2EBIA

Arabidopsis gt-1 dna-binding domain with t133d phosphomimetic mutation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPDMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords DNA binding protein GT-1
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ebiA01
2M9HA 2HOTA 1S7EA 1FIAA 1JUPA 4Y7NJ 1HCRA 1JKPC 4FISA 3JR9A 1UHSA 2I10A 2DA3A 4JP0A 1TC3C 5GPAA 5J1YA 3A02A 2QF7A 3HM5A 4A3MJ 3PO3J 3S1NJ 3GTJJ 1U9NA 3K2AA 5EZGA 4FE7A 1RKTA 2X48A 1YRNB 4D7MA 1H8AC 4C3IJ 1JJ8C 4BBSJ 5EG0B 3RQIA 2K9QA 3A01A 1QVUA 4MO7A 2VPRA 1WPKA 5EF6A 2XPVA 3GTMJ 3SDGA 3BR1A 4B4CA 1ZKGA 4D5FA 4MFEA 1PUFA 3BTCA 3LSPA 3CMYA 3OSGA 3IH3A 1XG1A 2QCOA 4BY7J 1GT0C 4A3KJ 2COBA 1LFBA 3BQYA 1VI0A 2H8RA 3HKZN 1QRYA 1FIPA 1IG7A 1ZGWA 4BY1J 3JRIA 1F36A 3TW7A 4A3EJ 1OJLA 4IHYA 1B8IB 2DMQA 4W1UA 2R5ZA 1ORKA 1D5YA 1TWAJ 4BXXJ 3B6AA 1U78A 3JRBA 4G12A 1H89C 2GLOA 5FKLA 1A5JA 2D5VA 3G1OA 1JKQC 5M3FJ 2GM4A 2YUSA 2YS9A 4M6VA 1WCMJ 1ENHA 3S15J 2LFBA 1WI3A 2Y31A 3PO2J 2DA1A 5EGOB 1Z77A 5K7ZA 2X6OA 5FKNA 4IHVA 5EDNA 4DYQA 3JRDA 4IHWA 5IYCJ 1HF0A 3BT9A 2R5ZB 4IHXA 2H1KA 3MKLA 3O8HA 4B3AA 3H3VK 2FX0A 4XICA 3IH2A 4DW6A 4A69C 1RESA 4UUTA 2Y2ZA 3E7LA 4J19A 3DCFA 4ABZA 4JYKA 3BTIA 3RKQA 3ZQHA 2R7ZJ 3S1MJ 3TP3A 3HOVJ 1MH4A 3FISA 1RKWA 5F0HA 4GFBA 1NTCA 4XIDA 3VPRA 4DZPA 3GTPJ 3ZQLA 2VKVA 2E2IJ 4A3CJ 1ZR4A 3HOZJ 2G0EA 2ECCA 5EYRA 4A3DJ 2XSDC 2LR8A 2CU7A 3FKIJ 2KT0A 1JKRC 1JUMA 3JRGA 5M3MJ 1RETA 1QPIA 5F08A 5IP9J 5DS9A 5M5YJ 4I6ZA 3HOUJ 1LE8A 3S1RJ 5F1JA 5J1RA 2LVSA 1GV2A 4JX5A 5FLMJ 4FTHA 1SFOJ 2YU9J 2XPWA 1H88C 4QTRA 4AUXA 3BR0A 3ZQGA 4UUSA 1GVDA 3L1PA 1ZQ3P 2DMNA 3FK7A 1B8IA 1W0TA 4C3HJ 2IEKA 5F0CA 2EZKA 2DA7A 2XB5A 3BR6A 2NVXJ 1ZK8A 3OOUA 1MBKA 3MN2A 2L7ZA 5J3LA 5FKMA 1YRNA 3S14J 2HDDA 4A3JJ 3Q0WA 1IDZA 2W48A 2JA7J 3K7AJ 5C4XJ 3QPLA 2PMZN 2B63J 1WH5A 3I4MJ 4XK4A 2R0QC 2AHQA 3Q3SA 5DTDA 3GTKJ 2EZIA 1IRZA 3GTLJ 2FD5A 1MBFA 3NARA 4QIWN 1VFCA 2EBIA 5F04A 2E2HJ 2JA6J 3PM1A 3LSJA 2XGDA 2JWTA 2HXIA 3HBLA 3A01B 2XPUA 1LFUP 3F0CA 4UUSB 1U9OA 5E3LA 2E2JJ 1B72B 1AKHB 1B72A 5FKOA 2ID3A 1ZR2A 4V2FA 3S17J 2HXOA 2JMWA 3LNQA 1DU6A 1O4XA 1ETVA 4BBRJ 2L7FP 3ZQFA 2MW8A 1FTZA 3OSFA 1MSEC 3HB9A 3BG3A 1UMQA 2Y0SN 5J1UA 3M4OJ 2CUEA 3GBGA 1NK3P 1NK2P 1MSFC 1ETWA 2LK2A 2HOSA 5IP7J 2M8GX 5E3NA 3FK6A 1MH3A 3DEWA 2ELKA 5EZHA 5FKKA 3Q0UA 1IV6A 3LOCA 1JT6A 2DMUA 3I4NJ 1CQTA 1HLVA 2XB0X 1ETKA 4D7NA 3RZDJ 5JLWA 5E3MA 4XRMA 1JKOC 1FTTA 1OCPA 2DA6A 2LLKA 3SFIA 2K9NA 1Z0XA 4AYBN 3BG5A 3HEFA 5F27A 3A03A 4DYCA 3QPSA 4C2MJ 5M5XJ 2E1OA 1I50J 5K7HA 2ID6A 3ZOBA 5C44J 1LE8B 1GDTA 2DA5A 3IH4A 1MBHA 1JGGA 1WGXA 2KDZA 5IP6A 2CQQA 5E3OA 1SANA 4A3GJ 5K7FA 2ZB9A 2HI3A 4L5EA 1BA5A 2IBDA 1VF9A 5IOZA 2ME6A 2Y30A 3H0GJ 1T33A 1VNDA 2NVYJ 4JX4A 1T56A 1JT0A 5M5WJ 3HDDA 1Y1VJ 4A93J 1WH7A 5IYDJ 3D1NI 1APLC 1FEXA 3HOWJ 1JJ6C 2CRGA 1OFCX 2EQRA 1MNMC 2JK3A 2Y9YA 3G1LA 1P7JA 2DA4A 2EZLA 5F0FA 5FJ8J 1ETYA 4CYCA 4A3FJ 2AO9A 3ZQIA 2O9LA 1JUSA 2K9SA 3UKGA 3TP0A 1UG2A 3JREA 3W6VA 4RBOA 1MBGA 3CQZJ 2NS7A 2ECBA 3M3YJ 2Y9ZA 1G2HA 1P7IA 2EH3A 4IEJA 2DTZA 2X9DA 1ETXA 1HOMA 1BW5A 4QSHA 1K83J 2E19A 1PUFB 1MBEA 3S1QJ 1X58A 2XGEA 4M3GA 2OPTA 1TWGJ 1Y1WJ 1AU7A 4Y52J 5HODA 2NS8A 3FIWA 1EF4A 1POGA 3C2BA 1TWHJ 2FJ1A 4W97A 1BW6A 2CUFA 1BJZA 1R9TJ 3SJMA 5C4JJ 2N8GA 1XS9A 2M34A 2R92J 3MVPA 3HOXJ 3BR5A 1X2MA 3TEDA 4DYRA 5C3EJ 1TWCJ 1I6HJ 2HQ5A 5GP9A 3BTLA 4S0HB 4AC0A 1IUFA 4I76A 1ETQA 3O8GA 2DMTA 2M0CA 3HOYJ 2FQ4A 3HGYA 5FLVA 4EEFG 1U8BA 5JLXA 2OF7A 2RAEA 1ITYA 4JX6A 1TWFJ 1FJLA 1ZTRA 3QQAA 3WHCA 5EEAA 1HDPA 2CJJA 1X2NA 3S2HJ 1A6IA 4HNVA 4NDLA 3NAUA 2DMPA 2HYJA 1RR7A 1BL0A 4XRSA 2R93J 2LP0A 3BQZA 2ME0A 4FCYA 2IAIA 4B1RA 2WAQN 5EG0A 2O8KA 4CYCB 4DZJA 4X1EA 2WB1N 1IJWC 4A3IJ 3Q0VA 1HDDC 3GTGJ 1OCTC 1F43A 5IYBJ 1JTYA 1QVTA 3B6CA 1IC8A 3JRAA 2JA5J 1Q1VA 1AHDP 1I3QJ 5EGOA 1RPWA 2EZHA 4A3BJ 2VKEA 5IOYA 1E3OC 2NVQJ 1GV5A 1MBJA 2L0KA 3S16J 2VUMJ 3LSGA 3IV5A 2XGCA 4MFDA 2MG4A 2M2EA 2NOGA 1AKHA 4MLOA 3GTOJ 2NVTJ 3S2DJ 4M3EA 2LKXA 3JRCA 1XC5A 3BG9A 2P81A 1GUUA 2DA2A 2LY9A 2HOAA 2L7MP 2TRTA 9ANTA 2JJ7A 2MGQA 4RDUA 2L9RA 3TW6A 2O7OA 4M3FA 3BR3A 3GTQJ 5BNGA 3BTJA 4FE4A 1IDYA 3WHBA 3BR2A 4M3DA 2CQXA 4C3JJ 3ZQCA 4LOCA 3JRHA 3CCYA 5IPAA 4BKXA 2DN0A 2MSYA 1W0UA 3HGGA 5GPCA 2JA8J 2LTPA 3OIOA 2VI6A 4A3LJ 3LSRA 1DU0A 2LD5A 2K40A 1ETOA 1JTXA 2JN6A 3G1MA 2R5YA 2R5YB 4M3BA 4V2GA 4D5CA 4MIMA 3RZOJ 2DJNA 2TCTA 2WV1A 3CDLA 4XRSG 2GBYA 1IGNA 1K61A 4X6AJ 3JRFA 2XRLA
chains in the Genus database with same CATH superfamily
3DU5A 4IKFA 2MH2A 2R7XA 1BR1A 3CCJI 1AA7A 2TDXA 1T39A 3L2QA 4FISA 3JR9A 3W6KB 3WU0A 3VEPA 2DA3A 2QBYB 3K4KA 4DJAA 2F4MB 4A3MJ 3S1NJ 3BCBA 3OR2C 2NNYA 4GCVA 3H3ZA 1H8AC 1JJ8C 2UXNA 4RA2A 3A01A 1QVUA 3FXOA 5HLIA 2VIXA 2PG4A 5D8KB 4MTDA 3SDGA 4HDVA 3BR1A 4ZJZA 3OYHA 2F4IA 2YU3A 3P5JA 4N0BA 4D5FA 1KYWA 1Z21A 4IHSA 2PQ8A 2Y75A 4LMYA 1IN5A 1QO0D 1Z1DA 3EETA 3L2RA 3SEQA 4BY7J 3I0TA 2HKOA 2JUCA 1X3UA 4A0YA 3G73A 1KA8A 1HW1A 1LFBA 5CVJA 2R7RA 1VI0A 4BHBA 1TQIA 3UR3C 4CZCA 4CSWA 5D4SA 4EATA 1HSJA 3VB2A 3CUOA 4CCKA 4BY1J 1OJLA 4BXUA 2ICWG 2BHYA 3M1CA 1B8IB 2H94A 4XLHA 4W1UA 4XLCA 2GXBA 2VPLA 3FMRA 4BXXJ 3CD6I 2P7VB 5LGNA 3FM3A 3JRBA 4Z2YA 2QYOA 3EQLF 3HZJA 4U7DA 3H35A 4Z6YA 3GFLA 5M3FJ 5J6XA 2JZYA 4G7HF 3CJTB 2YUSA 2FOWA 3CMAI 2M45A 1EA3A 2WY8Q 4OIPF 3M1EA 2CMPA 1WI3A 4CCMA 1D8JA 4JOMA 5CLSA 2DOEA 3B73A 5EDNA 1SD5A 3LSHA 3JRDA 3GLXA 1SMTA 3JSOA 1HF0A 3BT9A 2STTA 2F2EA 2W00A 4XRFA 4N9HA 4OMZA 2FX0A 4XICA 4A0ZA 4DQ2A 3H3VK 4DW6A 2NYXA 4XOTA 1UFMA 2EA2A 4J19A 5ERIA 3S2WA 4H4KC 4XM3A 1I3AA 2KMUA 2QSHX 1J09A 5EJCA 3H9QA 3S1MJ 1VZ0A 3HOVJ 1MH4A 3FISA 4BHCA 4LB6B 3M8FA 2CGPA 4E4HA 5E17F 1NTCA 2KDOA 4QLCU 1T0FC 3GTPJ 1H9TA 1HKQA 4HZFA 3A0BC 1FYMA 2MBFA 2XKPA 2VXZA 3CDHA 2XSDC 5D6FA 1BR4A 4XMYA 3G71I 2DLLA 2H1LA 2WA0A 1OLTA 2D2WA 2V1XA 3HYIA 4U0VA 3IRRA 1QPIA 5F08A 5HDGA 2QQAA 5M5YJ 2X6WA 3S1RJ 1O7FA 4OIRF 4I0AA 3GFJA 3CP8A 5J1RA 2KL4A 2LVSA 2PEXA 3F8CA 4FTHA 4DBRA 1OCCH 2QM3A 5DM6F 2XPWA 4P9UA 2M5WA 5F64A 3F3XA 1LUJB 1H88C 5L3CA 3OL4A 1YS6A 3CCEI 4BJ5C 4B3XA 2FBKA 2VT2A 4CCLA 3C2HA 3GXOA 5BQTA 3BROA 4KISA 1STZA 2LKPA 3LQQA 1GVDA 3QU3A 1R6RA 4UUSA 1WHUA 4IL6C 1WFXA 3NQOA 5CYVA 4KIGA 1T6SA 4C3HJ 3E6BA 4XLAA 2RN7A 4MHGA 5F0CA 3V4GA 1LEBA 2EZKA 2XROA 1KU2A 2R3SA 2NVXJ 1T08B 2PMZA 4HNTA 3E6MA 2L7ZA 1V55H 4A3JJ 4HX4A 4C2UA 3GUDA 4CCOA 1J2XA 2L3DA 2X1EA 1R5GA 5FLXK 2AHQA 2K5CA 3K70C 2BXYA 1S72I 2EIKH 2QBYA 3I54A 3GTLJ 2Z5UA 4M9XA 2M4GA 5E18F 1MBFA 3NARA 1B9MA 2PX9A 2E2HJ 3CMEI 5J4VA 5DCMB 1FZPB 3AFHA 3RSNA 3HBLA 1OR7A 3OYJA 5E3LA 3ZP5A 2F5FA 3LSKA 3P9IA 4BH9A 5TJJA 3OYFA 3FHZA 4ANJA 2ID3A 3OS2A 2JRTA 2YX7A 4HQEA 3IAM2 2FF4A 2HNHA 2JMWA 1VQ5I 1JHFA 1W36D 1DU6A 1OYIA 1Z6TA 3RPUA 4XLNF 2CFXA 2DOAA 2W57A 3QU6A 1S8NA 4BBRJ 3QYFA 2ZXWH 2MW8A 2I8DA 3RKWA 2QQBA 4RAGA 5HS9A 3BG3A 1UMQA 5EEHA 3ZMVA 4HX8A 3ELKA 2EFOA 3TOBA 1NK2P 1MSFC 3ZR8X 1SAXA 3K4CA 2FQ3A 2M8GX 4RS8A 4PZJA 4G8XA 4RAZA 5E3NA 5BPDA 3DEWA 4LG0B 2LH9A 2EIJH 5EZHA 2ZC2A 5FKKA 1IRXA 5DCMA 1O7LA 4GRIA 3V42A 2KIQA 2P4WA 2XV4S 3K9TA 5JLWA 1G8XA 4XRMA 3OYNA 4LD5A 2A68F 2DA6A 1Y0NA 2KIUA 5F27A 3A03A 2HPMA 2E1OA 1R7JA 5C44J 5K7HA 3ZOBA 3DKXA 1IRFA 2YPRA 3ONQA 2DA5A 3FBNB 2BHZA 2K4BA 2L9NA 2LBFA 2OD5A 3REOA 2GAUA 2ZB9A 3QYEA 3DPLC 4M71A 3GF2A 2QGUA 3KZIC 4YIRX 1FLIA 4B09A 1A31A 3ABTA 4PJ0C 1FSEA 5LEKA 1WJAA 3H0GJ 4E7KA 1QGPA 3OV8A 4LK0F 3LFUA 2IGMA 2L7KA 2V4JC 1Z67A 5HNHA 4A93J 2ZXIA 2VLAA 1VQ9I 4YIFA 2PMHA 3V7SA 2CRGA 1OFCX 2WAEA 2JUGA 3TKYA 1P7JA 2DA4A 2KFDA 4S04A 5F0FA 5H2FC 3KP2A 4CYCA 2WB1A 3E5UA 2O9LA 5LHHA 3V8JA 4PJLA 2BW3B 4L5IA 3PIOF 5TGTA 4EQQA 4RB3C 3DBRB 2K3PA 3SZTA 1R4MB 1G3YA 1BOAA 3ECOA 3JREA 5BPIA 4RBOA 1UELB 2UXXA 2ZSHB 5J8FA 4LGWA 3M3YJ 1E2XA 4IQ4A 1ZYRF 5LRSA 1P7IA 1G2HA 2KIMA 1K6OA 2DTZA 3RKYA 2XAUA 4U0WA 2V1DA 4KUMA 1HOMA 3BY6A 1BOBA 1PUFB 2RQQA 2W84A 3S1QJ 2ZO4A 1XTAA 1BC7C 1TWGJ 4KA4A 3KYCB 2NS8A 5HODA 1EF4A 2VJJA 2VKDA 1XSXA 1TWHJ 2DT6A 3WG7H 1ZARA 2VOPA 4R79A 1BW6A 1TQPA 1R9TJ 2HU9A 5C4JJ 2Q8KA 2NRAC 2DJIA 3HOXJ 1YG2A 3D5RC 1X2MA 3TEDA 1I6HJ 2XAHA 2FSWA 2GOMA 4KT5C 5IT9K 3DQVC 3BTLA 2VQHA 2JVHA 3SFZA 2QEXI 1SFEA 2L4AA 1R5HA 1ETQA 3ZQ7A 2DMTA 2M1BA 3D5SC 4P9FA 3HOYJ 4EEFG 1U8BA 1X1DA 2RAEA 5DCFA 4JX6A 2I5UA 3CF5F 1XGSA 2PFBA 1WJ5A 1LDDA 1SMYF 1X2NA 3KCCA 4G94A 1SVMA 1DGRM 1LVKA 4I01A 3TL4X 1RR7A 1A04A 4XRSA 2GWRA 3O6BB 3P7NA 2IS2A 2M8EA 4Q5SF 1LB2A 1HBXG 1F9NA 2R7QA 1R22A 1ZH5A 3EPZA 3P9KA 4X1EA 1T8IA 1S29A 1IN7A 2V6EA 1TW2A 3IAS2 4WX9A 2QLZA 1OCTC 3RI4A 2ZJQF 3GX4X 1IO2A 3B6CA 1VQ6I 5E1WA 3U21A 3MKZA 2V7FA 3CLQA 3PUFA 3V7CA 5LD2C 1HKSA 4KYWA 4MTEA 3DLLF 2BY3A 2V1NA 2A05A 2BEOA 1UCRA 5CPRB 3LSGA 