2EC9U

Crystal structure analysis of human factor viia , souluble tissue factor complexed with bcx-3607
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
120
structure length
116
Chain Sequence
b'EPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Probing the S2 site of factor VIIa to generate potent and selective inhibitors: the structure of BCX-3607 in complex with tissue factor-factor VIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 19
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 2007-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ec9U00
2A0LC 3OGOE 2VISB 3AY4A 1Q9KA 3O41B 1C7TA 3WFHB 3MSPA 1GRWA 4J2XA 1AY1L 1KIQB 3HCVB 3FOLB 3MRRA 1UKTA 2A6KB 2IAMB 5IEHB 5J6GB 1LEIA 3GJFH 4X6FA 1N5YL 5CEYA 3U4BH 4L8SA 1QRND 3B2VH 1DUYB 2CKNA 3BYTA 4I5BB 5EU4B 1ZGLB 1KPRB 1A3LH 2HWZH 3V79C 1P5VA 2Y6SD 5I75B 2GUOB 1YY9C 2RIKA 1I1FB 3NPZB 4NZDA 2EDFA 3ZKNC 1YEDA 2IALA 4IBLT 4U1NA 4X80H 4D3CH 4FQLH 4ZXBB 1MELA 4JPIA 1YYLL 5AZ2H 4PBVC 5B8CA 3BT2L 2EXYD 4IRSB 3VRJA 3K2UL 5FM5M 4KU1A 1RVFH 2DM7A 1TVDA 4QRRE 1I3RB 2F58H 1OP5K 1DN2A 3QO1A 5FDYA 5T3ZD 1VHPA 1Y18B 1UEMA 4MB3A 4EN3B 1XF1A 1PY9A 1YMMA 3HI1A 5C08B 3WLBA 2FRGP 4X7DC 5CHNA 2OJEA 2BY3A 4QRPB 4TUOA 2NY5L 1TCRB 5CAYB 5L2KE 4V1DE 2XWJB 2PXYC 4QCIB 3T4YB 5IVZA 1BFSA 2A9NL 3L9RB 3ZT5A 1ZLWH 3IU4L 2XFXA 4BH7B 1E27B 1MI5D 4Q0XL 4I13B 4N0FB 1F58L 4K3HA 1MRDH 4NHCH 3Q3GB 1J0ZA 4GSDL 2BHZA 2CMRH 3NCCB 2FJHA 5I1JH 1QFWH 3TC9A 1XF4A 5DA0B 4ZS7L 3HUJE 2NY4D 3MYJA 4HS6B 5F6HJ 5E70A 2YBRA 4YDLB 1J88A 4YXHL 2OP4L 3W2DH 2NTFB 1GXEA 1UZ6E 2FO1A 3UTTD 5FECA 1CG9B 2MHAB 3KPQB 2WZPD 2ESVB 1T89A 2BVPA 5IM7A 1C5CL 4PJIE 4DK3A 5LXGH 5IB5B 1XF3B 3CX5J 5F88A 2MQ0A 5HHQA 4LCCB 3QRGH 1N3NB 2UZIH 2UWEF 4PB9H 5HHVL 3QJFB 4XNZB 5ADPH 4P3CH 1DQJA 4Z76A 4UT7H 2BP3A 3MRCA 3T0XA 1DVFC 2WQRA 1YN7A 3ZKXB 3BPCB 4F9PC 5IROC 4JFYA 2R0ZH 4HV8B 4DCQB 2OQJA 3N06B 2VQ1B 3AMKA 4OQTA 1JHKH 3G5XB 4LRIA 4M43L 4M93B 5TQ0H 1MF2L 4I3GA 2X7LB 2R4SL 3UTPE 1CGTA 4J4PD 4TTDD 1RJCA 1BQLL 1AO7E 1G1YA 4G9DB 3LPWA 2DB8A 3D69B 4GBXB 4LDOB 4JJ5A 1JZ3A 3HE6D 4ZUTA 3WIHA 2VZTA 2NY3D 4H25A 1QRNA 4PP1D 1F4XH 4F7MA 2A73A 4F58L 1A7RH 3TYGH 3MFFA 1JWMB 2XG5A 4QHNA 3EOBB 4MLSA 1UENA 4M7ZC 3U7YH 2G75B 3P73B 2VDLL 5TF0A 2QQKH 4F7TA 3JUYA 5F9DC 4KRLB 1F6AB 2GK0B 1WBZA 1F42A 2IQAA 4PLKC 1WBYB 3LB6C 4P46D 3CFBA 2OJZL 5D7LD 5CILL 4KKAD 3U9PL 2CIIA 4BSVA 1FGNH 2RFXA 4OCNC 1JGDB 3MNZB 4JRXD 3ZDXE 1RK1A 2EH8H 2XKSA 3CH1A 4WEBH 3HUJF 1B4RA 1IT9L 2E5EA 4JY6B 1D5XB 2IH3B 1A6PA 2CLZB 35C8H 4X4XB 3O3DA 1T4KA 4ZFFA 1N6VA 1UZ6F 3P77A 3GIZH 5CS7A 1R24A 4Z7UB 3TJHC 1A4JA 2B1AH 4ORGB 2B5IB 4FFZL 4EIGB 3HPJB 4PJIF 5KSBB 3DX7A 3TZVC 7FABH 2IF7A 4KK8C 4S2SA 3QULB 4ZOCA 2NXYB 5EH1A 1ORQB 3QEQE 1C08B 4KROC 3V8OA 1FNSH 4YJZL 5TE7L 5CKAA 1UJ3B 4XBGB 3O6LL 1FRGH 4Z7UF 1RK0A 5HGAB 1X7QB 3WIFA 3UTTA 1CICC 1L0XA 4OLUH 5KSBF 1IQWH 1WZLA 3RWGA 3QA3A 1Q9OB 3BRDA 1EBPA 1S7UB 3GHBH 3ARGD 3G6JE 2WBWB 5EBGA 1K2DA 4X5XB 2R8SH 1G0DA 5L88L 5F70A 5KN5A 1DANT 3AVEA 1ZA3B 1U8OB 1W72L 2JCCA 3IXTA 1LE5B 3T04D 4YGAB 1LDSA 1S9VB 5L0QC 4PJ9C 4JPKH 3AUVA 3C6SB 3IS0X 4JZJA 1DTUA 3H2WA 4OCYL 4G5ZH 1BBJA 3O11B 1AR1D 1OTTD 2GJ6B 1WIOA 1I1YB 4QHMB 4X5WA 3T2OA 1N64H 1T0NA 4BA8A 1MJUH 3H9HA 3MOBH 2A74A 3F7VB 4D8PB 2B4CC 3SGDH 1IL1A 1XCQB 3E8UL 4ZNCD 1II4E 4L3EB 5GSRB 2JJVA 4YHNA 5HYSB 1NC2B 3MJGX 4J4PA 4UV4H 5D1XB 4Y19D 4U1GC 3VFGL 3HZVA 1FDLL 3HE6A 1E6OL 4LLAA 4ODXB 3VXMB 3DV6A 3DTXA 1FZOB 3BMVA 4PRIE 8FABA 3L95A 1P9MA 3ZDXF 1U41A 3IDYC 2BCKB 1TENA 4LNRB 3T77A 2VXVH 4KK6C 3WCYA 2J6EA 5DRXA 4O00A 3UJJH 4Z78B 3MLTB 3D2UB 3HZMA 5HYJB 1IGML 3R4DA 4V2CB 1MIEH 1IGYB 1PG7X 4NN5C 4RCAA 4A2MA 2JB6B 1PGRB 1JCKA 4F7EB 4P46A 1N7ML 1VGKA 5DFTA 3BKJL 4MAUL 4LVOC 4F3FB 4JRXA 1AGCA 1LE9B 2GSGA 3N85H 5BV7B 4GAJL 4DGYH 1HQRB 1UG9A 4QOKB 3JTSB 3UC0L 4XI5C 3SE8L 4HIXH 3DETD 4K9EH 2WUBH 1TETH 1WC7A 3ZE2E 3JV6A 4Q6IA 4YDVA 1HIML 4GAGL 3GMPB 4WW2B 1T66D 2VLKD 1H3TA 4OF8A 3U46B 3G6JF 3T0VA 3BDYH 3O3BA 3DVFA 4FQXB 2IH1A 4Y16B 1I8KB 1RZJC 4OM0L 1S7XB 5CINH 5D96B 1EXUB 4X7TA 3EFFB 5ID0A 1F4HA 5B4MD 1F4WL 5E9DE 2C4FT 3MOQA 2HJLB 2LQRA 3S96B 3SDAD 3VA6A 1MWAL 5K9JL 4E41A 4U3CA 1GGBL 1R5IA 1NCDL 2H45A 1W0WA 5HD8D 3ARDC 2DLHA 2J4WL 1FL6A 1T1XB 4NC1C 1YNLL 1WAAE 1L7IH 3ARGA 1BOGB 2YUZA 3GSUB 1RJZB 5ILTH 2O5ZH 5BO1H 4XWGH 1ONQA 2DI9A 2NY0B 5FGSA 2Z31C 1U3HB 5CZXC 4KJWD 2OK0H 2ZKHH 1JPFB 4P57A 3QQ3A 4RRPG 2ZSVA 4GG6A 1JTTA 4NKIL 4Y1AE 3H3KA 3DX6B 3Q6FB 4JN2A 1W0VA 3BZFA 5E00A 3VD3A 4YUEH 4QHLB 4GH7B 1WCBB 4TOYL 5TQ2H 5JHDD 3R1GL 1PAMA 1CIDA 1VGEH 3RIFF 1J9CT 2C1PB 1OP5H 2FB4H 5C0CD 5DRZA 2AKRA 1GAFH 2VUOA 4MD0B 3UMTA 2FLRT 5F6HI 1Z5LB 4XPGL 3FQUA 2D7QA 3CUPA 3F12B 3KDMA 4PG2C 3IKKA 1I7TB 4WFHE 3ZE1F 2NZ9C 2V2XA 1J0IA 3MYZA 4Y19A 1ND0B 2IPKB 2PO6A 1H3VA 1C12B 4LMQE 2R1YB 2O5YL 1LVEA 4LIQE 2VXUH 4HKBB 5DURB 1ETZB 4OZGB 4Q9BA 4HPOL 5JW4R 2VZOA 3VD4A 1J0HA 3UJIL 1D6EB 3ARQA 3BRFA 3WFEH 3OXRA 1XGRB 3FT2A 2VLMD 3P4OA 5SWZD 1ZWIB 2ORBL 3AREB 1BAFL 3BFOA 1PEZA 2WWMD 4M61B 1XAUA 2BSSB 3KYOB 2AEIT 3GK8H 4GMTH 3P4LA 5HYFA 3G6AB 5T1LD 