2EC9U

Crystal structure analysis of human factor viia , souluble tissue factor complexed with bcx-3607
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
120
structure length
116
Chain Sequence
EPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Probing the S2 site of factor VIIa to generate potent and selective inhibitors: the structure of BCX-3607 in complex with tissue factor-factor VIIa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 19
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 2007-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ec9U00
1AP2B 1F13A 2X4SB 4R6UA 5ACZB 3JWNC 1YNTA 1EZVX 2ICEB 5F7YC 3X3GL 5AG9A 3HRZB 3NVQA 1VGEL 4HHAA 5HHXH 3LH2H 2FX7L 1RPQA 3ARYA 1C08A 5DQJA 5CEYA 3TYFB 3OHXB 4XVTH 1KLGB 1SJVA 4EI5B 5CZVL 5IV2A 4XMLL 1DEEB 4YDKH 3VGDA 2OCFD 2PUQT 3D39A 4PS4L 3MV8D 2ZUQB 4PRID 2UZIL 3P77B 5HI4D 1BGXL 3PDDA 2E7CA 4KK8D 1V3JA 3UPAA 2GSIA 4XPTL 5BOZG 5J3HC 2YD3A 3OSKA 2Y23A 3ARUA 1BZ7B 4JM2A 2H2PD 3TNNB 1FYTD 3OKMA 4Q97A 1U36A 1S7VA 1A6UH 2AI0H 2C3WA 3DXAB 4PV9A 3HZMA 5GIRA 2PYFB 4IRJD 5D7JC 1EAPA 3NIGF 2VQUA 2R56H 3WIHA 5KVDL 4JZNA 2IFGA 1S5HB 5CILL 1DQLH 5HHQB 4IRSA 2VB5A 3HR5A 1FVEA 4Y4KA 2YUXA 5DWUL 1BFOB 3DWTA 4UT7L 3VFWA 3ORJA 4NNPL 5DQDH 1IL1B 5HD8C 2PW2B 5ESVB 3C87A 3S37H 5EO0A 4LLYB 4NUJA 3QQ9D 4K9EH 1VEOA 4GMSL 3WFCH 1FC1A 2J5LC 1PX3A 3VGAC 4GRLB 4LSUH 3ARRA 1JK8A 5I74B 3UTTE 4TNVK 4OV5A 3AUVA 1W72H 4Y19D 3NFPB 4X9IA 1HQRB 4JFQA 1I8LC 1BP3B 2IPKB 5KTEL 5LGJB 5E6IA 1KIPA 2M8XA 4WU5A 1JPSL 2MJWA 4XNQA 1BVLB 2FH8A 3RA7H 2FECL 4PTUA 2YA0A 4F7MA 1WGOA 2P8MA 4OB5H 5DJ6B 4NQVB 2BVPB 4DN4L 3H3BC 2V2XA 4JPIA 1F97A 1IGIH 1KFAH 5EIIA 4ZMAT 5DT1L 4N8CL 4HJJH 2BRRH 4TQEH 3HE6D 3CCHA 1UM4H 5DO2D 5JOFB 1N6QL 5JW4M 1LO0H 3S9DB 3BH9B 