2EV0A 2XGCA 2JTVA 1A36A 4MFDA 4L5JA 1G4DA 4MLOA 4ZH4F 2NVTJ 3S2DJ 4M3EA 3A1YA 2LKXA 2TRTA 1TNSA 2ETHA 1XGNA 2NAZA 3J81K 4PGHA 2IVMA 1FOKA 1D0XA 1TP4A 3WHBA 1ZAOA 2KRCA 3BDDA 3BR2A 4XN3A 4M3DA 2D1VA 1BJAA 2CQXA 4C9YA 3CMMA 5IPAA 2IS6A 2EPFA 1W0UA 2Z33A 3H5NA 2JA8J 3GW2A 3QP5A 2VI6A 3PFIA 1VQLI 4B47A 1D8KA 1ONVA 4AIKA 2JN6A 2IA1A 2ISZA 2R5YB 2GA1A 1YIJI 4I2OA 4M6YA 1V5FA 4MIMA 3I9V2 4ZYAA 1ACIA 1LFPA 3KP5A 4BE1A 3CDLA 4OINF 1O3SA 1D3YA 1U3EM 4K2EA 2JSCA 1ZG1A 5D5XB 2LBFB 2ADUA 3F23A 4X6AJ 2RQPA 2HQRA 1YS7A 1Z7UA 2M9HA 3I64A 1S7EA 1FIAA 1JUPA 2Q1ZB 5HS7A 4Y7NJ 1JKPC 3ZQQA 5JR3A 1HCRA 2OZUA 4IHTA 3FF5A 3I53A 4JP0A 4KMUX 1TC3C 1U6GA 4XR6A 3I56I 5JVTA 5GPAA 1B59A 5J1YA 1JE8A 2FMYA 3PO3J 4CXFA 3IHUA 3GFIA 5EZGA 3AL0B 1BIBA 3LA3A 4D7MA 4FT8A 3N4MA 4ZDLA 3RQIA 4HYEA 3ZXSA 4EJWA 4MO7A 4UVCA 5JFRA 2GOXB 3DTIA 3WE2A 2F6CA 5EF6A 3EUKL 4E7HA 4B4CA 1TW3A 1R4NB 3OYIA 1ZKGA 1OR7C 4F91B 3D5LA 4MFEA 4ZDOA 1LEAA 3DTEA 3CMYA 3E6CC 1K7AA 4ENMA 1XG1A 4E70A 1K78B 2K9LA 1LDKB 4A3KJ 3BPXA 2Y48A 3BQYA 3QWLA 2H8RA 3HKZN 1QRYA 1FIPA 5E79C 1R5ID 1Z3XA 5D5WB 4V19K 1IG7A 2VE9A 1MDMB 4A3EJ 3WTVC 3QPTA 1ORKA 1D5YA 2G9WA 4HRIA 2DT7B 3FBIB 1U78A 1XDUA 4EJUA 1H89C 3IWFA 1HXDA 2X85A 5FKLA 2QSGX 3KEOA 3Q5FA 3CTAA 5ICGA 1QHGA 3MD2A 2KP6A 3JW4A 4HOBA 3EUHC 4M6VA 2KJBA 2NNNA 2VQLA 1WCMJ 3S93A 2IGNA 1G3SA 3S15J 2F48A 2LFBA 5EGOB 4BEHA 1T98A 4PJJA 1LPQA 1U2WA 2X6OA 5FKNA 4E7LA 4IHVA 1ZRCA 4EM0B 3CCVI 2ZJRF 4IHWA 4ZYEA 2YSRA 3F8NA 4IHXA 1X3ZB 4FASD 3MKLA 4LK1F 3CJQB 3WG9A 4X0GA 2D1HA 3FXJA 4ESJA 1XSDA 1XN7A 3IH2A 1YW9A 5LEJA 3ERED 1V4RA 3L2VA 3K1PA 4ENKA 3S3NA 1X1PA 3IC7A 2X4HA 1WJFA 4ABZA 2WC2A 2CWEA 2HDWA 4IRGA 3H3UA 3OOPA 4MQVA 3RKQA 4U0YA 4RMNA 5TISC 3KEYA 3TP3A 2E36A 2VBWA 1CGPA 1RKWA 3I3LA 3AG1H 4UB8C 4AIJA 2RC4A 3M8JA 4GFBA 4XIDA 2J5OA 2UUZA 3VPRA 4DZPA 3GCMA 3F6VA 3QYBA 5E1XA 4Y13A 3ZQLA 4ZTFA 3N97A 1D1BA 2ECCA 4FETA 5ILVA 3OS1A 3MKWB 5EYRA 1DDNA 4A3DJ 2FUG2 2LR8A 1RR8C 4AD9A 3FKIJ 1I39A 1IN4A 3L7WA 1VTNC 4UB6C 4HQMA 3RKXA 1YTYA 1ZG3A 2KLOA 3JRGA 2HVRA 1EKEA 3GZNB 2V9KA 1RETA 1O3QA 5ED4A 4IX7A 2XC7A 1H0MA 4JX5A 1GV2A 2IPQX 5DEQA 1SFOJ 3ASNH 4PCQA 1WJDA 3HUGB 2UWMA 2KKOA 1C0WA 3H92A 4IVNA 3CUQB 1WVRA 3DEEA 4AUXA 4DGWB 3H5RA 3MEXA 2FEZA 4WK8F 1ZHFA 3L1PA 3HHGA 1DUXC 1G3WA 3FK7A 4LJZF 4J01A 2JSPA 1SVLA 1NG6A 2A69F 3CP2A 2X6YA 1L3LA 2XB5A 1HW5A 1KQ9A 4EJTA 1ZK8A 5K5QA 3OOUA 2CH0A 2CS3A 3KX2A 1VQKI 3S14J 1R1VA 3KP4A 2W48A 1ULYA 3W2WA 1J5YA 2E7WA 3QODA 3QPLA 5C4XJ 2IS4A 4CO8A 3WGHA 4L9JA 3I4PA 3GVAA 4UV9A 3BPVA 5FB2A 4BQNA 1FMWA 5KAIC 2LG4A 4IO9F 4O3MA 2DPDA 1VFCA 5F04A 2JA6J 3LSJA 4BS9A 1KU9A 2XGDA 1JXSA 4ON0A 3BZCA 3HG9A 2O3FA 2R7VA 1RUOA 5A2QZ 1HQCA 2E2JJ 2KJCA 4PFPA 2BVMA 2WTEA 4V2FA 5JHUA 2F5CA 3I59A 1RIOH 2DW4A 3S17J 3OYKA 2KQRA 3LNQA 3TO9A 3HRTA 2LREA 4RLFA 4UV8A 3K70D 2VJ4A 2IA2A 2K02A 1W5TA 5JVGF 3HB9A 5J1UA 2CUEA 3GBGA 1NK3P 4EVIA 3AKZA 1ETWA 4E7IA 3TMOA 3WTTC 3IKTA 1G59A 3HSEA 5IP7J 3M7GA 1JGSA 3K4MA 1MH3A 2RV8A 4EM2A 3OYDA 3Q0UA 3LOCA 1JT6A 2DMUA 3CO6C 2BBYA 4XLPF 2XB0X 1ETKA 2ZXJA 1F1ZA 3RZDJ 5B66C 3OWTA 3VSKA 5IY5H 5E3MA 3CCLI 3HSRA 2QENA 2FA5A 1E17A 1FTTA 1EH8A 5D5UB 2V79A 3CUQA 1TT5B 2LLKA 2K9NA 2FRHA 1E0EA 3D0SA 3BG5A 3JAMK 4QPOA 3HRSA 2CV1A 3CJNA 2FOKA 4HAMA 5LFAA 1P4WA 5M5XJ 1UHMA 2V26A 2ID6A 5KK1A 1MJBA 3E97A 2E1MC 3H5AA 3CUQC 3IH4A 1Y39A 5IP6A 3F8MA 2HYGD 4EGYA 4A3GJ 2GIVA 2EA4A 4L5EA 1BA5A 2BY1A 4B8XA 1W7PD 5IOZA 3CCRI 2ME6A 4BJTA 1WSUA 4PJNA 3ABLH 1RZ4A 1V5EA 3P9CA 1YI2I 3F9KA 1E3HA 2W7NA 2KPMA 2VT3A 2MD5A 1WRJA 2HQNA 1B4AA 1YHQI 1D5VA 1BIAA 3L00A 1T56A 5KAFC 1G3TA 4UXNA 5B3SH 3S3OA 3MZHA 2F5EA 1Y1VJ 3HDDA 2Z99A 1K4TA 3I71A 1WH7A 2ESNA 1Y0UA 3D1NI 1APLC 2XAJA 5E8IA 4GXOA 4MGRA 1VQ4I 5ICCA 1MNMC 3WODF 2Y9YA 3A4CA 4KT6A 1B9NA 2HZTA 2R7UA 1V5GA 5D6EA 2IXSA 5FJ8J 2AQEA 4A3FJ 5J40A 2K9SA 3DKYA 5FFZA 3TP0A 2ZMEC 4EJOA 2EJRA 3W6VA 3FKJA 3BJ6A 4XL9A 2DQLA 1RNLA 1YW8A 1FX7A 5FGMA 5HLTA 2DQRA 3TOAA 3OR1C 5F6FA 2X9DA 3E0JB 3ZMZA 4BEHB 1BW5A 1K83J 2BZTA 1FY7A 1MW7A 5FD6A 1XMKA 4A6EA 5JI6A 1Y1WJ 3OMYA 2XHKA 4AYBA 1MD0A 3FIWA 1U5TC 5LLQA 1DP3A 3CCMI 3IL2A 2XSJC 2OU2A 3PJRA 1L0OC 2CUFA 1MNEA 2WBMA 2N8GA 2OC6A 1IXCA 3E6DA 2M34A 3IRQA 1F5TA 4YEJA 4DYRA 1TWCJ 1DQUA 4OOIA 2CQKA 4U7BA 2HQAA 4E7ZA 2HQ5A 1XX5A 4S0HB 4AC0A 3BOQA 1WJBA 1YITI 1IUFA 2DODA 3KYDB 4I76A 1U8RA 1T95A 2NXNB 3L2CA 4PK4A 5JLXA 2PMUA 1FJLA 2B0LA 3RPQA 3JTGA 3QQAA 1ZN2A 2O8XA 3HPHA 1HDPA 1FWZA 3SYTA 4N4NB 6PAXA 2DMPA 3FM5A 4LFUA 4RB2C 1BL0A 3EUAA 2WAFA 2KISA 3W3CA 2LP0A 4LB5A 4E6KG 2IAIA 2KIFA 4IOCF 4IQJA 2WAQN 2CUJA 4CYCB 2JT1A 3AG3H 4FX4A 1UG0A 4UUVA 2GZWA 1BC8C 1YX5A 4LIUA 5EEGA 4A3IJ 4MQ9F 5LRRA 3U2RA 3GTGJ 4KNYA 2K86A 1FOWA 1KZHA 5AIQA 1FP2A 5IYBJ 3RIRA 1JTYA 1DPUA 1ZLJA 2W4SA 4BAYA 1SC7A 1AHDP 1PVEA 2H6CA 5H6RA 4BACA 4WWCA 2WY7Q 1W7PA 2XVCA 3AL0C 2LOOA 5CVRA 4G7OF 4XQFA 3H0DA 3SQNA 2OTJI 1GV5A 4CGZA 2L0KA 3S16J 4OAYA 2E71A 3IV5A 2EFNA 1D1AA 1HKTA 4II2A 1AKHA 2NOGA 3EYIA 3GTOJ 1MKMA 3LA7A 4LLGF 3HSFA 1NH3A 2X51A 3FMQA 3JRCA 2P81A 1U0JA 4BU2A 3FXKA 2L7MP 2EB7A 1MJAA 1Q1HA 2PBIA 3LSMA 1UJ8A 3SZPA 5J4YA 5LGUA 2WWYA 4RDUA 2AS5F 2EV5A 2L9RA 4M3FA 2EWNA 3BR3A 5BNGA 2G7HA 3X2QH 1WZ2A 3RCOA 4FE4A 1OPCA 2P5VA 5KHDA 1YJNI 2VASA 4YRVA 2Z16A 3HKZA 2DXIA 2VQCA 3W2VA 2K9MA 2ZBKA 1OCZH 1R58A 3ZQCA 4HA8A 4LOCA 3JRHA 4BDYA 2K4JA 4Y33A 4BKXA 1IV8A 3Q9SA 5CJ9A 2STWA 5AIPA 3HGGA 4QWQA 4U88A 5GPCA 2LTPA 5DUKA 2W24A 2DFHA 4ZZDA 3LSRA 2EV6A 1DP7P 3WTZA 3VDXA 1ETOA 1JTXA 2LD5A 1FOYA 1IZ1A 1OCOH 4D5CA 2OQGA 3SHFA 4RM2A 3J80K 3GWZA 1LKXA 4FQGA 4HBLA 1F4KA 4HF1A 4IOAF 2VC1A 3AAFA 2WAQA 4UVAA 1HW2A 4FX0A 2A6HF 4G6QA 2XRLA 4B48A 3COAC 2P5LC 1IUYA 2ZMEB 3F21A 2EFPA 4OIOF 1BBYA 3BJOA 2I10A 2ZMEA 4DNCA 4WXCA 2XF5A 3A02A 2QF7A 2RKHA 4BQQA 3HM5A 3KEQA 2QKLB 2WV0A 4XSZF 3K2AA 2LNBA 2IW5A 4RM3A 1YRNB 4C3IJ 4AVZA 4M74A 4BBSJ 1FMVA 2K9QA 1A6QA 5GADJ 1V54H 4S05A 3QRFF 4LITA 3VYSB 1WPKA 3UNGC 5H6QA 3GTMJ 2H8WA 2L02A 4WXHA 2HPIA 3DP7A 2LF7A 2QKMB 1TQMA 2M0MA 2R7SA 3I55I 1W5CC 3U9GA 1Z3YA 2R7FA 4XSXF 2DOFA 2COBA 2G7UA 4RGUA 1R36A 4ZYDA 2KRHA 2IJLA 1ERDA 4XKBA 2OZ6A 3F8BA 1BI1A 3JRIA 4GDFA 2ZCWA 2CQNA 4LLLA 1CF7B 4A6DA 5HS8A 1I5ZA 3EUHA 4IZZA 3OYLA 3QOEA 1TWAJ 2RGVA 4DOZA 1IN8A 3R0AA 2IP2A 3B6AA 1U5TA 4IRIA 2F5DA 3LSIA 4C2TA 2GLOA 1A5JA 1MMSA 4HPQA 2D5VA 1JKQC 2IGOA 2GM4A 3LQRA 4Q47A 2YS9A 2E34A 3ZCOA 4F3QA 1W7PB 2HVQA 3WTUC 1ENHA 2R7OA 5HDKA 2MD0A 3RJPA 4F92B 5F1RA 3PO2J 1USSA 4N9IA 2OTLI 5FROA 4DYQA 4RB1A 3HL2A 2BY2A 2VJIA 3FXQA 3CCQI 2E7XA 2XGXA 3WE3A 2E1NA 2R5ZB 4H0EA 5FO5A 3FXLA 1Y56A 3O8HA 1PDNC 2BW3A 2LC2A 5CVIA 4B3AA 2A5WA 4L9TA 3ZMTA 4A69C 4NBQA 5KNLA 3OL3A 3VYTB 3I5UA 4AU7A 4F52A 3E7LA 3DCFA 4I7HA 5E8GA 1VQ8I 2DDBA 1ODDA 2NOJB 4HG2A 5K5RA 2R7ZJ 2PJRB 1JHHA 3MWMA 4HF0A 4P55A 3SEZA 3K4BA 4I0BA 3KLNA 4ZDPA 4YG2F 4HNUA 1HC8A 3MKYB 1UZCA 2FE3A 3ULQB 2E2IJ 4NC6A 3HOZJ 1RUNA 4UY8I 2BE5F 4NC7A 4RGSA 4LG3A 4NQWB 2A61A 2DDAA 4BXFA 1JKRC 4XOPA 1ON1A 2L4MA 2QQ9A 3B02A 1T0FA 4CDGA 3OYBA 2DFIA 2IGKA 4G7ZF 4I6ZA 1XPXA 3LA2A 3G2BA 4FHTA 1ZGAA 4AVPA 2IRFG 2GIZA 5FLMJ 1K79A 1R71A 1XCVA 2VN2A 3F72A 5FFXA 5D5VB 3J81Z 3OYCA 3ASOH 1R1TA 4NNJA 2MA3A 3VSLA 5L3EA 4QTRA 1GLNA 3KETA 2FNPA 1XDSA 2XRNA 5BOXA 2DAOA 5TRDA 2K85A 3BR0A 3ZQGA 3KYLA 1SVOA 4XBFA 1LVAA 1B8IA 1W0TA 4OIQF 4UNOA 5CVVA 1IXRC 4Q48A 1RC9A 3DPTA 1RI7A 3ZN1A 2DCEA 2DFFA 2DA7A 5J47A 3BR6A 1QZZA 4GYIA 1MBKA 3MAJA 5J3LA 4ENNA 1YRNA 2HDDA 3L2UA 3Q0WA 1V3FA 1I1SA 1VQNI 2JA7J 3K7AJ 2QVOA 2B63J 1WH5A 1Y8QB 4XK4A 3GTKJ 5DTDA 3I4MJ 2EZIA 3MMYB 2VC0A 2UV1A 1A35A 2QWWA 1YW7A 4JBAA 2FD5A 4D0PA 2COMA 3DV8A 3O2PE 3E3VA 2O0YA 1AOYA 2JWTA 5GAHJ 4M6XA 3KIOA 4ZZLA 3G3ZA 1T38A 1FOXA 2ZKZA 5CQGA 2XPUA 2O03A 3A01B 3MZYA 4OU0A 3W2AA 3F0CA 1U9OA 4RAFA 3DBLB 3DBHB 3NWSA 4BJ6C 4HSTA 3WTXC 3E5QA 2HEOA 1HSTA 3FXRA 2H27A 1ZRFA 5DD8A 3J7ZI 2QSFX 1SFXA 1RRJA 4IF4A 2VB6A 2IT0A 2FNAA 4ZYHA 2PJPA 2VXDA 1ETVA 1O4XA 2V1UA 3BJAA 2BVLA 2L7FP 2F4OB 1IF1A 3ZQFA 3BWGA 3OSFA 3ERMA 2OJED 3GEZA 2V9VA 2Y0SN 4KITB 3J7AO 3F22A 1TNTA 3TQNA 2LK2A 3IP4B 1FYKA 3I58A 3TBIA 3LAPA 1R00A 5LHGA 3FK6A 3VYUB 1P6RA 4BE2A 4U87A 3OS0A 3ZMSA 1IV6A 4YFKF 3I4NJ 1BI3A 1HLVA 1Z7LA 2L9SA 4I02A 4D7NA 2CW8A 4BNCA 2P6TA 2JVGA 2M3AA 2MC3A 2OAZA 5IT9Z 4Y3OA 3LSTA 1OCPA 4F7ZA 3A2KA 3BZKA 4AYBN 2XAFA 4NB5A 2LY1A 3IUOA 2AXTC 4A12A 4DYCA 4C2MJ 3LMMA 3HIFA 1DGWY 2ZJ2A 3CCUI 1GDTA 1MMAA 1J9IA 5HVQC 4L9NA 1MBHA 4BDZA 3JCUC 4RLQA 1YX3A 2CQQA 3LL7A 3QP6A 4LLNA 1TTYA 4HX7A 2GXGA 3PIPF 2VONA 3RPUD 5HNFA 4UHTA 2FBHA 2Y30A 5GTIC 3K6GA 4KIBA 4KN7X 2XKOA 1T33A 4HLYA 3DLAA 3Q9VA 2QUFA 4JX4A 1JT0A 3V7RA 3MCZA 3NEUA 4HSRA 4CZZA 1S3JA 3BG7A 3HOWJ 2MLKA 1JJ6C 