5CSGA 4G6JL 3MRIA 3VXOB 1KF9B 1FO0A 1T5XB 1OAZL 3BI9X 4YQXH 4OLWL 4P2RD 4HX1A 3WS3B 1BJMA 3VFUA 2A9ML 4RMVA 1IGIH 2Y72A 3BGFC 3MRPA 3M07A 3DSFL 1KYOK 1CFNB 5DK0A 1FG2B 1UWEH 5E4IA 5A2LH 3KR3L 3BSZH 1FNFA 2NNAA 4XMPH 4PREA 1AQDB 5L6YH 1MCQA 5D1ZC 3ZYOA 1WAAF 5J3HD 1JN6B 4MA7H 5JA9A 3GMMB 1HH6A 3RNKA 5D4QA 3JZ7A 4GMSL 1OL0A 1PQZB 4Z6AT 4Z0XB 1YECH 4X7EC 3EDKA 3F7YA 4AT6B 3A6CH 3SDAA 3IT8D 3TNMA 3WUZA 3REWA 5CJOL 3BH8B 5GIRB 1FPTL 4P3DA 2X4TA 4RGNC 5FKAB 2IAMC 1MCCA 4PLOB 5L7XH 5EU5B 4O2CB 1HQ4A 4NC0B 5ERWB 4ODUA 5M94B 2OTWB 3I75B 2W59A 1FVDB 1ACYL 2I5YH 4Z7WE 1FJ1B 1LO4H 5EU3A 4RWHA 1SEBA 2VITA 5I75C 4Z7NE 5FOJA 4F15B 2AW2A 1ZT1B 4X0KA 3HR5A 1ERNA 4ZXBC 4LPCA 1U58A 4IHOB 4UQ3B 1IEAA 5A2IH 1XF2B 3B9KB 5ACLA 1UA6L 4IRSC 4OZHE 3DBXB 1XT5A 4PJGB 1V7NH 1YEIL 5JHDA 2CK0H 5TJWK 3QUML 4CDGC 5C0CA 4PJEA 3X14B 3PGCA 2OZ4H 4APQB 4JRYD 3T0EE 5I74B 5DD3H 5A3IC 3QXDA 1EHAA 2YK1H 3KAAA 2EDLA 5IB2A 5L2JA 3O4LD 3GEWB 4WDIA 4G7VL 4QRQA 4U2YA 1KEGL 4PV9A 1DBJL 1QRKA 1IQDA 3GGWB 4OLZL 5H37G 4JY5H 2DQCH 3BDBA 4PJGF 4U1IB 4X8XA 5DJ6A 1WCQA 1J5OL 1L6XA 1EO8L 5DJXB 5CSZB 3VFVA 3BH9A 4XP9H 2X4QA 4G7YH 3RWEB 2VC2L 5HJ3A 2YWYA 1EH9A 4LLYB 4NM8H 1MIMH 5I1EL 5C0EB 1K5NB 5B38A 2Y36H 2Y06L 1RZ8B 4PTTB 4N9GA 3MA7A 4PBWD 1K3ZA 4YHIB 5SWZA 3RTQB 4FOMA 2LTQB 4WI7A 4XPBH 4KJYB 3LN5B 4Y5YC 1XZ0B 4FG6C 5DD6A 5JQHC 4E0RB 3TN0C 4HUKB 3PDDA 4K94L 4YDLC 4U6YB 3GO1L 1UCTA 4OZFG 5T1LA 4RFOH 4AL8L 1AY1H 5BOZG 2DM2A 1U36A 4QT5B 2NY6B 4P2RA 2H9GA 5KVFL 3IFPA 1SYSB 4IJ3B 2BC4B 4F7PB 1BFOB 1HH9B 5JO5A 3LKNB 3ET9F 1RIHH 4OF7A 1N5YH 1IAIL 5GRXG 3WS6A 3AM8C 4BZ2L 4LCCC 3CFEA 43CAB 5HHPA 3FFCE 2F8XC 1JZ6A 3CSYB 5JW5A 4XNZC 1JGEA 3QIUC 1EFXD 2MCPL 5HI5C 1A14L 2ED7A 2DF3A 5JIHA 4PTUA 1A3RL 1JNHA 1G7PB 2GTZB 1DQLH 3K4ZA 5DEFA 3GRWA 1YYLH 3ZKXC 3QUZD 1S7RA 3BT2H 1WK0A 3VRIA 1CE1H 3WFBH 5INCB 1UJTA 3WKNA 2ATPA 4S10A 1N0XL 2JK5B 2DQDL 3HG1D 3OKMA 2Q7YB 4URTB 2VL5B 5AAMA 2ZOLA 2EE9A 1JNNH 2P5ED 3FQTB 1MFCH 2J8UE 2OMBA 4J3VA 4LK4A 4QXTB 4R4ND 3X12B 4MNHA 4X6EB 3ZLQC 4KH2A 3U7WH 2CDGA 4GBXC 2VZVA 1HXMA 5AD0A 5EO1B 3CAFA 4OCMC 2KUTA 3UZQA 4ZUVB 2GTWB 2NY5H 4PLJC 5IJKC 4PBXA 4G6AD 5EUKB 3IU4H 1G6RA 2OXGA 5CD3A 3PJSB 2YD4A 3K1KC 4Q0XH 4EQ2A 1F58H 4YWGH 4D0BB 1TITA 5E2WL 4YHZL 3T65B 2MKLC 4ZODA 1RUKL 1AGEA 1AKJD 1OTUC 3SPVA 4GKNA 5FV2A 4ZPTB 1ZT4B 4NPYB 4ZS7H 3UYRL 2FNBA 4ONHB 4DK6A 4HH9A 4JRYA 4YXHH 3QEUA 4JQVC 3ES6A 4YGVB 1JHTA 3NFNB 3BXNA 2IMMA 1Z9OA 1EV2E 3PWLA 1HCVA 4M00A 4L4TD 4DZ8A 3O4LA 2FR4B 2GFBA 4OIAA 3R0MA 3L5XL 3B5GA 3CVHH 5GS0L 1OPGH 3P2TA 4L3AA 3TA3C 1KN4L 4CAGA 2H2SD 5JOPD 3N1GC 3FQXA 4QWWC 2AABL 3I6GB 5F7WC 2ERJC 2LAAA 1ITCA 5CD5D 3IFOB 3L5WA 3BVNA 1QSFE 3CC5B 5SX4I 3D87B 4GAFB 4I0KA 4ZUWA 5IB1B 5DMIL 2NXYC 4E42A 3MGOA 3MRGB 3QIBB 1JNLL 5I16B 4KPHH 5T1MA 1UJ3C 1JRHI 2FATL 3L3HB 3BAEH 4L9LA 1UB5B 4G8GE 1A0QL 4M43H 4X9GA 5JMOC 1MF2H 4G6FB 3ULSB 4OCRH 1Y6NR 2R4SH 3NCBB 1HHJA 4EUPG 3K2MC 3L3GB 5F7UA 3S37L 4EVNA 2WLZA 1BQLH 2DKSA 4X4YA 3RWHB 1CCZA 3CFJA 3RUGA 4B5EA 4XHJC 1KG0A 5MEQB 4PRDA 4R96B 3D39E 4ONOA 4AK1A 4RMTA 4F58H 1P1ZA 4RNRB 5KG9A 3WJLC 2Q76A 3OHXA 5DD0L 5EORH 3QNXB 3HTLX 3RPIA 2PTVA 4BQBA 2VDLH 4KUZL 1EFXA 3AS0A 4JVPA 2QQLL 2DQGL 4XPFL 4W81A 5DJ0B 4HEPG 3QDME 3PABB 3SN6N 4XBEH 3DV4A 1G7IB 1KCVL 2H6PA 3QUZA 3P4NB 2XV6B 3WV0A 3RBSA 1A6UL 3QG6B 2MKWA 2OJZH 2V5SA 3HG1A 2A77H 5CILH 3DJ9A 4MD5A 4EI5D 3TYFB 2R2CA 3LKSB 2P5EA 1BIIB 1DE4B 5D1XC 4OCXL 4U6XA 2L7UA 3VFWB 4AEFA 2P8LA 4HXBL 5DS8B 3UBXA 3V5KA 1Z9MA 3FO1B 5HY9A 3LEXA 3HB3D 1IT9H 3OPZL 3OXSB 4CVXA 2FEEL 4M1CC 5JZ7D 4XVSH 1U3ZA 1JE6A 4L8BA 3CMGA 2VXSL 1H15A 5IVNA 2FBJH 2V7HA 4XWOC 5IVXA 4FFZH 4K9EC 4MMZC 4JCLA 3EO0A 3UTZA 1Q9WA 4Y4FB 4L1HA 4Z7VE 1W72B 5DJ2B 5EN2B 1OOAA 5D1QD 3PWNA 3QPXL 4CVWA 5TE7H 1Q94A 5BS0E 3M17A 1CLYL 5HVHB 5I66B 4O5LL 3O6LH 4MYWB 3J7HA 4G8IA 4WI5A 1JUFA 1A5FH 4H0GA 1MUJA 1ZHBA 2NPLX 4L4TA 4OKVB 1T83C 1XF5B 2E7HA 3NA4A 2PYEB 1I7RA 3HI5L 4UNUA 2XQBL 4WUUB 4QXGL 4KZEH 5FKPA 3OX8B 5FGCB 1INQB 3MZTA 3PQYB 2DJ4A 4DOHB 1IGCH 5L88H 2B7DT 4KKBC 3W9EA 2ICEB 1Q1JL 1W72H 4WW2C 3VG9B 5L2KD 1OGAB 4V1DD 4MA3B 3VXQA 4NWTL 1TJHL 5EOQH 2SEBB 4FQXC 4Y16C 3O45A 3RL2B 3ZL4H 1G7LB 3TVMC 1CL7L 5D96C 3H9SD 3KXFE 3QXAA 4YHOL 4MQ7A 2LE9A 1XGTA 4YX2L 2X4OB 2XKUA 4AMKH 5CZVL 4P23B 2GAZA 3CPLB 3D0VA 4P2QE 2BSED 5C0JB 3ULVL 3RGHA 3VFGH 1X44A 2YUVA 1OQXA 3REVB 3UTSB 3QXTA 1FDLH 1MCPL 3MRJA 3FB7B 2IBZY 4LQFL 1HHIA 1R3KB 1P7QD 2EDNA 1VFAB 2NY0C 2VO5A 1T3FB 3GMNA 3G5YA 2QBWA 3RY6C 3IXAA 4TNVK 3PWPB 2NX5E 5K59E 1VCAA 1VFMA 4PUBL 4ZFOL 2AJXL 5K9KB 2C1OA 4XZUA 3HRPA 4NIKB 1MSPA 3C9NB 1CD1A 1NUFA 3U9UB 3PWJA 2NXZC 4Z0BL 5J57B 3VXRD 4NT6A 5D71L 2BVEA 3V0VB 1IM9D 3BKJH 4MAUH 4EI5A 2CIKA 3VMOA 2YD6A 4RAVA 3MV9E 1CLCA 5EBLA 5DRNA 1AD0B 4NBZB 4CBPA 1FCGA 4Z7VF 3A67L 4LF3A 3UTQB 3SDYL 5EBWA 1JRHL 4LPXA 4Z77A 2OTPA 1MWAB 4GAJH 3SGEI 4MMXC 4RGNE 2ZNWA 3UC0H 1AO7D 4HWZB 3SE8H 5LCVH 3FQWB 2VR9A 4K3JL 5SX5H 1NGXB 3MNVA 5IMOA 2B8OT 3LZFL 1N6QH 1E4JA 4MVBC 4NQSA 1HIMH 4WUKL 3AB0C 4GAGH 1G9EA 4P4KB 3GHEH 1CDGA 2HVKA 3AREC 5C0IB 1G7HA 5D93B 1FVEA 1C16B 