3U46A 1F58H 4M00A 3ZYOA 3QDJB 3F7VB 1KELL 1T22B 5KSAC 2WBWB 4CBPA 2LE9A 2VLRA 4MJ5A 3BRFA 1G7HB 3DV6B 4OM1H 4JY4B 3RP1A 3U9PH 3V2AR 3VFOA 3OL2A 1RHHB 4Z6AT 3KYKL 2JJTC 3LEYH 1DQDH 5CBEB 4UT6L 3V7MA 1OCWH 1RJCA 2X5PA 1X5HA 1MWAB 3T0BA 2BNQA 3IKCB 1Q9OB 3MJ9H 2PW1B 2EZ0D 3WUWB 5MENE 1XH3A 2NLJA 1PVHA 2ZG2A 5E03A 1KCRL 1NDMB 4PRAB 1CLOL 2L7UA 4XCNA 2DQEH 3RDTC 3DRQA 3I3EA 5C0CD 5I71C 4TUOA 5JO5B 5DMGD 3X12B 1FNSL 4HUWA 5BV7L 2X4OB 5D7IE 3ULVC 1RZFL 2FZ3B 1PDKA 4HLZH 5DYOA 1O7SA 1EUUA 2Y5EA 5FA3A 3VRLE 3NFSH 4JO4L 3PWPB 1HCVA 4NBXB 1ZHKB 1NEUA 1X6LA 4OI8A 3WEXA 1RULL 4JM2D 4H20H 4ZXBC 2EDJA 2OJZH 3B9KB 4F7CA 4QOKA 3WS3A 4OI9A 5F9WB 2QHLA 4NP4H 5IMKA 1S5IH 2VLLA 1N0LA 4YHNA 2HFGL 1EJ6A 4IRSD 5KN5A 1HYSC 3HLAB 1NBZB 3LKSA 3BWAA 4K8RL 4LMQI 1IAIM 4Z7WF 2DYPD 1KLUB 4N9GA 3GSWA 5JUEL 1FIGL 4ENEC 4L1DA 3T08A 5CKAA 2VQTA 3RI5F 4AEEA 5JIHA 4QRPD 1U58A 1F6AB 3OQ3B 5L2JB 1QBMH 3QIWD 3FQUA 4L9LC 3EO0A 4KKLD 4PTTB 4LPVA 1A9BB 1BBDH 4XTRC 3SOBH 1TJIH 4QHKI 3FB6A 5E6ID 2EDNA 3U0TA 4XP9H 3BXNB 1UYWH 3WE6A 2ATPA 5F3BB 1ZVHA 1K5NB 2XTJB 5KS9B 1MY5A 3C60B 2Y07L 3PGDB 3DGCR 4AIOA 5HDQL 2OSLA 1UG9A 4OKDA 2K1MA 5HI5D 4S2SA 4HIHB 3U1SH 1YEKH 1RUAH 5SWZB 4YX2H 1AXSB 5EOTA 1T1YA 4PJFA 1YECH 4XAKE 1VACB 4AG4H 2F54B 2AJSH 4FXLA 3KPOB 4MQXD 3WXVH 4UTAL 5IB5A 4HIIB 3HMXH 4HS8H 2X4RB 3B2VL 3OGCB 1XGQB 2IQ9L 5CGMA 3V5KB 1H3VA 1YEEL 3H7BA 4NWTH 2F8OA 4OGXL 4RMUA 2F8XC 1OAKH 5IBTH 1UVQB 4PJDE 3W9DB 1MRFH 1H8NA 2R0ZL 3KDMA 4X9FA 1HZHH 1MJUH 1OB1A 3MXWL 3RWJA 1J10A 3MLYH 1BIIA 5L2KE 5EA0H 4I3SL 4FZEH 4YZFF 1NFDF 3MRQA 4MDJA 4S1QH 4RGNE 3N1MC 5J0BA 3W2DH 5CP7B 1OTUC 1JYVA 3BDYL 5D1QA 1TJHH 1A1MB 1ZV5A 3E3QE 4KQ3L 5CJOL 1CTOA 4OZHB 1K2DB 1TNNA 3VXRA 2AERT 4QOKD 3JTTB 3H9HB 3U36B 1MEXH 2AEWA 5I1JH 4LVOB 2E8ZA 