2DYRH 2JK3A 5BS6A 3G1LA 2L9VA 4NQWA 2EZLA 4HDUA 4P96A 2Y0SA 4WF2A 3ROUA 2M87A 2HS5A 2AO9A 3LWFA 3C3WA 3UKGA 3FXUA 1UG2A 3WTWC 4IJAA 1MBGA 4XKWA 5FRNA 4L0YB 4BHPA 1PJRA 2PJRA 4IEJA 3PQJA 1K78A 1ETXA 2Z9OA 1KU3A 5E1ZB 4E7SA 1IAWA 2ZNZA 2QZ8A 1MBEA 3MFKA 3RYRA 1XB4A 1AU7A 4CYDA 4Q4ZF 3ABMH 2VJ5A 3ISPA 5FD5A 4D1QA 1TBXA 2W25A 3C2BA 3C18A 1KQ8A 2F5VA 4W97A 3ZRGA 3V8KA 2KZGA 3C2GA 1BJZA 2V6CA 5L3BA 1XGMA 1XS9A 2DTRA 3CC7I 3MVPA 5DYMA 4CA0A 4EM1A 3BR5A 3DFGA 1LNWA 5C3EJ 2VOOA 4NC8A 4EGZA 1MNDA 2LY2A 2Y69H 4OMYA 2XIGA 2IA0A 5GP9A 4PDKA 1R49A 2JQ7A 3BZ6A 2M0CA 2FQ4A 5FLVA 3PNTA 4M9SA 2XDVA 2DI3A 1ITYA 1TWFJ 4BL0B 3U1KA 1ZTRA 4G6DA 3H9GA 3V8LA 4MEXF 1BI2A 1Z9CA 3J7YJ 1B1BA 1SAUA 2HYJA 4XN0A 3TO7A 5GTHC 4L9VA 2ME0A 5A2QK 4PJMA 2P5KA 1TL8A 2HFHA 3VOEA 1FBSA 1O57A 2O8KA 2ELJA 3PNVA 2BY0A 4XONA 4KN4X 4XKVA 2OBPA 1FBUA 2M4KA 3DKWA 3QPHA 1IJWC 1HDDC 3KLOA 1I1GA 1QVTA 3OIQA 4ETSA 2ACJA 1IC8A 3JRAA 2DT5A 1N75A 1Q1VA 2XAQA 2M7AA 5H20A 5EGOA 1LQ1A 2J5PA 3F8FA 3HRMA 2RVCA 3DPUA 2EZHA 2OQRA 4HEA2 4PFOA 3ZPLA 2ZFUA 1P4AA 2JRMA 1OKRA 5IOYA 1E3OC 3CC4I 1MBJA 1B6AA 2HR3A 4GGGA 3S3MA 1YFHA 1K6YA 2FXAA 1PP8F 2WADA 2MG4A 2E35A 1X4OA 3RYPA 5HDNA 1KGSA 1XC5A 1GUUA 2LY9A 1VQOI 3U1DA 2HOAA 3PSFA 2MGQA 3WTYC 3KP7A 1IN6A 4M72A 3TW6A 3HOSA 3DF8A 1MDMA 3BTJA 1FNNA 3RTRA 1OQYA 2DBBA 1ZGJA 3CCYA 2L01A 4BE0A 2DN0A 4BQAA 2K27A 2CQ7A 3HTUA 3PUBA 2GQQA 3OIOA 1T2KA 2K7LA 4IXAA 5B1BH 4ASNA 4A3LJ 2CYYA 3G1MA 1WJCA 1D0ZA 2DO7A 4V2GA 5IT3A 1TT0A 3FDYA 4HV5A 1J75A 2MYSA 1I27A 1VQMI 3PNYA 4ESFA 4XRSG 2HYFA 4RAYA 1XSVA 3ZMDA 2CO5A 2GBYA 4A0XA 1Y6IA 2OV7A 1K61A 3MZ8A 2MABA 3JRFA 2HOTA 1P92A 3M9AA 1YIOA 4BQOA 3JTHA 4BUPA 2OA4A 2AXLA 4B44A 4CH7A 1UHSA 3R61A 4G6TB 5B1AH 1QBJA 1MMNA 3E1SA 2E5NA 1WI9A 3ZGKA 3ABUA 3IKVA 3GTJJ 3T5XA 1U9NA 1S5LC 4F55A 4FE7A 1RKTA 2X48A 2R4GA 3CZ6A 3TDUC 5EG0B 1R1UA 2CV0A 2NVUB 3R6SA 2VQGA 2O61A 2DK5A 4CUGA 2X0LA 2VPRA 2A6EF 2RREA 5GAEJ 3RDIA 4M73A 2XPVA 3M8EA 2LDUA 5KVRA 3OYGA 2CG4A 2HDCA 1FSHA 1O3RA 3H9JA 1PUFA 3BTCA 3LSPA 1TLHB 1KONA 1MGTA 2M30A 1S7AA 3OIPA 2KHMA 3OSGA 3IH3A 2QCOA 1GT0C 3K4JA 3HUGA 1Z6RA 1XMXA 3K4NA 4HV6A 4RGXA 3FWEA 2X1DA 3K4LA 1WQ2A 1GXPA 3K1NA 1MZBA 2EIMH 3K2ZA 3TGNA 4AIDA 2JPCA 5HLGA 2EFWA 1ZGWA 1F36A 3TW7A 1KYZA 4IHYA 3LFKA 2BYVE 5E20A 4DBQA 1ZRDA 1SD6A 2A5YB 3GZ5A 2DMQA 1W5SA 4D9JA 3T8RA 3J80Z 2RNGA 2R5ZA 2EK5A 1D1CA 3VODA 4YIIA 1YYVA 3HPGA 4G12A 1OYYA 4P5OA 4XORA 2XAGA 3G1OA 4AIHA 2KZVA 4O6JA 4UVBA 1S6LA 3E5XA 2LRDA 4II3A 2HGCA 1QNTA 3N05A 2LF8A 2MH9A 2Y31A 5CQEA 2DA1A 2ELHA 3FMSA 5HOOA 1X4PA 5L3DA 2QA4I 3FZVA 1Z77A 4RGRA 1E3PA 4KICA 5K7ZA 3SZGA 2OCEA 1BN5A 3HHHA 3DTKA 1U5TB 4ITVA 2MFZA 2L5QA 5IYCJ 1XMAA 1SFUA 2H1KA 3PQKA 1SD7A 2H6BA 1DPRA 1P4XA 5FLXZ 1GHCA 1PYVA 1RESA 1WJEA 4UUTA 1BM9A 2Y2ZA 5K1YA 1XGOA 3BCAA 1YO5C 1QU3A 3R60A 4JYKA 1FPQA 2LKSA 3BTIA 3ZQHA 1ZG5A 1K4SA 3CJRB 3TO6A 2YX4A 2OCCH 2P7CB 5F0HA 2FU4A 1S9HA 4PUSA 1S7OA 4BGDA 1OYWA 4PSWA 2VKVA 4LG0A 5ICFA 3A0HC 5BMZA 1ZR4A 3F6OA 2E1CA 4A3CJ 2G0EA 4Y15A 1X19A 5ILUA 3CDIA 2CW0F 1BR2A 1N78A 1MMGA 3W6JB 2CU7A 2EINH 2KT0A 4GO1A 5J8CA 1JUMA 4ZTJA 2CSOA 2OUMA 1WWXA 1ZLKA 3WU1B 4G9YA 5M3MJ 5IP9J 5DS9A 3LAJA 3HOUJ 1NHAA 1LE8A 3ABKH 3JSPA 3HXLA 3R0JA 5F1JA 4NHJA 4HLXA 4I09A 3GLLA 2HZDA 1QPMA 5LBQA 2YU9J 2M7BA 4N4OB 2E5ZA 2BGCA 4E7JA 1YQAA 1X1BA 4RB0A 2R7TA 2VKHA 4C30A 1J7KA 4XNFA 1ZQ3P 3ML6A 2DMNA 4R1HA 1UHWA 3AG4H 2IEKA 3MN2A 2P0WA 5FKMA 4ZYGA 3GYHX 3BC8A 2RNJA 1IDZA 3KP3A 5CVUA 4MNUA 3KE2A 2PMZN 2EFQA 4NUBA 2R0QC 3Q3SA 2W82A 2HOEA 2Z3YA 5DUIA 2B7EA 2R7DA 1IRZA 1KU7A 3K69A 2DK8A 5GAGJ 4QIWN 2LSOA 2EBIA 4CCNA 1X1AA 3PM1A 4EJVA 1G6NA 2HXIA 1LDJA 3KZYA 4CCJA 1LFUP 4UUSB 2VBXA 2Q2EB 3ESWB 1B72B 1AKHB 1B72A 5FKOA 2Q2EA 3L9FA 1ZR2A 3DXJF 1OMIA 2QQ8A 3CC2I 4KFCA 2C6YA 3KZZA 4IRHA 4LIVA 2HXOA 1CF7A 2V9PA 1FP1D 2ZSIB 2HVSA 1YLFA 3WTSC 1JI8A 1GVJA 3PSIA 1XCBA 1MMDA 1FTZA 2DFEA 3QOPA 4F93B 2ISYA 2HTJA 1MSEC 2GXAA 5DM7F 3M4OJ 1TZLA 3I59B 3RQ4A 4ESBA 1Y8RB 2IS1A 4JQFA 2RDPA 2HTSA 2HOSA 2LYCA 1QZEA 2VL8A 1KQ0A 4MEYF 2VODA 2P6SA 1GXQA 1W4MA 2ELKA 5D8LB 5L3FA 1CQTA 4PGGA 5DV5A 3VFZA 2ESHA 4TV7A 1YJ9I 1JKOC 1R23A 3K1MA 1LJ9A 4XLFA 5CKTA 4O5VA 2L54A 1HA8A 3SFIA 2DPUA 1Z0XA 3L2WA 3HEFA 3OYMA 2KRFA 2BXZA 4PSXA 5JHFA 1ZELA 3PFYA 4R8HA 3QPSA 3DWLE 4I98B 3GFMA 1I50J 3JAMZ 2A6TA 3FXMA 1LE8B 2D45A 1W36C 2UZKA 2FBIA 2ZJPF 4WXDA 5LGTA 1JGGA 3ZN0A 1WGXA 2KDZA 9ANTA 5E3OA 1SANA 5K7FA 2HI3A 3KPHA 2GA2A 3T0YA 2IBDA 1VF9A 3HRUA 2R7WA 3VWBA 2EILH 3DEUA 4XKCA 2PI0A 2W85A 2CV2A 1FBQA 1VNDA 3CLOA 4YFXF 5LHIA 2ZXHA 2NVYJ 1W1WE 4EV0A 4KIFA 1ZREA 5M5WJ 5IYDJ 5AONA 1FEXA 4CHUA 2Z2SB 3DU6A 2MC4A 3K10A 2A3SA 1IRGA 2EQRA 3EDPA 3NRVA 4YFNF 1EH6A 2XASA 1YE9A 1SD4A 3QAHA 3FHNA 4Y4RA 1ETYA 5DD4A 3ZQIA 2ZFWA 1JUSA 3H1CA 5FRMA 2LMDA 3SXYA 2H09A 1PUEE 2A07F 3HJEA 1YOVB 3CQZJ 2L2OA 2ECBA 2NS7A 2YR2A 1M1EB 3GZ6A 3FX3A 2Y9ZA 2EH3A 4B43A 2VE8A 3CF2A 1USTA 3BP8A 4QSHA 2E19A 4CICA 1FC3A 2BOLA 1X58A 1Z91A 2XF7A 2XGEA 4I99C 4M3GA 2OPTA 4Y52J 2Q0OA 3VYRB 3OYAA 1D0YA 1POGA 3ECHA 3K0LA 1H9GA 1EJ9A 2FJ1A 1Z05A 2E1MB 3BLYA 3S32A 1X3WB 1DU0A 3SJMA 5L3GA 4QPQA 2R92J 2MLGA 2FMLA 3CO7C 1ON2A 2HKXA 2XF6A 3BG6A 1OCRH 3M07A 4L0ZB 3KP6A 2W1OA 1MJ9A 2B9SA 4YELA 1VQPI 3CCSI 3HC7A 3GMEA 2VBZA 1P2FA 1FT9A 5D4RA 5KCMA 3PL8A 3WU2C 3O8GA 4EMSA 3S8PA 2ZNYA 4XLEA 3HGYA 4WCGA 2O5RA 2OF7A 3IWZA 5K5OA 3OY9A 5ILSA 3HTSB 3T1BA 2BV6A 2CUZA 2CFOA 1QA6A 3WHCA 4P1WA 3WGIA 3MQ0A 2CJJA 5EEAA 3S2HJ 1A6IA 3L09A 4HNVA 4KMFA 4NDLA 3NAUA 2X6XA 1UAAA 4DIQA 1O3TA 2P8TA 2R93J 1J59A 2X1CA 3GO5A 3BQZA 4FCYA 2VBYA 4GYGA 4B1RA 1MIJA 5EG0A 4ENJA 1I6XA 4DZJA 1N25A 2DU9A 3J7AY 2WB1N 4HF2A 3Q0VA 3NWTA 1F43A 4BYYA 2AQFA 3SDBA 1IW7F 3R4KA 4OWRB 2JA5J 1I3QJ 1RPWA 4OAZA 5B5EC 3C1DA 1NG7A 4L18B 4A3BJ 2VKEA 1VQ7I 2DYSH 1X1CA 3CESA 2NVQJ 2E60A 2VUMJ 3C7JA 3TDZC 2JPBA 4HW0A 4AWXB 1N77A 4A5NA 2M2EA 5HLHA 1AWCA 4KJZA 4ZC3A 3G4SI 3BG9A 2DA2A 1YJWI 3AG2H 1UB9A 2JJ7A 2Y0MA 2O7OA 3GTQJ 4A5MA 1FYLA 1EH7A 3EYYA 4Y17A 1IDYA 1SEUA 2XUBA 3ZMUA 5ICEA 1WKMA 1IXSB 2CW7A 4C3JJ 2Z1DA 4KDPA 5DDGA 1J0RA 2MSYA 4IPAA 1PP7U 3O3KA 4AM3A 2O6GE 1SFKA 1QHHD 2PLYA 3HOTA 2K3FA 3H36A 2K40A 2NS0A 2R5YA 2HWVA 4M3BA 4J00A 1QQIA 3RZOJ 1QZYA 2DJNA 2TCTA 3OYEA 4M9ZA 1EV7A 1BI0A 1OISA 3KFWX 2WV1A 3T8TA 1REPC 3G6EI 1P9QC 2PN6A 3WGGA 4A2UA 1IGNA 2JA2A 1XD7A 4JK1X
chains in the Genus database with same CATH topology
2M9HA 2HOTA 1S7EA 1FIAA 1JUPA 4Y7NJ 1HCRA 1JKPC 4FISA 3JR9A 1UHSA 2I10A 2DA3A 4JP0A 1TC3C 5GPAA 5J1YA 3A02A 2QF7A 3HM5A 4A3MJ 3PO3J 3S1NJ 3GTJJ 1U9NA 3K2AA 5EZGA 4FE7A 1RKTA 2X48A 1YRNB 4D7MA 1H8AC 4C3IJ 1JJ8C 4BBSJ 5EG0B 3RQIA 2K9QA 3A01A 1QVUA 4MO7A 2VPRA 1WPKA 5EF6A 2XPVA 3GTMJ 3SDGA 3BR1A 4B4CA 1ZKGA 4D5FA 4MFEA 1PUFA 3BTCA 3LSPA 3CMYA 3OSGA 3IH3A 1XG1A 2QCOA 4BY7J 1GT0C 4A3KJ 2COBA 1LFBA 3BQYA 1VI0A 2H8RA 3HKZN 1QRYA 1FIPA 1IG7A 1ZGWA 4BY1J 3JRIA 1F36A 3TW7A 4A3EJ 1OJLA 4IHYA 1B8IB 2DMQA 4W1UA 2R5ZA 1ORKA 1D5YA 1TWAJ 4BXXJ 3B6AA 1U78A 3JRBA 4G12A 1H89C 2GLOA 5FKLA 1A5JA 2D5VA 3G1OA 1JKQC 5M3FJ 2GM4A 2YUSA 2YS9A 4M6VA 1WCMJ 1ENHA 3S15J 2LFBA 1WI3A 2Y31A 3PO2J 2DA1A 5EGOB 1Z77A 5K7ZA 2X6OA 5FKNA 4IHVA 5EDNA 4DYQA 3JRDA 4IHWA 5IYCJ 1HF0A 3BT9A 2R5ZB 4IHXA 2H1KA 3MKLA 3O8HA 4B3AA 3H3VK 2FX0A 4XICA 3IH2A 4DW6A 4A69C 1RESA 4UUTA 2Y2ZA 3E7LA 4J19A 3DCFA 4ABZA 4JYKA 3BTIA 3RKQA 3ZQHA 2R7ZJ 3S1MJ 3TP3A 3HOVJ 1MH4A 3FISA 1RKWA 5F0HA 4GFBA 1NTCA 4XIDA 3VPRA 4DZPA 3GTPJ 3ZQLA 2VKVA 2E2IJ 4A3CJ 1ZR4A 3HOZJ 2G0EA 2ECCA 5EYRA 4A3DJ 2XSDC 2LR8A 2CU7A 3FKIJ 2KT0A 1JKRC 1JUMA 3JRGA 5M3MJ 1RETA 1QPIA 5F08A 5IP9J 5DS9A 5M5YJ 4I6ZA 3HOUJ 1LE8A 3S1RJ 5F1JA 5J1RA 2LVSA 1GV2A 4JX5A 5FLMJ 4FTHA 1SFOJ 2YU9J 2XPWA 1H88C 4QTRA 4AUXA 3BR0A 3ZQGA 4UUSA 1GVDA 3L1PA 1ZQ3P 2DMNA 3FK7A 1B8IA 1W0TA 4C3HJ 2IEKA 5F0CA 2EZKA 2DA7A 2XB5A 3BR6A 2NVXJ 1ZK8A 3OOUA 1MBKA 3MN2A 2L7ZA 5J3LA 5FKMA 1YRNA 3S14J 2HDDA 4A3JJ 3Q0WA 1IDZA 2W48A 2JA7J 3K7AJ 5C4XJ 3QPLA 2PMZN 2B63J 1WH5A 3I4MJ 4XK4A 2R0QC 2AHQA 3Q3SA 5DTDA 3GTKJ 2EZIA 1IRZA 3GTLJ 2FD5A 1MBFA 3NARA 4QIWN 1VFCA 2EBIA 5F04A 2E2HJ 2JA6J 3PM1A 3LSJA 2XGDA 2JWTA 2HXIA 3HBLA 3A01B 2XPUA 1LFUP 3F0CA 4UUSB 1U9OA 5E3LA 2E2JJ 1B72B 1AKHB 1B72A 5FKOA 2ID3A 1ZR2A 4V2FA 3S17J 2HXOA 2JMWA 3LNQA 1DU6A 1O4XA 1ETVA 4BBRJ 2L7FP 3ZQFA 2MW8A 1FTZA 3OSFA 1MSEC 3HB9A 3BG3A 1UMQA 2Y0SN 5J1UA 3M4OJ 2CUEA 3GBGA 1NK3P 1NK2P 1MSFC 1ETWA 2LK2A 2HOSA 5IP7J 2M8GX 5E3NA 3FK6A 1MH3A 3DEWA 2ELKA 5EZHA 5FKKA 3Q0UA 1IV6A 3LOCA 1JT6A 2DMUA 3I4NJ 1CQTA 1HLVA 2XB0X 1ETKA 4D7NA 3RZDJ 5JLWA 5E3MA 4XRMA 1JKOC 1FTTA 1OCPA 2DA6A 2LLKA 3SFIA 2K9NA 1Z0XA 4AYBN 3BG5A 3HEFA 5F27A 3A03A 4DYCA 3QPSA 4C2MJ 5M5XJ 2E1OA 1I50J 5K7HA 