2EBWA

Solution structure of the brct domain from human dna repair protein rev1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
GSSGSSGTSSTIFSGVAIYVNGYTDPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSYIPYQLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the BRCT domain from human DNA repair protein REV1
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA repair protein REV1
total genus 13
structure length 97
sequence length 97
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ebwA00
2EP8A 3OLCX 2XNHA 3L41A 4JLUA 2ADOA 3PXBA 4U4AA 2WT8A 1OQAA 3HUEA 3PXDA 3PC6A 3SHTA 1IMOA 3PC8A 2VXCA 2COKA 3PA6A 1JNXX 1T29A 2R1ZA 3KTFA 4OFBA 2NTEA 2HTFA 2COEA 1IN1A 4IGKA 2LE0A 3U3ZA 2EBWA 4Y2GA 1CDZA 2DUNA 2INGX 4BMDA 3T7JA 2K7FA 3PD7A 4IFIA 2L42A 3T1NA 1Y98A 3I0MA 2K6GA 3T7KA 1Z56C 3K0KA 3K16A 1L0BA 3K05A 3AL3A 3PXEA 4BMCA 3II6X 3I0NA 3SZMA 3PC8C 3L40A 2XNKA 3UENA 2D8MA 3PXCX 1WF6A 3HUFA 2EBUA 3EF1A 2JW5A 5ECGC 1GZHB 4XPZA 3EF0A 1T2VA 3SHVA 4ID3A 2M2IA 3K15A 3FA2A 3PC7A 1L7BA 2ETXA 3COJA 2E2WA 4N40A 1T2UA 4BU0A 3QVGA 3T7IA 3JVEA 3L46A 3K0HA 4BU1A 2AZMA 1N5OX 3QVGB 2COUA 3UEOA 1T15A 2VXBA 4Y18A 3AL2A 3PXAA 4XQ0A 3SQDA 1KZYC
chains in the Genus database with same CATH superfamily
2JIQA 3DMTA 1KPGA 3R44A 5ADVA 2VOJA 2C5GA 4CM8A 2Z08A 1H0RA 1XTIA 2OEPA 2PKEA 2VJDA 1D9ZA 1J9EA 1VIDA 3EHEA 2VYFA 2WF5A 2JATA 3FPHA 3L0BA 5C31A 1VB3A 3WGIA 2W5UA 2WTUA 4KODA 1EP9A 4UMDA 5AVUA 3GOHA 4W7SA 3EIOA 4AY5A 1QE5A 1J8MF 2ADOA 2CBZA 2H85A 4RHEA 5KOYA 3MCVA 2CYCA 1UADA 2BGNA 2FN3A 4MINA 4MVWA 4N9QA 3JQPA 2YTZA 5BVHB 5AW0A 1K5PA 4POAA 4C4ZA 3GUVA 4G1CA 3QWHA 2G4LA 1ZHOA 2JJ2D 5DDIP 1A04A 1FBNA 2FHSA 3IT3A 3KSMA 3RHZA 1QPZA 3W5BA 1XVVA 1PUIA 1N8KA 2Z2ZA 3GV0A 5F7ZA 1E5XA 1KZ9A 1RQGA 3H1TA 5A4IS 3K5PA 2NP6A 1KI6A 4GKAA 2IPOA 5L3QB 4R1MA 1SPXA 1P33A 2PH3A 3HYSA 2C78A 1HQYE 1SC4A 3VNRA 3WFIA 2I9KA 1WUYA 4KR0A 1UBKS 2E49A 3EFBA 4JBLA 4OSPA 3ZS8A 5J5AA 4NOLA 3GWZA 3AUKA 4XIJA 3HJAA 2WLSA 4N7MA 3PL5A 2V7QA 1W88B 3W5DA 1I30A 5GMOA 3HO1A 1SM4A 4FUQA 4Y2TA 1JBQA 1LI5A 3HRKA 1CVRA 5J4YA 4H7EA 3BMOA 4RIIA 1PX0A 2X5NA 3SLGA 1L5OA 1JLSA 2RONA 2ZB8A 2WV7A 2RHBA 1RJFA 1JR3D 2QUZA 2REQB 3ND7A 1NXVA 4PZ9A 1N8NA 4B6JA 2QX6A 4H08A 4XM0A 2IL1A 5CFQA 4J91A 3WADA 1VPDA 2HK7A 1BW9A 5AVRA 5IKPA 4FNAA 1JIXA 1VJCA 2I7TA 3A9RA 5BUCA 3F0TA 3FSEA 1X87A 3PHCA 5EP1A 4YMTA 4RA6B 3EG9A 5ENZA 4CXMA 1X9HA 4IY1A 4KIWA 4E1AA 2Z6VA 3PUHA 4TT8A 2QMOA 2BUAA 2OHOA 5AK0A 3W2TA 4EHHA 3F71A 1R0LA 1JL3A 4MQFA 4J3JA 2GO1A 2XNDD 1RYNA 3T5PA 4XD7D 1UKCA 1I32A 5DWVA 1VDMA 4UNSA 3RUEA 4S35A 1IXYA 2Q45A 3EGWA 3LUAA 4HWTA 3K6JA 3L43A 4LZWA 4OHPA 1GTZA 1AXRA 5AM3A 3QHAA 4DJTA 3CLUD 4F92B 2JI6A 2ZTUA 4EYEA 5KS2A 3QEJA 2XY4A 4MA0A 2DP4E 1TE2A 1Q16A 2C31A 3PTLA 3MGKA 2CUNA 4RFSA 3M4XA 1FVOA 4OL9A 3TOVA 1SIBE 1ORIA 4QDOA 1D1QA 4U39A 1Z36A 1JZQA 3C6XA 4KWIA 4OHFA 1NONA 4FZJA 5BRAA 3PFBA 1JALA 1ZESA 1E89A 2CVPA 2D4HA 4I8XA 4G9BA 4JB8A 2QPOA 4QUAA 3RKSA 1ZICA 3TW6A 1SZPA 1EBFA 1Y1TA 2R8OA 3T5CA 2I6FA 3OU2A 4AC9A 4BB0A 4Q15A 5BPHA 3IQDB 1ZW1A 4PFKA 2GLXA 1XZPA 2AQ8A 3FYUB 2R6HA 3U1BA 1T0UA 4HTFB 4F9EA 4O2AA 4A2CA 3VU3A 2BMDA 3QFCA 1VHJA 1JILA 2OGZA 3CLUC 3O3OB 4ECAA 2REBA 3EDOA 3Q3CA 4V39A 5ECYA 3GJZA 2ZRKA 1AM4D 5A4KA 3S55A 1U0BB 5ESWA 3TX2A 1OXTA 3IAUA 4BQQA 2OCIA 2JBWA 1MDFA 3CRRA 1EVEA 4DLRA 3F4LA 1O0CA 4O0MA 5GV7A 4Z1MD 3S1AB 1ZP6A 2ZR7A 3M5WA 5K5EA 4LKRA 1CUVA 1KPHA 1GKYA 2F17A 2DQ4A 1NDHA 2W2PA 4FSHA 4AXXA 4IIJF 1HL3A 3JARA 5F52A 3S99A 1FS4A 5FULA 4TZ6A 1SGWA 2C2KA 2P65A 3EAGA 5JAUA 5IDYA 1HGXA 1P7VA 3IUMA 2LIPA 1E9BA 2RGNC 3DE4X 3GPCA 4OQEA 1OLOA 1U7HA 1N2OA 4L28A 3JRNA 1YZUA 2R2GA 2I8CA 2ZRNA 3H17A 2ZCVA 3DXFA 3O4IA 2R60A 4HG2A 1P77A 3AKDA 5IYZB 1XKTA 1TK9A 2E4WA 1JI0A 3W5UA 4E14A 1RWWA 2CN1A 4P98A 4X1IB 5JO9A 1SK9A 3FBGA 4JKOA 4PONA 2F9FA 3TCNA 2QTZA 4MXDA 3W3AA 3OZWA 3SMVA 3WLOA 1VMEA 3BIWA 3E18A 1RP1A 2JF0A 2WMOB 1DJLA 1IU9A 5ES3A 3TR6A 3E7FA 4UTXA 5DHUA 3UT6A 4DIUA 4R1OA 2X1HA 2PTHA 7ABPA 5JHHB 1FDVA 1RM4A 3C3XA 3HL4A 3Q6NA 4JWTA 4W1SA 1SKUA 2V54A 3CTMA 4IFBA 4NMHA 3T52A 1W4AA 3RVRA 3A6KA 1LJ8A 2PRZA 4GMXA 2E5WA 1DUIA 2RC5A 3G2NA 4PAQA 5DO9A 2O0MA 3W5JA 3WIEA 4B5KA 2A9OA 4CUKA 5LMCA 1ZU5A 3T7EA 4Q5IA 2FAXA 2C59A 3VUFA 3TTTA 4HLUA 4E15A 3TIIA 2BFOA 3WP1B 2OAEA 4IGFA 4E2XA 3W6OA 4IDDA 2HIGA 2OBLA 4YV1A 3D6MA 4ZV7A 1N3LA 3I05A 2I7XA 2A1UA 2JAOA 3EVFA 3PHIA 3H5LA 4PAOA 4KR6A 1NI4A 4XUDA 2PUTA 4OMDA 4J6EA 1RU3A 1VKNA 3UV6A 4HVLA 2PNJA 4QGAA 1H94A 2I71A 3LZDA 4HB4A 4RCVA 3ZQKA 3IAFA 1MEEA 4HZGA 5FFNA 1SRQA 3L4SO 1TM3E 1SZDA 3TVDA 2KQUA 1NSTA 1NT2A 3CE9A 4ZVRA 2FSVC 3PNMA 3RC3A 2JZCA 2HDWA 4FIZA 2JIZA 5C7LO 3ANYB 1BVUA 1QHHA 2QK4A 2V6GA 1O89A 5E9WA 5JSHA 2PXCA 3CQ9A 2A5DA 2BOVA 4G5GA 2GM5A 2OV1A 4AWBA 1Y48E 2ZRAA 3N2LA 3OTQA 1PR4A 4EAQA 2AG8A 3KQNA 3IBTA 2YASA 1NW6A 4D5EA 1NVTA 1Z7GA 4U63A 4I9UA 3B7GA 3L3BA 5AW5A 1WUHS 3M7IA 1SKYB 4TRMA 1FNSA 4DNPA 2HU5A 2YV4A 2IHBA 3HRIA 4B87A 2XUAA 1YUMA 3NEPX 5K09A 2GPWA 1GL6A 4IVRA 1EFPA 3A6GA 4Q9KA 5KYTA 4RV4A 2QD2A 3UN1A 3M5PA 2JH3A 5CEEA 5CM2Z 3IAHA 3G1TA 