3EYFB 2FLRT 5L8KB 1FO0L 1ZVSA 5I9QC 3OJ2C 4QRUB 5IROA 4DN3L 4LNRB 5ID1B 2CRZA 4RGMC 1ZEAL 3QQNA 4LVHC 3ZT5A 5EH1A 4HGWB 2Z31C 4F37F 3PXHA 5AYUL 5A43C 2YEZA 1CG9A 4QRRB 3V6FB 4MYWB 5GGVH 3TA3D 2Q87A 1G9MC 5ISZA 3G5VA 3BD3A 4F8QA 2DIAA 1VENA 1KUMA 3KYNB 4JO3H 2VAJA 4WUKH 5E6YA 4JFZH 1YEIL 3K4AA 1CDBA 4Q6IB 2IH3B 1IZJA 5DF0A 1R3KA 5MEQA 1LILA 1AO7E 1I8KB 1RIUL 4ZODA 5ELIA 2X6MA 4XRCB 3GHEH 2X4NA 2OL3L 3ARGA 3QIBA 1BF2A 3CVHH 4PJ9D 3U7YL 3SDYL 4C54A 3HS0B 1X3DA 5DD6A 1NAKL 2D7NA 5C9KA 4LHUG 5A2KH 1DBBH 4NM8H 4OZFH 2OTUB 2PYEA 1N5AA 4NDMB 4MNGE 5ILTH 5CSGA 5DGQA 4PJ7A 2CPCA 3KJ6H 2EIBA 2HVJA 1WFNA 4U1GB 2YSSB 1KJVB 1QRNE 4PUBL 4M9OA 2ZJSH 2APXA 1RFDL 1KN2H 3QG6B 4MA8H 2VDPL 4P2CG 3VD4A 5C6PB 3HPJA 4OZGF 3I3DA 4R7NA 1YQVL 3DYMA 5A3IC 1KB5A 1JHKL 2X9XA 1N8ZB 1P9MC 4Y1AB 4Z7VA 4OSUH 1IGYA 3LCYA 4K7PX 2I5YH 3MBEB 5FYJH 2JJSC 5FOBB 2MTPA 4G3YL 3OJDA 2PETA 4HD9A 3ILPA 2UWEB 4X4ZA 3VXUB 1U8OB 3G9VA 2HJKB 43C9B 4OKVB 1BFVH 4HIJB 3I6KA 3MRRB 2NY1C 3RNQB 2DM3A 4YNYA 3LEXA 1EHXA 1GIGL 4PJHB 2CDGA 4K3HA 5I30L 5CP3H 5L0QC 1SY6H 3MLUL 1QQDB 3PHOA 1A3RH 2YMXH 1NMBL 4O02H 5CGYC 5HGDA 3LS4L 3VXRD 2GSGA 4PY7B 4C83A 4N68A 3LKOA 1FNAA 4E42A 3I9GL 3FQTA 2R4RH 3QWRA 5IR1B 3NZ8A 4ODXB 4F7TA 5DMIH 3T77B 1FVCB 1IAOA 2A0LD 5MP6H 4BFBD 1OARH 4FQXC 4Z95H 3RBSA 4ZUUB 5EO9B 4NKDA 4NZTH 3DO7B 1AGCB 1IEBA 1INEL 5E9DD 5F93C 5DJCA 5MI0B 3OAZH 2GW5A 2X1OA 4XVUC 4XNZB 4P2OA 4D9RD 1F00I 3EFFA 3BPLC 1QLFB 1UM6H 3FOLB 4PD4J 4XXCA 3RIFK 2HT3D 4M61A 3BISA 4QHMB 3EJYD 4CW1A 1IAIL 4WI7A 5IVZA 3ULSB 3ARGD 3I2CH 1RURH 1Z3GH 2DTSA 3KPRD 3WNKA 4ODHL 3O6LH 4OTXH 1NLDH 5BVJB 2R1WA 4I2XB 5DQ9A 4LU5H 3CFBB 4N90D 5C3TA 3EYUH 3CSPA 4X4MA 1UB6B 4IOIA 1EXUA 3CGTA 5DK0B 4RGNC 3D25A 1EO5A 1CICA 1MQKH 2YZ8A 4Y5YA 3VFSA 5IB4B 4OBSA 