1T2XA 1JF5A 5F9JA 5D1QA 3BHBB 5D5ME 1F4WH 1FFNB 5DTFA 2Z9TA 4WI3A 1MWAH 5DQJA 3LQMA 5FHAL 1R3JB 1EK3A 1YZZA 3RL1B 4OFYD 1GPOH 1KIPA 1BQSA 1GGBH 3CFCH 4ZYKB 3LPFA 1NCDH 3LKQB 1JZ8A 1S5HA 3VD7A 1DEDA 2J4WH 2WMPA 5ESVB 1MY7A 3S4SA 2OBGA 5T1KD 4ORZC 2F54B 3T3PF 3H3PH 1YPZB 1Q72L 3MZGB 4XNMA 1NANH 1LO2L 1ZHLB 3LKRB 1ZVYA 4HS3B 5E6YA 1FVCA 3HKFA 4IRZL 5ITBL 5L2KA 4NKIH 1DDHA 4V1DA 5JXAL 2WP3T 2YMXL 1U8JA 3S5LA 1ZS8A 1QBAA 3H9SA 4AYFA 1LD9A 4TOYH 5EZJB 2E9BA 3R1GH 4NO2B 3MO1A 5BRZE 1OCWL 1SJXA 3WEXB 4Z5RA 2X1OA 5JW4N 2I24N 5K59F 2DN7A 3QEQD 4PJ8D 2QR0B 1U8IA 2YSSB 4WV1C 2R56L 1PKQB 5D7IB 3C2SA 4JFHE 4U1LA 1MJJB 3CSBA 4NO0B 2FO4B 5GS3A 2ZUTA 5I1DA 1JFQL 2O5YH 3O2DL 3BZDA 3O8XD 4HZLA 4HPOH 4U05A 3TF7C 1I1AB 2NYYD 1P7QA 4U1SB 5LAXB 3EJYC 1T1ZA 4HUXA 4F15C 3UJIH 5FYKU 3QUYB 2QKIA 5HHOB 2VH5L 5D7IF 5HGGS 1YQ2A 4ZUSA 4L9DA 3B9KC 4M5YL 1DL7H 1QLRA 3C5ZD 3UROR 3BP4A 4KDTA 2R2EA 2ORBH 1BAFH 1AHWA 2YOCA 1D5BA 4ISVA 4OCWL 2COQA 2ZUYA 1IGFL 3QFJE 3K8MA 4Q9QL 1OW0A 5CEZH 3MROB 3VXRA 4APQC 1HDMB 4FQ1H 3L1OL 4G6JH 5I74C 2X10A 1IM9A 2PETA 5DHVA 4PJDE 3HC0A 3HRZA 1H0DB 2FHFA 4ZAKB 4I77L 5F1IA 4OLWH 5DUBB 4HJGB 1C7SA 2A9MH 4P2OB 2Z8RA 1HNFA 3FT3A 1BF8A 4KAQL 4KK9C 1AP2B 4KJPC 2CLVA 1FZMB 1OSZA 5D5MF 4HFWA 4BUGA 1VEPA 5C0AD 1AXSA 2X4PB 3GSVA 3LKOA 3RY4A 3NZHL 3KR3H 4LGPB 4HWBL 4ODSL 1YC8A 4PRID 2CGRL 4YDJA 3RIAK 2YRLA 1BJ1H 2JIXB 2P8PA 5DJDB 1FV1A 4R2GB 1E6JL 5MENB 5D6DC 5T3XL 1UWGL 1NJ9B 2BX5A 3DXAD 4PJ5B 3RTQC 1NLBL 4GMSH 2AXGB 2VR5A 3TBYA 2PUQT 1J05A 3AMLA 1KC5H 1CTOA 4QTIH 1V3JA 4QY8A 4M3KB 5CJOH 1HCFX 2NY6C 2FCBA 3C8KB 1DBBL 3MODH 4OFYA 3QUMB 4IJ3C 3PHQA 5IJVA 3RA7L 3MNWA 1MCDA 3KS0J 2EO9A 3PXJA 2VDNL 4J8RB 3L3DA 4ZDHA 5T1KA 2VLJE 2P48B 3RWJB 1EEYB 1ORSA 1WJ3A 5FK9B 4M9OA 4FN0A 1JF1A 4WHYH 5FYJL 2UY6A 4GXUN 2LVEA 3CK0L 2NY5C 3BZEA 1A6AA 4WVRA 3RWCB 3QAZC 1RUAH 1SM3H 2XXCB 4LU5L 1X4XA 1H3UA 4UDTA 3LAFA 2VAAB 1UA6H 5IHUH 4LFHD 1YEIH 3TFKC 2MPAH 2P49B 3S36L 1FN4B 4AEHL 2P5WB 2C3XA 3CXDH 5FM4A 5FYLL 5GGSY 1GGYA 3P11L 3SJVE 4LEOA 2V5TA 3QEQA 5DA4A 3L3KB 2DQTL 4P59H 4PJ8A 4BZ1H 2DYPD 1CFTB 3BKMH 4Q6YA 5E9DD 5ISZE 4G7VH 4PGDB 5IEKB 2QQQA 1GOGA 2M1KA 3QDGB 1KEGH 5C0ND 5FYKD 5JW4M 4PJAA 1DBJH 4OLZH 3QEHA 3U4EA 3O3AB 3HE7B 5GRUH 3BZ4B 3VFNA 3U0PA 1PBYA 2AV1A 4CU7A 4WJ5A 1A7QH 4PJDF 4PRNA 3O8XA 4C4KT 5MHSE 2UUDK 2KZWA 4MA1C 2EEDA 3TWCL 4Y4HD 1H8SA 5K9OA 3U79A 1Z6JT 4X4MA 3VFSB 1Q8MA 2B2XL 2Y06H 2HAZA 4YAQB 3EOAA 3C5ZA 4KK5D 4ODVL 2AJVL 4JFED 1R5WB 1KENL 3PL6C 2MWCA 3LDBB 4JFQB 4K94H 2X9YA 3GO1H 4P2CG 1WFUA 1GH7A 3QWQB 4K7FB 4JFFE 3DUHA 5ICZA 5KVFH 2NCMA 3KLAB 3M1BB 4PJFE 3D3VE 5DJCA 4K3DL 5DXWA 5FA3A 3RGVB 3TBTB 4TSBL 1A02N 1IAIH 4OJFH 4ELMB 4OV6F 4WFHD 3CLFL 1AXTH 2Q8AL 5C0AA 1N4XL 5DDHA 1A47A 4Z7QE 1KT2B 4GKOA 3ZE0E 1H5BA 1MHCB 1X4ZA 3BE1H 3W0WE 1S9YB 5IB4B 4Y8DC 1INEL 4HUVA 1BM3L 3FAWA 4JQIL 5D2NC 2MCPH 5I8CA 1QNZL 3CMOH 2XQYG 2J8HA 1A3RH 5AUMB 5IMMA 1GZQB 4OFPA 5IQ9B 3QIBC 3DXAA 4ELMF 1QBBA 1YY9D 4EIZC 5C8JB 3LEVL 1CZ8L 1T2JA 3ZKND 2VXQH 1N0XH 2DQDH 1NPUA 2FD6L 3DHMA 5DJAB 1TZGH 1FIGL 3FRUB 1L9NA 3HNTH 4MJIE 4EEEA 3HPLB 5FUCE 1P5UA 2DQHH 1QQDA 3RJQB 5HVWA 4BQ9A 5BJTA 3L6FB 1AQKL 4JR9L 5D70L 3NN8A 3QCUL 4WY7H 3MLSH 1B9ZA 3AGVA 5JPNB 3DVIA 2DWDA 3QHFL 3EUUA 4MD4B 3IVKB 1CGWA 1QHPA 3WFZA 3MA9H 2P24A 1MHHB 4BFIB 2WWKO 3RZWA 1ZVSA 2IADA 2E6QA 4IS6A 2AXFA 2C3HA 1RUKH 5TGBA 5GS1B 2I9TA 4ZNEE 3UYRH 4JFZL 3UXFA 4K3GA 4PJHA 4PRAB 3UZVB 3KPSE 4JO4L 1XGQA 4UB0L 1M6OB 4NQDE 1PZUB 2WBKA 4HBCL 3SO3C 1U3YA 2DYPA 3FO9B 3P9LA 5E9DA 1BQHG 3RVVC 4X98A 2WBJB 3HR6A 1KFAH 1KN4H 2EICA 4FA8A 1A1MA 5MERB 1KPUA 4JHAH 5BVJA 2G9HA 1RV6X 1T03L 4PD4K 3GI9L 4F37F 2F53B 4XT1C 2OX5A 2R29L 4MJ5B 3K4AA 4RMRA 1I9EA 1OAQL 3WIHL 4OF6A 2XIDA 3L3IA 3DYMA 5BXFB 2ZSWA 5D7SL 4Y4HA 1CGYA 3I02A 2PW1A 5IWLA 1KJVB 1WUNT 5I6XB 1V3KA 2RJMA 5DMIH 4Y4FC 3BP5A 1H3XA 4IDJL 1DN0B 3MFGB 3K81A 5KZCB 1JNLH 5C3TA 5FOBB 4JFEA 5C0GA 3EO9L 1F90L 3IFNL 2DD8H 2W0FB 3TT3H 4CADA 3TO4B 1A0QH 1K6QH 1DVFD 1HILB 3DGGB 3KNBA 3S37H 2XACC 2FWOB 2UVEA 5E8PB 4N0CC 1OF2A 5F89A 1YC7A 5GRVL 4ETQA 1XR8B 3RP1A 4LHUB 2DQEL 2Z93A 1MH5B 2APXA 4FZEL 5SWSE 3EYVB 1OLLA 5DD1L 2HT4C 2DDQL 4K7PL 1K8DA 5DD0H 3RJDA 4M48L 4CMHB 3VG9C 4NO3A 4L1DA 4KUZH 3PWUB 3EFDL 3BWAB 2G5BA 2QQLH 5E2VH 2DQGH 4MJ6A 3PV7A 4XPFH 3WN5C 4XPAH 3C2AH 2K3TA 4DVBB 5ANMA 1KCVH 3GSWB 3IDXH 5F96L 2H2PC 3GB7B 1F11A 1LK2B 3VFPA 1BD2D 3OAYK 2HFGL 1U91A 4K8RD 5ID1A 3QNYA 25C8L 4WI2A 4EI6B 4HZAA 1KB9J 5C6WH 4OCXH 4HXBH 3B8SA 4PLKD 3VG0L 3LB6D 5JIPA 1I7ZA 3OPZH 5E95B 3JV4B 3FFDB 2H32B 2MFNA 1JVKA 1QG3A 3MCLL 4HT1L 5D8JL 1FSKB 5GGUB 5T1DL 4JM4L 2VXSH 3SKNA 5DZOA 3E6FB 1YJDL 3PHOA 4OQ1A 3MR9B 3FFCD 1M05A 4RBPK 4ZQKA 3WO3B 4ZS6D 4O2FB 4FMFA 1NFDA 1FL5B 3TJHD 2OS7A 2XPGA 3QPXH 1NSNH 4XP6L 1WT5C 2ZUWA 4GRLD 1CLYH 1VFBB 4LARL 3I6LE 1TCMA 3UX9B 3TZVD 3WL9B 4X9FA 3DHJA 4KK8D 2H32H 4PGZA 4NNPL 3OKDA 1UXWB 1A9BA 3T8XB 4JAMA 4JFDE 4KROD 4AM0B 3HI5H 4QXGH 5E8OB 1YMHB 2VDRH 2W9LA 4R4FH 1BVLB 1P7HL 5JLZA 2J3SA 4KGJA 4R0LC 2OXHA 1AGBB 2EIEA 2Q8BL 3MBEB 1CICD 1GZPA 2BOBA 2VDKH 4YXKH 1NL0L 3IGAB 2YD5A 