3GPBA 3N2KB 3Q9SA 2BEVA 3BXZA 5KIAA 8LDHA 1FSZA 4YC7A 3CF2A 5BWNA 5KKNB 1E18A 2G83A 4HXEB 3KFXA 5G0WA 4JJFA 1N5JA 4MRVA 3NT2A 1DDOA 3OJWA 4HDCA 3LS2A 1V8OA 1VZ2A 1W75A 2GJ4A 3RSCA 4ZOEA 2IYWA 3I9V1 3S2EA 1SD2A 1QQTA 3CINA 1T9GR 2C9YA 3ETNA 2ZBQA 2PUWA 4G86A 3T34A 4F2GA 1E1RA 1I7NA 1TM4E 4LQLA 3RJZA 3TUIC 4DABA 3W6NA 3QMMA 5IK2A 2AHOA 4A73A 2H7YA 3C1TA 3DLIA 4O4JB 3B12A 5J2UB 3TQHA 3VSEA 3WK9A 4D6YA 3WIDA 4YRAA 4ZO9A 2VPPA 1AKEA 1X1TA 3P9ZA 3SJZA 4E6EA 3SD7A 3HR8A 2VRCA 2VXOA 2QRQA 3ZZUA 5IJ9B 1T29A 1N2BA 2F55A 4URZR 5LQDA 4P7JA 4U0KA 2QE6A 3HMQA 3FHOA 2OHXA 2FZGA 1V4NA 4P58A 5E6RA 5T3YA 3FTDA 5C3UA 2YNMA 2IT1A 3D5EA 5H3LA 1H1LA 3Q7RA 3IGFA 4O2AB 2C7RA 2OGTA 1TZJA 2VCEA 4DJAA 1JQLB 1QYCA 2C8VA 4RBNA 1M10A 3ROPA 4CU5A 3ZGLA 2HGSA 3IX7A 1WCXA 1ITZA 4P4GA 3ROFA 2PAAA 5F2KA 1FQOA 2OBNA 2WDZA 1M33A 1PQ4A 4CT5A 3LUBA 4HPJB 4K40A 4QDXA 4EVSA 4PAGA 2ECFA 4C6TB 4DRYA 3OAAA 1REQB 1XRQA 3PX3A 3VO1A 4XWOA 3FLEA 3QWFA 1Z4KA 4YX9A 1HDCA 1Y8AA 1G6KA 3QELB 4BLVA 1G7RA 2ZFUA 4B6RA 1QU2A 4CKWB 3VM6A 4GZ5A 1QTRA 1ILEA 4BNZA 4QZVA 5IKEA 2IYAA 4RQUA 2VHEA 4JA2A 3ORSA 5DHAA 1U7UA 3G49A 4YRZA 2XX3A 5C5EA 1NX6A 2XHEA 4PX9A 3TI9A 4TLAA 5CIQA 4AZWA 1MIHA 2AW5A 1KVRA 1FNNA 1RAHA 2VQ6A 3SG0A 2VLIA 5BWBA 1VSUA 3R1IA 1WVGA 3IA2A 1BQ3A 2HQBA 3MBOA 3SC2B 2Z8XA 3SQNA 4DIDA 2BAGA 5IK2D 1KFCB 3WRYA 4XX0B 3NT4A 5HTKA 1ODFA 3FMGA 1A2QA 2JBAB 4GDMA 3ZN2A 4ZICA 4GWGA 2R6GA 1PW5A 2MMGA 2P3OA 4RXMA 4ZQEA 1ZM2A 2JKZA 2NPIA 4R7ZA 4R41A 1OZHA 2GDJA 1T13A 2IZZA 1OX4A 1BAPA 5KQPA 2DPGA 1I0ZA 1SXGA 1BN6A 2HCFA 2AR9A 2ORYA 3NLLA 5JS2A 3COJA 4UTPA 4JUDX 4M9SA 1WXEA 4EUSA 1RWQA 4ZEWA 2I1QA 3W6UA 1G5PA 1GSIA 1KERA 1EZZA 5IU6A 1OFHA 3Q8MA 3EQ2A 3NKVA 4Q3EA 5T7BA 4IX1A 1ICEA 4M1TA 4IDEA 1CT9A 4RLQA 1CZLA 1EUDA 1BFDA 1YS7A 2BCGY 2JDID 4HGOA 4X3OA 5DYWA 4BU1A 2YXEA 2OMKA 1XZBA 1IHUA 3L8FA 1GSOA 2VYND 2JFGA 3SU8A 2F8MA 2HADA 4K0RA 2WIJA 4QHTA 4IGAA 1XU4A 1ODJA 2JD0A 1SG6A 2WF8A 1NW5A 3BB4A 3KYDA 3OLYA 4H27A 2BUBA 3EVGA 3GLHB 3CVUA 3PLAE 4TXHA 5IVKA 1KEEA 1XHFA 2I2BA 5F77A 3GEEA 4MJ3A 3UK6A 1ZSNA 2RHCA 1T2DA 1G63A 4M9ZA 1Z16A 3GLFB 3PEEA 1FTGA 2F1KA 1AQIA 3DKKA 5TJHA 3KUDA 3WMGA 4BUZA 3AVPA 3PRYA 2O8EA 1ZRHA 1KPIA 3Q0EA 3UMYA 3NFYA 1IHYA 3O4HA 1ESZA 3GH3A 5KVVA 5H9WA 1RACA 2HSWA 1T1SA 3IB6A 3HZRA 3KJXA 4GUDA 3R9XB 2JGDA 4LYYA 2BUCA 3VU9A 4BX3A 9MHTA 3UAXA 1XLUA 1YH3A 3JALA 4LDJA 3K20A 4LXQA 2D5AA 4YRGA 5JYEA 1IAVA 1TD1A 2AC7A 3USCS 4C0LA 3FGOA 1AGXA 5C1PA 2C84A 2FF5A 4XGIA 2WJ6A 2G88A 1HDXA 3A9UA 3N8GA 4V24A 2VIIA 3OCZA 1T10A 1QSGA 3EWIA 4ZMBA 2H8GA 4MUGA 1PJAA 2C2MA 3DE0X 4EUFA 4X71A 1D03A 2AOVA 2P6OA 2OBMA 1KFKB 1LPOA 4A6DA 4BCCA 4EBBA 3VYWA 4NCJA 1R4MB 5DCUA 4ZEMA 4P8RA 1W8IA 2YC4C 1XTVA 3J7TA 4M87A 5GP1A 5FOUA 4ZCRA 2JASA 1JAIA 3DFIA 4GX1A 4LDAA 4FFSA 4US2R 5DJ5A 3QBTA 3CUVA 4G81A 4HFMA 3KXLA 4JELA 3HLYA 2JCXA 1L3BA 2Q4BA 2VK1A 3D4PA 3F8TA 1RLOA 4XQGA 3W78A 4Y1FA 1EUCA 4G01B 1SBQA 3V00A 4NBVA 3ANNA 2ZS8A 1XL1A 2AMYA 3R40A 2NN3C 4QOHA 3R5XA 1ZCAA 4WX2B 3ZHXA 4DNXA 4KR7A 1EQUA 1AU9A 1Q91A 4QBHA 4F84A 4F9FA 3Q8LA 3U4QA 1YMVA 4LXXA 1B8OA 2J0VA 1AZWA 5JAQA 4B71A 2VL7A 5DX0A 1RP7A 4RTNA 1MVNA 1VBNA 1V39A 2ZYWX 3HO6A 5THKA 1PTJC 3G8CA 3WI7A 4F4DA 2EKDA 2WFAA 1PBNA 2W2TA 3Q3HA 3RU7A 5F2NA 3RAFC 5THXA 4KO8A 2AOXA 3U3RA 4DCUA 1YVDA 1JT2A 1OGJA 3AR7A 1Z12A 2P90A 1AK1A 4QOFA 3PVCA 1BXGB 1XVIA 1USUA 2F9LA 3NTOA 1KQOA 3QNUA 3FF1A 3I1FA 4NK4A 3SS8A 2OFWA 4I50A 1BKDR 1U2PA 4OX9B 3O4JA 3R8CA 5LDDC 2H52A 4OHZA 3RG2A 3O21A 2R85A 4CQJA 1AF4A 1Z75A 2NUTB 2YDXA 3INTA 4JP5A 4JVNA 2YIJA 4KNWA 4Q9HA 3VYSB 4RH3A 3GCZA 2G3YA 2QRMA 2ZYVX 1Z3CA 2WWRA 2BVNA 1QHGA 2ZE5A 5FTNA 2JEYA 1FFYA 1ESCA 3F96A 3H84A 1CUUA 1LKZA 2C83A 1SA0A 4EA6A 5BMVA 3ICVA 5JDIA 3RANA 1X8KA 2BI8A 2DLDA 1DEKA 3V4OA 3S8YA 5GZ6A 3HE3A 4LWPA 4YBRA 4Q4AA 1EFVA 5DW0A 5TT0A 4AMYA 2L19A 4R2MA 4YK7A 1N1DA 3QVUA 2REOA 1QKKA 3DO5A 4XARA 3SE0A 3QXSA 1K63A 4MW0A 1DEXA 1JVSA 421PA 5BN1A 1E79A 1SXHA 5TMEA 4XJSA 1Z8DA 2EERA 1YVUA 2A5YB 1W48A 4I3FA 5CT8A 2Y0CA 4EG7A 3MT7A 2I03A 1ISRA 4Q7LA 4RKQA 5C8DA 1F9EA 3BH0A 1J1IA 1YGYA 1THZA 5DTJA 3UAWA 1WXDA 1ZUHA 2H5EA 2PXAA 2PYIA 1AY0A 1NF2A 2Z2JA 3NW9A 4PXSA 5DV9A 3BC1A 3PJEA 1DJMA 3UHAA 1XJCA 5ADHA 3S3TA 3UMVA 1T1GA 2RKBA 1DWOA 3HXLA 3ZUPA 2FRDA 2IRWA 3QYJA 3ER6A 4MR8A 5CA0B 3ZLVA 4YAUA 1JU4A 2W6PA 3LWBA 4CLOB 2VPQA 1P5FA 4KIUA 4ZO7A 3S2YA 2PIDA 4WACA 2XRMA 4HNSA 5JISA 2B4RO 2E4ZA 1DFIA 4OYHA 4PS0A 2HHLA 1J6UA 4BVGA 5ADWA 4C88A 3O8LA 1E0DA 4LV8B 4RFVA 1V71A 4C7KA 1AKQA 1DAFA 3K9BA 4E51A 2DAPA 5DZSA 3WIBA 1FJHA 4FCVA 1P1RA 4L4SA 3B2QA 1UOOA 4IS3A 1D1TA 4KR9A 3K6KA 1GYRA 4WXHA 2FPPA 1BD4A 1RYHA 1UBMS 5E1OA 1G64A 2WWWA 4Y6QA 4POOA 3H16A 2VLBA 4Z1MA 1LS6A 4EX6A 5ISMA 1MX5A 2H29A 5FHRA 3OM1A 1X7ZA 4OQDA 3H0KA 1UP4A 1YDFA 1UT6A 2X9LA 1C9MA 1Q0SA 1I2CA 1UKEA 1I2MA 1E2JA 4NAHA 4QUEA 3PEYA 5IMSA 2PGXA 3BBLA 2HBRA 4O4LA 2J4CA 3RRXA 4EKYA 1EB9A 3ERCA 4MPPA 4TS3A 3LWNA 2M1XA 2Q1SA 4JP3A 3D3EA 1DHTA 5ALRA 5CW1A 3WS7A 1Q83A 2QB5A 4MV0A 1OFGA 4MIKA 5EUQB 1XO1A 2XRFA 1IBCA 4FYKA 2XIJA 4CCYB 1IOZA 1WETA 4PHCA 1CR2A 1NC1A 4LZAA 