3E3QC 4FFVD 2W0PA 1BJ8A 3PG2A 3ARDD 2BSSA 3V5HA 3KG5A 4I4WA 1AJ7L 3R8BB 2NPLX 5CJQL 4JFDB 1MI5E 3VG9C 1JMZA 2NR6D 5D4QA 2DF3A 4K94L 1UKQA 5DFWH 5J6HB 2ZOKA 4ZUWB 1S8DA 5JW4Q 4K9EC 4XVSH 4FTVB 3MCG1 2XFXB 3DIFB 1A3LH 3S5LG 1DVFA 3VXMA 4O5LL 4XMPL 1PQZA 5CD5D 1AGFA 4NRXB 4TSAL 1FNEB 5CEZH 1NQBA 3PABB 4KKBD 1HHHA 5FYKE 3GNMH 3L6FA 4Z77B 2OYPA 3GKWL 3VXNB 4Z7WE 2FATH 4UNVA 1WAAA 1AGBB 4PY8I 3SKJL 2AEPH 2I60H 2P4AB 5FK9B 4MWFB 1M6OB 3DUUB 3LIZH 1NC2B 2FCBA 4DKFL 1RJYA 4MXWL 3R4DA 5I1CH 3HAEA 4UB0L 1XR9B 4LBEA 3OXSB 5FYLL 5JNYB 5C0BE 1GGIH 3SJVE 3QWRD 3VFUA 2Z35B 4GLRI 2DWEA 3GMRB 5FECB 1FZMA 3P0YH 1MELA 5F7UA 4PLKC 3CDGB 3GMOA 4QKXB 4Y5VC 5E8PA 1MFCH 5DZNA 4J8RA 5BZDA 2AXHA 3OAZK 2DQIL 1AE6L 5EBLB 4P2OD 4LCUB 1NCBH 1W8NA 4MXVF 3S36L 1I4FA 5HGGS 5D5MF 5GGSB 5TH2B 3RNKB 3ZT7A 1ZKAA 3EJZD 4N0YL 4KVCL 4LAJH 1T20A 2A1WH 3MYJB 4CJ1A 1F45A 5GZOD 4NQSB 2HFFB 3RUGE 2ADIA 3JZ7A 4LLDB 3EYOB 3TVMB 4KVNL 3LQAH 2HLFC 1EX0A 1QBLL 4G8FA 4IS6A 5B4MD 4UTBL 3P30H 5T1LB 1EIBA 1QNZL 3RVTD 4I3GA 3CX5K 1A2YB 4U0RB 1CICD 1I1FB 4LCWE 4YZFE 5DUBA 4CMMA 1OP3K 3QUMH 2W0LA 3MRLA 4ZOAA 5DJ0B 4KZEH 3BZFA 4ZDHA 4NQDE 4FQ2L 2XWJA 1NDGA 4U1JA 5FYJE 3LDBB 1Z5LB 1OW0A 2FWOA 5D2NB 1T2QL 2V9RA 4Q0XL 4NIKB 5E1HB 4LSQL 4HQQL 2AK4A 2R2HA 3QUYB 5J11B 2HFTA 1S9XA 5GHWH 4AY0A 5CCKL 1DVFD 4P3DB 1G7QB 4P2RE 3VXMD 1WFOA 3TZVB 3DSFL 4QRTA 1R24B 5F3HA 1R3IH 1KN4H 2UV3A 3A6BH 3IFOA 4Q6YA 1UWGL 4HCRA 4KROB 5T3ZE 4NJ9H 3L5HA 5F1IB 3KLDA 4R96A 5JHDE 3K1DA 4K3JH 1AC0A 2FJHA 4DAGL 2QQNL 1QTYT 5C0GA 1A47A 2IALB 4FFWC 2LQRA 5FGCE 1P1ZB 3FRPG 3T4AA 3O8XD 2ZUSA 3BT2H 3MRPA 2D9CA 3CZFA 1DL7L 1REIA 3FT4B 3G08B 1CF8L 1CGSL 1IKFL 1T7WA 4PY8J 4PLNC 3G6JA 5HJ3A 3ZE2F 3RL2B 1PG7H 1CXFA 2DQCH 5DRNA 5TE7H 2RIKA 2WBJB 1WICA 2A9NH 3B3IA 3HPLB 