1IBGL 5J0BA 4KQ4L 1TJHH 4ZMAT 3T1WA 1U92B 5IR1A 2DLIA 5C9JA 1FGVH 4ELKB 1CL7H 1IAKA 2ITCB 1BZ7A 1BVKB 5DT1L 5D93C 3P0YL 4YHOH 4GRMA 4ZFGL 4UDUB 4JHBA 4ZFOB 3T3ME 4JKKA 3ULVF 2XKNB 4YX2H 3T0DA 2AK4B 4HWEL 4OZHA 4PJ9D 2AJSL 1BPVA 5CZVH 1T1WB 2HG5A 4DUWA 2ICWB 1BGXL 4JPVL 5F1SA 1DVFA 4R7NA 1BQUA 2R15A 1I9RL 2W65B 4F9PA 2F74A 3MCKA 5IROA 3IYLW 4PRHE 1PSKL 4X9BA 1MCPH 3S98A 3ILQC 2Y07H 4N5UA 2MQCA 5CBEA 3IDMB 5A1AA 4LQFH 5J8OA 2BNUB 1HNGA 1SBSH 2ED8A 4O2EB 5J12B 2R0WL 3F7RA 4CKVX 1WBXB 3KPTA 4LRNL 4PJCE 5I1KL 4PUBH 1UH2A 2AJXH 1F4AA 4LP5A 1NAMA 1MRCH 1HSAA 4I48B 4LSPH 1QSFD 4Y4KB 1N5AB 4FTVE 3VWKB 1BD2A 4Z0BH 4KK6D 1UFUA 1QYGL 3I50L 4N1EA 5D71H 4NGHL 1RPQA 1PVHA 5TDPA 4X7FC 2F5AL 4QRUB 5DC9B 1I9JL 4G8GD 3OKNB 4J3OC 3DPBA 2L4OA 4C56E 1S7VB 2BVUA 4NN7B 1XCTB 3KYNB 2PCPA 3F62A 4I0CC 2UUDH 3DO3A 3DRTB 1N8ZB 1I1AC 4K3JH 1M1SA 4R4BA 4FFVC 2IANB 5CGMA 3LZFH 1CGSH 4XMLH 4RIRB 3IJYA 4PGCA 2EC9U 2EDBA 3Q1SL 1E28B 1KTLB 3QO0A 3N50A 3QUYC 5IQ7L 4R3SB 3FFCA 4YO0B 1CBVL 1EBAA 4NSKA 3SY0A 1AI1H 4OFDA 3X3GL 3ALPA 3GMLB 1FYHB 2Z8WC 3JTTB 5CJBA 2YEZA 1QKZL 3BGMA 1FL3B 2ZUSA 3B43A 5HDOA 4U1JA 5FHAH 3S97C 4ZAKC 3TZVA 1G9ML 1RZGA 2PW2B 2PYFB 1J12A 2ARJA 4J6RL 3LMJL 4P2OC 2VYRE 4RZCA 1IGJB 2YXFA 5HYIA 3T3MF 2J8UA 1YQVL 1EIBA 4YIQA 3H9ZA 1H3WM 4XNYL 2YN5A 5GRVK 1CQYA 5MEOA 4U2ZA 4JO3H 4X8JB 4XPTL 3V4PL 2AJ3A 1CICA 1KCRL 3ARDD 1I8IB 2YPLE 4IRZH 1A1NB 5J89A 1XGUB 3TO2A 1CLOL 3PNWB 4KUCF 1VEMA 1U8KA 4R2GC 2EE6A 3G5ZA 4Y2DB 2ED9A 5BMFH 2Y25A 2Z31D 5CZXD 5F7EL 3NCYP 1WV7T 4XC3L 4MB5A 2BVOA 3VA2C 3IS1X 3BRGC 1XIWB 2WV3A 2X4SB 2C3VA 4PJ9A 4K71C 4ZPVA 4OZFB 4HIEB 5IF0A 1HOCA 3SO5A 3G08B 5BS0D 5H37H 2R56H 3DIFB 4G3YL 5HHNB 3U82B 1U8HA 3MJ8B 3BN9D 2IWGA 1FO0L 1JFQH 3LSOB 3O2DH 2BERA 5CIPA 3WIIH 5LQBL 4WHTA 4PRBA 2BDNL 1VENA 5J1AA 3G04A 2NZ9D 3TM6A 4R26L 1TTFA 2HJFA 5EOTA 3NABL 4QGYA 4M5YH 5D2NE 1X4YA 3QEGL 4YBQD 4OZFH 1REIA 2YS4A 3GSOB 4DZBA 4PJBA 1QSFA 5EBMB 2DI7A 4OCWH 5FM8A 3V7AE 1IGFH 2NTSP 3U36A 1LP9B 4OUUB 3KXFD 3L1OH 2OMNA 3MUGB 3GBLA 5EO9B 1WVZA 1OHQA 1PG7H 4G80A 1ES0B 5C7XL 1ITBB 4XXCC 4P4RB 4TVPE 1IC5H 3KPRD 4K94C 4L3CB 4G8GA 5ADOL 2X4RB 1B0WA 4KRNA 4P2QD 4C59B 1Z2KA 5IFJA 1T0MB 3ULUH 4P5MB 4ONFL 4HUMB 5HHME 3DNKA 3NZHH 3LIZL 1DQQB 3FB8B 3BUYA 4MA8H 1FFOB 1LP9F 4NCC2 2V9TA 5DRWB 5B3JE 5EZIH 2BVQB 4WU7B 5FO9A 3O2VH 5EC2B 2Q6WB 4ACPA 3SDCB 4NYLB 2CGRH 3S4SG 1J1XH 2VOTA 3VGDA 4NBXB 1YDPB 4G42B 2DWEB 2NX5D 1UWGH 1YMME 5T3XH 3MLZL 4KMQA 5EB9A 1FLRL 1NLBH 3B3IA 2WW8A 3ESVF 3HMXA 2FSEB 4U33A 4M6ML 3LDBC 2XWTA 5D1ZD 5ENWA 5B21A 3GSXB 4FQQA 4LLMB 4XGZB 1U8LA 1EEQA 3FN0L 3EO1B 5FFLA 4BKLA 1DBBH 3IJHB 1NC4B 2CD0A 3S5LG 4JFPB 3RGVC 2NW3B 2CDEB 3SKJL 3MV9D 1NAKH 2VDNH 4N8PA 5C0DA 3WDIA 2IPUG 3EGSB 5GGRA 3E6HB 1RD6A 3C8HA 3T2PA 4YR6A 4RGND 3IDIA 2IAMD 3ARDA 3HZKA 3OR7B 4H1LH 4F7CB 1P7KA 2X70B 4NQCA 4H8WL 4IIQB 4HK0B 3BW9B 1J7VR 1CFSA 3MREB 4LU5H 4NQXA 1EGJL 2VDPL 3ILPA 4X6FB 3BP6A 3FQNB 5LGJB 1OGTA 4JKPL 5CEYB 4LCWE 1INDL 2HJKB 1Z9LA 4L8SB 5TE6H 2Z31A 3RX5A 4PJ7B 3S36H 2UYLA 1JK8B 2QADB 4AEHH 5JQ6H 3PWVA 2UZXB 5FYLH 1HZHL 3KPLA 2H3NA 4ZXBD 2DLFL 1X5KA 2DQTH 2I07B 2BJML 3BOVA 4NBYB 5ECJE 1YEDB 5BS0A 4IRSD 1PX3A 3UBXI 4EUPB 5TDOB 5E94A 4NKOB 6FABL 5JPMA 3UJTL 4KC3B 1YEGL 3VU2A 4LPWA 5A3ID 3CU7A 5JW3H 2IFFH 4PG2A 5MI0B 4GXVL 5IB3A 5FIEA 3Q5OA 3MRDB 3NMEA 4OI9A 4RBPH 5BZDA 4WFED 4NCC1 2YD7A 3WNNA 5CP3H 2D0GA 5JDSA 1S8DA 3BPNB 2B2XH 2D7NA 1B4JL 3U83A 4RGMC 5BVPL 5LGKA 5GS1C 1KCUH 5CHNB 2OJEB 1I1RA 4ODVH 2AJVH 2HKHH 4M4RA 2FJGA 4EUPH 1U42A 3T4AA 1U8QA 1FAKT 3KWWA 3KXFA 4DWHA 5AWNL 3DX9A 3QHZL 3UEZA 3KPRA 3SE3C 3GBNL 4K3DH 1KGCE 3FZUC 3WHXA 3BP7A 4FG6D 4P2QA 3TN0D 4JPWH 5B39G 2R2BB 1Q0YL 2VUYA 5I17B 4KKCC 1DP0A 2EDXA 2KH2B 1NEZG 3RWIA 1RUQL 2W60B 3MLYL 4LVEA 3GI8L 4XCNB 3TBSA 4NQTA 1INEH 4NZRL 5F93C 2Y5TA 2ESVD 4LLDB 4JQIH 4DQOL 1O0VA 2V7NB 5EULV 5HGDA 1QNZH 1U8NB 3BJLA 5I6XC 5FECB 3IF1A 4JFOB 1WISA 5T3ZE 2BVPB 1NFIA 2NX5A 1SY6H 2OL3L 3F5WA 3GJFA 1G6RL 3V4VL 3RFZC 4W4NA 5I71B 3DROA 3HAEG 3QIUD 3LEVH 1CZ8H 5F88B 1MQ8A 5HI5D 1NGQH 4NKDA 3L3JB 5D1ZA 4OBRA 1AR2A 3TO4C 1F3DJ 1A21A 2FD6H 3QFJD 5KTEH 1RIUL 2G60H 1FIGH 4OZIE 3TIDB 3EKCA 3GMOA 3BD5A 5DQDL 1S9KC 3ZTNL 1YY8B 3MV9A 3WFHA 1U95B 2KKQA 2VLRE 1KIQA 4KI5C 2OQJB 3UO1L 2P46B 5KSAB 3FOLA 1Q38A 1AQKH 4JR9H 5D70H 3AC0A 4HIHA 3QCUH 2A6KA 2IAMA 5IEHA 5J6GA 1T7VA 4GBXD 4LL9A 3QHFH 2R69L 3KGRA 1QFUL 4EZMA 5EIVA 1DUYA 4DN3L 2DQIL 2EDEA 1MHPL 4PLJD 3A6BH 5EU4A 4ZUTB 1ZGLA 3UTTE 1KPRA 2QSCL 1I8LC 1QRNB 3IU3B 2GUOA 4F7MB 1I1FA 4X7SL 4JO4H 4OFVA 4OT1L 4EDXB 3FHQA 4HBCH 1B0RB 4ZG1A 4ZXBA 4OAWB 3WLWC 2BOCA 3MRQA 4XVUC 2CJUL 4QXUL 5I15L 4IRSA 1OTUD 5DC4B 3ROOA 2JCCE 3LQAL 4P5TB 2HRPL 1RZ7L 1I3RA 3JXAA 5M7QA 1EHLH 4OUOA 4ZUUB 1Y18A 3GI9H 3QCTL 1FSKC 4BSVB 1CXHA 2RFXB 4ZFZA 3TA3D 2LU3A 2OLDA 4CU6A 1OAYH 1RZFL 5DEGB 4ZSOB 4FABL 1U2CA 1E4KC 4QWWD 1TCRA 2I25N 2XWJA 3B6SA 5C92A 4QCIA 4MAYC 3CD4A 1RUPH 3L9RA 3O3DB 1T4KB 1F90H 3IFNH 4ZFFB 5JORB 1E27A 1JI2A 1P6AB 3T0BA 4N0FA 1A4JB 2XG4A 5CSBA 1IAOB 3VXUB 2NXYD 4AQ1B 4XC1L 1RAMA 3EYOA 3Q3GA 3D18B 4TSCL 