1F9AA 4YCSA 1GTMA 2QPLA 4YJ3A 1ISFA 1U3VA 1Z83A 2J3DA 2JVIA 1WXQA 2OB2A 3P2OA 4IW3B 4NDNE 4PCAA 4X1IA 3DLHA 2NQ8A 3UA3A 3JV7A 5BQOA 5NLLA 2B94A 3CW8X 3GLHA 2I2DA 3HCDA 4YS6A 1J99A 1JXMA 2QQEA 1A2BA 4MUMA 4W5HA 4GI1A 2Z2XA 3BFVA 5G1PA 2IY8A 3FW1A 1JQKA 1O97D 4GI2A 4RK7A 4ZI3A 3SKXA 2PZEA 4NZYA 3SHVA 4RUKA 5JQGF 3GNSA 2H0QA 4M1YA 3I5UA 3DS8A 3UQZA 2LKCA 4B09A 1SHUX 2Q2OA 4TKUA 4A8PA 4LXHA 3EVDA 3N2IA 2NZUG 3NBQA 2DBRA 2P41A 5F64A 5KSPA 4P35A 4CF6A 3I5XA 2N46A 2XVYA 4I1PA 3QM1A 4XGNA 3OMXA 2HSEA 3VSDA 2BJWA 2XOKD 1NW9B 3G5LA 4X63A 1ZD5A 2QTFA 1BMDA 5GPBA 2UVPB 1M2EA 2WIKA 3U1VA 2HMSA 3PDHA 3LLSA 5CUQA 3TZCA 2IXDA 2B5OA 4QUBA 3V8QA 3E15A 2IVZA 4GZLA 1U1GA 1AZTA 2DFVA 3ZWNA 2D1QA 2YHAA 3I2IA 1HORA 2PGIA 5TB5A 1VLZA 4J0EA 4NDZA 3GUZA 1UWCA 1N5KA 2PQ6A 1II9A 2ZBUA 3H0CA 5HGXA 5SV2A 1YL6A 2PVSA 1UFQA 4JSTA 2JA2A 4DLPA 4I9FA 2OD2A 5LVAA 3T3GA 3BWCA 3I23A 4YN3A 1GQYA 3G0CA 3VMMA 2Z2KA 3ZIDA 2ACWA 2CD9A 2GFIA 1MVLA 3AG5A 4UDYX 4LISA 1A77A 2HLDD 3RE1A 4BTVA 2G8LA 3QF4A 5GQSA 1FFBA 1ZN8A 4KBFA 3GFTA 3GGDA 1CY7A 4EY3A 5BR4A 3T3HA 2QROA 3L0PA 1JG7A 1Z6TA 1X2BA 2NXJA 4CL0A 3I1IA 4RWZA 3LBFA 5DGCA 3CNNA 1G8SA 1SELA 5A3RA 5EZ6B 1XEAA 4A5SA 2GJ9A 2WUFA 1FUUA 3H65A 2O23A 4CF4A 4MWTA 3W77A 4DG9A 1FJ2A 3EBPA 1RQPA 1FB5A 1U02A 2H4WA 1JX6A 3QITA 1L1FA 1JDJA 3N0WA 4DB4A 3KTOA 1WW2A 3PVZA 4Q4AB 2I6GA 3MF4A 3ZBQA 3BWEA 1F48A 3PT5A 1IXSB 1EE2A 5A2QA 1OR8A 3EW9A 4ZYXA 1DG3A 1EKXA 3VR4A 1NVDA 5BYJA 3VTAA 2H1VA 1GPLA 2EJVA 1XN4A 3R6TA 5EUBA 3X1ZA 3H4IA 2WVAA 3A3YA 1DDGA 2Q1UA 2YIVX 1ZM4A 3RASA 1PDWA 1NRXA 5A06A 4NI5A 1RMQA 2M32A 4MAAA 3P9CA 2JFNA 1ND5A 2CWDA 1PNTA 3PQCA 2ZXEA 2AXQA 2UAGA 4HP8A 3QA9A 1DTWB 4OATA 5LBTA 1RLMA 2FPRA 2WJ3A 3DJFA 3JQDA 3ITDA 2SBTA 3LYHA 4OQZA 1SVIA 1YC5A 4EFMA 4BNDB 2YJTD 3IBFA 5F2OA 3ZHRA 3CUTA 3DHVA 1Y1RA 1XRLA 2VRNA 3V1YA 2P2ZA 1Y8ZA 3OZSA 4RTPA 4QPZA 1PS0A 4G0VA 2O8NA 2J0EA 3ZYCA 4D6XA 4W63A 1EAMA 3FJ1A 2EJBA 1DS6A 5F7JA 5B7NA 3LI2A 4GSYA 3WJ1A 3FPBA 5A0VA 1JLHA 3FR8A 1ZWKA 4TQGA 4TV8A 5GV8A 5I8ZA 3GLGA 4M1ZA 4UNNA 4IJ5A 4NMXB 3UATA 1VGRA 5IBRA 5AXDA 3LQFA 1J70A 5C8YA 3OEED 2IOFK 2X9VA 5SYMA 2H4ZA 2PRKA 4EA7A 2LVBA 4WH0A 5H7XA 5G1NA 1ZA2A 4AB1A 1F6WA 3DCYA 4C6TA 5AVQA 1STOA 3QUAA 1FYVA 1XALA 2I99A 2P68A 3AEXA 3LYAA 1VL1A 2I8LA 4JHXA 4JQSA 3AILA 1VPLA 3GK3A 1J2RA 1L7OA 4FDLA 4GL2A 3D3NA 1N9ZA 4Q4JB 5TV2A 1NRWA 1XJ5A 1JR4A 1OLUA 2PR2A 4Z9AA 1FZQA 2WM9B 3ZHSA 1SQFA 3K6SB 2UZ3A 3B6ZA 1XZAA 4PYLA 1Q21A 5AW9A 2FRXA 1RI4A 1M7GA 5AW7A 1MO6A 2DF8A 2ZYIA 3AXSA 3VVLA 2DGDA 2IYNA 2OO3A 3N6VA 2W6JA 4BRUA 1N4AA 4MI1A 4Y3UA 1BDBA 3S1SA 3LL4A 3AL2A 3QXHA 4AICA 5IRCD 2PZLA 4XFJA 1KZYC 1I2AA 4PLZA 2Q41A 1IUOA 3ETHA 2YZKA 1OFIA 1TLFA 4GQIA 4I1IA 5JAHA 4P7BA 4ZAGA 4DCGA 4Q1VA 1DBIA 2OHGA 2A9QA 3J80A 2IHUA 1C7FA 1WWKA 2AI3A 2AMLA 3N2NA 1BGXT 3MCTA 1FNDA 4BE4A 1CS4C 1COWD 1CWUA 3RBXA 1H2YA 1M8JA 5BV0A 5B3JC 1UFKA 2V3WA 4M9CA 1N92A 5EJ8A 2BP7B 5FLEX 1CQIA 3UV3A 4B43A 2PUBA 3FHCB 2DERA 3MFYA 1ANKA 1EGVB 4QVGA 4ROTA 2AMJA 1JHMA 4UOZA 3JQGB 1U7WA 3QX9A 2Q07A 3D4IA 1Z3IX 3WNDA 1AKVA 1FFSA 3D43A 1CUEA 2OK7A 4QREA 4OHRA 3RSFA 5I8PA 5JDCA 2PGNA 3KYDB 4OUDB 3F1KA 1NVBA 1YUBA 2WG1A 3ICWA 3NRJA 2IEBA 4BQNA 4RGVA 2EP7A 3A6JA 1J8YF 5E1MA 2P4UA 5IH7A 1VE3A 1WZNA 2FVXA 2H92A 721PA 2BMEA 4UATA 5L8VA 4P9NA 1TTPB 4WY5A 3ZKWB 2PNFA 2YJNA 5FADA 3WLTA 1TT5B 3EY9A 1XEXB 2O4UX 4YJGA 4DIOA 4DXDA 1P7CA 1TKBA 2HPAA 4NE2A 4C7OB 5CFPA 2Z09A 4WFKA 5BVGB 4HXFB 2CXQA 3DKIA 3N0RA 2WWFA 1CEQA 1T9AA 2BKLA 5KJCA 3Q9LA 2I2AA 4I81A 4G24A 3JD3A 5AKGA 3I01M 3I9MA 4GGOA 3E81A 2Q9CA 1XLTA 3QLJA 3CLTD 4B2YA 3NASA 2CFTA 4DWVA 2YVLA 2P7HA 4MYDA 3RNLA 2P6NA 3K70D 3L01A 1JLRA 4KQCA 4DHWA 4GKKB 1D07A 4K3UA 4BNIA 3WXMA 2CNWA 1UZNA 1VL5A 4CMGA 1EUDB 1JI3A 3W8NA 3L1KA 3I45A 4WFJA 3ZGYA 2IZ6A 3I53A 4MYRA 3D6UA 5IT4A 2O3UA 3AM4A 3IDOA 3L7YA 1SIUA 2C54A 3P1JA 2ZJ8A 1XAGA 4AIRA 1E5LA 2XTNA 3BXPA 4KVAA 2SCUA 2WAXA 1B14A 1Q74A 1XHLA 4MS3A 2X2OA 1CW2B 3ZCPA 3HXKA 1M2OA 4GPD1 1GNVA 4H0FA 4MVJH 4RJJA 3UMFA 3H1AA 1MXHA 1Z2EA 1SD1A 4G89A 4WUTA 5HCIA 3KQSA 3NHAA 4X64B 4CNBA 2JGNA 4AY4A 1SIWA 4OFZA 4CVNA 2IITA 3UPUA 1I13A 3IA7A 4QYXA 4HBGA 1EZ4A 1DX9A 1ZY2A 3NJ4A 1NMEA 4W6QA 3DFUA 3WFJA 3P5SA 1PP4A 5HE8A 2O19A 4HEJA 2CMDA 3AY7A 2X3FA 2ZULA 4TWAA 1TXGA 1B6RA 2UYQA 3KOXA 4JJAA 3WGKA 1W0JA 2HREA 3MQFA 2PLRA 1I6LA 1KFEB 4QTZA 4RQTA 2D6FA 1SKYE 3K30A 3U26A 1VMKA 4EGSA 2P69A 4YLYA 2H59A 4N3GA 4G1FA 5C80A 3DXXA 3A6HA 1ILWA 2B1IA 2J3MA 4IS2A 1WUTA 4U9HS 4B3BA 4AZ3A 1GT91 4C07A 1KMNA 2QP4A 5E3HA 4FD3A 3ICQB 3A6FA 1XQ1A 4URXR 4TWIA 5B53A 4C1NA 5FUMA 4FR2A 3K0AB 5G0VA 2XEDA 3F46A 1T0HB 2EQAA 1G291 4IDFA 2BTQB 3L6RA 1T4BA 2YJGA 1AKWA 3JWEA 3ZU2A 1SQSA 1XCJA 1MH9A 3EEBA 2QL5A 4AQYB 4TV9A 3HCNA 4H3SA 1B7GO 3F6RA 3OI7A 1OI2A 3MA0A 3IKMB 4Q21A 5LA6B 4BP8A 5I7RA 1CIJA 1FXWA 4YT4A 1I6KA 4UTOA 2Z6QA 3GG9A 4GU5A 1HG1A 4YJFA 3FPFA 5LMZA 4ZTZB 3MCAA 2ZRIA 4IEFB 4EMTA 3IIJA 1AUQA 4L2IB 4XLLA 2IKQA 1NR5A 2UZAA 3E0QA 1C8VB 4WXRA 5P8WA 3QOXA 4IO0A 4BNDA 1T34A 2HDHA 3HU2A 1AQNA 2BZGA 1C41A 4FZ3A 3UT5A 1RE1A 2UZ0A 4C20A 1Z06A 4U2CA 1JRLA 