2ID6A 3ZOBA 5C44J 1LE8B 1GDTA 2DA5A 3IH4A 1MBHA 1JGGA 1WGXA 2KDZA 5IP6A 2CQQA 5E3OA 1SANA 4A3GJ 5K7FA 2ZB9A 2HI3A 4L5EA 1BA5A 2IBDA 1VF9A 5IOZA 2ME6A 2Y30A 3H0GJ 1T33A 1VNDA 2NVYJ 4JX4A 1T56A 1JT0A 5M5WJ 3HDDA 1Y1VJ 4A93J 1WH7A 5IYDJ 3D1NI 1APLC 1FEXA 3HOWJ 1JJ6C 2CRGA 1OFCX 2EQRA 1MNMC 2JK3A 2Y9YA 3G1LA 1P7JA 2DA4A 2EZLA 5F0FA 5FJ8J 1ETYA 4CYCA 4A3FJ 2AO9A 3ZQIA 2O9LA 1JUSA 2K9SA 3UKGA 3TP0A 1UG2A 3JREA 3W6VA 4RBOA 1MBGA 3CQZJ 2NS7A 2ECBA 3M3YJ 2Y9ZA 1G2HA 1P7IA 2EH3A 4IEJA 2DTZA 2X9DA 1ETXA 1HOMA 1BW5A 4QSHA 1K83J 2E19A 1PUFB 1MBEA 3S1QJ 1X58A 2XGEA 4M3GA 2OPTA 1TWGJ 1Y1WJ 1AU7A 4Y52J 5HODA 2NS8A 3FIWA 1EF4A 1POGA 3C2BA 1TWHJ 2FJ1A 4W97A 1BW6A 2CUFA 1BJZA 1R9TJ 3SJMA 5C4JJ 2N8GA 1XS9A 2M34A 2R92J 3MVPA 3HOXJ 3BR5A 1X2MA 3TEDA 4DYRA 5C3EJ 1TWCJ 1I6HJ 2HQ5A 5GP9A 3BTLA 4S0HB 4AC0A 1IUFA 4I76A 1ETQA 3O8GA 2DMTA 2M0CA 3HOYJ 2FQ4A 3HGYA 5FLVA 4EEFG 1U8BA 5JLXA 2OF7A 2RAEA 1ITYA 4JX6A 1TWFJ 1FJLA 1ZTRA 3QQAA 3WHCA 5EEAA 1HDPA 2CJJA 1X2NA 3S2HJ 1A6IA 4HNVA 4NDLA 3NAUA 2DMPA 2HYJA 1RR7A 1BL0A 4XRSA 2R93J 2LP0A 3BQZA 2ME0A 4FCYA 2IAIA 4B1RA 2WAQN 5EG0A 2O8KA 4CYCB 4DZJA 4X1EA 2WB1N 1IJWC 4A3IJ 3Q0VA 1HDDC 3GTGJ 1OCTC 1F43A 5IYBJ 1JTYA 1QVTA 3B6CA 1IC8A 3JRAA 2JA5J 1Q1VA 1AHDP 1I3QJ 5EGOA 1RPWA 2EZHA 4A3BJ 2VKEA 5IOYA 1E3OC 2NVQJ 1GV5A 1MBJA 2L0KA 3S16J 2VUMJ 3LSGA 3IV5A 2XGCA 4MFDA 2MG4A 2M2EA 2NOGA 1AKHA 4MLOA 3GTOJ 2NVTJ 3S2DJ 4M3EA 2LKXA 3JRCA 1XC5A 3BG9A 2P81A 1GUUA 2DA2A 2LY9A 2HOAA 2L7MP 2TRTA 9ANTA 2JJ7A 2MGQA 4RDUA 2L9RA 3TW6A 2O7OA 4M3FA 3BR3A 3GTQJ 5BNGA 3BTJA 4FE4A 1IDYA 3WHBA 3BR2A 4M3DA 2CQXA 4C3JJ 3ZQCA 4LOCA 3JRHA 3CCYA 5IPAA 4BKXA 2DN0A 2MSYA 1W0UA 3HGGA 5GPCA 2JA8J 2LTPA 3OIOA 2VI6A 4A3LJ 3LSRA 1DU0A 2LD5A 2K40A 1ETOA 1JTXA 2JN6A 3G1MA 2R5YA 2R5YB 4M3BA 4V2GA 4D5CA 4MIMA 3RZOJ 2DJNA 2TCTA 2WV1A 3CDLA 4XRSG 2GBYA 1IGNA 1K61A 4X6AJ 3JRFA 2XRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9H A;  2HOT A;  1S7E A;  1FIA A;  1JUP A;  4Y7N J;  1HCR A;  1JKP C;  4FIS A;  3JR9 A;  1UHS A;  2I10 A;  2DA3 A;  4JP0 A;  1TC3 C;  5GPA A;  5J1Y A;  3A02 A;  2QF7 A;  3HM5 A;  4A3M J;  3PO3 J;  3S1N J;  3GTJ J;  1U9N A;  3K2A A;  5EZG A;  4FE7 A;  1RKT A;  2X48 A;  1YRN B;  4D7M A;  1H8A C;  4C3I J;  1JJ8 C;  4BBS J;  5EG0 B;  3RQI A;  2K9Q A;  3A01 A;  1QVU A;  4MO7 A;  2VPR A;  1WPK A;  5EF6 A;  2XPV A;  3GTM J;  3SDG A;  3BR1 A;  4B4C A;  1ZKG A;  4D5F A;  4MFE A;  1PUF A;  3BTC A;  3LSP A;  3CMY A;  3OSG A;  3IH3 A;  1XG1 A;  2QCO A;  4BY7 J;  1GT0 C;  4A3K J;  2COB A;  1LFB A;  3BQY A;  1VI0 A;  2H8R A;  3HKZ N;  1QRY A;  1FIP A;  1IG7 A;  1ZGW A;  4BY1 J;  3JRI A;  1F36 A;  3TW7 A;  4A3E J;  1OJL A;  4IHY A;  1B8I B;  2DMQ A;  4W1U A;  2R5Z A;  1ORK A;  1D5Y A;  1TWA J;  4BXX J;  3B6A A;  1U78 A;  3JRB A;  4G12 A;  1H89 C;  2GLO A;  5FKL A;  1A5J A;  2D5V A;  3G1O A;  1JKQ C;  5M3F J;  2GM4 A;  2YUS A;  2YS9 A;  4M6V A;  1WCM J;  1ENH A;  3S15 J;  2LFB A;  1WI3 A;  2Y31 A;  3PO2 J;  2DA1 A;  5EGO B;  1Z77 A;  5K7Z A;  2X6O A;  5FKN A;  4IHV A;  5EDN A;  4DYQ A;  3JRD A;  4IHW A;  5IYC J;  1HF0 A;  3BT9 A;  2R5Z B;  4IHX A;  2H1K A;  3MKL A;  3O8H A;  4B3A A;  3H3V K;  2FX0 A;  4XIC A;  3IH2 A;  4DW6 A;  4A69 C;  1RES A;  4UUT A;  2Y2Z A;  3E7L A;  4J19 A;  3DCF A;  4ABZ A;  4JYK A;  3BTI A;  3RKQ A;  3ZQH A;  2R7Z J;  3S1M J;  3TP3 A;  3HOV J;  1MH4 A;  3FIS A;  1RKW A;  5F0H A;  4GFB A;  1NTC A;  4XID A;  3VPR A;  4DZP A;  3GTP J;  3ZQL A;  2VKV A;  2E2I J;  4A3C J;  1ZR4 A;  3HOZ J;  2G0E A;  2ECC A;  5EYR A;  4A3D J;  2XSD C;  2LR8 A;  2CU7 A;  3FKI J;  2KT0 A;  1JKR C;  1JUM A;  3JRG A;  5M3M J;  1RET A;  1QPI A;  5F08 A;  5IP9 J;  5DS9 A;  5M5Y J;  4I6Z A;  3HOU J;  1LE8 A;  3S1R J;  5F1J A;  5J1R A;  2LVS A;  1GV2 A;  4JX5 A;  5FLM J;  4FTH A;  1SFO J;  2YU9 J;  2XPW A;  1H88 C;  4QTR A;  4AUX A;  3BR0 A;  3ZQG A;  4UUS A;  1GVD A;  3L1P A;  1ZQ3 P;  2DMN A;  3FK7 A;  1B8I A;  1W0T A;  4C3H J;  2IEK A;  5F0C A;  2EZK A;  2DA7 A;  2XB5 A;  3BR6 A;  2NVX J;  1ZK8 A;  3OOU A;  1MBK A;  3MN2 A;  2L7Z A;  5J3L A;  5FKM A;  1YRN A;  3S14 J;  2HDD A;  4A3J J;  3Q0W A;  1IDZ A;  2W48 A;  2JA7 J;  3K7A J;  5C4X J;  3QPL A;  2PMZ N;  2B63 J;  1WH5 A;  3I4M J;  4XK4 A;  2R0Q C;  2AHQ A;  3Q3S A;  5DTD A;  3GTK J;  2EZI A;  1IRZ A;  3GTL J;  2FD5 A;  1MBF A;  3NAR A;  4QIW N;  1VFC A;  2EBI A;  5F04 A;  2E2H J;  2JA6 J;  3PM1 A;  3LSJ A;  2XGD A;  2JWT A;  2HXI A;  3HBL A;  3A01 B;  2XPU A;  1LFU P;  3F0C A;  4UUS B;  1U9O A;  5E3L A;  2E2J J;  1B72 B;  1AKH B;  1B72 A;  5FKO A;  2ID3 A;  1ZR2 A;  4V2F A;  3S17 J;  2HXO A;  2JMW A;  3LNQ A;  1DU6 A;  1O4X A;  1ETV A;  4BBR J;  2L7F P;  3ZQF A;  2MW8 A;  1FTZ A;  3OSF A;  1MSE C;  3HB9 A;  3BG3 A;  1UMQ A;  2Y0S N;  5J1U A;  3M4O J;  2CUE A;  3GBG A;  1NK3 P;  1NK2 P;  1MSF C;  1ETW A;  2LK2 A;  2HOS A;  5IP7 J;  2M8G X;  5E3N A;  3FK6 A;  1MH3 A;  3DEW A;  2ELK A;  5EZH A;  5FKK A;  3Q0U A;  1IV6 A;  3LOC A;  1JT6 A;  2DMU A;  3I4N J;  1CQT A;  1HLV A;  2XB0 X;  1ETK A;  4D7N A;  3RZD J;  5JLW A;  5E3M A;  4XRM A;  1JKO C;  1FTT A;  1OCP A;  2DA6 A;  2LLK A;  3SFI A;  2K9N A;  1Z0X A;  4AYB N;  3BG5 A;  3HEF A;  5F27 A;  3A03 A;  4DYC A;  3QPS A;  4C2M J;  5M5X J;  2E1O A;  1I50 J;  5K7H A;  2ID6 A;  3ZOB A;  5C44 J;  1LE8 B;  1GDT A;  2DA5 A;  3IH4 A;  1MBH A;  1JGG A;  1WGX A;  2KDZ A;  5IP6 A;  2CQQ A;  5E3O A;  1SAN A;  4A3G J;  5K7F A;  2ZB9 A;  2HI3 A;  4L5E A;  1BA5 A;  2IBD A;  1VF9 A;  5IOZ A;  2ME6 A;  2Y30 A;  3H0G J;  1T33 A;  1VND A;  2NVY J;  4JX4 A;  1T56 A;  1JT0 A;  5M5W J;  3HDD A;  1Y1V J;  4A93 J;  1WH7 A;  5IYD J;  3D1N I;  1APL C;  1FEX A;  3HOW J;  1JJ6 C;  2CRG A;  1OFC X;  2EQR A;  1MNM C;  2JK3 A;  2Y9Y A;  3G1L A;  1P7J A;  2DA4 A;  2EZL A;  5F0F A;  5FJ8 J;  1ETY A;  4CYC A;  4A3F J;  2AO9 A;  3ZQI A;  2O9L A;  1JUS A;  2K9S A;  3UKG A;  3TP0 A;  1UG2 A;  3JRE A;  3W6V A;  4RBO A;  1MBG A;  3CQZ J;  2NS7 A;  2ECB A;  3M3Y J;  2Y9Z A;  1G2H A;  1P7I A;  2EH3 A;  4IEJ A;  2DTZ A;  2X9D A;  1ETX A;  1HOM A;  1BW5 A;  4QSH A;  1K83 J;  2E19 A;  1PUF B;  1MBE A;  3S1Q J;  1X58 A;  2XGE A;  4M3G A;  2OPT A;  1TWG J;  1Y1W J;  1AU7 A;  4Y52 J;  5HOD A;  2NS8 A;  3FIW A;  1EF4 A;  1POG A;  3C2B A;  1TWH J;  2FJ1 A;  4W97 A;  1BW6 A;  2CUF A;  1BJZ A;  1R9T J;  3SJM A;  5C4J J;  2N8G A;  1XS9 A;  2M34 A;  2R92 J;  3MVP A;  3HOX J;  3BR5 A;  1X2M A;  3TED A;  4DYR A;  5C3E J;  1TWC J;  1I6H J;  2HQ5 A;  5GP9 A;  3BTL A;  4S0H B;  4AC0 A;  1IUF A;  4I76 A;  1ETQ A;  3O8G A;  2DMT A;  2M0C A;  3HOY J;  2FQ4 A;  3HGY A;  5FLV A;  4EEF G;  1U8B A;  5JLX A;  2OF7 A;  2RAE A;  1ITY A;  4JX6 A;  1TWF J;  1FJL A;  1ZTR A;  3QQA A;  3WHC A;  5EEA A;  1HDP A;  2CJJ A;  1X2N A;  3S2H J;  1A6I A;  4HNV A;  4NDL A;  3NAU A;  2DMP A;  2HYJ A;  1RR7 A;  1BL0 A;  4XRS A;  2R93 J;  2LP0 A;  3BQZ A;  2ME0 A;  4FCY A;  2IAI A;  4B1R A;  2WAQ N;  5EG0 A;  2O8K A;  4CYC B;  4DZJ A;  4X1E A;  2WB1 N;  1IJW C;  4A3I J;  3Q0V A;  1HDD C;  3GTG J;  1OCT C;  1F43 A;  5IYB J;  1JTY A;  1QVT A;  3B6C A;  1IC8 A;  3JRA A;  2JA5 J;  1Q1V A;  1AHD P;  1I3Q J;  5EGO A;  1RPW A;  2EZH A;  4A3B J;  2VKE A;  5IOY A;  1E3O C;  2NVQ J;  1GV5 A;  1MBJ A;  2L0K A;  3S16 J;  2VUM J;  3LSG A;  3IV5 A;  2XGC A;  4MFD A;  2MG4 A;  2M2E A;  2NOG A;  1AKH A;  4MLO A;  3GTO J;  2NVT J;  3S2D J;  4M3E A;  2LKX A;  3JRC A;  1XC5 A;  3BG9 A;  2P81 A;  1GUU A;  2DA2 A;  2LY9 A;  2HOA A;  2L7M P;  2TRT A;  9ANT A;  2JJ7 A;  2MGQ A;  4RDU A;  2L9R A;  3TW6 A;  2O7O A;  4M3F A;  3BR3 A;  3GTQ J;  5BNG A;  3BTJ A;  4FE4 A;  1IDY A;  3WHB A;  3BR2 A;  4M3D A;  2CQX A;  4C3J J;  3ZQC A;  4LOC A;  3JRH A;  3CCY A;  5IPA A;  4BKX A;  2DN0 A;  2MSY A;  1W0U A;  3HGG A;  5GPC A;  2JA8 J;  2LTP A;  3OIO A;  2VI6 A;  4A3L J;  3LSR A;  1DU0 A;  2LD5 A;  2K40 A;  1ETO A;  1JTX A;  2JN6 A;  3G1M A;  2R5Y A;  2R5Y B;  4M3B A;  4V2G A;  4D5C A;  4MIM A;  3RZO J;  2DJN A;  2TCT A;  2WV1 A;  3CDL A;  4XRS G;  2GBY A;  1IGN A;  1K61 A;  4X6A J;  3JRF A;  2XRL A; 
#chains in the Genus database with same CATH topology