5I30H 1ZGLM 1MI5B 5DMKB 1IRAY 1CDBA 5A2FA 4HS6A 4Y5YA 3V0WL 3TN0A 5ISZD 5CEZE 2EIZB 2A38A 2A6DB 1DLFL 4FZEH 1NUDA 2NY4B 3MBEC 2QLVB 2DDQH 4YFDB 4M48H 3MOAL 2MHAA 5FDWB 1N59B 3KPQA 2ESVA 2F19L 3BESR 3GKWL 4OIIL 4XHJD 1JWUB 3EFDH 1OVZA 2IEPA 2ZPKL 2N7BA 1LK3L 1XF3A 3B9VA 3QA3B 2IG2L 3AM8A 2VKWA 4MHHG 4JRXE 4I3RL 3AXLB 5F96H 4KKLC 3W39A 3UPRA 1D6VL 2FX8L 3QIUA 2HFGH 1DBKH 1CDIA 2NW2A 1S3KL 4G9FE 25C8H 4LSSL 3BPCA 1FNAA 2B0SH 3GSRB 4WGVB 5D2LB 4I3SL 4HV8A 4TVSa 2X42A 3UYOD 4DCQA 2VQ1A 4PJXB 4LFHG 2FH8A 1JYXA 3CCHA 3G5XA 3D3VD 3WSQH 3X3FL 4X5WB 3AS1A 2GSIB 2X7LA 1AIFA 3MCLH 5E5MB 4HT1H 1HINL 5D8JH 4HGWA 2DAVA 4JM4H 5E4EB 5T1DH 1IL1B 2K1MA 4GBXA 1YJDH 2EEBA 1A7PH 5C09E 3VXMD 3HZVB 4M1CD 4FQJH 4H88L 4E41E 4M7LL 5IJKA 4Y4KC 3EOBA 3VWKC 2NY3B 5E08L 1BBDL 2G75A 3DTXB 3IRZA 4UIMB 4XWOD 4XP6H 8FABB 4JJHA 5DWUL 3LY6A 3D2UD 1J0YA 4LARH 3ECBB 4KWUA 5DI8B 5DRXB 1QO3B 2XZQL 4Y5XB 2VDML 4NNPH 1F6AA 5F9OH 5KVGL 2GK0A 3HZMB 2GY7B 1WBYA 4N1CA 5HI4C 4GG6E 2X1PA 3EDEA 4NN7C 1KNOB 4RA3A 4MJID 3MNZA 4JQVA 2Q8BH 5D7LB 3SCMB 1P4LA 3HNVH 4YPGB 3TA3A 1Z0NA 4MXVF 5AYUL 4QOKD 1IBGH 3ARZA 4PYHA 4JY6A 4HXAL 2CLZA 4YXLL 4X4XA 4NNXB 1R3LB 3C08L 4LKCB 4P5KA 5DT1H 3P0YH 5DVLA 1WIUA 3X11B 4Y19E 4ZFGH 2YC1B 4ORGA 1EDQA 1ACZA 1X9QA 4FQXD 1WC7B 2HLFC 4HWEH 4Y16D 3HPJA 4Q6IB 2AJSH 4YDVB 3MLUH 5KSBA 1UH3A 4DEPB 3TVMD 1BGXH 4S1SL 1Y0LA 3QULA 1T2QH 3KPSD 2XN9E 1ORQA 1C08A 1PZ5A 5F3HB 1MVUB 3O6FD 3VFOB 2J8OA 2EKSA 1PSKH 2HN7A 2LV4A 2PR4L 1UJ3A 3I85A 5ISZA 2XTJC 3C8DA 5E6IC 3O81A 3O6KL 5DMGD 1X7QA 5HGAA 5GGTL 2R0WH 3FCTB 4M03A 1Q9OA 1MPAL 1S7UA 4AG4H 2W07A 3VCLB 4LRNH 2X9WA 1FYTE 3MLXL 4Y2DC 2NY0D 3WJLA 2CDFA 3D1MC 1U8OA 3B9EA 4PGJA 3TBWB 1LE5A 4JDZB 4HJJL 3I50H 2AI0L 2YA1A 4NGHH 1S9VA 3Q6GL 2E7LC 3WNLA 2KQNA 5MP6L 2FECI 1CI5A 3G9VA 2F5AH 3O11A 3QP3A 1I9JH 4DKEL 3IDNA 2HRLA 1I1YA 4JN2B 4QHMA 3VW3L 2NXZD 1W0VB 1KELH 5BOPA 1QSEB 3MV8B 3AS2A 3F7VA 1NMAL 4D8PA 4PJFA 3D3VA 5I1HL 2YXMA 4L3EA 1H3GA 5GSRA 4S0SD 5HYSA 5CBAB 1QHOA 2VSCA 2YD2A 4ODTL 3FQUB 4LLQB 3ULUC 2ZUVA 3KDMB 5CFHA 4GG6F 3LN4B 4OTXH 1J86A 5IQ7H 5DURD 3EBAA 4ODXA 3ARUA 3VXMA 4PGBB 5D7JB 2VLLB 1FZOA 4X6DB 2O61B 4MVBD 4LNRA 1CN4A 1GGCL 3BYYA 4NP4L 3MTRA 4W4OC 1K4CB 1QKZH 4Z78A 1T04B 3MLTA 3D2UA 2YKLH 3EAKA 4KY1H 1G9MH 2X1QA 5FB8B 1A6VL 4J6RH 3LMJH 3ARED 4XHQA 2JB6A 5DQ9A 4F7EA 3OXRB 1RU9L 3HHRB 2CRMA 4N68A 4U6HA 3MRHA 1LWRA 2WUCL 3U30B 4X83A 3WFDL 2V5RA 1YQVH 2CXKA 3ESUF 4XNYH 4MJIA 4F3FA 1LE9A 3V4PH 4XPTH 3MV01 3MRIB 4PR5A 1KCRH 1G7QB 1FO0B 1T83A 5C2BL 1YN6A 4M1DH 4PJEE 3MACH 1HQRA 3SDCC 4QOKA 3JTSA 4N0YL 1CLOH 2KL6A 2YPKB 1DQDL 5LGHL 4HIIB 1MVFA 4LASH 5F7EH 4D2NA 4XC3H 3GMPA 4WW2A 5H35A 4HJ0C 2ZG1A 4PREB 4FQXA 4HIJA 4FQ2L 4Y16A 2AJZB 3NCYS 4NCDA 5GPRA 1I8KA 3TVMA 3N1QC 1EXUA 2VLKB 5CKGA 3KPSA 3F7PC 4IMKA 4G3YH 5T33L 4Q97A 5IGXL 5F1NB 2HJLA 3S96A 2CKBH 2BDNH 1U8MA 5SWZE 1DSFL 3F7YB 1ZLUK 4GG8B 3V6OC 3REWB 1T1XA 1HXYA 4UUJB 4IIQC 2JKXA 4P3DB 1BOGA 4HC1A 1RJZA 3NABH 2X5PA 4ODUB 3QEGH 3QZWG 4P2RE 1N6UA 1HWHB 5F44A 5FO8A 1L9MA 1JP5A 1E4XI 1TXKA 3RY6A 5EU3B 5CGYC 3P3YA 3K46A 1DANU 3DX6A 3Q6FA 1S7SB 3B9KD 5EU6B 5C7XH 4QHLA 5M95B 4PRPE 3I6KB 5F1OB 3ZDYE 2C1PA 1U58B 3IDGA 5ADOH 4CRPA 1JMXA 1NLDL 4XMKH 2HMIC 2VERN 4APQD 4MNQE 1P84K 4MD0A 5JHDB 4MX7B 4ONFH 2BMKA 2CRIA 2CR3A 1MREH 5C0CB 3F12A 5LBSL 1CFVH 2E6JA 5MI0C 3PGCB 3UPAA 4ZO8A 1I7TA 4N1HB 5FUOL 3GNML 1DFBL 3H3BC 2DM4A 3QXDB 4KK9D 4KJPD 2X09A 4HQQL 2IPKA 5DJ8A 1C5DB 2R1YA 2RAMA 1KXTB 4HKBA 3BPNC 3TJEL 4XX1E 2GT9B 1UADC 4OZGA 3FRPA 3MV7B 5DLML 2O26U 1HE7A 4JREB 2MCG1 3QH3B 4LSUH 4LCUB 5DJ6B 2MQ3A 3CXHK 4JDVB 5GGQH 4PJEF 1D6EA 4M6MH 1BEYH 4FQHB 5IIEB 1R3IH 3BH9B 2HT3C 3FN0H 3H7BB 1AD9B 3DARA 2BY0A 1ZWIA 5KANG 5DHYA 3RTQD 3R06B 1Q9LB 2JJTA 3AREA 2Q1EA 1BQHB 1NQBA 3LHPL 4N9GB 4XVTL 5D9SB 3SKJH 1GJIA 3G6AA 3VXOA 5HXMA 1FNGB 5GGSB 3WNKA 2NY6D 4C56D 5DD6B 3WS3A 2XZCH 3K7UA 5C1MB 1J8HB 4GUPA 2DM3A 1JV5B 5CJQH 5B22A 4RX4A 1CFNA 3WNPA 2YPVL 2DBJA 4EJ1C 4H26A 2VDPH 1MLBB 2VQUA 4OI8A 3O4LE 4JKPH 1INDH 3ROLA 5I71C 3P30L 5JR1L 3SDXB 2OTUB 3J8F7 4UAOB 2V2WB 5HHPB 1HZHH 4FFWC 3ZDZE 3RVTC 1X5XA 4TTGA 1U93A 4XTRC 1JN6A 4CW1A 3SDDB 4L29B 3MGTA 4U0RB 5E1HB 4LCYA 3GMMA 1NKOA 4LPUA 5KSVB 1MCSA 2DTML 3DUUB 2ZOKB 3TFKD 5DFVC 3VGBA 1PQZA 6FABH 4UV7L 2C7UA 3KYAA 1CD8A 1YEGH 5INDA 4OV5B 3BH8A 5KSAC 5EUOB 5GIRA 3BDXA 4KV5E 4WV1A 2C4FU 4GXVH 5FKAA 3D5OF 5T5FH 2OZ4A 3ZDYF 5EU5A 4O2CA 5ERWA 2B20A 3QWOA 2QJDA 2OTWA 3I75A 2VXTH 3UCRA 1PD6A 1B4JH 2R4RH 1FJ1A 5BVPH 5DUMH 1RSFA 3QJHB 3WO4B 3CZFA 1VFUA 4WIQA 1I9IL 5E1AB 3C5JB 2Y23A 3RUGE 1ZT1A 1SBBA 4NWUH 5DO2D 4Y8AA 2CH8A 4IHOA 2OL3B 1XF2A 3B9KA 4L4VE 4LLWA 5AWNH 1G6RB 3QHZH 1NGYA 4DAGL 4P5TC 3PL6D 3VXSE 4M8QB 4APQA 1Q0YH 2EXYC 1S78C 1TNMA 1BZQK 4QKXB 1NGPL 3MLYH 3GI8H 2X2YA 4NUJB 3KJ4B 5E24E 3S88L 1JHTB 3VJ6A 4DQOH 3GGWA 4DZ8B 1EERB 5FGRA 2FIKB 2P5EE 4NQEB 1SJEA 2Z35B 4GQ9H 4LQ1A 5CSZA 2OL3H 4PJCA 1T6WA 5EIIB 4NZTH 2V5MA 5C0RH 5C07E 4S1QL 3WDHA 1UWXH 3QFDB 3BGAA 1RZ8A 3L5WB 2EXWC 3BVNB 4YHIA 4XNXL 1PYWA 5D6DA 2XICA 1E4XL 3QIBD 3RTQA 2BNRB 1BIHA 1WQVT 5DQDH 4N8VA 