1SBCA 4LYFA 5FJIA 4R8RA 3RVLA 2BKUA 1JQBA 2COEA 1QB8A 3UJ9A 1IIRA 2IF2A 3LZCA 2HCRA 4IMJB 2N3ZA 2Z5VA 2J59A 1YZTA 2PO7A 3PUJA 1ZN7A 3IAS1 3BL5A 3L6DA 1UBEA 5CPFA 5JTTA 4N41A 1CDZA 2DR0A 3SYLA 4XWAA 4ENQA 3ONVA 3GFPA 1T6ZA 2F4NA 2NAFA 2OZEA 3I30X 1ZMBA 4EPTA 2XTMA 4QFCA 4MA4A 3KKMA 4LCJA 4RHFA 5LZ4A 2WF7A 1Q0UA 2X0IA 4ZHQA 2L2QA 5L3RA 1SVNA 1CFZA 4UQLA 1MENA 2GTPA 5F78A 2Y6UA 3EMDA 3JQAA 2V3VA 3WNZA 2ZYHA 2J45A 3VOTA 4BAUA 3IUYA 5EQTA 4A8JC 1PEDA 4X24A 5HEKA 1L4YA 5KX5A 4N7RA 5IVIA 1RIIA 4ZI7B 2H1OA 4GPTA 3L04A 5AKEA 5E2IA 3T7DA 4KBGA 1XPOA 4DLNA 4HQFA 1RWKA 3WYDA 4BVAA 1MKYA 2PMCA 2DY1A 1ADFA 1DHRA 1S8NA 4A3SA 1PEKE 1QDLB 4R8MA 5EGSA 2O7VA 4XPIB 2OD7A 3M5CA 5LNK1 1M6HA 4FUTA 2L0XA 2JLCA 2AG0A 3BZUA 4JN6B 1JEQB 4MYUA 4O33A 2XSZD 3BOSA 4HX2A 1MV5A 1CLEA 1FTWA 1UC5B 2IW3A 2P2LA 3R3SA 1FDOA 4HPWA 1TZBA 1XROA 4OAPA 1JP7A 4Q7EA 2DECA 2FE4A 1DAEA 4L74A 1G5RA 3WWYA 1CG6A 1Y63A 4OXQA 3ZDQA 1XG5A 2JIDA 5AVYA 4D57A 3DDHA 1C1DB 1GA1A 2I2XB 4EPXA 3IKVA 4B2IA 3ZPXA 5EJGA 3DNMA 1KAEA 1FMTA 1G6HA 4EA9A 1EQ2A 3HLTA 2I0FA 5BUQA 3CG0A 3QFSA 3CYFA 1IBKB 1YS9A 4YECA 4TKVA 2K7FA 4GZMA 2H7CA 4JSYA 1Y9DA 3A6ZA 1NDQA 1SCBA 4FS3A 3CRQA 1W59A 1UBLS 4Q9DA 4CTJA 3IQGX 5DNVA 4PZZA 2P9JA 4EIWA 1U6IA 2ZCUA 1A95A 1IZYA 5FTKA 3I2JA 1JSZA 1CQXA 4P38A 1EFTA 3I8XA 3QEBZ 4EG1A 3G9ZA 4R69A 1G59A 1MT3A 4B84A 3KLBA 1AS0A 3QEAZ 1F2UA 4J76A 1V1RA 3CUEF 1FFXA 2FDXA 2JZNA 2X6TA 3WO0A 4TPKA 4DCVA 5K51A 1JR3E 2FYTA 1M5UA 2E1RA 5KQMA 1J07A 4K8RB 4NS4A 1SUFA 2ASEA 3MM4A 1LTHR 5D01A 2B4QA 4XOIA 5DXAA 3TQOA 3V9PA 4RE5A 3H7AA 3KOWA 3CKLA 1NY5A 4JXKA 3QEMA 1Y5LA 5EE9A 3KQUA 3EZ2A 1E3SA 3LKZA 5FYQA 4YBZA 1FSGA 3HEBA 4IGEA 2HMUA 4KC0A 4EX7A 3PXDA 4TUYA 4XR9A 3C3EA 3U9TA 4ACBA 1CZNA 4EHKA 1NGSA 2GYVA 2BZ1A 2BT4A 3OETA 2CZQA 1RLIA 4C2AA 5IAOA 4YH1A 3ZHBA 4M2LA 3WMXA 4N0MA 4MEBA 1XQVA 3OCUA 4BO5A 4EGFA 1PRYA 1Z6QA 4G36A 2VEDA 4DBLE 1L5LA 1T26A 3OF3A 2Q6OA 4FXPA 4FYMA 5AOBA 1OYVA 2FJPA 4MUEA 4PG5A 4KMOA 2FWIA 4UDNA 3DE1X 5C7IO 5MF6A 2IHYA 2QZ9A 4RHTA 1RZ3A 1RE0A 3EEQA 4MWCA 1F06A 3M89A 4EFLA 4BNHA 1G8HA 2OT3B 3KFLA 4N47A 2JLQA 1RNLA 4OM7A 4O59O 2VA9A 4JBWA 1YJ5A 2FSVA 4GBMA 3B36A 1U6JA 2OKGA 3RPEA 2ZE7A 2YC2C 1E9CA 3D8HA 1R10A 2ZSDA 3QG1A 1TECE 2ZPAA 3OZIA 2FU5C 1JTVA 4TTVA 3QVKA 5K6RA 3ZYZA 3W0LB 3LQYA 1Z4OA 4NMWA 1EE9A 1GQFA 2GVZC 4CHGA 3U13A 1OFUX 5ALWA 3DTVD 3KOOA 3RARA 3W2EA 3KTAA 3CPJB 1GRNA 3DD5A 2O6HA 1AO3A 2WLTA 3ORYA 5AKIA 4OKNA 2ADMA 1ATZA 2IZ0A 4EHBA 5DLPA 3H8VA 4EQ6B 1K66A 1R0RE 2ODNA 4D41A 3OG9A 3KKQA 3Q1LA 4HNAA 3L84A 2FEMA 4R7TA 1L8QA 1G5FA 2WBLC 3EDMA 5AICA 5T6BA 3HB7A 1P8JA 3QV2A 3WRXA 3VHXA 3EC1A 1W0KA 1Y6FA 2EX1A 2JI7A 4P4TA 4Q34A 4MZDA 2NO6A 3VKVA 2BTOA 1E2DA 1WUIS 3OC6A 3S28A 1KO5A 4BX0A 3EXG1 5I6DA 3FDXA 1LPMA 2VYCA 2WPNA 1QRAA 1DBQA 1KI2A 3DA8A 5KC9A 3M6MD 2H54A 2ATEA 4B4DA 4UTNA 1RHRA 2EGHA 3V7UA 1QVAA 4KW7A 2A9PA 3O2SB 4CM4B 2RHHA 4QODA 4R8VA 5FV4A 2Q2WA 4J2HA 1UEJA 4JU8A 4YRTA 4AJ1A 1KP2A 5FIUA 1U80A 2DCMA 1GWNA 4N76A 2WOOA 5AOCA 2WINI 2O8CA 3N7UA 2H51A 4B47A 1U7ZA 2IBMA 4AQDA 1JNYA 1J22A 2ONJA 1M72A 1EFRA 4ZCSA 4ND8B 5KQRA 1O4WA 2JAUA 4P2BA 5DWDA 4KSCA 4DMGA 3IB3A 5EKUA 2RGNA 1XN1A 4GIBA 4DG5A 1LSUA 2JJQA 3LA6A 3G9XA 4G4SP 4OQPA 5C5DA 2FUNB 2PJUA 4YCCA 2V9CA 3W5CA 2YMQA 4JLWA 1TIBA 5DTRA 3QX8A 4GM4A 2Z6UA 2RGDA 4N5HX 1KBZA 5T5QA 1NHGA 2XBLA 4DCCA 2QTCA 5AJVB 1D09A 1EUQA 2H7XA 4WD3A 4IIJB 1WPGA 1ZYUA 1OYWA 1J23A 5CCBA 3G6WA 1IXRC 4CUJA 3CR7A 1NYTA 2O3SA 2FSPA 2PS0A 1GQRA 1HMYA 4TLCA 1ORVA 4U2DA 5CVCA 1E8NA 3DZIA 4JQOA 1PCXA 5FB3A 2HSGA 3RR2A 3HG7A 3VPHA 2GEBA 1A4RA 4FOLA 2X77A 5CH5A 5KZMB 3O2NA 1H1TA 1JVNA 4KXVA 3AO0B 4WNIA 3AUJB 3N8KA 4C08A 5A7FA 1ID8A 3SZOA 4PIPA 3HM2A 1TDJA 3LPNA 4MKHA 1CUWA 2VT6A 2WG0A 4WZAB 2J6BA 3NHFA 5K2MA 2QENA 1EPUA 5ANRB 4IJVA 2NM0A 3TLGA 3FRHA 7REQA 5K6AC 4YXFA 1SBIA 3QJGA 3HKEA 3ZD9A 3SAJA 2XMPA 2PVPA 2R751 1BVYF 2FWPA 3NBUA 4BWGA 2ATXA 1UK8A 5LQAA 3AT1A 3SI7A 3CGWA 1QAQA 4G8BA 4HAZA 4R0NA 4BVBA 3UH0A 4QDUA 1BO6A 1UJ6A 1RWNA 4D8VA 3DFZA 4R2JA 4TX1A 1Z7BA 3CXRA 2O50A 3L7IA 3LUJA 4MR9B 4QFDA 4WGFA 5TXGA 4B75A 4NCIA 4MGYR 4YAIA 5FCDA 3KVYA 1IN5A 5HFJA 3TK1A 4DV6B 4PSUA 4YR9A 3IR5A 4OHVA 3VQTA 4HNQA 3ER8A 5HKBA 2DB3A 2Q5EA 3C3YA 5ICSA 2I66A 1NNI1 3PF8A 3M70A 1TM1E 2ZK7A 3HY6A 5AKHA 1X0XA 4QJIA 5DGDA 4BCBA 3RADC 1ZG3A 3Q2KA 3U61B 3IHLA 4LTDA 2FGJA 1WULS 3OQ1A 2GKOA 4FZVA 4N3NA 4D44A 2P2CA 5JZ9A 3W34A 3SXJA 3HYLA 3RH0A 1L5FA 1XWFA 3BFKA 2QMUA 3FNHA 1T4DA 3HRHA 3QPDA 4FBMA 1AHIA 2EBFX 1TMKA 3F47A 3GA5A 1YDGA 3KEGA 2YHBA 3Q9UA 3WB9A 2JFZA 1DT3A 4YFYA 2XE6A 3NI2A 2GPJA 3WK7A 1IWOA 5EJIA 4ZV4A 3TQTA 3KL2A 1BE6A 4E6PA 5K8IA 1DKLA 1NBMA 1W93A 4M7WA 1FFXB 2DSNA 4O8CA 2OC4A 3FPLA 3PEFA 4KJZA 5MN4A 3WNCA 5LOVB 4JCCA 3RRYA 3ZE9A 2R5FA 5KOJA 2VDNB 2D7DA 5KYYB 1QPGA 3QK7A 4G09A 1TO6A 2VDLB 2FLVA 5GOZA 1DKMA 2AB0A 1IOVA 1QFMA 2H9AA 2WNSA 3DM9B 3ECSA 5TF0A 2IWHA 5GONA 2WJJA 1Q22A 3WB0A 2J5XA 5D6NA 3BSSA 3KUCA 4TUYB 2FFBA 1AS3A 2BELA 1P29A 2FMKA 4FFVA 4NNJA 5HW0A 1QO9A 4WFIA 4R1QA 4BECA 4C2TA 4I3HA 2XUFA 1CLUA 4LCBA 5H9VA 1P81A 1RADA 2G4CA 3NUQA 1T8TA 