 3DU5 A;  4IKF A;  2MH2 A;  2R7X A;  1BR1 A;  3CCJ I;  1AA7 A;  2TDX A;  1T39 A;  3L2Q A;  4FIS A;  3JR9 A;  3W6K B;  3WU0 A;  3VEP A;  2DA3 A;  2QBY B;  3K4K A;  4DJA A;  2F4M B;  4A3M J;  3S1N J;  3BCB A;  3OR2 C;  2NNY A;  4GCV A;  3H3Z A;  1H8A C;  1JJ8 C;  2UXN A;  4RA2 A;  3A01 A;  1QVU A;  3FXO A;  5HLI A;  2VIX A;  2PG4 A;  5D8K B;  4MTD A;  3SDG A;  4HDV A;  3BR1 A;  4ZJZ A;  3OYH A;  2F4I A;  2YU3 A;  3P5J A;  4N0B A;  4D5F A;  1KYW A;  1Z21 A;  4IHS A;  2PQ8 A;  2Y75 A;  4LMY A;  1IN5 A;  1QO0 D;  1Z1D A;  3EET A;  3L2R A;  3SEQ A;  4BY7 J;  3I0T A;  2HKO A;  2JUC A;  1X3U A;  4A0Y A;  3G73 A;  1KA8 A;  1HW1 A;  1LFB A;  5CVJ A;  2R7R A;  1VI0 A;  4BHB A;  1TQI A;  3UR3 C;  4CZC A;  4CSW A;  5D4S A;  4EAT A;  1HSJ A;  3VB2 A;  3CUO A;  4CCK A;  4BY1 J;  1OJL A;  4BXU A;  2ICW G;  2BHY A;  3M1C A;  1B8I B;  2H94 A;  4XLH A;  4W1U A;  4XLC A;  2GXB A;  2VPL A;  3FMR A;  4BXX J;  3CD6 I;  2P7V B;  5LGN A;  3FM3 A;  3JRB A;  4Z2Y A;  2QYO A;  3EQL F;  3HZJ A;  4U7D A;  3H35 A;  4Z6Y A;  3GFL A;  5M3F J;  5J6X A;  2JZY A;  4G7H F;  3CJT B;  2YUS A;  2FOW A;  3CMA I;  2M45 A;  1EA3 A;  2WY8 Q;  4OIP F;  3M1E A;  2CMP A;  1WI3 A;  4CCM A;  1D8J A;  4JOM A;  5CLS A;  2DOE A;  3B73 A;  5EDN A;  1SD5 A;  3LSH A;  3JRD A;  3GLX A;  1SMT A;  3JSO A;  1HF0 A;  3BT9 A;  2STT A;  2F2E A;  2W00 A;  4XRF A;  4N9H A;  4OMZ A;  2FX0 A;  4XIC A;  4A0Z A;  4DQ2 A;  3H3V K;  4DW6 A;  2NYX A;  4XOT A;  1UFM A;  2EA2 A;  4J19 A;  5ERI A;  3S2W A;  4H4K C;  4XM3 A;  1I3A A;  2KMU A;  2QSH X;  1J09 A;  5EJC A;  3H9Q A;  3S1M J;  1VZ0 A;  3HOV J;  1MH4 A;  3FIS A;  4BHC A;  4LB6 B;  3M8F A;  2CGP A;  4E4H A;  5E17 F;  1NTC A;  2KDO A;  4QLC U;  1T0F C;  3GTP J;  1H9T A;  1HKQ A;  4HZF A;  3A0B C;  1FYM A;  2MBF A;  2XKP A;  2VXZ A;  3CDH A;  2XSD C;  5D6F A;  1BR4 A;  4XMY A;  3G71 I;  2DLL A;  2H1L A;  2WA0 A;  1OLT A;  2D2W A;  2V1X A;  3HYI A;  4U0V A;  3IRR A;  1QPI A;  5F08 A;  5HDG A;  2QQA A;  5M5Y J;  2X6W A;  3S1R J;  1O7F A;  4OIR F;  4I0A A;  3GFJ A;  3CP8 A;  5J1R A;  2KL4 A;  2LVS A;  2PEX A;  3F8C A;  4FTH A;  4DBR A;  1OCC H;  2QM3 A;  5DM6 F;  2XPW A;  4P9U A;  2M5W A;  5F64 A;  3F3X A;  1LUJ B;  1H88 C;  5L3C A;  3OL4 A;  1YS6 A;  3CCE I;  4BJ5 C;  4B3X A;  2FBK A;  2VT2 A;  4CCL A;  3C2H A;  3GXO A;  5BQT A;  3BRO A;  4KIS A;  1STZ A;  2LKP A;  3LQQ A;  1GVD A;  3QU3 A;  1R6R A;  4UUS A;  1WHU A;  4IL6 C;  1WFX A;  3NQO A;  5CYV A;  4KIG A;  1T6S A;  4C3H J;  3E6B A;  4XLA A;  2RN7 A;  4MHG A;  5F0C A;  3V4G A;  1LEB A;  2EZK A;  2XRO A;  1KU2 A;  2R3S A;  2NVX J;  1T08 B;  2PMZ A;  4HNT A;  3E6M A;  2L7Z A;  1V55 H;  4A3J J;  4HX4 A;  4C2U A;  3GUD A;  4CCO A;  1J2X A;  2L3D A;  2X1E A;  1R5G A;  5FLX K;  2AHQ A;  2K5C A;  3K70 C;  2BXY A;  1S72 I;  2EIK H;  2QBY A;  3I54 A;  3GTL J;  2Z5U A;  4M9X A;  2M4G A;  5E18 F;  1MBF A;  3NAR A;  1B9M A;  2PX9 A;  2E2H J;  3CME I;  5J4V A;  5DCM B;  1FZP B;  3AFH A;  3RSN A;  3HBL A;  1OR7 A;  3OYJ A;  5E3L A;  3ZP5 A;  2F5F A;  3LSK A;  3P9I A;  4BH9 A;  5TJJ A;  3OYF A;  3FHZ A;  4ANJ A;  2ID3 A;  3OS2 A;  2JRT A;  2YX7 A;  4HQE A;  3IAM 2;  2FF4 A;  2HNH A;  2JMW A;  1VQ5 I;  1JHF A;  1W36 D;  1DU6 A;  1OYI A;  1Z6T A;  3RPU A;  4XLN F;  2CFX A;  2DOA A;  2W57 A;  3QU6 A;  1S8N A;  4BBR J;  3QYF A;  2ZXW H;  2MW8 A;  2I8D A;  3RKW A;  2QQB A;  4RAG A;  5HS9 A;  3BG3 A;  1UMQ A;  5EEH A;  3ZMV A;  4HX8 A;  3ELK A;  2EFO A;  3TOB A;  1NK2 P;  1MSF C;  3ZR8 X;  1SAX A;  3K4C A;  2FQ3 A;  2M8G X;  4RS8 A;  4PZJ A;  4G8X A;  4RAZ A;  5E3N A;  5BPD A;  3DEW A;  4LG0 B;  2LH9 A;  2EIJ H;  5EZH A;  2ZC2 A;  5FKK A;  1IRX A;  5DCM A;  1O7L A;  4GRI A;  3V42 A;  2KIQ A;  2P4W A;  2XV4 S;  3K9T A;  5JLW A;  1G8X A;  4XRM A;  3OYN A;  4LD5 A;  2A68 F;  2DA6 A;  1Y0N A;  2KIU A;  5F27 A;  3A03 A;  2HPM A;  2E1O A;  1R7J A;  5C44 J;  5K7H A;  3ZOB A;  3DKX A;  1IRF A;  2YPR A;  3ONQ A;  2DA5 A;  3FBN B;  2BHZ A;  2K4B A;  2L9N A;  2LBF A;  2OD5 A;  3REO A;  2GAU A;  2ZB9 A;  3QYE A;  3DPL C;  4M71 A;  3GF2 A;  2QGU A;  3KZI C;  4YIR X;  1FLI A;  4B09 A;  1A31 A;  3ABT A;  4PJ0 C;  1FSE A;  5LEK A;  1WJA A;  3H0G J;  4E7K A;  1QGP A;  3OV8 A;  4LK0 F;  3LFU A;  2IGM A;  2L7K A;  2V4J C;  1Z67 A;  5HNH A;  4A93 J;  2ZXI A;  2VLA A;  1VQ9 I;  4YIF A;  2PMH A;  3V7S A;  2CRG A;  1OFC X;  2WAE A;  2JUG A;  3TKY A;  1P7J A;  2DA4 A;  2KFD A;  4S04 A;  5F0F A;  5H2F C;  3KP2 A;  4CYC A;  2WB1 A;  3E5U A;  2O9L A;  5LHH A;  3V8J A;  4PJL A;  2BW3 B;  4L5I A;  3PIO F;  5TGT A;  4EQQ A;  4RB3 C;  3DBR B;  2K3P A;  3SZT A;  1R4M B;  1G3Y A;  1BOA A;  3ECO A;  3JRE A;  5BPI A;  4RBO A;  1UEL B;  2UXX A;  2ZSH B;  5J8F A;  4LGW A;  3M3Y J;  1E2X A;  4IQ4 A;  1ZYR F;  5LRS A;  1P7I A;  1G2H A;  2KIM A;  1K6O A;  2DTZ A;  3RKY A;  2XAU A;  4U0W A;  2V1D A;  4KUM A;  1HOM A;  3BY6 A;  1BOB A;  1PUF B;  2RQQ A;  2W84 A;  3S1Q J;  2ZO4 A;  1XTA A;  1BC7 C;  1TWG J;  4KA4 A;  3KYC B;  2NS8 A;  5HOD A;  1EF4 A;  2VJJ A;  2VKD A;  1XSX A;  1TWH J;  2DT6 A;  3WG7 H;  1ZAR A;  2VOP A;  4R79 A;  1BW6 A;  1TQP A;  1R9T J;  2HU9 A;  5C4J J;  2Q8K A;  2NRA C;  2DJI A;  3HOX J;  1YG2 A;  3D5R C;  1X2M A;  3TED A;  1I6H J;  2XAH A;  2FSW A;  2GOM A;  4KT5 C;  5IT9 K;  3DQV C;  3BTL A;  2VQH A;  2JVH A;  3SFZ A;  2QEX I;  1SFE A;  2L4A A;  1R5H A;  1ETQ A;  3ZQ7 A;  2DMT A;  2M1B A;  3D5S C;  4P9F A;  3HOY J;  4EEF G;  1U8B A;  1X1D A;  2RAE A;  5DCF A;  4JX6 A;  2I5U A;  3CF5 F;  1XGS A;  2PFB A;  1WJ5 A;  1LDD A;  1SMY F;  1X2N A;  3KCC A;  4G94 A;  1SVM A;  1DGR M;  1LVK A;  4I01 A;  3TL4 X;  1RR7 A;  1A04 A;  4XRS A;  2GWR A;  3O6B B;  3P7N A;  2IS2 A;  2M8E A;  4Q5S F;  1LB2 A;  1HBX G;  1F9N A;  2R7Q A;  1R22 A;  1ZH5 A;  3EPZ A;  3P9K A;  4X1E A;  1T8I A;  1S29 A;  1IN7 A;  2V6E A;  1TW2 A;  3IAS 2;  4WX9 A;  2QLZ A;  1OCT C;  3RI4 A;  2ZJQ F;  3GX4 X;  1IO2 A;  3B6C A;  1VQ6 I;  5E1W A;  3U21 A;  3MKZ A;  2V7F A;  3CLQ A;  3PUF A;  3V7C A;  5LD2 C;  1HKS A;  4KYW A;  4MTE A;  3DLL F;  2BY3 A;  2V1N A;  2A05 A;  2BEO A;  1UCR A;  5CPR B;  3LSG A;  2EV0 A;  2XGC A;  2JTV A;  1A36 A;  4MFD A;  4L5J A;  1G4D A;  4MLO A;  4ZH4 F;  2NVT J;  3S2D J;  4M3E A;  3A1Y A;  2LKX A;  2TRT A;  1TNS A;  2ETH A;  1XGN A;  2NAZ A;  3J81 K;  4PGH A;  2IVM A;  1FOK A;  1D0X A;  1TP4 A;  3WHB A;  1ZAO A;  2KRC A;  3BDD A;  3BR2 A;  4XN3 A;  4M3D A;  2D1V A;  1BJA A;  2CQX A;  4C9Y A;  3CMM A;  5IPA A;  2IS6 A;  2EPF A;  1W0U A;  2Z33 A;  3H5N A;  2JA8 J;  3GW2 A;  3QP5 A;  2VI6 A;  3PFI A;  1VQL I;  4B47 A;  1D8K A;  1ONV A;  4AIK A;  2JN6 A;  2IA1 A;  2ISZ A;  2R5Y B;  2GA1 A;  1YIJ I;  4I2O A;  4M6Y A;  1V5F A;  4MIM A;  3I9V 2;  4ZYA A;  1ACI A;  1LFP A;  3KP5 A;  4BE1 A;  3CDL A;  4OIN F;  1O3S A;  1D3Y A;  1U3E M;  4K2E A;  2JSC A;  1ZG1 A;  5D5X B;  2LBF B;  2ADU A;  3F23 A;  4X6A J;  2RQP A;  2HQR A;  1YS7 A;  1Z7U A;  2M9H A;  3I64 A;  1S7E A;  1FIA A;  1JUP A;  2Q1Z B;  5HS7 A;  4Y7N J;  1JKP C;  3ZQQ A;  5JR3 A;  1HCR A;  2OZU A;  4IHT A;  3FF5 A;  3I53 A;  4JP0 A;  4KMU X;  1TC3 C;  1U6G A;  4XR6 A;  3I56 I;  5JVT A;  5GPA A;  1B59 A;  5J1Y A;  1JE8 A;  2FMY A;  3PO3 J;  4CXF A;  3IHU A;  3GFI A;  5EZG A;  3AL0 B;  1BIB A;  3LA3 A;  4D7M A;  4FT8 A;  3N4M A;  4ZDL A;  3RQI A;  4HYE A;  3ZXS A;  4EJW A;  4MO7 A;  4UVC A;  5JFR A;  2GOX B;  3DTI A;  3WE2 A;  2F6C A;  5EF6 A;  3EUK L;  4E7H A;  4B4C A;  1TW3 A;  1R4N B;  3OYI A;  1ZKG A;  1OR7 C;  4F91 B;  3D5L A;  4MFE A;  4ZDO A;  1LEA A;  3DTE A;  3CMY A;  3E6C C;  1K7A A;  4ENM A;  1XG1 A;  4E70 A;  1K78 B;  2K9L A;  1LDK B;  4A3K J;  3BPX A;  2Y48 A;  3BQY A;  3QWL A;  2H8R A;  3HKZ N;  1QRY A;  1FIP A;  5E79 C;  1R5I D;  1Z3X A;  5D5W B;  4V19 K;  1IG7 A;  2VE9 A;  1MDM B;  4A3E J;  3WTV C;  3QPT A;  1ORK A;  1D5Y A;  2G9W A;  4HRI A;  2DT7 B;  3FBI B;  1U78 A;  1XDU A;  4EJU A;  1H89 C;  3IWF A;  1HXD A;  2X85 A;  5FKL A;  2QSG X;  3KEO A;  3Q5F A;  3CTA A;  5ICG A;  1QHG A;  3MD2 A;  2KP6 A;  3JW4 A;  4HOB A;  3EUH C;  4M6V A;  2KJB A;  2NNN A;  2VQL A;  1WCM J;  3S93 A;  2IGN A;  1G3S A;  3S15 J;  2F48 A;  2LFB A;  5EGO B;  4BEH A;  1T98 A;  4PJJ A;  1LPQ A;  1U2W A;  2X6O A;  5FKN A;  4E7L A;  4IHV A;  1ZRC A;  4EM0 B;  3CCV I;  2ZJR F;  4IHW A;  4ZYE A;  2YSR A;  3F8N A;  4IHX A;  1X3Z B;  4FAS D;  3MKL A;  4LK1 F;  3CJQ B;  3WG9 A;  4X0G A;  2D1H A;  3FXJ A;  4ESJ A;  1XSD A;  1XN7 A;  3IH2 A;  1YW9 A;  5LEJ A;  3ERE D;  1V4R A;  3L2V A;  3K1P A;  4ENK A;  3S3N A;  1X1P A;  3IC7 A;  2X4H A;  1WJF A;  4ABZ A;  2WC2 A;  2CWE A;  2HDW A;  4IRG A;  3H3U A;  3OOP A;  4MQV A;  3RKQ A;  4U0Y A;  4RMN A;  5TIS C;  3KEY A;  3TP3 A;  2E36 A;  2VBW A;  1CGP A;  1RKW A;  3I3L A;  3AG1 H;  4UB8 C;  4AIJ A;  2RC4 A;  3M8J A;  4GFB A;  4XID A;  2J5O A;  2UUZ A;  3VPR A;  4DZP A;  3GCM A;  3F6V A;  3QYB A;  5E1X A;  4Y13 A;  3ZQL A;  4ZTF A;  3N97 A;  1D1B A;  