3PGDB 3MGOB 3C60B 3RY5A 1YEHL 4NUGL 4G6FD 4NJAH 4QT5A 3UO1H 4C56A 5A2KH 5FCSH 2BC4A 4F7PA 4J3SA 2KZ1B 4GO6B 1QFUH 1ULVA 4QNPE 4X4YB 1F02I 2DQIH 2R0KL 5D6CB 3MBXL 1RFDL 3VMPA 4L4TE 4PRDB 1YJDC 1CD9B 3CSYA 2D2OA 2ADGB 4X7SH 5JOPE 2Q76B 3OHXB 4OT1H 1G7PA 2GTZA 1NBZB 2JELL 2VABB 3NH7L 4J7RA 3RDTB 2QSVA 3RPIB 1MCNA 1RURL 2ADJB 4JZOB 5AG9A 1ZHKB 4QLRA 4QXUH 4PV8B 1RZKL 4X6CE 3VGEA 5I15H 4RFNB 5INCA 3LQAH 3RUGF 2JK5A 2HRPH 2Q7YA 1RZ7H 1XFPA 2H6PB 2N4IA 4I4WB 4YBLB 2VL5A 2CRYA 4JY4B 4MXQC 3RU8L 2M8XA 4QXTA 1SJHB 3X12A 3QCTH 5J6HB 3HG1B 4MD5B 3RVVD 5E4EC 2XTJE 4XH2B 3BQUC 4NM4L 1QPXA 5GJTL 1RZFH 4M9PA 4U6XB 4UIKL 5ALBL 2P8LB 2JJSC 3V5KB 4IRJB 5HDLA 4QRTA 2GTWA 3VH8G 4LIQL 3CVHA 3MLRL 5IOPA 1I85C 2W9EL 4HUWB 4FQPA 4AIOA 3NCFB 1LO0H 4L8BB 4LCWD 2X1XR 4ESKA 5JOFB 3ZSTA 2EYRB 2V7HB 1U9KA 4D0BA 1NKRA 4Y4FD 4Y5XC 3BMWA 4XC1H 4AIZA 3T65A 5IVXB 4TSCH 4JANB 1QP1A 5I0ZA 1ZT4A 4M6AA 2RCSH 4ONHA 3PL6A 3V0WH 1LEGB 3RAJL 2JE8A 1AKJB 2V17H 2WM0A 3QCVH 1DLFH 3NFNA 3PWNB 1V7ML 2VWEE 4ODHH 2EC8A 3GUTB 2FR4A 3P0VL 1T80A 3HC3L 3SCMC 3T0AA 3UDWC 3H42L 4WRLA 4EXKA 3TGXA 1A7OL 5SWQB 4G8IB 3OF6D 4WUUD 1VSCA 1F97A 2F19H 1FNLA 4N0CD 3GKWH 3QT2A 4OIIH 1ZHBB 5IVXF 5KANI 2ZPKH 3PQYD 2FBOJ 4GW5B 3SBWC 5I1GL 5KJRL 4OCSL 3ULUE 2IG2H 3S37X 1JYVA 3DRQB 4I3RH 2AV7A 1JYWA 2HT4D 3I6GA 4DVRL 2YUXA 4JM2C 3L7FB 3IFOA 1D6VH 2AJYL 2FX8H 5J06A 2D31B 4GW4B 4P9MH 5D2NA 2APFA 4U6VL 4DEPC 4QNPF 1UVQA 3KYKL 4XNQA 3MRGA 3QIBA 3F8UB 4DGVH 1CWVA 2H2PD 5I16A 3V5HB 2YZ8A 3L3HA 4HGKC 1UB5A 3QXAB 2GCYB 1ZLUH 5ICYB 1KGCD 3KJ6L 3K1DA 1WIPA 1XGTB 3L3GA 2EYTA 1F5WA 1HINH 2GAZB 3RKPA 3UTSD 2H1PL 4XCFH 4HG4K 5MEQA 1NFKA 1MFDL 4R96A 4D94A 4OLYL 4HD9A 3EYFB 3OKEB 4OD1H 4H88H 4KHTH 1NCCL 5CLWA 4TSAL 5GZNC 3QNXA 1L4IA 1KLUB 4HFUL 5E08H 1VPOH 3H6JA 3PWPD 1HHIB 4GAYB 1M4KA 4NO5A 5EU7E 3NZ8B 3P9MB 3PABA 3NCMA 3RIFK 4XP1L 2XZQH 1G7IA 2VDMH 3P4NA 3ARBD 5KVGH 1HHGA 4NDMA 3QRFM 3BN3B 1G9MC 1R6VA 3TYFA 3S35X 3ME0A 5EA0L 4NT6B 3H9SE 1BIIA 1DE4A 1ZXQA 3DUSB 3D25B 4NZUH 5DS8A 4EI5B 4HKJB 5E8EA 3OBAA 2VLRD 4LBEA 3VRLF 3FO1A 4EDWL 1I8MA 1ADQL 3OXSA 4HXAH 5D7JC 4IOIA 4YXLH 3TCLA 3C6LB 3H8NA 3U2SA 3C08H 3HFML 4UT6L 5HDQL 2UWEB 4O51A 4F8TA 4XP4L 2OR7A 5IV2A 1NAML 1WZMA 4LCWA 4S1SH 4WI6A 3MJ9H 4Y4FA 1KEML 1W72A 5DJ2A 3DMMB 3RI5F 5FAAA 2HVKB 4K8RL 3BWUC 3U30C 1G7HB 4GJTB 5HGHB 5DMYA 2BHUA 4HF5H 5GGTH 2YWZA 3KPPA 5DTFB 4OKVA 5DQJB 1XF5A 4KQ3L 1EZVX 4FQCL 3OF6A 5IFHL 4WUUA 3QUKB 1F8TH 1KIPB 1MPAH 3VXRE 2ZP0T 3OX8A 4QRRB 1INQA 5E0QA 4G8EA 1M7DB 1JL8A 4Z7OE 3ILQD 3GMRA 1T5WA 3PQYA 1QEWB 2DS4A 1AC0A 1IARB 4JQXA 3S4SB 3MLXH 1KJ2L 1MJ7L 4ALAH 2R1XB 1RZIA 3LV3B 4POYA 3E1F1 1OGAA 3DETC 3ZKMC 2AI0H 1NBYB 3Q6GH 3CGTA 1FG9C 5DMJB 4G8FB 3RL2A 3WN5A 5IKCB 4K3EH 3IKCB 4OSUL 4V1DB 1MJ8L 4XVJL 4Y0GA 3AAZB 1JPGB 2RHEA 4G6KH 2X4OA 1LD9B 4N5EC 4YDKL 2RQ8A 3NA9L 4I0PB 3CPLA 5I1HH 1GGIL 5CEZD 1WEJL 5IG7B 3HUJB 3UTSA 4I18C 3VFMB 1DLHB 1BWMA 4GRWE 5HD8C 2E7CA 4YE4L 2EDYA 4G6ML 3FB7A 3I3EA 1BX2B 1U6AL 5I1DB 4FFVD 4XCCL 4U49A 1MCOL 1T3FA 3WXVL 1IC4H 3FONA 1J11A 1GGCH 4JN1L 2NY2C 4NP4H 2FGWL 3PWPA 3WUWG 2XYCA 2QHRL 5HHOD 1DBML 2W0KA 5JUEL 4PJIB 5K9KA 5KVDL 5GXBB 1EVTC 1A6VH 2QKIB 3MLVH 3ARBA 1P53A 4G9FD 4ZUSB 3U9UA 5J7CC 1RU9H 4KFZC 3FQRB 5EG6C 1WT5A 3RZCB 3V0VA 3WFDH 4OZIA 1AHWB 1HSBB 2XWBB 4Q7DA 5DD5L 4ZAKD 2WIMA 1TMCB 3BEVB 1AD0A 1QUNA 5F7YC 3UTQA 1JPSL 4MDJB 1WGOA 2VLRA 1B2WH 3HC0B 3HRZB 5C2BH 2FX7L 1MWAA 2ZUQB 2WLYA 5JIKA 3P0GB 3MUHL 4HWZA 2ADIB 3FT3B 3PDOB 2BRQA 1AGDB 1DQDH 1KN2L 4FNLL 2P8MB 4R0LA 1OSZB 1QVOA 5LGHH 3UTOA 5LVEA 1NGXA 5C09D 1AO7B 1AXSB 3GSVB 4E41D 4PJAE 5FUZL 2CUMA 4TN9A 4FQ2H 4Z7OF 1F13A 1JGUL 5IHZA 4R2GD 3RVXC 4PJ5D 5C0IA 4F80A 1C16A 3NAAH 1SVZA 4PIRF 3KPOA 3ZO0A 3BHBA 3R8QA 2NQCA 5IGXH 1FFNA 4X4ME 3GKZA 5B39B 4AJ0A 4HCRL 4MNGE 1R3JA 4M5ZL 5F9AC 4BSWA 5I18L 3RL1A 3TBYB 1NEZB 3NPSB 1DSFH 1J05B 1FZJB 3U1SH 1LO3L 4NRZB 4QY8B 5ESVA 3K74B 1P2CB 1EZVY 1YPZA 2EYSA 2DMKA 3MNWB 2AEQL 2IGFL 3LKRA 4K23L 4HS3A 4LHQB 1NMBL 3X17A 2WIIB 4UAOC 3HAEB 3MRKB 4GRWF 5C0AE 3SDDC 2LAGB 4U0RC 1JF1B 2VMFA 2PO6D 3F58H 3GMQB 3BZEB 5EZJA 4NO2A 3HMXL 5J3HC 3WEXA 1NLDH 4FFYH 1WZ1L 5SV4A 2B1HL 2XN9D 1QTYT 1L7TL 1Y6MR 2QR0A 3VDAA 5LBSH 2YSSA 3ZT6A 4R97B 3DXAE 4LEOB 3GNMH 3QDGD 3QEQB 4PJ8B 1XMWA 1SYVB 4HQQH 1WWWX 5I2IA 3TJEH 3HAEH 1IVLA 1IGTA 1A6WL 5DLMH 3SKUD 3FKUS 5LKNA 1I1AA 1CXFA 2DLGA 3WO4C 4FMKA 3MRLB 3U0PB 1FYTD 3OV6A 4R8WL 1NBVL 4J1UB 3G6JB 3QUYA 5HHOA 2X4NB 1OAUH 2WAHA 4G9FA 3TH2T 3LHPH 4XVTH 3MROA 1HDMA 2A6IB 4PJAF 3C5ZB 3DI3B 2V5YA 5DHXB 4UTAL 4JDTL 1C1EL 1H0DA 4ZAKA 3QDJB 1HI6A 1FFPA 5CCKH 5DUBA 4HJGA 5H2BB 4P2OA 3RGVD 1B0GB 2P47B 3MJ7B 4PJHE 5E8NB 1OAXL 2YPVH 5L9DL 2X4PA 5DR5L 1TPXB 5BV7H 4YK4B 5C09A 4M1GL 4WW1B 5JR1H 1JPST 5FYKE 3ZHKA 1CFQB 2HH0L 2E9WA 4M7JL 5KW9L 1IC7L 5EOCH 4OD3H 2EKJA 1CU4H 5DJDA 4GKZA 4BZYA 2YD3A 1NJ9A 4PRIB 2DTMH 4PJ5A 3VXTA 4JZNB 1D5IL 2AXGA 3MRNB 4TPRL 3C60C 4CVUA 1R5VB 2WINB 3C8KA 2I26N 2R23B 3S36X 3LQAC 4ODBD 4JFEE 3B5TA 1CK0L 4BJLA 4J8RA 2AEPH 4NHUB 3EOYG 3BD3A 5IVOA 4Y89A 3VE0B 2N1KA 1K4DB 1I9IH 1QQDB 5E99L 5HPMA 4HC1H 