4GC9A 4QQKA 1KJIA 2E89A 3GT3A 3SLKA 1Q0RA 1XZHA 5T6MA 4B3DA 4X6XA 3KQWA 4BDSA 1UXOA 2EFCB 2W2LA 4HDOB 2EKQA 3O4VA 1UMBB 5AK6A 5I9MA 4GYWA 1B23P 2Q4RA 2FSFA 1VYHA 3WKBA 4NYMR 4U7WA 3N2YA 1ZOLA 2B1RA 4OX9Y 4XGQA 2R66A 1KZ4A 1L5HB 3EGEA 4XASA 3UTCA 2B8WA 1N6LA 1SVUA 2OXRA 4QOSA 4RD4A 4RZSA 1XZLA 5E8RA 4GQAA 3EFOB 4DLLA 3D1JA 2WJHA 2BDUA 5JCJD 5FI0B 4LHXA 3GGSA 1GKIA 2AXNA 1K97A 1Z4NA 3TCXB 2C1EA 2GN9A 2QKYA 3DPSA 1XDBA 3GEIA 3AHEA 4MUHA 3U7FB 1QGOA 1SBNE 3FTEA 2ZU0C 3V7FA 4WESB 2H2AA 2W2OA 4CKXA 4DCMA 3B3FA 1HV8A 3MBKA 3WZMA 1R6XA 5NULA 4RGQA 1GQQA 5GOTA 1ZI9A 2BTQA 3PWTA 3SP1A 4CDNA 1VGQA 1ZMXA 2VTDA 4NTZA 1GAJA 3L8CA 3RVNA 1WDKA 3M1YA 4D56A 4JBYA 1G7TA 1OGYA 1O9HA 5K0BA 4KNYA 1FDRA 2PS9A 2IEDA 3NORA 3WQHA 4YLGA 3QWAA 5FNVB 1BJTA 4KHPB 2L42A 1IY0A 4FCWA 2E3JA 4XQ9A 3E7XA 2C2WA 1IVYA 1M1YE 2CMHA 2JJ1D 2ZUCA 3BK1A 3Q3JB 2ODEA 4FE7A 4WHMA 1OIVA 5K8CA 5LYJB 2BSXA 3ZWMA 5KC8A 1ULSA 4H9GA 1VM6A 3ZI4A 1T5SA 2GOYA 4YPOA 3TSCA 2VK2A 3VNBA 1U99A 3QZUA 4Z7NB 1K8XB 1K06A 1P9WA 4TYQA 1SWWA 3IV9A 3SX0A 4C0QC 5JI2E 2FCAA 1GPMA 5E7IA 1NUQA 2Q5HA 3KEQA 4O1MA 2PZBA 2EZUA 4JIGA 4A6PA 5E1BA 5HFAA 4TRNA 1B41A 3FNFA 3SSNA 4KYVA 5EYPA 2CC2A 5ICEA 3MCZA 3O74A 5C52B 1Y8QA 3LWDA 4W99A 2IOHA 3DDCA 3SIWA 4UMVA 4G63A 4DYVA 1HSOA 3C5HA 3CSSA 4GVXA 4GRDA 5THQA 1JIJA 2WTBA 4WXPA 3IEUA 4Y2HA 3P4YA 5JNSA 2ZJYA 3MJDA 4Q3LA 2O2HA 4BNVA 3UA4A 3K15A 1U3FA 1UBCA 1AUPA 3FCYA 2IPLA 4BLQA 4W5RA 3I73A 2NTYC 2H2GA 3FCOA 3E9RA 2IPNA 5E3JA 3WGQA 3E22A 1YAHA 5LUBA 3B1FA 2ZLBA 3BB3A 4XX0A 2GN2A 3V7NA 3VJMA 3GPIA 2CXSA 4EHFA 4R3UC 4PSVA 1RZUA 4IIJA 1H93A 4UAVA 3COSA 2OG1A 3FYUC 2CHGA 4GSKA 1BX0A 3HS3A 5BYAA 5B12A 3NM5A 4LYJA 4YYZA 3CF6R 2Q8NA 1M34B 4ROSA 1C3EA 1PSZA 1NURA 2BFCB 3M6UA 3BKXA 4UVHA 2CDNA 4IXWA 4ND5A 4D9CA 4FM9A 1RWMA 3VR0A 1NKVA 2XNDA 3R20A 1H6CA 2I4OA 3DFKA 4YCNA 3O8BA 4NDAA 3SF8A 4HYYA 2HBQA 1CJTC 2ZPTX 1L8LA 4GECA 1SFRA 4OXNA 1CXZA 3UT5B 1NR7A 1ZK1A 2FPMA 5H3CA 4ENPA 2WHQA 4AN4A 1NM5A 4ARIA 3B3AA 1KAOA 1K8ZB 3GGPA 3NOQA 4NYJQ 2F9MA 1ZOPA 3CLRD 4ZU1X 4ODIA 4OA8A 1PLKA 1AOXA 1WB5A 3SHWA 4W1PA 4ARSA 2NZYA 2WHRA 3S70A 2AN5A 2O2GA 4TXJA 5BYBA 4I2NA 1PK9A 3GXBA 1B15A 3PUVA 2R65A 2QVCA 5EOVA 2FQYA 2GAJA 4MWDA 1FP2A 2C2OA 2FXVA 3FYHA 5IS2A 1V11A 1XQYA 2NSJA 5K03A 3BCUA 1GPDG 3TNJA 5K20A 4QULA 3LT2A 2F3PA 2HDNB 3LT5A 3RSQA 1BHJA 1WXFA 2HB6A 3SZLA 3ABIA 4UE3S 4ESHA 1Y7LA 2NU8A 2NV0A 2CLLB 2Q6KA 4B3IA 2ZE6A 4TTAA 2D7JA 4TSRA 4PXAA 1XZFA 5DTQA 1VHWA 1LTKA 2XAUA 2KPOA 4JLNA 1BSVA 2NTEA 1SXIA 4QASA 3AQIA 3A2NA 1M7HA 4G0MA 2A0YA 3T3IA 4B35A 5YASA 3V1UA 2HXSA 2JAQA 2VAXA 4PLGA 4FC6A 2R6AA 3ESCA 3G23A 1YRBA 3A31A 1MD9A 2B3TA 2JARA 4DBZA 4OI0A 7MHTA 4HAIA 2RHJA 4LRUA 4LAFA 4C6HA 4YRFA 4MKFA 1UMBA 2YQZA 3NTQA 4INAA 3P9XA 1MJFA 5FOXA 4LDZA 1M67A 4DM4A 2DR2A 3FTQA 1TUBA 2E37A 3QEMB 4LXUA 1E2IA 4R7GA 4UTVA 5EJ9A 3GAZA 3G2JA 5D7BA 1G3RA 5JD4A 4L8YA 2LRHA 3ZK7A 5BXYA 3F5QA 3GLQA 3CH4B 4MS1B 4UVIA 4HGNA 3RYIA 3TEJA 4A03A 1P44A 1PQYA 2WKQA 1Z47A 1C5KA 1YCDA 1C7RA 3DZJA 3M6VA 5ALNA 5ESRA 3W8DA 1QAOA 3I0NA 3IT0A 4RULA 3VZBA 2QGZA 4M9UA 4ZZ2A 4LF9B 2C0CA 1EK0A 2FPPB 3PJFA 4EPVA 1T5HX 3EC7A 2WZCA 3GVHA 1ZS9A 3L8EA 1WF6A 1PZGA 3L8YA 2ZATA 4HWSA 3NO4A 1V96A 4TROA 1YNOA 3TMKA 1W2GA 3IAM6 3H1EA 1ECJA 4FGSA 1JEYA 2GQ0A 3LGAA 4BLTA 5DCLA 5ICCA 2GZSA 1LNQA 1NFRA 2OLEA 1EUZA 5H16A 4EJ6A 5FOQA 3DR5A 2DWQA 5AUQA 3JYQA 1WTCA 3ESQA 1DQZA 3KOYA 3OZ7A 3EVAA 3U09A 2ACEA 1QFJA 4EHJA 4Y1GA 3TDKA 4F3KA 7AT1A 1FS6A 4JOBA 4LZZA 3QYAA 2PKCA 4F06A 3QOWA 3IAEA 1YQUA 4HGQA 5FNVA 2BGMA 2VSOA 3ABSB 3ITNA 3TW4A 4UHCA 5EWJA 2GUGA 1W4BA 4PYJA 1ZIPA 3IMCA 4OUKX 2J8ZA 4ZZ3A 3KDSE 1RTTA 2IV2X 3WGTA 4KLRA 4L6IA 5KYWA 1EJ6A 2PFGA 3QVGB 1Z7EA 3AHGA 2EKLA 1SC9A 1U63A 5JBNA 3WHLA 3QSYA 3RYHB 1SUIA 3OJCA 5A3VA 4CIAA 5LR6A 4CDRA 5IULC 2XKKA 4EF4A 4BO1A 1KQGA 3NGLA 2GRJA 4XD2A 3U4QB 1RC8A 4J03A 4MQLA 2YWHA 1FU8A 4LF4B 3NWJA 1ZUD1 2Q0QA 3SQDA 3ZXUB 2PIAA 2H9IA 3JYHA 1NUAA 3LX6A 1JR2A 3ZZMA 2J3JA 3OKAA 2RGYA 2A58A 4MYTA 1SVKA 2RB4A 4KQHA 4NS1A 4ZYTA 1KI7A 3F97A 1G9XA 2DR3A 3HH8A 1W0KD 2J3EA 1TZCA 3KZVA 3ZWDA 4UD6A 3P0JA 1WHTB 3H9GA 4G0XA 3TNLA 3VSCA 3SM9A 4DNQA 3ZCQA 4NZMA 3R0VA 2XJ9A 4JCOA 1SRRA 1JKIA 2PRIA 5JXJA 1IWPB 3AIKA 3GVXA 1PX2A 2ZIZA 2FEWB 2ZTVA 4EITA 4UM8B 1KI3A 4NRDA 3VH2A 3STHA 1P4SA 4Q4DA 2W43A 4RMJA 4GE3A 3LT0A 4MAMA 4MMXB 1BG6A 5DXJA 3AUUA 3EX7C 4LJYA 2R25B 2PKQP 4WZZA 4TYNA 1N1GA 4X1YB 4R98A 5AJWA 2ZIEA 3LRTA 5SZIA 2VDPB 5I4BA 1U98A 3Q4GA 3A4LA 3D6NB 4N54A 1PGJA 4J0KA 2DETA 2NVUB 6YASA 5FPYA 3F5SA 2I55A 4DAEA 3JQ7B 4D80A 2RE8A 1LDMA 4RHCA 1G5IA 2NQ2C 2WSLA 3I6QA 3BMCB 1HQKA 4KXUA 5KDDA 2ODQA 4IOJA 2PH1A 3BH6A 3JRWA 1SVWA 3PBKA 1WL8A 4LC9A 1Z08A 3F6CA 1KVSA 3Q1KA 4IIYA 5JS6A 4KIGA 3G0HA 3QU7A 3DL4A 4G3XA 1FP7A 2Z3VA 5DBHX 3WDMA 5EMNA 2CLMB 1YIDA 3TF5A 1Q84A 4MW7A 5SZKB 4FNOA 1DRWA 4BNYA 1IRIA 2L18A 4S24A 1P0PA 1L4BA 1W19A 5F4ZA 3SKYA 2FY8A 2DHQA 2HUNA 3I04M 2XKJE 5JD6A 3GLVA 3NCTA 3Q5DA 4JEIA 4YCLA 2WKWA 4NV3A 5E9JA 1Z5UA 3U5TA 3MT0A 2O8VA 5LYYA 2ZS7A 5HSGA 3UAYA 1T36A 2JW5A 1DT5A 5LIRA 1YDEA 4GWLA 4OP2A 4LVOA 3UZUA 