2ECC A;  4FET A;  5ILV A;  3OS1 A;  3MKW B;  5EYR A;  1DDN A;  4A3D J;  2FUG 2;  2LR8 A;  1RR8 C;  4AD9 A;  3FKI J;  1I39 A;  1IN4 A;  3L7W A;  1VTN C;  4UB6 C;  4HQM A;  3RKX A;  1YTY A;  1ZG3 A;  2KLO A;  3JRG A;  2HVR A;  1EKE A;  3GZN B;  2V9K A;  1RET A;  1O3Q A;  5ED4 A;  4IX7 A;  2XC7 A;  1H0M A;  4JX5 A;  1GV2 A;  2IPQ X;  5DEQ A;  1SFO J;  3ASN H;  4PCQ A;  1WJD A;  3HUG B;  2UWM A;  2KKO A;  1C0W A;  3H92 A;  4IVN A;  3CUQ B;  1WVR A;  3DEE A;  4AUX A;  4DGW B;  3H5R A;  3MEX A;  2FEZ A;  4WK8 F;  1ZHF A;  3L1P A;  3HHG A;  1DUX C;  1G3W A;  3FK7 A;  4LJZ F;  4J01 A;  2JSP A;  1SVL A;  1NG6 A;  2A69 F;  3CP2 A;  2X6Y A;  1L3L A;  2XB5 A;  1HW5 A;  1KQ9 A;  4EJT A;  1ZK8 A;  5K5Q A;  3OOU A;  2CH0 A;  2CS3 A;  3KX2 A;  1VQK I;  3S14 J;  1R1V A;  3KP4 A;  2W48 A;  1ULY A;  3W2W A;  1J5Y A;  2E7W A;  3QOD A;  3QPL A;  5C4X J;  2IS4 A;  4CO8 A;  3WGH A;  4L9J A;  3I4P A;  3GVA A;  4UV9 A;  3BPV A;  5FB2 A;  4BQN A;  1FMW A;  5KAI C;  2LG4 A;  4IO9 F;  4O3M A;  2DPD A;  1VFC A;  5F04 A;  2JA6 J;  3LSJ A;  4BS9 A;  1KU9 A;  2XGD A;  1JXS A;  4ON0 A;  3BZC A;  3HG9 A;  2O3F A;  2R7V A;  1RUO A;  5A2Q Z;  1HQC A;  2E2J J;  2KJC A;  4PFP A;  2BVM A;  2WTE A;  4V2F A;  5JHU A;  2F5C A;  3I59 A;  1RIO H;  2DW4 A;  3S17 J;  3OYK A;  2KQR A;  3LNQ A;  3TO9 A;  3HRT A;  2LRE A;  4RLF A;  4UV8 A;  3K70 D;  2VJ4 A;  2IA2 A;  2K02 A;  1W5T A;  5JVG F;  3HB9 A;  5J1U A;  2CUE A;  3GBG A;  1NK3 P;  4EVI A;  3AKZ A;  1ETW A;  4E7I A;  3TMO A;  3WTT C;  3IKT A;  1G59 A;  3HSE A;  5IP7 J;  3M7G A;  1JGS A;  3K4M A;  1MH3 A;  2RV8 A;  4EM2 A;  3OYD A;  3Q0U A;  3LOC A;  1JT6 A;  2DMU A;  3CO6 C;  2BBY A;  4XLP F;  2XB0 X;  1ETK A;  2ZXJ A;  1F1Z A;  3RZD J;  5B66 C;  3OWT A;  3VSK A;  5IY5 H;  5E3M A;  3CCL I;  3HSR A;  2QEN A;  2FA5 A;  1E17 A;  1FTT A;  1EH8 A;  5D5U B;  2V79 A;  3CUQ A;  1TT5 B;  2LLK A;  2K9N A;  2FRH A;  1E0E A;  3D0S A;  3BG5 A;  3JAM K;  4QPO A;  3HRS A;  2CV1 A;  3CJN A;  2FOK A;  4HAM A;  5LFA A;  1P4W A;  5M5X J;  1UHM A;  2V26 A;  2ID6 A;  5KK1 A;  1MJB A;  3E97 A;  2E1M C;  3H5A A;  3CUQ C;  3IH4 A;  1Y39 A;  5IP6 A;  3F8M A;  2HYG D;  4EGY A;  4A3G J;  2GIV A;  2EA4 A;  4L5E A;  1BA5 A;  2BY1 A;  4B8X A;  1W7P D;  5IOZ A;  3CCR I;  2ME6 A;  4BJT A;  1WSU A;  4PJN A;  3ABL H;  1RZ4 A;  1V5E A;  3P9C A;  1YI2 I;  3F9K A;  1E3H A;  2W7N A;  2KPM A;  2VT3 A;  2MD5 A;  1WRJ A;  2HQN A;  1B4A A;  1YHQ I;  1D5V A;  1BIA A;  3L00 A;  1T56 A;  5KAF C;  1G3T A;  4UXN A;  5B3S H;  3S3O A;  3MZH A;  2F5E A;  1Y1V J;  3HDD A;  2Z99 A;  1K4T A;  3I71 A;  1WH7 A;  2ESN A;  1Y0U A;  3D1N I;  1APL C;  2XAJ A;  5E8I A;  4GXO A;  4MGR A;  1VQ4 I;  5ICC A;  1MNM C;  3WOD F;  2Y9Y A;  3A4C A;  4KT6 A;  1B9N A;  2HZT A;  2R7U A;  1V5G A;  5D6E A;  2IXS A;  5FJ8 J;  2AQE A;  4A3F J;  5J40 A;  2K9S A;  3DKY A;  5FFZ A;  3TP0 A;  2ZME C;  4EJO A;  2EJR A;  3W6V A;  3FKJ A;  3BJ6 A;  4XL9 A;  2DQL A;  1RNL A;  1YW8 A;  1FX7 A;  5FGM A;  5HLT A;  2DQR A;  3TOA A;  3OR1 C;  5F6F A;  2X9D A;  3E0J B;  3ZMZ A;  4BEH B;  1BW5 A;  1K83 J;  2BZT A;  1FY7 A;  1MW7 A;  5FD6 A;  1XMK A;  4A6E A;  5JI6 A;  1Y1W J;  3OMY A;  2XHK A;  4AYB A;  1MD0 A;  3FIW A;  1U5T C;  5LLQ A;  1DP3 A;  3CCM I;  3IL2 A;  2XSJ C;  2OU2 A;  3PJR A;  1L0O C;  2CUF A;  1MNE A;  2WBM A;  2N8G A;  2OC6 A;  1IXC A;  3E6D A;  2M34 A;  3IRQ A;  1F5T A;  4YEJ A;  4DYR A;  1TWC J;  1DQU A;  4OOI A;  2CQK A;  4U7B A;  2HQA A;  4E7Z A;  2HQ5 A;  1XX5 A;  4S0H B;  4AC0 A;  3BOQ A;  1WJB A;  1YIT I;  1IUF A;  2DOD A;  3KYD B;  4I76 A;  1U8R A;  1T95 A;  2NXN B;  3L2C A;  4PK4 A;  5JLX A;  2PMU A;  1FJL A;  2B0L A;  3RPQ A;  3JTG A;  3QQA A;  1ZN2 A;  2O8X A;  3HPH A;  1HDP A;  1FWZ A;  3SYT A;  4N4N B;  6PAX A;  2DMP A;  3FM5 A;  4LFU A;  4RB2 C;  1BL0 A;  3EUA A;  2WAF A;  2KIS A;  3W3C A;  2LP0 A;  4LB5 A;  4E6K G;  2IAI A;  2KIF A;  4IOC F;  4IQJ A;  2WAQ N;  2CUJ A;  4CYC B;  2JT1 A;  3AG3 H;  4FX4 A;  1UG0 A;  4UUV A;  2GZW A;  1BC8 C;  1YX5 A;  4LIU A;  5EEG A;  4A3I J;  4MQ9 F;  5LRR A;  3U2R A;  3GTG J;  4KNY A;  2K86 A;  1FOW A;  1KZH A;  5AIQ A;  1FP2 A;  5IYB J;  3RIR A;  1JTY A;  1DPU A;  1ZLJ A;  2W4S A;  4BAY A;  1SC7 A;  1AHD P;  1PVE A;  2H6C A;  5H6R A;  4BAC A;  4WWC A;  2WY7 Q;  1W7P A;  2XVC A;  3AL0 C;  2LOO A;  5CVR A;  4G7O F;  4XQF A;  3H0D A;  3SQN A;  2OTJ I;  1GV5 A;  4CGZ A;  2L0K A;  3S16 J;  4OAY A;  2E71 A;  3IV5 A;  2EFN A;  1D1A A;  1HKT A;  4II2 A;  1AKH A;  2NOG A;  3EYI A;  3GTO J;  1MKM A;  3LA7 A;  4LLG F;  3HSF A;  1NH3 A;  2X51 A;  3FMQ A;  3JRC A;  2P81 A;  1U0J A;  4BU2 A;  3FXK A;  2L7M P;  2EB7 A;  1MJA A;  1Q1H A;  2PBI A;  3LSM A;  1UJ8 A;  3SZP A;  5J4Y A;  5LGU A;  2WWY A;  4RDU A;  2AS5 F;  2EV5 A;  2L9R A;  4M3F A;  2EWN A;  3BR3 A;  5BNG A;  2G7H A;  3X2Q H;  1WZ2 A;  3RCO A;  4FE4 A;  1OPC A;  2P5V A;  5KHD A;  1YJN I;  2VAS A;  4YRV A;  2Z16 A;  3HKZ A;  2DXI A;  2VQC A;  3W2V A;  2K9M A;  2ZBK A;  1OCZ H;  1R58 A;  3ZQC A;  4HA8 A;  4LOC A;  3JRH A;  4BDY A;  2K4J A;  4Y33 A;  4BKX A;  1IV8 A;  3Q9S A;  5CJ9 A;  2STW A;  5AIP A;  3HGG A;  4QWQ A;  4U88 A;  5GPC A;  2LTP A;  5DUK A;  2W24 A;  2DFH A;  4ZZD A;  3LSR A;  2EV6 A;  1DP7 P;  3WTZ A;  3VDX A;  1ETO A;  1JTX A;  2LD5 A;  1FOY A;  1IZ1 A;  1OCO H;  4D5C A;  2OQG A;  3SHF A;  4RM2 A;  3J80 K;  3GWZ A;  1LKX A;  4FQG A;  4HBL A;  1F4K A;  4HF1 A;  4IOA F;  2VC1 A;  3AAF A;  2WAQ A;  4UVA A;  1HW2 A;  4FX0 A;  2A6H F;  4G6Q A;  2XRL A;  4B48 A;  3COA C;  2P5L C;  1IUY A;  2ZME B;  3F21 A;  2EFP A;  4OIO F;  1BBY A;  3BJO A;  2I10 A;  2ZME A;  4DNC A;  4WXC A;  2XF5 A;  3A02 A;  2QF7 A;  2RKH A;  4BQQ A;  3HM5 A;  3KEQ A;  2QKL B;  2WV0 A;  4XSZ F;  3K2A A;  2LNB A;  2IW5 A;  4RM3 A;  1YRN B;  4C3I J;  4AVZ A;  4M74 A;  4BBS J;  1FMV A;  2K9Q A;  1A6Q A;  5GAD J;  1V54 H;  4S05 A;  3QRF F;  4LIT A;  3VYS B;  1WPK A;  3UNG C;  5H6Q A;  3GTM J;  2H8W A;  2L02 A;  4WXH A;  2HPI A;  3DP7 A;  2LF7 A;  2QKM B;  1TQM A;  2M0M A;  2R7S A;  3I55 I;  1W5C C;  3U9G A;  1Z3Y A;  2R7F A;  4XSX F;  2DOF A;  2COB A;  2G7U A;  4RGU A;  1R36 A;  4ZYD A;  2KRH A;  2IJL A;  1ERD A;  4XKB A;  2OZ6 A;  3F8B A;  1BI1 A;  3JRI A;  4GDF A;  2ZCW A;  2CQN A;  4LLL A;  1CF7 B;  4A6D A;  5HS8 A;  1I5Z A;  3EUH A;  4IZZ A;  3OYL A;  3QOE A;  1TWA J;  2RGV A;  4DOZ A;  1IN8 A;  3R0A A;  2IP2 A;  3B6A A;  1U5T A;  4IRI A;  2F5D A;  3LSI A;  4C2T A;  2GLO A;  1A5J A;  1MMS A;  4HPQ A;  2D5V A;  1JKQ C;  2IGO A;  2GM4 A;  3LQR A;  4Q47 A;  2YS9 A;  2E34 A;  3ZCO A;  4F3Q A;  1W7P B;  2HVQ A;  3WTU C;  1ENH A;  2R7O A;  5HDK A;  2MD0 A;  3RJP A;  4F92 B;  5F1R A;  3PO2 J;  1USS A;  4N9I A;  2OTL I;  5FRO A;  4DYQ A;  4RB1 A;  3HL2 A;  2BY2 A;  2VJI A;  3FXQ A;  3CCQ I;  2E7X A;  2XGX A;  3WE3 A;  2E1N A;  2R5Z B;  4H0E A;  5FO5 A;  3FXL A;  1Y56 A;  3O8H A;  1PDN C;  2BW3 A;  2LC2 A;  5CVI A;  4B3A A;  2A5W A;  4L9T A;  3ZMT A;  4A69 C;  4NBQ A;  5KNL A;  3OL3 A;  3VYT B;  3I5U A;  4AU7 A;  4F52 A;  3E7L A;  3DCF A;  4I7H A;  5E8G A;  1VQ8 I;  2DDB A;  1ODD A;  2NOJ B;  4HG2 A;  5K5R A;  2R7Z J;  2PJR B;  1JHH A;  3MWM A;  4HF0 A;  4P55 A;  3SEZ A;  3K4B A;  4I0B A;  3KLN A;  4ZDP A;  4YG2 F;  4HNU A;  1HC8 A;  3MKY B;  1UZC A;  2FE3 A;  3ULQ B;  2E2I J;  4NC6 A;  3HOZ J;  1RUN A;  4UY8 I;  2BE5 F;  4NC7 A;  4RGS A;  4LG3 A;  4NQW B;  2A61 A;  2DDA A;  4BXF A;  1JKR C;  4XOP A;  1ON1 A;  2L4M A;  2QQ9 A;  3B02 A;  1T0F A;  4CDG A;  3OYB A;  2DFI A;  2IGK A;  4G7Z F;  4I6Z A;  1XPX A;  3LA2 A;  3G2B A;  4FHT A;  1ZGA A;  4AVP A;  2IRF G;  2GIZ A;  5FLM J;  1K79 A;  1R71 A;  1XCV A;  2VN2 A;  3F72 A;  5FFX A;  5D5V B;  3J81 Z;  3OYC A;  3ASO H;  1R1T A;  4NNJ A;  2MA3 A;  3VSL A;  5L3E A;  4QTR A;  1GLN A;  3KET A;  2FNP A;  1XDS A;  2XRN A;  5BOX A;  2DAO A;  5TRD A;  2K85 A;  3BR0 A;  3ZQG A;  3KYL A;  1SVO A;  4XBF A;  1LVA A;  1B8I A;  1W0T A;  4OIQ F;  4UNO A;  5CVV A;  1IXR C;  4Q48 A;  1RC9 A;  3DPT A;  1RI7 A;  3ZN1 A;  2DCE A;  2DFF A;  2DA7 A;  5J47 A;  3BR6 A;  1QZZ A;  4GYI A;  1MBK A;  3MAJ A;  5J3L A;  4ENN A;  1YRN A;  2HDD A;  3L2U A;  3Q0W A;  1V3F A;  1I1S A;  1VQN I;  2JA7 J;  3K7A J;  2QVO A;  2B63 J;  1WH5 A;  1Y8Q B;  4XK4 A;  3GTK J;  5DTD A;  3I4M J;  2EZI A;  3MMY B;  2VC0 A;  2UV1 A;  1A35 A;  2QWW A;  1YW7 A;  4JBA A;  2FD5 A;  4D0P A;  2COM A;  3DV8 A;  3O2P E;  3E3V A;  2O0Y A;  1AOY A;  2JWT A;  5GAH J;  4M6X A;  3KIO A;  4ZZL A;  3G3Z A;  1T38 A;  1FOX A;  