12E8H 4I2XE 4IOFC 1AGFB 3RDTC 2DWDB 1QLFB 5ESAA 1N0LA 4O4YH 2VAAA 3EOTH 4O58H 3FRPG 2P24B 4OZ4B 1FN4A 4YBLC 5TE4H 2HWZL 1ZSDB 2XN9A 4XRCB 1O5DT 3L3KA 4N8CH 1EO5A 5ANME 4TULL 1NGPH 4XXCA 4S1DD 4D3CL 5IEKA 1VESA 3PP3H 3PXHA 4FQLL 3QDGA 3RBGA 2ZUXA 3FZUD 3S88H 3ARXA 3TIEA 1YNTA 4R4NC 1TJGL 5E9DB 3O3AA 5SV3A 4IRJC 1SVCP 32C2A 3BZ4A 2FZ3B 4X98B 3OJVC 4KKCD 3ZE2F 1RVFL 1ZHNB 2F53D 3THMH 3T0WA 1KPUB 2VZUA 2MJWA 3OAZK 2P4AB 1FYTA 2WP3O 1U2HA 4PJHF 4S1QH 4H0IA 2ZSWB 4Y4HB 1FORH 4XNXH 3I02B 4OLVH 3LRSB 4L8CA 1IFHH 3GSQB 1OM3L 2ZCKL 3M45A 1R5WA 3GZKA 2OR9H 4JFQA 3W81A 4PRPD 4OM1H 2FL5A 4Y1AB 3TO4D 4TUKL 4UILL 5DJYB 5E56A 3LPGA 3DYOA 4K7FA 4POZC 5ESQB 1OP9A 4NZJA 1NFDE 4MNQD 4HEME 3KLAA 4HUUA 3M1BA 4YHPA 3RGVA 4WO4B 3SGDI 5MEPA 4CMMB 1GL4B 2CMRL 4LHUD 5I1JL 5EFIB 2D4DA 4KI5D 2BVYA 3MBXH 1KT2A 1OF2B 1RFDH 4OF5A 2H2SC 1MHCA 5IB4A 1S9YA 2Y4SA 3W2DL 3BPOB 1JI1A 3EHBC 3NH7H 1PEWA 2JELH 4LKXB 1S9XB 1EX0A 4ZOEA 3H7LA 5AUMA 3VGHA 1GZQA 1RURH 3E0GA 4CNIB 3KYMB 2V9QA 5IQ9A 1RZKH 5LXGL 4UI2A 3OWEA 4WI9A 5C8JA 5H94A 1HYSC 2VNCA 3QRGL 2UZIL 2WQ8A 1UXSB 3DX8B 1IE5A 5T5NG 5DJAA 3WLWD 3RU8H 3PV6A 4XVUD 5A2JH 1U91B 1F4YH 1A2YB 4UT7L 5ID1B 2OSLB 2DL2A 1PKOA 4NM4H 5GJTH 3HPLA 1N2RB 3HZYB 3SKMA 2WANA 4UIKH 5TF1L 1XGYH 5HI3C 1YUHB 3L6FA 4LIQH 3MLRH 4TRPH 1JHKL 4BFBD 3OB0H 2W9EH 3NGBB 5JPNA 3BEWB 4EN3C 4MD4A 3IVKA 4I9WE 4EBQH 4CVZB 5J9PB 1JWSB 5J1SC 4BFIA 4JVUA 3T2NH 4MAYD 5GS1A 1JTOA 2NR6C 1YYMH 2K7QA 1ZLVK 4PRAA 1M6OA 2P1YA 4M4PA 3RAJH 1CXEA 1NDGA 4PP2A 4MSWB 3U7YL 3O6ML 1JNJA 1QR1B 5SX5K 5C0BE 1V7MH 3FO9A 3V8CA 5F97E 3GFUA 3HC3H 1CD0A 3SE3A 5IW1B 1BD2E 4OLXH 5MERA 3OKDB 5CP7B 4JAMB 1JZ2A 4N8VG 4CJ0A 5I1GH 2FJFA 3C6LC 4FZ8L 4KVCL 4OCSH 5KJRH 2F53A 3K8LA 3MBED 4DVRH 4N0UE 4WU5B 4MJ5A 2AJYH 1P4IL 1NGZB 4U6VH 2BOBB 5FGBC 4Z7WB 4WEBL 3CFKB 1ZT7A 4K7PX 3KYKH 1R3HB 4PG9A 4HLJA 4F2MB 5KBNC 1T6VN 3DMMC 4KKLD 5FOBA 1UZ8A 4FXLA 4L4VD 2KBGA 3E3QC 3SQBA 2W0FA 2AK4D 3GIZL 3IDJB 3WFCL 4R6UA 3MUY1 4PRPA 3TO4A 5C86A 2VE6B 4C83B 3VXSD 1HILA 4MNQA 5CUSL 4OZHB 1I3UA 1BECA 4KGLA 2HG5B 4A6YL 4Z7WF 7FABL 2H1PH 4NFDA 1W0YT 4X7CC 2BY1A 4OLYH 4LHUA 3T0EB 3GM8A 4C4KO 3K2UH 1MH5A 1KIRB 4UTBL 3L5HA 4Z7NF 3EYVA 1PLGL 1XGPB 4LNVA 4KMTL 1FRGL 4M93C 4H5SA 4HFUH 4NNYA 3PWUA 4MXWL 5F9WB 1GCFA 3BWAA 2X4UB 4OZHF 1ZE3C 1IQWL 3D85B 4XP1H 5C07D 3JWDL 4DVBA 3GSWA 3NIDE 1I8LA 2MMXA 3VWKD 3S9DB 1OARL 1LK2A 3MUZ1 1NAMB 1HSAB 4I0PC 5KS9E 4M6NL 2D0FA 2A9NH 5EA0H 5EWIL 3MLPA 1WWAX 2ZG2A 2Q86B 3CFIC 1HKLL 1I7UB 2E7MA 4YC2B 4Y5VB 1D7FA 5HI4D 1HHHB 1X5AA 1G7JB 4GSDH 4EDWH 2HLAA 1ADQH 3FFDA 2H32A 3JV4A 5I8EB 1YEKL 4TNWF 3HLAB 1DCLA 2IAND 3HFMH 4UT6H 3QZWB 5HDQH 2AERT 5GGUA 2PCPB 2OP4H 2ARWA 5HGBB 3B5HA 1EAPB 1FCCA 1E4KA 1KJ2B 4PGCB 3U6RB 1KEMH 3GJEB 4XCEA 3WHE0 1FL5A 3FFCB 1C5CH 4MAYA 1DEEB 2BNQE 2CUHA 4K8RH 3SY0B 4LP4A 1TLKA 3RZCC 3QI9B 2HLFD 1VFBA 3NIGE 4UOW0 5HHVH 3VXPA 4QRSB 4D9QE 2B5IC 4PJBE 1UXWA 4AM0A 4GRLB 3V7AG 4KQ3H 4XBPA 1S7WA 2GKIA 4FQCH 4OD2A 5IFHH 1MIEL 2ZUQC 2ARJB 5E8OA 1KYOJ 2XZZA 1YMHA 2DIJA 5IT2L 1BVLA 2XTJD 4RZCB 5E6ID 2VAJA 1AGBA 3ZYZA 4M3JA 5TFSL 1KJ2H 1MJ7H 2J8UB 3MBEA 3IGAA 1AH1A 2AJ3B 3ARFB 1JF6A 5DK2A 1U92A 3L7EB 5IFAL 3AU1B 4ELKA 1NCUA 2RR3A 4DGYL 2ITCA 2IBZX 1KB5L 1OQOA 1MNUL 4Y2DD 3VGAB 4K7PY 3TPKA 2EH7L 3GSNL 4Y2OA 4UDUA 4ZFOA 4U1KB 1T22B 3GIVB 4K9EL 2XKNA 4L4VA 1RY7B 4FRWA 2WUBL 4YDKH 2AK4A 2J8UF 3NA9H 4R7DB 5FM5O 2ICWA 2BVOB 3HMWL 2Z91B 3NPSC 3VXSA 1QA9B 1OP3K 2W65A 3BDYL 5A43C 1WEJH 4PJ9B 2IBGA 4LLUA 4F9LC 4UU9B 4TUJA 5ETUB 4YE4H 4PY8I 1UACL 3IDMA 2BNUA 4O2EA 3NCJL 3U9PH 3ULUD 4JN1H 1OSPL 2FGWH 3PGFL 2QHRH 3O4OB 4KTDL 4P9HL 1DBMH 4YFLI 5JUEH 1NGWA 3T1FB 5KVDH 4HH8A 4U1GB 5C07A 1L7IL 3DVGA 4I48A 3ZHDA 5EOTB 4D0CB 1N5AA 3OGCB 5BZWB 3VWKA 3UP1A 3KHOA 4NQCE 4NC1E 1QSFB 3B8YA 3IDYB 5T3XD 4RMQA 3QWRA 5IBTL 2ZKHL 4JFXA 4R97C 3U36B 5KAQF 1TVHB 3KVQA 4QRUA 4TQEL 4Z8FL 1FP5A 3OKNA 1JPSH 4ENEC 4G80B 1S7VA 1S7QB 3S35L 5TQ2L 4QTHA 1VGEL 4G8GB 3NIGF 2FB4L 4CGTA 3JVGC 2XNAA 2IBBA 1KN2H 3DRTA 1N8ZA 3MRFA 3FAXA 3MXVL 3OAZH 2IANA 1FNHA 4PJBF 1FNEB 3WMSA 3TH3T 2OM5A 1T21B 4JB9L 3SDCD 1WWCA 4NJ9L 3WE6A 1H3PL 4R3SA 5CJ5A 4YO0A 3D39B 5BV7C 1IMHC 2DMCA 1JGUH 5GZOD 2UVFA 5F3BA 5E5UB 3DO7B 3JV0A 43C9A 1VKXB 3GMLA 3JTTA 3OAUL 5IBLC 4HJ0D 1FL3A 4ERSL 1A7NL 4X6CA 4HCRH 3QDMB 2EDDA 4M5ZH 1PY4A 2PW2A 5I18H 2FHCA 4WWID 3PIQB 2R39A 4E5XB 4EOWL 1U8LB 4HS8L 5FYLD 4Q2ZB 1IGJA 3V5DA 4BKLB 4OCYH 2AVGA 2BK8A 1NCAL 5L8KB 1NCNA 3CFDB 5E6IA 3CX5K 2AEQH 2IGFH 5EC1B 4K23H 4X8JA 4YK4C 5E2JA 3KPRE 4LSQL 1NMBH 2GY5A 4MQXC 3O2DA 3E8UH 1XGUA 1IGIL 3IETB 1T20A 3HZKB 1P7KB 5BW7C 3LS5L 4Y2DA 2GW5A 1E6OH 1UWEL 3ILPB 4JLRA 3BP6B 5F8QC 3BSZL 1WZ1H 2B1HH 5CGYD 2V2TB 2X4SA 1U3HC 5L6YL 2Z31B 4OZFA 2E7LA 2UYLB 1H8OA 5C6PB 1DUZB 3G08A 3IRPX 3DIFA 4Z7VB 5IK3B 4YFEA 1CT8B 4MA7L 1G84A 1IGMH 5HHNA 2XA8L 3MJ8A 3OSKA 2HMID 5BS0B 1A4KB 1XH3B 2I9LA 3LSOA 2UZYB 2BZDA 2EDHA 1A6WH 1YECL 1N7MH 4JHWL 4U7KA 1T0PB 3OMZA 5FCUL 3VXNB 1NBVH 3CJJA 1I4FA 4R90L 5IB3B 3VFTB 5EPMB 1KJMA 5ITFB 3D6GA 5BZDB 1ZLVH 3GSOA 5EBMA 5JDSB 3SGJC 3O0RL 4XPHL 4RSVA 5ACMA 