1KGCE 1N7MH 3SGJA 1UB5B 5I19H 5F9JA 3CZJA 5E94B 2WANA 2AJZB 1KT2A 5KSBA 3FO2A 3L3GB 3BEWB 1QR1B 3L1OL 3P4OA 1YEGL 3H3PH 4XZUA 5KSAD 3AAZA 4WDIB 1ORQA 1S78C 1SYSB 3Q6GH 4M9PA 3SQOH 1C7TA 3LKQB 3OKNA 3QXDA 3QA3A 4JY5L 4G8IB 3TN0B 5ITBH 3UAJD 4WW2A 1MLCA 3B9EA 3HCVB 4OZGE 2NY2D 1VFAB 2QADB 5EBMA 1J8HE 4U6YA 3D5OF 4FQCH 2NXZB 3MX0A 3QZWG 1UZ6F 2B20A 4X6EA 3O45A 2PTVA 3BKCL 3CC5B 4JQVC 4K2UH 3DURB 5AG8A 2VDML 5ESQB 3JV0A 1UJ3B 4HC1L 3MUGA 4HLZG 5T1KA 4MCZB 1IAMA 1J88A 5AAMA 2IADB 1V05A 1RK0A 3B9VA 4LF3B 3VH8G 3C9NB 2DMKA 2ATKB 1H15B 1NCDH 1UKSA 1YMMB 2R39A 4G9FB 3MLWH 4EQ2A 3V0WL 3F5WA 1BIHA 1P5VA 3TT3L 4N0UA 5KVEH 1WFUA 3JV4A 4ZOEA 1AP2A 2X4SA 1RZGB 2ZOLB 4BQCA 5ACZA 2ICEA 3HRZA 3STBA 3MODL 5LAXB 3V52L 3EIFA 4HMDA 1NLBL 2MNUA 1Q0YL 3CJJA 3O6KL 3OHXA 4XBEL 1KLGA 3TYFA 4EI5A 3SBWC 4EZMA 1DEEA 3BD5A 2AK4D 5E24E 1T1ZB 3IDGB 2Y6SC 1IGCL 35C8L 4L3AA 5I1HH 1J7VR 3SEPA 3MZGB 4POZD 3WO4C 1VDGA 3P77A 2FX9L 1RUPH 3NABL 1BZ7A 3TNNA 2IANB 1V3LA 3B2UD 2ZCKH 3HG1E 4X7EC 3DXAA 2CO7B 3B9DA 2PYFA 5B39G 4ZO6A 4NRZB 4PBWD 2CO6B 1YEHL 3RTQD 4M1GH 4BZYA 1S5HA 5HHQA 3WNMA 1B90A 3QAZC 4YEEA 1BFOA 3ZMRA 2X1PA 3FONB 1DUZB 3QEGH 4ZD3H 2W9EL 4OD2B 4ZS7L 1IL1A 3DX8A 2PW2A 5ESVA 3Q6FB 3Q5YA 4GQ9H 5T5NG 3T3PF 2XG5A 4UIKL 2ZKHL 2J8UF 1RIHH 2FBJL 4LLYA 3MLZL 2N7BA 3DGGB 3MA9L 2E27H 4GRLA 1FP5A 2MPAL 2OLDA 5DI8B 5GS2D 3NFPA 1YYMH 1HQRA 2VMFA 2IPKA 5LGJA 2WUBH 5GGRB 1WZ1L 3KLHC 1CQKA 3QXTA 1BVLA 2LU4A 4FNLL 1IC1A 2XYCA 4YHPB 1NGWB 4KDTA 3FFCB 5DJ6A 4NQVA 1EJOL 3UTSB 2BVPA 2W0KA 5DD0L 3MTRA 4APQB 2CLRB 3LEVH 3WFBL 1MCJA 4OJFL 1JI1A 4WV1C 5JOFA 5T1KD 3BH9A 2N1KA 4PJXF 5KVFL 1YNKL 4RX4A 3QDJA 2RB8A 3F7VA 3IFLL 5JOPD 1T22A 2O5ZH 2MCPL 3KR3L 3QBTB 1DN2A 1G7HA 4LQFL 4QTIL 4FFYH 3SO3B 4H8WC 3DV6A 3Q1SH 1E4WL 4JY4A 