5LKAA 1VP9A 2YN0A 4Q9LA 1FSFA 2YXDA 5C1DA 2IYZA 3P2YA 5KYUA 5IHPA 2FLKA 2VDVE 1DPFA 1K5GA 2G63A 4MV3A 4UAJA 2NU6A 2KLHA 4X1KA 1UIMA 1ZD4A 5ALSA 2WR8A 1NBIA 5E9QA 5IM4F 4MGIR 4QWMA 1L7NA 1K6IA 4Q1DA 2OC9A 2ZTSA 4MAFA 4D3DA 1QH0A 3C6KA 2JBHA 4M4SA 5CGZA 5DNAA 1Z4MA 4Z2AA 4NECA 3UWKA 2BM8A 2JHFA 3GRRA 3VUEA 2IGTA 3I6YA 2V03A 1P0IA 5CLQA 2OFPA 4DN6A 2GHRA 1QIGA 4DA4A 2FPLA 2EARA 4LTMA 1W36D 1B74A 1MQ8B 2QJFA 2ZIAA 3HN7A 2WJIA 5K1ZA 2HMYB 1Z8HA 3REGA 1US8A 4MHTA 1MQ9A 1QVZA 1WXGA 4MWEA 5BQ5A 3Q2IA 3TE6A 2CVZA 4KN8A 4EY4A 4BIMA 1Z0FA 4XQCA 3OIDA 3VYTB 3MMZA 2OVBA 4Q7MB 3QIAA 1XA4A 4JYPA 2BHNA 4KH1A 4A9AA 1P7ZA 4UFPA 1XEFA 1DXHA 3I2YX 4FNGA 4YO8A 4GSLA 3TGWA 5LQCA 1KIFA 1II0A 2FMHA 2XUOA 2VUSA 3EAQA 2D3TA 4G8JA 4GHWA 4RNDB 4EKDA 4AP6A 4EKEA 3GROA 4MVJF 2PZKA 4MV9A 1DZIA 1VL2A 2G25A 3LQ2A 3PIDA 4TN5A 2WILA 2DUUA 4R3NA 2IYVA 3HMKA 3QW2A 4LJ8A 3C97A 3L1IA 1JZTA 3T1OA 1ZXXA 3AEYA 2OHIA 5T8KA 4GT1A 1MQSA 4PQYA 2C77A 3GFQA 8ABPA 2DVMA 3AW9A 3TMAA 1BX3A 3JW8A 2XCTB 1A9YA 3I9NA 1YKGA 2HJSA 3ZIUA 3KTFA 4LGVA 2AJTA 3GUUA 3PNVA 2YH2A 1A5AB 2ID8A 1M1ZA 1XKLA 4US0R 4WKBA 3TGLA 1E98A 3M6IA 1Q77A 4I66A 3DE6X 3KB6A 2VPIA 1ODCA 1SCAA 2BY4A 2EX4A 1P1KA 2QNRA 4PNPA 4RK4A 1EWVA 1Y6GA 3FI9A 3E3NA 1PSWA 2XMZA 3E53A 1G3UA 2OBFA 4M8IA 4MDYA 1D8TA 2IA5A 1M75A 3H75A 4XYGA 5TVGA 2J4DA 4DBLC 3F90A 3ZZ1A 4HFJA 3WNQA 3C39A 1CVIA 2EKPA 1ZMOA 2VK4A 3DXYA 5AOAA 1AKUA 1ZI6A 1QUEA 2Q3EA 4EZBA 4B3GA 4WZBB 2NU7B 2Z5FA 3I2HA 3WO1A 1LNZA 3FFAA 3INGA 4E5SA 1J5PA 1QFZA 2XQVA 2YHIB 3A9VA 3PEUA 4WTOA 4ZU3A 3VOBA 4JS0A 5KTRA 1UWKA 4QYWA 4B3HA 1O6BA 2WT9A 3NHJA 4KVFA 4ZHQF 2QMZA 1CE8B 2FVYA 5AKXA 2R8EA 1U2GA 1Y8RB 4M1MA 1DQSA 1Y4UA 3T7AA 2Z8YM 3D54D 4S04A 3I6ZA 1VA5A 5DLYA 2ZRFA 3LP5A 4MZXA 3EJWA 1VJ5A 3ILXA 4ND2A 4UCQA 2YYYA 4CKZA 2PJRA 1BA3A 1SBHA 1TUIA 2MSLA 2GO7A 4KMRA 2REQA 4JLPA 4DCOA 2YOHA 1KEUA 4E1BA 1MO5A 2Z8ZA 4OP1A 3GLIA 1MAVA 4FR0A 5JQGB 2F8TA 1UP6A 5AWFC 1ZH8A 3RRNA 3WJAA 1NJ5A 5PNTA 1QLWA 3TXAA 9LDTA 4BYMA 4QJ4A 1DJNA 3ZCVA 1G5TA 4NR0A 1N9GA 2VQFB 1QYDA 2B92A 3D6HA 4OQLA 5D5HA 5C0OE 4M38A 4B3FX 1OXSC 2WTXA 5LOVF 3IXMA 4R5HA 5F2EA 3THYB 3L6UA 5IJZA 1QYWA 3DKRA 3FYUA 4L85A 3M8KA 1VJDA 4TTPA 5LUAA 4JI8B 1F2VA 3CKKA 3EPLA 1C4XA 3D3QA 1GDTA 2NO7A 4OFWA 2CVQA 1KZGB 4MKXA 4QGSA 4KKXB 5IWAB 1M34E 4ZEVA 1YE3A 4MJXA 3N53A 2BD0A 2X15A 2RGEA 5DN6D 4RVFA 1QH9A 5LZ2A 2AOWA 1VTKA 1HNNA 1EDBA 4LJKA 2GVDC 1E6LA 1Q92A 3PDWA 4YRNA 1N2GA 1XLWA 5ARDA 4DV5B 1A97A 4YPVA 4MO9A 3T0GA 3K5WA 2JB9A 1YR3A 4WWHA 4ZQGA 3A4MA 1H6AA 1LGYA 1W0JD 3OOWA 1MCZA 5EESA 5JDCC 1N0VC 5K99A 1E3EA 1MT0A 2G04A 4RHYA 5IJXA 3WLHA 4NHEA 4WN9B 2XWSA 1LFAA 1HMPA 4LMBA 4U7TB 2GZDA 1LJUA 1UT8A 2OECA 5U4QA 4QYSA 1A9QA 2A7XA 2GYYA 3AHHA 3T7SA 4LEIA 4C5BA 2JFBA 4ZFNA 3O2JA 2G9VA 1RBMA 2VRWA 2VDMB 4ND4A 4S2UA 3C70A 3K8YA 1IY2A 3X1JA 4CLXA 2YW2A 3D8BA 4M7OA 3OPXA 4ZYVA 3GEGA 2ZIGA 3ESAA 4ENRA 4MIYA 3T9CA 4N8DA 2JJYA 5JCOC 3B6JA 5DNEA 2ALJA 2QD1A 2A1TR 3LX4A 4X00A 3D9QX 2Q5LA 2EW8A 2GTIA 4G41A 5HYVA 1J0XO 3ZU3A 4DJJA 1JVBA 4B9EA 4U2GA 3W04A 1ECGA 1I1QB 3B6KA 5MGBA 2SICE 4CLRB 2ACKA 3AERA 2JGKA 3EXAA 3T5TA 2NACA 3OE7D 2GAFA 5AKYA 4C21A 1V6SA 3L18A 1RLJA 2EQ5A 2E18A 5KAPA 2YV2A 1P2BA 4PSCA 1DU4A 4R51A 3GG2A 1XK6A 2VTBB 4MGHA 1V9CA 4WCFB 1XLVA 2IP4A 2ZS9A 2EFHB 3BD6A 2QGNA 3C6MA 3LTEA 1JA1A 4FKMA 1BS2A 3OE7A 5B3JA 3KR2A 1I7QB 1NLFA 3CPEA 2ZROA 1CJUC 3DEZA 3GJXC 3R5TA 4O1HA 5B3KA 5BR8B 2GMWA 5JIBA 5TIIA 4HBZA 2Q2QA 1E2BA 2ZQ5A 1WZEA 1CRLA 5KOHB 4W5WA 5EIAA 1BYUA 2O05A 4JX8A 4AURA 3R0IA 4FN4A 1QIJA 4KI0A 2VC2B 3UNXA 1NQAO 2YRWA 2VSNA 2FZ4A 3DUWA 2P9ZA 3PC8C 3BXGA 4FCTA 3GCWA 1YA8A 4KDEA 1P5ZB 3VPXA 3VZPA 3I34X 2BEWA 1EUCB 5AJUA 3PX2A 4A5OA 3N58A 2J6HA 4HDKB 2PYDA 5HGJA 4K6HA 2V7WA 1JQEA 4FMCB 4LVUA 2VXYA 4ADSG 4M0CA 1P1HA 2PVCA 2PUAA 3HACA 1JMYA 1XTSA 3Q3VA 5BW6B 2J87A 4FZRA 1UC4B 2FMFA 5FBWB 5AUPB 4REQA 3NTVA 3K1AA 1MX3A 1RC1A 1XZ8A 5ALXA 1MJGA 3UO8B 3D4OA 1E3LA 3OPQA 1HLPA 1M2VA 2CCJA 4PTLA 1O95C 1P45A 4NFHA 5E2BA 1YR8A 3TSWA 5HWSA 4DDKA 1ZD3A 2BEVB 2AN1A 1PJZA 1M2HA 2AX3A 5JALA 4ZTBA 4NXMB 2B7CA 3DC7A 3DNFA 1REQA 3HYTA 3O92A 5AW6A 2VTVA 4YRLA 1BN7A 1T6YA 3W79A 3ZY2A 1YQDA 4ARAA 1YK0A 1WY5A 1YQEA 5F33A 1EA7A 2WWYA 2J32A 1MW9X 5CG2A 1GGMA 4TMWA 3I0ZA 1UMCA 2VWQA 4NE9A 1RAAA 4PYIA 4Q47A 5AYVA 1U4NA 4WEQA 4M7RA 1LPSA 2HHAA 3DPIA 4BFCA 4BZXA 3F9IA 2V55B 1CETA 2HJVA 3AJRA 1Y6JA 4ZYZA 2FR8A 2QSUA 1SOAA 5F9MA 5AI9A 4IFTA 4H15A 3M82A 4RF3A 1BJRE 4KAFA 2P40A 1ZAKA 3AR3A 2HBZA 2PLFA 3DE5X 5FUQA 3OZAA 5HIAA 1GT6A 3OT5A 3MTEA 3RS7A 2MSNA 4YNBA 1X19A 3F67A 3GP3A 3KVRA 3QKRA 3VAAA 3LAWA 4ESEA 1FYEA 1UQUA 1YFKA 5F5LA 1Z34A 2A7QA 2G72A 2QV7A 4MQBA 5IN5A 3CX4A 1LVGA 1RXEA 4FE3A 1YU9A 3S2GA 2DE0X 1RI1A 4MP6A 1LDBA 5FD8A 4EFDA 1R12A 4R81A 2FPKA 3KZNA 3EEIA 1NTRA 1QVWA 1XNJA 4MO2A 4M9QA 3CZ4A 5D5QA 1TYBE 2WSMA 1BROA 3JD4A 5DRYA 1F2UB 3ZHZA 1MZPA 1HEYA 1MC5A 1U2GC 2I7VA 4HSEA 5A05A 1R9NA 2W6QA 4FKBA 3WLSA 3B5JA 3HJGA 2O4CA 1L8XA 4TZTA 4WUVA 4FDVA 3EVTA 4OTZA 2ACVA 2BV3A 3IEIA 1V3QE 5C5IA 7REQB 1K7FB 1EDOA 3AG6A 1F8GA 2RJNA 5L9AA 3SWWA 2QT1A 4G8DA 