;  3HEF A;  3H0G J;  3G1L A;  5FKN A;  4B1R A;  1GUU A;  2CRG A;  3E7L A;  2CUF A;  4AUX A;  1WH5 A;  1WH7 A;  1I50 J;  2TRT A;  2XGC A;  3M4O J;  2XB5 A;  1ZQ3 P;  2CQX A;  3HOZ J;  1B72 B;  3ZQL A;  4A3B J;  3LSR A;  4B4C A;  1K83 J;  1OFC X;  1JTY A;  4X1E A;  5EZG A;  3Q0W A;  2K9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...