5T3XE 5C0AD 2B1HH 5CJBA 4HAFA 3QPXH 3MLTB 1RHHA 5E2UL 2WUCH 5CBEA 4JO2H 1J8KA 2CR3A 4PJAF 2YWYA 1AR1D 1MWAA 4PP1C 3G6DL 4EI5D 3IKCA 4DTGH 1Q9OA 3MJ8B 2PW1A 3NZHH 3WUWA 1MRCH 3ESVF 1NDMA 4PRAA 4WW1B 3L3HB 4FP8H 2F58H 1CK0L 2VSCA 4M6OL 5JO5A 3X12A 1OGTB 2VSDA 2X4OA 2H2SD 5IESL 1OAUH 3BEVB 5TF0A 2FZ3A 4LVEA 3QG7L 4L4VE 3QRGL 4KJQD 3K1KC 2DQFB 3PWPA 1ZHKA 3EJJX 4U7SA 3AGVA 2YN5A 1F8TH 5ICZB 1G0XA 1JN6B 5HHOE 3B9KA 3GDBA 1VHPA 3DXAD 2ZUYA 4M8QB 2EYSB 1RK1B 4FMKA 4OZFG 5TQ2L 1KB9K 4PRPE 3RVXC 5D5ME 2NQCA 1FFRA 2X4QB 2KUTA 4W4NA 3OR6B 2A6IB 1WITA 2IAMD 1NBZA 3HLAA 1X5AA 3ARPA 3OG6B 1KEGL 5EOQL 4YHML 1T66C 3RDTB 1XGPB 3QDHA 1KLUA 4W68A 5DHVH 1J86A 1SHMA 4OQTA 2HH0L 4JCLA 2LVCA 4E41E 3N85L 1J18A 1KC5L 2B4CC 3WJLA 1F6AA 4AJ0A 5L2JA 1UXWB 3GMPB 2YXMA 3UCRA 3DV4B 4PTTA 4Z18A 4ZG1A 2PXYB 1LE9B 1A9BA 4Z0BL 3P11H 2HYMA 3C5ZC 3QDMD 3QT2A 5FYKU 5GPRA 1LP9E 3BXNA 3C5JB 2HRPL 5F3BA 4X6DF 3CLFL 1K5NA 4ZFGL 5KS9A 3BE1L 3WFHB 3C60A 3PGDA 3FAXA 3U48A 4HIHA 4PB9L 5SWZA 3JWOH 1AXSA 2P44B 5GGQH 4MA1B 1VACA 2W92A 1JGLL 1AHWC 4OFYD 2F54A 4TNWF 1EK3A 3KPOA 5IT2H 1KPVB 4J3OC 4I9WE 4HIIA 4RFEB 3AC0A 1N4XL 2X4RA 3OGCA 1UA6L 3V5KA 5KOMC 1N59B 5SX5H 4LHUB 1UVQA 2EE3A 3W9DA 1C1EL 4M1CC 2VDNH 4G7VL 1T7XA 4DVBB 4Y4HC 2DI8A 3FO9B 3EOTL 4PLJC 4GKSB 2VTFA 5K9JH 1TJGH 3ZE2E 2DDQH 3MNVB 2VXSL 1HEZB 3QH3B 5F9OL 1VFOA 3AY4C 1IGMH 1WT5C 1IC4L 2FHBA 3FN9A 4X6FB 1NKOA 3O4LB 5IJKC 1NBQA 5CP7A 3CMOH 3NN8B 4K71C 1OAYL 4RGOL 1A1MA 4KPHH 5F7NC 1I85A 3PWPD 1OLZA 4PJGA 4JHBA 2EO1A 2OR9H 1K2DA 4OZHA 3BGMB 3B9KD 4WFHD 4YDLC 3JTTA 3H9HA 3U36A 2KDGA 4RFNB 4WCYL 4XXDB 3EYFA 4OD1L 1MF2L 1WC7B 3SCMC 3QCVH 3UZVB 1R6VA 3TT1L 2XN9B 4QRUA 5ABDE 4LNRA 5ID1A 3V6OE 1KCSL 4MJ4A 3P9MB 4HGWA 3U2SA 3V7AG 3T3MF 4QRRA 2X42A 3V6FA 4NBYB 1UZ6E 