2ZKZ A;  5CQG A;  2XPU A;  2O03 A;  3A01 B;  3MZY A;  4OU0 A;  3W2A A;  3F0C A;  1U9O A;  4RAF A;  3DBL B;  3DBH B;  3NWS A;  4BJ6 C;  4HST A;  3WTX C;  3E5Q A;  2HEO A;  1HST A;  3FXR A;  2H27 A;  1ZRF A;  5DD8 A;  3J7Z I;  2QSF X;  1SFX A;  1RRJ A;  4IF4 A;  2VB6 A;  2IT0 A;  2FNA A;  4ZYH A;  2PJP A;  2VXD A;  1ETV A;  1O4X A;  2V1U A;  3BJA A;  2BVL A;  2L7F P;  2F4O B;  1IF1 A;  3ZQF A;  3BWG A;  3OSF A;  3ERM A;  2OJE D;  3GEZ A;  2V9V A;  2Y0S N;  4KIT B;  3J7A O;  3F22 A;  1TNT A;  3TQN A;  2LK2 A;  3IP4 B;  1FYK A;  3I58 A;  3TBI A;  3LAP A;  1R00 A;  5LHG A;  3FK6 A;  3VYU B;  1P6R A;  4BE2 A;  4U87 A;  3OS0 A;  3ZMS A;  1IV6 A;  4YFK F;  3I4N J;  1BI3 A;  1HLV A;  1Z7L A;  2L9S A;  4I02 A;  4D7N A;  2CW8 A;  4BNC A;  2P6T A;  2JVG A;  2M3A A;  2MC3 A;  2OAZ A;  5IT9 Z;  4Y3O A;  3LST A;  1OCP A;  4F7Z A;  3A2K A;  3BZK A;  4AYB N;  2XAF A;  4NB5 A;  2LY1 A;  3IUO A;  2AXT C;  4A12 A;  4DYC A;  4C2M J;  3LMM A;  3HIF A;  1DGW Y;  2ZJ2 A;  3CCU I;  1GDT A;  1MMA A;  1J9I A;  5HVQ C;  4L9N A;  1MBH A;  4BDZ A;  3JCU C;  4RLQ A;  1YX3 A;  2CQQ A;  3LL7 A;  3QP6 A;  4LLN A;  1TTY A;  4HX7 A;  2GXG A;  3PIP F;  2VON A;  3RPU D;  5HNF A;  4UHT A;  2FBH A;  2Y30 A;  5GTI C;  3K6G A;  4KIB A;  4KN7 X;  2XKO A;  1T33 A;  4HLY A;  3DLA A;  3Q9V A;  2QUF A;  4JX4 A;  1JT0 A;  3V7R A;  3MCZ A;  3NEU A;  4HSR A;  4CZZ A;  1S3J A;  3BG7 A;  3HOW J;  2MLK A;  1JJ6 C;  2DYR H;  2JK3 A;  5BS6 A;  3G1L A;  2L9V A;  4NQW A;  2EZL A;  4HDU A;  4P96 A;  2Y0S A;  4WF2 A;  3ROU A;  2M87 A;  2HS5 A;  2AO9 A;  3LWF A;  3C3W A;  3UKG A;  3FXU A;  1UG2 A;  3WTW C;  4IJA A;  1MBG A;  4XKW A;  5FRN A;  4L0Y B;  4BHP A;  1PJR A;  2PJR A;  4IEJ A;  3PQJ A;  1K78 A;  1ETX A;  2Z9O A;  1KU3 A;  5E1Z B;  4E7S A;  1IAW A;  2ZNZ A;  2QZ8 A;  1MBE A;  3MFK A;  3RYR A;  1XB4 A;  1AU7 A;  4CYD A;  4Q4Z F;  3ABM H;  2VJ5 A;  3ISP A;  5FD5 A;  4D1Q A;  1TBX A;  2W25 A;  3C2B A;  3C18 A;  1KQ8 A;  2F5V A;  4W97 A;  3ZRG A;  3V8K A;  2KZG A;  3C2G A;  1BJZ A;  2V6C A;  5L3B A;  1XGM A;  1XS9 A;  2DTR A;  3CC7 I;  3MVP A;  5DYM A;  4CA0 A;  4EM1 A;  3BR5 A;  3DFG A;  1LNW A;  5C3E J;  2VOO A;  4NC8 A;  4EGZ A;  1MND A;  2LY2 A;  2Y69 H;  4OMY A;  2XIG A;  2IA0 A;  5GP9 A;  4PDK A;  1R49 A;  2JQ7 A;  3BZ6 A;  2M0C A;  2FQ4 A;  5FLV A;  3PNT A;  4M9S A;  2XDV A;  2DI3 A;  1ITY A;  1TWF J;  4BL0 B;  3U1K A;  1ZTR A;  4G6D A;  3H9G A;  3V8L A;  4MEX F;  1BI2 A;  1Z9C A;  3J7Y J;  1B1B A;  1SAU A;  2HYJ A;  4XN0 A;  3TO7 A;  5GTH C;  4L9V A;  2ME0 A;  5A2Q K;  4PJM A;  2P5K A;  1TL8 A;  2HFH A;  3VOE A;  1FBS A;  1O57 A;  2O8K A;  2ELJ A;  3PNV A;  2BY0 A;  4XON A;  4KN4 X;  4XKV A;  2OBP A;  1FBU A;  2M4K A;  3DKW A;  3QPH A;  1IJW C;  1HDD C;  3KLO A;  1I1G A;  1QVT A;  3OIQ A;  4ETS A;  2ACJ A;  1IC8 A;  3JRA A;  2DT5 A;  1N75 A;  1Q1V A;  2XAQ A;  2M7A A;  5H20 A;  5EGO A;  1LQ1 A;  2J5P A;  3F8F A;  3HRM A;  2RVC A;  3DPU A;  2EZH A;  2OQR A;  4HEA 2;  4PFO A;  3ZPL A;  2ZFU A;  1P4A A;  2JRM A;  1OKR A;  5IOY A;  1E3O C;  3CC4 I;  1MBJ A;  1B6A A;  2HR3 A;  4GGG A;  3S3M A;  1YFH A;  1K6Y A;  2FXA A;  1PP8 F;  2WAD A;  2MG4 A;  2E35 A;  1X4O A;  3RYP A;  5HDN A;  1KGS A;  1XC5 A;  1GUU A;  2LY9 A;  1VQO I;  3U1D A;  2HOA A;  3PSF A;  2MGQ A;  3WTY C;  3KP7 A;  1IN6 A;  4M72 A;  3TW6 A;  3HOS A;  3DF8 A;  1MDM A;  3BTJ A;  1FNN A;  3RTR A;  1OQY A;  2DBB A;  1ZGJ A;  3CCY A;  2L01 A;  4BE0 A;  2DN0 A;  4BQA A;  2K27 A;  2CQ7 A;  3HTU A;  3PUB A;  2GQQ A;  3OIO A;  1T2K A;  2K7L A;  4IXA A;  5B1B H;  4ASN A;  4A3L J;  2CYY A;  3G1M A;  1WJC A;  1D0Z A;  2DO7 A;  4V2G A;  5IT3 A;  1TT0 A;  3FDY A;  4HV5 A;  1J75 A;  2MYS A;  1I27 A;  1VQM I;  3PNY A;  4ESF A;  4XRS G;  2HYF A;  4RAY A;  1XSV A;  3ZMD A;  2CO5 A;  2GBY A;  4A0X A;  1Y6I A;  2OV7 A;  1K61 A;  3MZ8 A;  2MAB A;  3JRF A;  2HOT A;  1P92 A;  3M9A A;  1YIO A;  4BQO A;  3JTH A;  4BUP A;  2OA4 A;  2AXL A;  4B44 A;  4CH7 A;  1UHS A;  3R61 A;  4G6T B;  5B1A H;  1QBJ A;  1MMN A;  3E1S A;  2E5N A;  1WI9 A;  3ZGK A;  3ABU A;  3IKV A;  3GTJ J;  3T5X A;  1U9N A;  1S5L C;  4F55 A;  4FE7 A;  1RKT A;  2X48 A;  2R4G A;  3CZ6 A;  3TDU C;  5EG0 B;  1R1U A;  2CV0 A;  2NVU B;  3R6S A;  2VQG A;  2O61 A;  2DK5 A;  4CUG A;  2X0L A;  2VPR A;  2A6E F;  2RRE A;  5GAE J;  3RDI A;  4M73 A;  2XPV A;  3M8E A;  2LDU A;  5KVR A;  3OYG A;  2CG4 A;  2HDC A;  1FSH A;  1O3R A;  3H9J A;  1PUF A;  3BTC A;  3LSP A;  1TLH B;  1KON A;  1MGT A;  2M30 A;  1S7A A;  3OIP A;  2KHM A;  3OSG A;  3IH3 A;  2QCO A;  1GT0 C;  3K4J A;  3HUG A;  1Z6R A;  1XMX A;  3K4N A;  4HV6 A;  4RGX A;  3FWE A;  2X1D A;  3K4L A;  1WQ2 A;  1GXP A;  3K1N A;  1MZB A;  2EIM H;  3K2Z A;  3TGN A;  4AID A;  2JPC A;  5HLG A;  2EFW A;  1ZGW A;  1F36 A;  3TW7 A;  1KYZ A;  4IHY A;  3LFK A;  2BYV E;  5E20 A;  4DBQ A;  1ZRD A;  1SD6 A;  2A5Y B;  3GZ5 A;  2DMQ A;  1W5S A;  4D9J A;  3T8R A;  3J80 Z;  2RNG A;  2R5Z A;  2EK5 A;  1D1C A;  3VOD A;  4YII A;  1YYV A;  3HPG A;  4G12 A;  1OYY A;  4P5O A;  4XOR A;  2XAG A;  3G1O A;  4AIH A;  2KZV A;  4O6J A;  4UVB A;  1S6L A;  3E5X A;  2LRD A;  4II3 A;  2HGC A;  1QNT A;  3N05 A;  2LF8 A;  2MH9 A;  2Y31 A;  5CQE A;  2DA1 A;  2ELH A;  3FMS A;  5HOO A;  1X4P A;  5L3D A;  2QA4 I;  3FZV A;  1Z77 A;  4RGR A;  1E3P A;  4KIC A;  5K7Z A;  3SZG A;  2OCE A;  1BN5 A;  3HHH A;  3DTK A;  1U5T B;  4ITV A;  2MFZ A;  2L5Q A;  5IYC J;  1XMA A;  1SFU A;  2H1K A;  3PQK A;  1SD7 A;  2H6B A;  1DPR A;  1P4X A;  5FLX Z;  1GHC A;  1PYV A;  1RES A;  1WJE A;  4UUT A;  1BM9 A;  2Y2Z A;  5K1Y A;  1XGO A;  3BCA A;  1YO5 C;  1QU3 A;  3R60 A;  4JYK A;  1FPQ A;  2LKS A;  3BTI A;  3ZQH A;  1ZG5 A;  1K4S A;  3CJR B;  3TO6 A;  2YX4 A;  2OCC H;  2P7C B;  5F0H A;  2FU4 A;  1S9H A;  4PUS A;  1S7O A;  4BGD A;  1OYW A;  4PSW A;  2VKV A;  4LG0 A;  5ICF A;  3A0H C;  5BMZ A;  1ZR4 A;  3F6O A;  2E1C A;  4A3C J;  2G0E A;  4Y15 A;  1X19 A;  5ILU A;  3CDI A;  2CW0 F;  1BR2 A;  1N78 A;  1MMG A;  3W6J B;  2CU7 A;  2EIN H;  2KT0 A;  4GO1 A;  5J8C A;  1JUM A;  4ZTJ A;  2CSO A;  2OUM A;  1WWX A;  1ZLK A;  3WU1 B;  4G9Y A;  5M3M J;  5IP9 J;  5DS9 A;  3LAJ A;  3HOU J;  1NHA A;  1LE8 A;  3ABK H;  3JSP A;  3HXL A;  3R0J A;  5F1J A;  4NHJ A;  4HLX A;  4I09 A;  3GLL A;  2HZD A;  1QPM A;  5LBQ A;  2YU9 J;  2M7B A;  4N4O B;  2E5Z A;  2BGC A;  4E7J A;  1YQA A;  1X1B A;  4RB0 A;  2R7T A;  2VKH A;  4C30 A;  1J7K A;  4XNF A;  1ZQ3 P;  3ML6 A;  2DMN A;  4R1H A;  1UHW A;  3AG4 H;  2IEK A;  3MN2 A;  2P0W A;  5FKM A;  4ZYG A;  3GYH X;  3BC8 A;  2RNJ A;  1IDZ A;  3KP3 A;  5CVU A;  4MNU A;  3KE2 A;  2PMZ N;  2EFQ A;  4NUB A;  2R0Q C;  3Q3S A;  2W82 A;  2HOE A;  2Z3Y A;  5DUI A;  2B7E A;  2R7D A;  1IRZ A;  1KU7 A;  3K69 A;  2DK8 A;  5GAG J;  4QIW N;  2LSO A;  2EBI A;  4CCN A;  1X1A A;  3PM1 A;  4EJV A;  1G6N A;  2HXI A;  1LDJ A;  3KZY A;  4CCJ A;  1LFU P;  4UUS B;  2VBX A;  2Q2E B;  3ESW B;  1B72 B;  1AKH B;  1B72 A;  5FKO A;  2Q2E A;  3L9F A;  1ZR2 A;  3DXJ F;  1OMI A;  2QQ8 A;  3CC2 I;  4KFC A;  2C6Y A;  3KZZ A;  4IRH A;  4LIV A;  2HXO A;  1CF7 A;  2V9P A;  1FP1 D;  2ZSI B;  2HVS A;  1YLF A;  3WTS C;  1JI8 A;  1GVJ A;  3PSI A;  1XCB A;  1MMD A;  1FTZ A;  2DFE A;  3QOP A;  4F93 B;  2ISY A;  2HTJ A;  1MSE C;  2GXA A;  5DM7 F;  3M4O J;  1TZL A;  3I59 B;  3RQ4 A;  4ESB A;  1Y8R B;  2IS1 A;  4JQF A;  2RDP A;  2HTS A;  2HOS A;  2LYC A;  1QZE A;  2VL8 A;  1KQ0 A;  4MEY F;  2VOD A;  2P6S A;  1GXQ A;  1W4M A;  2ELK A;  5D8L B;  5L3F A;  1CQT A;  4PGG A;  5DV5 A;  3VFZ A;  2ESH A;  4TV7 A;  1YJ9 I;  1JKO C;  1R23 A;  3K1M A;  1LJ9 A;  4XLF A;  5CKT A;  4O5V A;  2L54 A;  1HA8 A;  3SFI A;  2DPU A;  1Z0X A;  3L2W A;  3HEF A;  3OYM A;  2KRF A;  2BXZ A;  4PSX A;  5JHF A;  1ZEL A;  3PFY A;  4R8H A;  3QPS A;  3DWL E;  4I98 B;  3GFM A;  1I50 J;  3JAM Z;  2A6T A;  3FXM A;  1LE8 B;  2D45 A;  1W36 C;  2UZK A;  2FBI A;  2ZJP F;  4WXD A;  5LGT A;  1JGG A;  3ZN0 A;  1WGX A;  2KDZ A;  9ANT A;  5E3O A;  1SAN A;  5K7F A;  2HI3 A;  3KPH A;  2GA2 A;  3T0Y A;  2IBD A;  1VF9 A;  3HRU A;  2R7W A;  3VWB A;  2EIL H;  3DEU A;  4XKC A;  2PI0 A;  2W85 A;  2CV2 A;  1FBQ A;  1VND A;  3CLO A;  4YFX F;  5LHI A;  2ZXH A;  2NVY J;  1W1W E;  4EV0 A;  4KIF A;  1ZRE A;  5M5W J;  5IYD J;  5AON A;  1FEX A;  4CHU A;  2Z2S B;  3DU6 A;  2MC4 A;  3K10 A;  2A3S A;  1IRG A;  2EQR A;  3EDP A;  3NRV A;  4YFN F;  1EH6 A;  2XAS A;  1YE9 A;  1SD4 A;  3QAH A;  3FHN A;  4Y4R A;  1ETY A;  5DD4 A;  3ZQI A;  2ZFW A;  1JUS A;  3H1C A;  5FRM A;  2LMD A;  3SXY