4G5XA 1G41A 3P94A 3EXIB 4HXGA 4QLAA 1SC6A 2ZKIA 1GL3A 3SJCA 4MQ6A 3S2ZA 1WMAA 4KX3A 4UU1A 1RRCA 3DBLB 5GM1A 4ZMSA 2QTMA 2ZR9A 3K16A 2HQ1A 1Z6YA 4YXWA 3KELA 4RVSA 1KDZA 1UKYA 3RJ5A 4C05A 4Q4CA 1J0DA 2PBLA 2WVHA 3KNZA 2JEOA 5DP2A 1KDPA 1GZ6A 3SMQA 3MHTA 4WI1A 1P91A 1OMOA 3SHFA 4KTVE 1NQTA 4B44A 4YJDA 5TMBA 3HFJA 4UNPA 4HF7A 4JDPA 2H16A 4GG1A 4KXLA 2W6ID 5ALLA 4ANFA 1AN0A 3L40A 3O2QB 3ZWKA 1GQSA 4GBGA 5JADA 3ECCA 5B4TA 4FI3C 5JRZA 4AFNA 1OI3A 3ENWA 1GZSA 5J4VA 2JIZD 2VHTA 5JSYA 2HMTA 3NV9A 2QV0A 1WNFA 3DEYX 4WCVA 1U94A 3WDKA 4UBOA 5FOVA 3AB8A 3H5TA 5IZCC 1BS9A 1Q3TA 3HBLA 3BWBA 4PX5A 3HQ4O 3COWA 3TPCA 2RB5A 3PWZA 4US1R 2FRDC 3HB4X 3QE4A 2I3AA 4DRXB 4EQZA 3R8FA 1E3MA 4RETA 5JBIA 4U6SA 2XGMA 3R3HA 4II2A 3Q2OA 2RARA 2P77A 1MNAA 4UBKA 4W1RA 3RBZA 1TFUA 3WA6A 1NLUA 2V7QD 3T4XA 1XJ0A 2XUHA 1D4AA 1P0QA 2BMWA 3TG2A 5KNCD 4E4RA 3NAQA 3L93A 4ZRDA 3RTBA 3IDZA 2JANA 2AKYA 1NWCA 4K8OA 1OBCA 1YCFA 1L2TA 1SZCA 2P67A 4QQNA 2G67A 2NZXA 1RKUA 3EGDA 3OY2A 4IQGA 1OFTA 1QHFA 1KORA 1LSSA 1BQ4A 2W2KB 2BBOA 4TLEA 5TS3A 2E48A 5HKOA 1G8KA 2A5JA 2VPZA 2WAYA 2WJVA 3MCUA 1JDSA 4TS1A 1OXMA 3RFVA 2G0AA 3DAPA 2QRGA 2JAPA 4H7HA 4LHSA 3LHKA 2GZ2A 4K9RA 2Q5CA 1RPTA 2QBYA 4CMEC 5HUQA 1SKBA 2UXCB 1X13A 3GN1A 1U9CA 3I04A 1QGDA 1LPBB 2BFDA 1YS2X 1O2DA 2EVWX 3CLHA 1ZNQO 2R96A 1IDN1 3RK1A 2ZWVA 5HA5A 4W8OA 4XIIA 4O1IA 4XM2A 3ZEAA 4M8SA 5LWHA 4MROA 2IEAA 3TVTA 5FWDA 4JI4B 3R7FA 4C89A 3C3CA 4M89A 5FBRB 4BRSA 1HSZA 3GZTB 4ND8A 5IAEA 3VBCA 2BISA 1LNSA 2QAGB 5CFMA 1KA9H 3FCSB 5LD2B 2DFDA 2YUTA 5CVEA 4Y1RA 2A3NA 5LQMA 1TC1A 3IXLA 5EWLA 4PC7A 1CRWG 3D6TB 3BN3A 3MELA 4NZPA 1IM5A 3TBKA 3WBFA 4BKRA 5TMPA 1EG7A 2HTFA 4G5FA 2TMYA 4BEJA 2PJZA 2W2QA 4TVOA 2QTTA 2R00A 1SBTA 2CXNA 4X61A 5J59A 5IG2A 1ADCA 2MINA 5B6JA 3IVMA 1A8IA 3PS9A 3E9EA 4HDQB 4LVNA 3HDQA 4Q16A 1OZGA 2G1JA 3R4VA 4HVAA 4FBGA 5DSZA 1KQ3A 4BAZA 5L95A 4YB8A 1JH8A 2CJYA 1TMOA 1W25A 4HLDA 2Y71A 3TZ6A 1I94B 1FYXA 3K1JA 4GFDA 1PT6A 3HBFA 5IUKC 3VGPA 2IDJA 1O57A 3FNIA 2NUAA 4ARBA 1H0SA 3C7CB 1X9GA 1VMIA 2A8YA 2WTMA 3NDRA 3K0KA 4DLUA 2JJ8A 4PWYA 5EQFA 2NPOA 2BEKA 2IW1A 2PZJA 2Z83A 5TGTA 2D3WA 3DCIA 3F8WA 3FNBA 1G4HA 1U0LA 3LUCA 3HK2A 1DRVA 2OWDA 4KQ2A 1JXAA 4IICA 3WGJA 3LY5A 1JEAA 1E4VA 1NIPA 3HA5A 3PPWA 2J9RA 1NQUA 1E1LA 5EI5A 1PHRA 2WZBA 3H2SA 3P2IA 5JNWA 2G5CA 4E1VA 2XNKA 5CAEA 4ETIA 3NAGA 2A0FA 3PXCX 4MTCA 1YAJA 3UJNA 4BPBA 3F7NA 4ZAVA 3SBXA 1ZM7A 3G2PA 5BMVF 1GEEA 4GOXA 3LSYA 1UZUA 3T3DA 4GDFA 1TAUA 3W3AH 2C2XA 1UK7A 4TWZA 4B6EA 2OK8A 3P52A 2GR9A 5DTMA 2PSJA 2XWBF 3A32A 3CIOA 5F76A 1C0LA 3DB2A 1VSTA 1NVAA 4O2BF 3SIXA 4PLVA 1KVUA 1KHHA 1Q7RA 4MRRA 3WISA 1MEJA 2AG1A 1JXQA 1VYUA 2FR8C 1EXWA 3HU3A 4OEHA 4RYLA 5E7QA 3UXHA 3WKAA 1FUEA 1GJRA 2Y4OA 3C8HA 3QKRB 2YIDA 4XVQA 3QI2A 5EWMB 3V42A 3LBNA 3M33A 2I80A 3FUUA 1A0OA 3C0KA 2ZYDA 3FNRA 3IH5A 1U2ZA 1L4FA 2BCJQ 3LA8A 2JA1A 2VJMB 4NPAA 1HLFA 1FJXA 3RVSA 2WQ6A 1UWVA 2G7MC 3M4ZA 1UMDA 3L9WA 2EC5A 4YIHA 2ZVPX 3RLFA 4R9VA 4DLBA 2DOKA 5DX1A 4KOEC 1N5LA 3R7WB 5EJFA 1SVSA 3OJ0A 2PKWA 2PS1A 4M36A 2HHJA 4XCQA 5LZ9A 4YV2A 4N5MA 3KQLA 3THSA 1OYOA 3NHYA 3WYFA 5KEIA 1JPNA 1RRPA 1XF9A 3WGUA 2DM6A 1PFWA 2FN9A 2X7HA 3ABOB 4O6VA 1CF2O 1XI2A 4PG6A 4PZLA 5FPSA 4BDTA 1IZ0A 2RHLA 3O94A 4I9GA 3ZD6A 4K26A 4EB3A 3B5IA 3K4PA 1FK8A 2BKXA 4D0SA 2ZR8A 4CDGA 1JFTA 1SQGA 4JB3A 4PRZA 5BOSB 5CA1B 2XTAA 1EK5A 4WA7A 1C3VA 4XOUA 3A9SA 1H69A 4MMZB 4EM6A 3USZA 3COPA 4Z4HA 3DVAA 2DPYA 5I51A 3ZV6A 1TAGA 1RJGA 4RKRA 4K2AA 4B81A 1I7PA 2B69A 3NYRA 4ZVLA 2EWVA 3H1GA 1D2AA 3GUCA 2W98A 2W6ZA 4L16A 3ZGNA 1LF5A 1JNXX 3Q8WA 5BORA 2POCA 2QUIA 5BNTA 1MW8X 4FPXA 4DPLA 1BHO1 2XUGA 1WDWB 3FD8A 1AV6A 1NKSA 1XSEA 1U7XA 2WA1A 4H7KA 5BOVA 4C6SA 1YQWA 4F3NA 4L5JA 2WM3A 1SXQA 4S1OA 4QD3A 1YASA 2VDJA 1S9HA 3KQMA 1CZOA 4YPFA 5FOWA 5TSDA 1MA3A 1WS6A 4TS9A 3VNUA 1ZW6A 3T12A 1WXWA 3H13A 5ALJA 1J0BA 1B6GA 1EGHA 5DYIA 3EE6A 1RS0A 2Q0SA 1MOQA 3EOZA 3P9IA 2KYRA 4OQQA 1JQ5A 4IJ6A 3C3JA 2X0KA 3K2IA 4MPRA 4UD2A 1VFNA 4OK6A 5CVDA 4LHWA 3IP1A 1M8GA 3IKTA 1SU4A 2RD2A 3DLTA 4KN9S 1AC5A 3OAAD 3X1MA 1NFQA 4P83A 1K2VN 1TT7A 4ZI2A 4GOJA 4M37A 2V4ZA 2ZXFA 1T8RA 1Z5GA 3V7WA 1G6OA 3P19A 3NIFB 4I9HA 5CTAA 3ZV4A 5JEDA 3RJTA 5B37A 2I7CA 2GEUA 5FL3A 4RAQA 1SB8A 1KDOA 2D8MA 2RH4A 3BDIA 3V2IA 1MJ5A 5CLFA 4KRYA 4B7UA 4TV9F 4KPUA 2WYIA 1VPWA 1G21B 1NC3A 1JEDA 3KJFA 4JL6A 4D9HA 2WE7A 4MWGA 4RTJA 1E9AA 2NT3A 2KMLA 4B7XA 3R0QA 3OCWA 1NZDA 2WWGA 2BZ0A 1RJDA 2B25A 3H9BA 1UJ4A 4AJOA 4TL9A 3WGZA 2V7EA 3K9NA 3EXG2 1EK6A 3T06B 3L8DA 1C9DB 5JLJA 3IUPA 4GNKA 1ZLYA 4QOJA 1E92A 2ZT7A 1W85A 2EATA 4F4UA 4QGGA 5KYGA 4OIMA 1JHPA 1CR0A 2Q3CA 4D8XA 5IARA 1OH7A 1D4FA 2AHRA 4I1YA 4OQMA 2BFEB 4L6AA 5AKZA 1N2IA 1O95A 1A82A 4OB6A 5DFAA 3OCXA 2FJUA 4ZCPA 3BYZA 2ZUTA 1OZFA 4LWQA 4NY1A 1C80A 3OO0A 3N3AC 5HPYB 4CR8A 3DDSA 4DMFA 1T9BA 3PG5A 1RQRA 4BHTA 2D2VA 1MX1A 4TOIA 4DJEC 1BWQA 2WIDA 1BFKA 1G4AE 1Y6QA 3QI7A 2XDWA 2JGEA 3EXIA 3FN4A 3ILVA 3ML1A 2DFTA 4JNKA 4YJHB 1FRQA 2A3RA 1ACLA 2AZTA 1QYVA 3NTRA 1CUYA 2FEPA 4I1VA 3DQZA 3VU8A 1FL9A 2VDRB 5K4GA 2Q3BA 1M0EA 2VP5A 3W1WA 4EG0A 1A7KA 2Z1DA 1DO8A 1AMNA 