4E0RB 3BX7C 2J8UB 3S98A 3NA9H 4O2CB 3MREB 1IM3B 3KYNA 4U7KA 5GQBA 3UTTB 1GOFA 4G6JL 1AD0B 5HVGB 4YFDB 1CLYH 1ZLSL 4Q6IA 2IH3A 4M4RA 2P43B 1B6UA 1I8KA 5IQ9B 1CE1H 4DFIA 5DD1H 4XRCA 1IQDB 2GY7B 1VSCA 4BH8B 2DL2A 5ALBL 3HS0A 5I9QB 4NCDA 5I1EH 4JE4B 2QBWA 1FORH 2XTJD 4OLYL 2VXQH 3C60D 3PHQB 1KB5L 4GAYB 2OTUA 3UYRL 3QR2A 4QHUB 4NDMA 5DHXB 4LPXA 2ICWI 2AS5M 4AMKL 5GZNC 3DBXB 4AEFA 1TQCC 5SWZD 2QHRH 1U93B 2YSSA 4M02A 1KJVA 3IFPB 5EU5B 3ZLQC 5ESAB 3K4ZA 5SWSD 1YDPB 2F54D 5K33A 1HHJB 1BOGB 5HHPB 2QEJA 1KIQB 1TZGH 1RQ5A 5C2BH 4NN6C 1VFBB 4I3RH 1N8ZA 4NOBA 5GS0C 4JR9L 3DX6B 2YUVA 4Y1AA 4LASH 1I9IH 3TGXA 5MENB 3MBEA 5E00B 1YC7A 3IT8D 4UBDD 4YHYC 3X3GH 5FOBA 4Q9BA 1MPAL 1I1CA 2FX7H 2ORBL 2UWEA 3HB3D 3VXUA 1U8OA 4DKAA 2HJKA 5CZVH 4QLRA 4XMLH 3SE3A 43C9A 4OKVA 3R06B 4HIJA 2GCYB 2HRLA 3MRRA 4GRWH 4LPTA 3QUXC 1CL7L 4PS4H 1FPTL 4X7SL 3RNQA 5I1GL 4ZFFB 3REVB 4PJHA 2ZUVA 4OLVL 5DD3L 4CNIB 1HH9B 3MSPA 1QQDA 4X6CE 2UZIH 3QEQB 4LDEB 4ZTPL 1BGXH 3S5LB 1GGYA 4XPTH 2IPUG 4PY7A 1LD9B 4JB9L 4ZAKD 5GSRB 3K46A 1U95B 4JG1L 5D7LB 1OAZL 5IR1A 3TNMB 4ODXA 4AL8L 3NCYP 3HC0B 3T77A 1SJXA 1FVCA 1XGTB 5ICXB 4JFFE 4I1NB 1WIOA 4ZUUA 5EO9A 3DO7A 1KPUB 1AGCA 4QRRD 1NKRA 3AVEA 2YD7A 3LKNB 2HKHL 5DWUH 4UT7H 4NHUB 2NY1B 1RU9L 2ESVB 4NNPH 5T1DH 4LGRB 2X41A 5DJZB 1PY4A 3AS2A 1TMCB 2BNRE 1QLFA 3FOLA 2VDLL 4GMSH 2Q86B 4C4KO 1LO3L 3BHBB 4HEME 4IEFB 1GC1H 4QHMA 3AS0A 3ULSA 4EIZC 3DUSB 2Z8SA 2XACC 3RVVC 3H9YA 5KTEH 5BVJA 3U7WH 4FQXB 5CEXB 4PJAE 2EKJA 4DWHA 1G0DA 3P73B 4I2XA 3CFBA 4I77H 1DQML 1QFPA 4KHTL 1Q9KB 1UB6A 4Y88A 5DK0A 4GBXC 4K7PL 1QHOA 4LSSL 3T1FB 5A2IH 5IMLB 5MEOB 5IB4A 2FEEI 4FFWD 1G1YA 4N8CH 1URLA 4Z7OF 2ZP0T 3BPLB 4I5BB 1N6QH 1JNJA 2B5IC 4JFDA 1TQBC 2HTKC 2KPNA 1CIDA 1MCPL 1KELH 1O5DT 5J6HA 3DVFA 4POUB 4ZUWA 