4PY7B 1LP9A 4W4OA 4OUUA 3FT4B 3MUGA 1S7TB 2HT3D 1MEXL 1GSMA 4LLVB 4JDTH 1C1EH 2DOCA 4LSTL 1U8QB 2VR4A 3KWWB 1A6TB 3KXFB 2YUWA 3S7GA 4L3CA 2J12B 2X4RA 4OM0H 4F37K 2GQHA 1OAXH 4P5MA 2CLRB 4P3WA 3S3SA 5JOEA 4P2QB 5DR5H 2OZ4L 3VH8B 1FFOA 3B2UC 1A1OB 1MCIA 5DRWA 4BM7A 4M1GH 4JVWA 4WU7A 5K9JH 5JXED 5EC2A 3V9FA 3SDCA 4P2YA 1A9EB 5KW9H 1IC7H 4LAQL 2BSRA 3BGFB 3FL7A 5IESL 2Z4QB 1YDPA 1YNLH 2DWEA 4H1LA 4JY5L 5C08E 1BJ1J 2CRZA 3IF1B 4WFEE 2FSEA 1A6ZA 2NX5B 3F5WB 4FFWD 4NKMB 4LLMA 3GJFB 4TPRH 3RVTD 4QRPE 4XTRD 4G7YL 3IAGC 3QUXB 2LU7A 1RZKC 3DROB 3EO1A 4B53A 4NM8L 3E2HB 4NKDB 1NC4A 1MQKL 2Y7QA 2NW3A 5DFVD 2CDEA 3V7MA 1OY3B 4WO4C 1OTSC 3T09A 2BFVL 3RKDC 1HEZA 3FO2B 3UAJC 4F33B 3QISA 4XPBL 2AGJL 3GMOB 3EGSA 4MZ2A 3E6HA 5KSAD 3MV9B 5FEBA 4RFOL 3BPOC 1PFCA 5E99H 3OR7A 4XPGH 1ZTXL 3V6OA 4F7CA 4XB8A 2X70A 4WTWA 4IIQA 5CWSB 2UWEE 4HIHB 4HK0A 3BW9A 4RGNB 3MREA 2IPTL 4RQQA 1RIHL 1UYWL 3FQNA 5LGJA 2XOTA 4NQVA 2HJKA 5GGVY 5CP3A 4U31A 4PJ7A 2ESVE 1JK8A 5L8JB 3HS0A 2I07A 1X3DA 3E3QE 4TULH 5EZLB 1DQLL 4EUPA 5TDOA 3MPCA 4NKOA 3N1FC 4ETYA 2BOCB 4P5TD 4B7LA 3MRQB 5FA4B 3LKPA 2J2ZA 5D5MB 1TJGH 5C2UB 1S78D 1CE1L 3WFBL 3ROOB 2DI8A 2OI9B 1D5ZA 4WNQB 1U8PB 1KTRL 5K93A 3NGBC 2H26B 3B4NA 1JNNL 3MRDA 3BIBX 1OAZH 1MFCL 3ORJA 3UZEA 3STZA 3U7WL 4J12A 4ZFZB 4O02L 3DSFH 2LABA 1TQBB 1OM3H 2ZCKH 3B6SB 4W6YB 1VACA 1MCRA 4TUKH 4UILH 4YNYB 3VXUD 1SY6A 1YEJL 2EXWD 4Y88A 3WD5L 5GRJL 1BLNA 1J1PL 1T7XA 4MS8C 5BRZB 4YWGL 2ITDB 4WHYG 1BZ9A 3EYOB 3RWDB 1NUNB 4B41A 5F6IB 2R2BA 1GC1L 5I17A 2LTQC 3TPUB 1X5GA 5ELIA 1TJIL 4Y5YB 5TH2B 3TN0B 2W60A 4XCNA 4KRPB 5KSUA 2DIAA 4HDIB 3FB5B 4LLDA 2Z92B 2V7NA 3AROA 3DVNB 4L5FL 5JXEA 1FPTH 1U8NA 2HFEA 3CVHL 4QF1B 1OPGL 4JFOA 2DL9A 2D9CA 2VIRB 4BYHA 5EO0B 1ACYH 1NCTA 2EDRA 3QXWA 2P7TB 5JW4Q 1S9WB 2PTTB 3TBVB 3L3JA 5DJZB 1OP3H 3UPRB 3W39B 4FXGB 3W82A 2E27L 3QIUB 2NW2B 4Z7UE 3TIDA 5HPOA 3OQ3B 3G5VA 4GW1B 3QFJB 1RULL 1YY8A 4LDLB 2FGZA 1U95A 3T0EC 3EYUL 5KSBE 3CU1A 5TF1H 4KPHL 4MXQD 4PJDB 3QUMH 1KTDB 4QYOB 5KSAA 1MFEL 4JG0L 3BAEL 5TDNB 3CCHB 4N0RA 3ARVA 3BQUD 2O93L 4OCRL 5LG1A 5I8OL 2AP2A 5F9WC 1AIFB 3F6IA 2E6PA 4HGWB 4N90D 1X5HA 3BIKB 3IU3A 1HHKB 2AEWA 3G6DL 1J5OH 3FB6B 2EZ0C 1EO8H 1GHFL 1BWWA 1QBML 3OJDB 4XXDB 4EDXA 5EORL 5I1AB 1UH4A 1B0RA 2NY1B 4OAWA 2VC2H 3O6MH 3W9DA 4NOBA 2PTUA 4YC2C 4K8RC 5I1EH 3SE9L 4Y5VC 5FO7A 4XBEL 5F72S 4MNGA 4TVPL 4P5TA 1MHEB 3WJJC 2HKFL 1VB9A 4ZUUA 4FZ8H 1IAMA 4KVCH 5D7KD 2GJ6E 3PDGA 1CE6B 2A77L 4A6YB 1FC2D 1JHLL 3SCMD 2IQ9L 4AL8H 4HPYL 3EJJX 2BHYA 1P4IH 5DEGA 3O3EB 4ZSOA 1NANI 2DMBA 4XAKD 4P48A 3WUWB 2A0LD 2VLJB 1QZ1A 1P4LB 2BXZA 1IILE 3TA3B 4L3EE 5CEXB 2K9UA 1OB1B 1RQ5A 4JM2D 1GGTA 2BY2A 5IMLB 1UKQA 4ZS6C 1GOFA 2J1KA 1FE8L 4XVSL 4BZ2H 4LPYA 5JORA 3WFCH 3QI9C 4P5KB 2GJZA 2WSKA 5I76B 2ERJB 3VXME 4LGSB 1IAOA 3VXUA 1OWRM 2FBJL 1ZEAL 5ALCL 1A14H 5E03A 3D18A 2CO7B 3OKOB 2E9IA 1MI5A 4GRLC 5CUSH 5DMKA 3CH8A 4A6YH 1Y0LB 4OGXL 2F9BT 4KKNA 3L3OB 2EIZA 3SJVB 1PZ5B 5HYJE 5F8RC 2A6DA 4UTBH 2EDTA 2EKSB 1PLGH 1TZIB 2HN7B 5JNYA 1UT9A 5ISZB 4KMTH 3V6ZA 4G43A 5FDWA 1N59A 2BSTB 5CMAB 1A5FL 3DYPA 4MXWH 4OGYL 1CR9L 5GSVB 3ARFC 3N1PC 1JWUA 2VZSA 1K85A 3MRBB 3ETBF 1UQSB 3JWDH 1HWGB 4KZEL 3VGAC 3AXLA 1LMKA 5GZND 5GHWL 5F21B 4U4BA 1OARH 3VGFA 1IGCL 5IW6B 5IMKA 5GJSL 2M26A 4F57L 1G6VK 4QOKE 1UB6A 2CDFB 4M6NH 4U1HB 1G7MA 5EWIH 4RAUA 2DKMA 1HKLH 3GSRA 5EOQL 3CSPA 5D2LA 3ZL4L 3ZMRA 3MXWL 3QDJE 1LDPL 2OYPA 4RDQF 3PF2A 3QNZA 4Y7MA 4YHZH 1QSED 4PJXA 5E2WH 5B3NA 2PXYD 3MV8D 3IDNB 3DURB 1YEKH 4WHDA 4GXUM 2GSIA 3TV3L 3X13B 4JFFB 3V95A 5E5MA 4AMKL 4BSJA 4PJFB 3D3VB 4KTYA 3BQUA 4MGXA 4GLRI 2FX9L 3O4OC 5B38G 3CLEL 1EHXA 2GITA 2JJSA 3L5XH 5D7JD 5GS0H 3S3JA 4OQTL 1BVZA 1JZ7A 5I1LB 3BO8B 2D7PA 3W0WB 1W2KT 1I85A 1EPFA 1YA5A 1KCKA 4UIMA 2AABH 4KHXL 1KB5B 3ECBA 4PJFF 1QR4A 4LSVL 4O9HL 5DI8A 1LO5B 1QO3A 4AEEA 4Y5XA 3GSNB 4GKSB 5E2TL 4OKDA 1A22B 2UV3A 1K8IB 1OT2A 1CF8L 1TZHB 1VADA 4Z7QF 3ZE0F 3ZE1E 4AEIL 5DQ9B 5IT2H 2IJ0C 1JPTL 1KNOA 1M7IB 3P4MB 5J11B 4U6HB 3MRHB 5TFSH 2FATH 5D7LA 5HVHC 3ELAT 3UDWA 3SCMA 1KPVB 4MJIB 4YPGA 4UQ2B 2L0DA 5DEZA 3RWFA 4PR5B 1YN6B 5IFAH 2R1WB 3SBWA 4NNXA 1R3LA 1KB5H 4LKCA 1MNUH 4I9WD 4LHUG 4I2XA 5T3ZL 4MLIA 4JM2A 5DYOA 4PS4L 3X11A 4CU8A 2EH7H 3GSNH 1OAKL 2YC1A 4GFTB 4IM8A 5LCVL 3NFPB 3VFRA 3ZKMD 2FEDC 4XX1G 1D9KB 1N6QL 4OZGE 1VA9A 2R2HA 1UM4L 3HMWH 5H35B 5GS2H 4UINL 3EYQC 4HIJB 5F3HA 3GHEL 1MVUA 1E4WL 3VFOA 4JO1L 3TVMB 1RHHB 4HWNA 5C0BD 3CIQA 4N5ED 3KPSB 4MDIA 4NQDB 1SQ2N 1UACH 4MCYB 3O6FB 1A6UH 1ZA6A 1XR9B 2NLJA 3NCJH 1BHGA 4P23C 3SHSA 3FCTA 1U8MB 1GPOL 1LEKB 4WW2F 3CFCL 1OSPH 3VCLA 3PGFH 4KTDH 4P9HH 2XTLA 1TVBA 1HXYB 3M8OL 3KLDA 3H3PL 1RJYA 4LGRB 2NY2D 5A40E 2XY1A 3TBWA 4JDZA 5IP4A 2ICWJ 4FQIL 5FO8B 4FXKB 5AAWA 2H8PB 5C6TL 2Z8VC 1UM5L 1KV3A 5IBTH 5EU6D 4QHUB 3R0NA 4TQEH 4Z8FH 3S35H 2EDKA 1QSEA 2PXYA 3MV8A 1M71B 3IDGB 2NXZB 3BN9C 3MXVH 4CDHA 4U1MB 4HKXB 5CBAA 4ZTPL 4RWYL 2BMKB 4O5LH 1IAII 4LLQA 1W8NA 4JB9H 4YHKL 1VEOA 3OJMB 3LN4A 4NJ9H 2CPCA 4WHCA 1H3PH 2HFFB 1ZANL 4J3WA 3MV7D 4PGBA 5D7JA 3F7QA 2VLLA 5DJ8B 1I3VA 5SWSB 2XQBH 1WFNA 4X6DA 2CR6A 2O61A