1NF9A 1VCHA 3FSGA 1N2SA 2IIBA 3RT9A 2EHJA 4Q1EA 1BCSA 4BWYA 1TKCA 1LU9A 1RKVA 2V7VA 2VYVA 4HL6A 3UHFA 1R88A 4BLPA 4U4AA 2N42A 2QAIA 3GW8A 3BORA 2C92A 1QIKA 1USGA 4AUNA 3HUUA 4PX2A 4U8GA 2PFKA 1ONNA 1OBFO 5ELLA 1R0XA 2HJ9A 4L95C 1AA6A 3K0BA 2ZM6B 3DTVB 3S68A 3LP6A 2VAPA 4S1TA 4RC9A 1J2UA 1QK5A 3UHPA 3AC0A 4ND7A 4X1OA 4YP7A 3RSOA 3MTGA 1THGA 4BMSA 2HR1A 5F9FA 3RFTA 1XZKA 4I99A 4RHXA 1ADGA 1M74A 2BGJA 1ZI8A 2X8JB 3LY8A 1JDBB 3REQA 1SC1A 1IN1A 3Q5EA 1YXMA 3DDZX 5CLGA 3L7JA 4DGQA 5HZGA 1UZLA 1GNLA 3HCCA 4XWTA 3JATA 3R7WA 2FQXA 1WDMA 1CRQA 3D8NA 4LPSA 2NUPA 2WSIA 1FA9A 3H3JA 5EHQA 2H07A 2I78A 3UWSA 1DAIA 3EVZA 3HCFA 4ZAZA 3VR2A 4KPYA 4MP8A 4ISBA 5CNIA 3ILHA 3ZE7A 2LTAA 1F7VA 3BSWA 2R4TA 3P71T 1L6IA 3Q15C 4R16A 4ZARA 5FA5A 3K0SA 1T9ZA 5DLQC 4JR2A 5JNLA 1Z6AA 3MWYW 1WQ4A 4JHLA 1IB6A 2PPLA 3FMVA 3PGMA 4C0HA 4KV7A 1N2CE 3A1WA 5B1DA 1T91A 1KJ8A 2GM4A 5BSEA 1NG9A 1PGOA 1U81A 4HWPA 5JZSA 4NZNA 1E6UA 2TRSB 2QNBA 4TM8A 1FU4A 4O4IB 1C30A 3QWIA 3KJGA 1DX6A 1EFDN 1J06A 4AT1A 1IJBA 4LQ4A 2VDOB 2FEOA 3WKCA 3TD2A 3MCWA 1ZR2A 1N6IA 2XGJA 3COVA 3LD9A 5P21A 3VRHA 2BONA 1EFHA 4W4TA 2WMNB 4BJ1A 4KEAA 3AY3A 2RKWA 3CZAA 2O2SA 4C4YA 2ICAA 1T2VA 4XI9A 3QU5A 3HY4A 4PLTA 4ZYYA 1MFPA 3IVRA 2VPTA 2ZRQA 4J0JA 5C51B 5H4HA 2G09A 5KYUB 4K0KB 1PDOA 4R68A 2B4TO 4PZ0A 1B3BA 5EKSA 3I8OA 1TJ4A 1F8UA 2ZRCA 3CWCA 3IQWA 5DBOA 3EZ6A 3GJTA 2ZANA 3PDIB 4G2TA 2ZAYA 2IDKA 2D4AA 4OU4A 1KEPA 4RVGA 3VR4D 1AF7A 2IE8A 3UWMA 1ZVVA 5BV2P 3UG7A 2XDAA 3MQ2A 4JVMA 1GU0A 2AZMA 2VHUA 3B3QA 5J4KA 2LPMA 1L4NA 2IPAB 1E61A 2COUA 3DO6A 3RVBA 3CJTA 1OWMA 3DZCA 3VYVA 2A9VA 4IUBS 4P7KA 2BWJA 2CLDX 3CRW1 3R5JA 4BMNA 2VO1A 5AVKA 4JJKA 3IQXA 3SR4A 4D9KA 5A6SA 3A8TA 3KFVA 4KSYA 2EL9A 3PGVA 1GU1A 3AUAA 1UPUA 1GQ2A 3EXHB 3P96A 3RRJA 4LWOA 4ZYLA 1L8OA 2DUMA 1T0PA 4AKHA 4FMBB 4IG9A 2XQIA 2Q3LA 3V97A 2JEZA 4WK6A 2EP8A 4I36A 4YMSA 4BATA 4A82A 3GEMA 3OCYA 2XCQA 1JKJB 2QLNA 4GOMD 4MV1A 5K3DA 2PV0A 5IEJA 1CC1S 4ECEA 3CH5A 4LJSA 1K7SN 4WPGA 5KYVA 2O5VA 1KOLA 1NBOA 1VKZA 1Z4PX 2WKSA 4L4ZA 4P86A 4JEUA 4DDVA 1AB5A 3FSRA 1P2SA 1QF9A 1ST2A 5KNBD 1LH0A 2ZJ4A 2WQ7A 3I58A 2AG6A 4GE0A 2WVJA 1M8PA 3DBLA 4ARZA 4C7VA 3DOEA 3TG8A 3DLBA 4MSUA 1GRVA 3EXEA 3KSZO 5JJBA 4G0WA 3JD2A 2K7ZA 2GJKA 1SO8A 2R47A 4KQKA 1U2SA 4FFDA 2B6NA 3GMTA 4AP9A 3HJFA 4KH0A 2A0UA 2HCTA 4KLAA 2HO5A 5HJ5A 4RE6A 2LE0A 4EEXA 1WVMA 1JHVA 1MB9A 2JI8A 1D4OA 1VI6A 1YKSA 5DI3A 2ATIA 4BZQA 2HU8A 3KZCA 3PHBE 3S4YA 4LJRA 1GFIA 3HEAA 4JOCA 3V4SA 5JMTA 1GLNA 1NVVR 3OFKA 1U7OA 3AR2A 2P9BA 4AJNA 3EZLA 4JT2A 1V48A 4D1YA 2RCNA 2FJ0A 4RSHA 1Q44A 2LDBA 1U0FA 1SCUA 5A5GA 2RAVA 1DUVG 4OP3A 3UK2A 1BHSA 1E3DA 1R6AA 2DUWA 2EAUA 1AUVA 2YJ3A 3C48A 4MCJA 4D98A 5FR2A 3IAAA 2W6MA 1TQ4A 1ZK4A 4RAOA 2A1TS 4LG1A 1W9MA 3FCXA 1RI2A 3OFVA 2AEEA 1CD5A 4M0UA 4Q01A 5CM9C 3SC3A 1I33A 3ZWYA 4AUMA 3KRTA 2WHPB 3KCQA 1A69A 2C8JA 4I50B 4QOGA 2B1JA 1FLNA 3RIMA 5GADl 3SFZA 2VZ9A 4PSDA 5SYNA 3DGEC 3S5UA 6CHYA 1A8PA 5F73A 3O3NB 5K0FA 2X8JA 3REQB 4DM7A 5ITZA 2AZ4A 1PJCA 1XK7A 4XH9B 3EA4A 5KVSA 3I9JA 4XPZA 4EVIA 5J4LA 1KEEB 2P8JA 4ID3A 4UBJA 3E2MA 2WU0A 4ARCA 3KWFA 2AK2A 3R5KA 4RA9B 1F3OA 3GNLA 2WA2A 5AJXA 4H59A 1JAZA 5IFLA 1BE0A 3PJRA 1QO0A 3JQCA 4LZOA 2HZBA 4G0QA 4C5CA 4Q3BA 4RTQA 1JJ7A 1E2MA 1U8XX 1J1UA 2I2WA 1E58A 1KF0A 2RHRA 3MJFA 4G5OA 3KXPA 4Y6GB 1YZKA 3LKBA 4HH3C 1XJWA 2OG2A 2RHTA 3KJEA 4TXNA 5EEHA 3OJLA 3GRYA 8ATCA 3CUWA 3GYGA 1T36B 3T95A 3WTCA 4YRIA 1RTKA 2YR0A 4XR4A 4Q3NA 3I8SA 4E7PA 5HZMA 2CVHA 3U39A 2CEAA 2VBCA 1TVMA 3RIGA 2I67A 2OR3A 3RI3A 5FAKA 5LN1A 1KETA 2XNCA 4ZZ1A 1HG0A 1LV8A 4IJUA 1ZLXA 3BDAA 3OZBA 2FE1A 3RS0A 4AYTA 5B1YA 1UJMA 4DGSA 3DYVA 5DPMA 5ARCA 1LQUA 3BFXA 2Z98A 1ULHA 1J1ZA 5A02A 4EF5A 1PEAA 3NH9A 1WMSA 1T8SA 4XRGA 4Z51A 2A59A 2DYKA 2M9MA 3IERA 1YOVB 3FI0A 3KZOA 3BWMA 1KFBB 4F9TA 4EW1A 4KACA 1KDYA 2AD1A 2G08A 1Z7YA 1ZMTA 2V58A 4MGEA 1DI0A 4ABTA 4C1BA 2O5CA 4DZRA 1KDTA 3TAHA 1UAAA 3HABA 4BLSA 3CNLA 3NPAA 3VU9B 2X42A 1N6OA 2JCYA 2VP3A 2GZMA 3S7TA 5ITVA 3A05A 1QC5B 1Z0DA 2GZAA 5E6RB 4YJ2A 4AY2A 3GUYA 1CUZA 2RHMA 3D8UA 4QDZA 1B00A 3MGGA 2C20A 1P9OA 3BRWD 1JDPA 5TMDA 5EEGA 3PT9A 4U2KA 3NOOA 5K0LA 4W9NC 2EJUA 4YQZA 4LXTA 2X4GA 2ZSEA 4MVYA 2H5IA 3V1LA 4CIYA 3CEAA 4CI0B 1NPYA 1GGJA 5KDLA 2TS1A 4BQSA 2VF7A 4CLRA 1SR8A 4ZYWA 4CU2A 1YRWA 4TYYA 1UJCA 1XB2A 2YDYA 4IDHA 3WLKX 1YA6A 2ZSBA 3T1NA 1YRYE 3EASA 2G8NA 4ZPJA 4AZTA 3QJYA 1G7CA 4BKUA 4KJXA 3QPCA 2Q46A 1KMQA 3L1UA 1VCNA 5HF8A 2WY2D 1EVLA 1KKLA 4FOOA 3WL8A 4AJKA 1MABB 2EYQA 2LDXA 2VHVA 2GF0A 3ZY4A 3WRYC 3OUUA 2HOQA 1LY1A 5C8ZA 1C1XB 5LQRA 3DV2A 3TVYA 1H05A 1KO1A 2D54A 4MVJE 3Q8KA 2DBVO 4I1RA 4J43A 1G21E 2JHPA 1ECBA 1X80B 1ZGAA 2XCLA 3A04A 3CSUA 3BJEA 3P4XA 4P34A 2ZZNA 4YMWA 2HIAA 3NC0C 3HSYA 4AVYA 1R3DA 2G40A 3WQSB 2IU0A 1YCGA 1I6MA 2R8XA 3D6FA 4OH1A 3UJ3X 3IMFA 1U2DC 1Y81A 1N34B 1OJ7A 3DMNA 4ZVVA 3P0IA 2R7MA 16PKA 3O84A 5C34B 1KS2A 1UFOA 1YRAA 5MHTA 4LPKA 4U7DA 2YHIA 4NNOA 4BOYA 2C96A 1NXQA 2VDWB 3FSJX 4IYRA 2PMBA 1IOLA 3PF9A 2NTVA 3GJ8A 1HK7A 3ZNQA 4AJIA 4C01A 2WIFA 1GO2A 4CFSA 4FFRA 1SBYA 3CNEA 1M2VB 2ZDGA 1W44A 1MV8A 4LX8A 1HE5A