A;  2H09 A;  1PUE E;  2A07 F;  3HJE A;  1YOV B;  3CQZ J;  2L2O A;  2ECB A;  2NS7 A;  2YR2 A;  1M1E B;  3GZ6 A;  3FX3 A;  2Y9Z A;  2EH3 A;  4B43 A;  2VE8 A;  3CF2 A;  1UST A;  3BP8 A;  4QSH A;  2E19 A;  4CIC A;  1FC3 A;  2BOL A;  1X58 A;  1Z91 A;  2XF7 A;  2XGE A;  4I99 C;  4M3G A;  2OPT A;  4Y52 J;  2Q0O A;  3VYR B;  3OYA A;  1D0Y A;  1POG A;  3ECH A;  3K0L A;  1H9G A;  1EJ9 A;  2FJ1 A;  1Z05 A;  2E1M B;  3BLY A;  3S32 A;  1X3W B;  1DU0 A;  3SJM A;  5L3G A;  4QPQ A;  2R92 J;  2MLG A;  2FML A;  3CO7 C;  1ON2 A;  2HKX A;  2XF6 A;  3BG6 A;  1OCR H;  3M07 A;  4L0Z B;  3KP6 A;  2W1O A;  1MJ9 A;  2B9S A;  4YEL A;  1VQP I;  3CCS I;  3HC7 A;  3GME A;  2VBZ A;  1P2F A;  1FT9 A;  5D4R A;  5KCM A;  3PL8 A;  3WU2 C;  3O8G A;  4EMS A;  3S8P A;  2ZNY A;  4XLE A;  3HGY A;  4WCG A;  2O5R A;  2OF7 A;  3IWZ A;  5K5O A;  3OY9 A;  5ILS A;  3HTS B;  3T1B A;  2BV6 A;  2CUZ A;  2CFO A;  1QA6 A;  3WHC A;  4P1W A;  3WGI A;  3MQ0 A;  2CJJ A;  5EEA A;  3S2H J;  1A6I A;  3L09 A;  4HNV A;  4KMF A;  4NDL A;  3NAU A;  2X6X A;  1UAA A;  4DIQ A;  1O3T A;  2P8T A;  2R93 J;  1J59 A;  2X1C A;  3GO5 A;  3BQZ A;  4FCY A;  2VBY A;  4GYG A;  4B1R A;  1MIJ A;  5EG0 A;  4ENJ A;  1I6X A;  4DZJ A;  1N25 A;  2DU9 A;  3J7A Y;  2WB1 N;  4HF2 A;  3Q0V A;  3NWT A;  1F43 A;  4BYY A;  2AQF A;  3SDB A;  1IW7 F;  3R4K A;  4OWR B;  2JA5 J;  1I3Q J;  1RPW A;  4OAZ A;  5B5E C;  3C1D A;  1NG7 A;  4L18 B;  4A3B J;  2VKE A;  1VQ7 I;  2DYS H;  1X1C A;  3CES A;  2NVQ J;  2E60 A;  2VUM J;  3C7J A;  3TDZ C;  2JPB A;  4HW0 A;  4AWX B;  1N77 A;  4A5N A;  2M2E A;  5HLH A;  1AWC A;  4KJZ A;  4ZC3 A;  3G4S I;  3BG9 A;  2DA2 A;  1YJW I;  3AG2 H;  1UB9 A;  2JJ7 A;  2Y0M A;  2O7O A;  3GTQ J;  4A5M A;  1FYL A;  1EH7 A;  3EYY A;  4Y17 A;  1IDY A;  1SEU A;  2XUB A;  3ZMU A;  5ICE A;  1WKM A;  1IXS B;  2CW7 A;  4C3J J;  2Z1D A;  4KDP A;  5DDG A;  1J0R A;  2MSY A;  4IPA A;  1PP7 U;  3O3K A;  4AM3 A;  2O6G E;  1SFK A;  1QHH D;  2PLY A;  3HOT A;  2K3F A;  3H36 A;  2K40 A;  2NS0 A;  2R5Y A;  2HWV A;  4M3B A;  4J00 A;  1QQI A;  3RZO J;  1QZY A;  2DJN A;  2TCT A;  3OYE A;  4M9Z A;  1EV7 A;  1BI0 A;  1OIS A;  3KFW X;  2WV1 A;  3T8T A;  1REP C;  3G6E I;  1P9Q C;  2PN6 A;  3WGG A;  4A2U A;  1IGN A;  2JA2 A;  1XD7 A;  4JK1 X; 
#chains in the Genus database with same CATH homology
 2M9H A;  2HOT A;  1S7E A;  1FIA A;  1JUP A;  4Y7N J;  1HCR A;  1JKP C;  4FIS A;  3JR9 A;  1UHS A;  2I10 A;  2DA3 A;  4JP0 A;  1TC3 C;  5GPA A;  5J1Y A;  3A02 A;  2QF7 A;  3HM5 A;  4A3M J;  3PO3 J;  3S1N J;  3GTJ J;  1U9N A;  3K2A A;  5EZG A;  4FE7 A;  1RKT A;  2X48 A;  1YRN B;  4D7M A;  1H8A C;  4C3I J;  1JJ8 C;  4BBS J;  5EG0 B;  3RQI A;  2K9Q A;  3A01 A;  1QVU A;  4MO7 A;  2VPR A;  1WPK A;  5EF6 A;  2XPV A;  3GTM J;  3SDG A;  3BR1 A;  4B4C A;  1ZKG A;  4D5F A;  4MFE A;  1PUF A;  3BTC A;  3LSP A;  3CMY A;  3OSG A;  3IH3 A;  1XG1 A;  2QCO A;  4BY7 J;  1GT0 C;  4A3K J;  2COB A;  1LFB A;  3BQY A;  1VI0 A;  2H8R A;  3HKZ N;  1QRY A;  1FIP A;  1IG7 A;  1ZGW A;  4BY1 J;  3JRI A;  1F36 A;  3TW7 A;  4A3E J;  1OJL A;  4IHY A;  1B8I B;  2DMQ A;  4W1U A;  2R5Z A;  1ORK A;  1D5Y A;  1TWA J;  4BXX J;  3B6A A;  1U78 A;  3JRB A;  4G12 A;  1H89 C;  2GLO A;  5FKL A;  1A5J A;  2D5V A;  3G1O A;  1JKQ C;  5M3F J;  2GM4 A;  2YUS A;  2YS9 A;  4M6V A;  1WCM J;  1ENH A;  3S15 J;  2LFB A;  1WI3 A;  2Y31 A;  3PO2 J;  2DA1 A;  5EGO B;  1Z77 A;  5K7Z A;  2X6O A;  5FKN A;  4IHV A;  5EDN A;  4DYQ A;  3JRD A;  4IHW A;  5IYC J;  1HF0 A;  3BT9 A;  2R5Z B;  4IHX A;  2H1K A;  3MKL A;  3O8H A;  4B3A A;  3H3V K;  2FX0 A;  4XIC A;  3IH2 A;  4DW6 A;  4A69 C;  1RES A;  4UUT A;  2Y2Z A;  3E7L A;  4J19 A;  3DCF A;  4ABZ A;  4JYK A;  3BTI A;  3RKQ A;  3ZQH A;  2R7Z J;  3S1M J;  3TP3 A;  3HOV J;  1MH4 A;  3FIS A;  1RKW A;  5F0H A;  4GFB A;  1NTC A;  4XID A;  3VPR A;  4DZP A;  3GTP J;  3ZQL A;  2VKV A;  2E2I J;  4A3C J;  1ZR4 A;  3HOZ J;  2G0E A;  2ECC A;  5EYR A;  4A3D J;  2XSD C;  2LR8 A;  2CU7 A;  3FKI J;  2KT0 A;  1JKR C;  1JUM A;  3JRG A;  5M3M J;  1RET A;  1QPI A;  5F08 A;  5IP9 J;  5DS9 A;  5M5Y J;  4I6Z A;  3HOU J;  1LE8 A;  3S1R J;  5F1J A;  5J1R A;  2LVS A;  1GV2 A;  4JX5 A;  5FLM J;  4FTH A;  1SFO J;  2YU9 J;  2XPW A;  1H88 C;  4QTR A;  4AUX A;  3BR0 A;  3ZQG A;  4UUS A;  1GVD A;  3L1P A;  1ZQ3 P;  2DMN A;  3FK7 A;  1B8I A;  1W0T A;  4C3H J;  2IEK A;  5F0C A;  2EZK A;  2DA7 A;  2XB5 A;  3BR6 A;  2NVX J;  1ZK8 A;  3OOU A;  1MBK A;  3MN2 A;  2L7Z A;  5J3L A;  5FKM A;  1YRN A;  3S14 J;  2HDD A;  4A3J J;  3Q0W A;  1IDZ A;  2W48 A;  2JA7 J;  3K7A J;  5C4X J;  3QPL A;  2PMZ N;  2B63 J;  1WH5 A;  3I4M J;  4XK4 A;  2R0Q C;  2AHQ A;  3Q3S A;  5DTD A;  3GTK J;  2EZI A;  1IRZ A;  3GTL J;  2FD5 A;  1MBF A;  3NAR A;  4QIW N;  1VFC A;  2EBI A;  5F04 A;  2E2H J;  2JA6 J;  3PM1 A;  3LSJ A;  2XGD A;  2JWT A;  2HXI A;  3HBL A;  3A01 B;  2XPU A;  1LFU P;  3F0C A;  4UUS B;  1U9O A;  5E3L A;  2E2J J;  1B72 B;  1AKH B;  1B72 A;  5FKO A;  2ID3 A;  1ZR2 A;  4V2F A;  3S17 J;  2HXO A;  2JMW A;  3LNQ A;  1DU6 A;  1O4X A;  1ETV A;  4BBR J;  2L7F P;  3ZQF A;  2MW8 A;  1FTZ A;  3OSF A;  1MSE C;  3HB9 A;  3BG3 A;  1UMQ A;  2Y0S N;  5J1U A;  3M4O J;  2CUE A;  3GBG A;  1NK3 P;  1NK2 P;  1MSF C;  1ETW A;  2LK2 A;  2HOS A;  5IP7 J;  2M8G X;  5E3N A;  3FK6 A;  1MH3 A;  3DEW A;  2ELK A;  5EZH A;  5FKK A;  3Q0U A;  1IV6 A;  3LOC A;  1JT6 A;  2DMU A;  3I4N J;  1CQT A;  1HLV A;  2XB0 X;  1ETK A;  4D7N A;  3RZD J;  5JLW A;  5E3M A;  4XRM A;  1JKO C;  1FTT A;  1OCP A;  2DA6 A;  2LLK A;  3SFI A;  2K9N A;  1Z0X A;  4AYB N;  3BG5 A;  3HEF A;  5F27 A;  3A03 A;  4DYC A;  3QPS A;  4C2M J;  5M5X J;  2E1O A;  1I50 J;  5K7H A;  2ID6 A;  3ZOB A;  5C44 J;  1LE8 B;  1GDT A;  2DA5 A;  3IH4 A;  1MBH A;  1JGG A;  1WGX A;  2KDZ A;  5IP6 A;  2CQQ A;  5E3O A;  1SAN A;  4A3G J;  5K7F A;  2ZB9 A;  2HI3 A;  4L5E A;  1BA5 A;  2IBD A;  1VF9 A;  5IOZ A;  2ME6 A;  2Y30 A;  3H0G J;  1T33 A;  1VND A;  2NVY J;  4JX4 A;  1T56 A;  1JT0 A;  5M5W J;  3HDD A;  1Y1V J;  4A93 J;  1WH7 A;  5IYD J;  3D1N I;  1APL C;  1FEX A;  3HOW J;  1JJ6 C;  2CRG A;  1OFC X;  2EQR A;  1MNM C;  2JK3 A;  2Y9Y A;  3G1L A;  1P7J A;  2DA4 A;  2EZL A;  5F0F A;  5FJ8 J;  1ETY A;  4CYC A;  4A3F J;  2AO9 A;  3ZQI A;  2O9L A;  1JUS A;  2K9S A;  3UKG A;  3TP0 A;  1UG2 A;  3JRE A;  3W6V A;  4RBO A;  1MBG A;  3CQZ J;  2NS7 A;  2ECB A;  3M3Y J;  2Y9Z A;  1G2H A;  1P7I A;  2EH3 A;  4IEJ A;  2DTZ A;  2X9D A;  1ETX A;  1HOM A;  1BW5 A;  4QSH A;  1K83 J;  2E19 A;  1PUF B;  1MBE A;  3S1Q J;  1X58 A;  2XGE A;  4M3G A;  2OPT A;  1TWG J;  1Y1W J;  1AU7 A;  4Y52 J;  5HOD A;  2NS8 A;  3FIW A;  1EF4 A;  1POG A;  3C2B A;  1TWH J;  2FJ1 A;  4W97 A;  1BW6 A;  2CUF A;  1BJZ A;  1R9T J;  3SJM A;  5C4J J;  2N8G A;  1XS9 A;  2M34 A;  2R92 J;  3MVP A;  3HOX J;  3BR5 A;  1X2M A;  3TED A;  4DYR A;  5C3E J;  1TWC J;  1I6H J;  2HQ5 A;  5GP9 A;  3BTL A;  4S0H B;  4AC0 A;  1IUF A;  4I76 A;  1ETQ A;  3O8G A;  2DMT A;  2M0C A;  3HOY J;  2FQ4 A;  3HGY A;  5FLV A;  4EEF G;  1U8B A;  5JLX A;  2OF7 A;  2RAE A;  1ITY A;  4JX6 A;  1TWF J;  1FJL A;  1ZTR A;  3QQA A;  3WHC A;  5EEA A;  1HDP A;  2CJJ A;  1X2N A;  3S2H J;  1A6I A;  4HNV A;  4NDL A;  3NAU A;  2DMP A;  2HYJ A;  1RR7 A;  1BL0 A;  4XRS A;  2R93 J;  2LP0 A;  3BQZ A;  2ME0 A;  4FCY A;  2IAI A;  4B1R A;  2WAQ N;  5EG0 A;  2O8K A;  4CYC B;  4DZJ A;  4X1E A;  2WB1 N;  1IJW C;  4A3I J;  3Q0V A;  1HDD C;  3GTG J;  1OCT C;  1F43 A;  5IYB J;  1JTY A;  1QVT A;  3B6C A;  1IC8 A;  3JRA A;  2JA5 J;  1Q1V A;  1AHD P;  1I3Q J;  5EGO A;  1RPW A;  2EZH A;  4A3B J;  2VKE A;  5IOY A;  1E3O C;  2NVQ J;  1GV5 A;  1MBJ A;  2L0K A;  3S16 J;  2VUM J;  3LSG A;  3IV5 A;  2XGC A;  4MFD A;  2MG4 A;  2M2E A;  2NOG A;  1AKH A;  4MLO A;  3GTO J;  2NVT J;  3S2D J;  4M3E A;  2LKX A;  3JRC A;  1XC5 A;  3BG9 A;  2P81 A;  1GUU A;  2DA2 A;  2LY9 A;  2HOA A;  2L7M P;  2TRT A;  9ANT A;  2JJ7 A;  2MGQ A;  4RDU A;  2L9R A;  3TW6 A;  2O7O A;  4M3F A;  3BR3 A;  3GTQ J;  5BNG A;  3BTJ A;  4FE4 A;  1IDY A;  3WHB A;  3BR2 A;  4M3D A;  2CQX A;  4C3J J;  3ZQC A;  4LOC A;  3JRH A;  3CCY A;  5IPA A;  4BKX A;  2DN0 A;  2MSY A;  1W0U A;  3HGG A;  5GPC A;  2JA8 J;  2LTP A;  3OIO A;  2VI6 A;  4A3L J;  3LSR A;  1DU0 A;  2LD5 A;  2K40 A;  1ETO A;  1JTX A;  2JN6 A;  3G1M A;  2R5Y A;  2R5Y B;  4M3B A;  4V2G A;  4D5C A;  4MIM A;  3RZO J;  2DJN A;  2TCT A;  2WV1 A;  3CDL A;  4XRS G;  2GBY A;  1IGN A;  1K61 A;  4X6A J;  3JRF A;  2XRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...