4BFIB 4M7JL 4FTVA 2XFXA 3DIFA 1S7SB 1RZJC 4Y1AD 3V6OC 5HDLA 3ULUF 5CZXC 3GJFH 1CBVL 4YJZL 3GSOB 1YZZA 5L2KB 4NRXA 3KYKH 1XF1A 5J57B 1CXKA 1FNEA 4UT6H 3PABA 5DJDB 4RGNB 2WINB 3VXUD 4Z77A 3H0TB 1UH2A 1ACZA 3VXNA 4M93C 1KCRH 1S78D 2ZG1A 1AGBA 1CLOH 2ICCA 1P7QD 3TJHC 2J12B 2VLKB 4KU1A 4MWFA 5FK9A 1M6OA 2BXYA 3DUUA 1NC2A 1FNSH 2R8SL 5BV7H 1CGVA 3IYLW 3K8KA 3VG9B 3MLRL 1XR9A 3OXSA 1RULH 4EOWL 5JNYA 1C8PA 1FV1B 3WFEH 1QUNA 1FGVL 1HDMB 1FSKC 4HWNA 5IKCB 4RZCB 3RWCB 1W72B 2Z35A 4PJBE 4P5MB 3GMRA 5FECA 4P23B 4MNHB 2JK5B 3CDGA 1IILE 2A73B 2V2WB 2XKNB 2HFGH 4F57H 5L88H 3PP4L 5EBLA 4PJCE 4LCUA 3GJEB 3DNKA 1U3HB 4FZ8H 1SVCP 4W4OC 3ULVL 4WRLA 1I1RA 5GGSA 5C08B 5TH2A 3RNKA 1AO7B 1EO7A 5JUEH 2E7MA 1FIGH 4DEPB 1L7TL 1SEQH 3MYJA 1JWSB 3C2SA 5GISH 5FIEA 1AC6A 4NQSA 2HFFA 4LLDA 3EYOA 3TVMA 3X3FL 4R90L 4X9HA 2DN7A 4ZTOL 5EC1B 2Y6SD 4MNGB 3RGVC 5F44A 5JDSB 5B3JE 5C9JB 1QSFE 5T1LA 4N0CC 4Y5VB 3JV5A 1QRNB 2HP4A 2Y07H 3FL7A 1XGYL 1A2YA 1WCQA 1I1FA 3QPQD 2QQLL 4PG2A 4V1DE 5DJ0A 4P5TB 4HCRL 3AB0C 5IBLC 3HNSL 3BQUB 2P5WE 1Z5LA 4YK4B 5EU6E 4WI4A 3L9RB 3HNVL 5D2NA 3QZWB 2B1AL 4UTAH 4OZ4B 4JQXA 4FTVD 3QUYA 1F2QA 3B2VH 2IQ9H 2ENSA 4NGHL 5L6YL 4P3DA 5IB1B 1G7QA 1YEEH 1T03L 1WTLA 3GJFK 4GRWE 3TZVA 4OGXH 1R24A 4C4KT 4NSKB 4U3XA 2WM0A 2R0ZH 2WMPA 3S4SG 5F1IA 2D3VA 3WNOA 2EE6A 3CX5J 3MXWH 3IDNB 2IALA 2IGFL 2J7LA 4N5EC 3WHE1 1P1ZA 2CK0L 4X7TB 2GYSA 1P6FA 2X4TB 4FS0A 2DD8L 5IM7B 2D03L 2RQ8A 3FT4A 2APWA 3G08A 3T09A 4LLWB 5D9SB 3BDYH 5J12C 5A2FA 4YXHH 1E4XL 4A6YL 4BFEA 4KQ3H 1KCUL 3KXFD 3RL2A 3BP5B 4CL7A 5CJOH 2WBJA 2DL9A 1CLCA 1DE4B 3MV9D 1G6VK 3HPLA 2HT2D 1BD2B 1UB5A 3HI1B 2DM2A 1U8PB 5E94A 2V5MA 4LSDA 2AJZA 1FO0H 5IOPB 2GIYA 3L3GA 3BEWA 4DN3H 1QR1A 5B21A 3BMVA 4QRSB 4WDIA 5JDJA 1SYSA 1T7YA 1KCLA 3LKQA 4L3EB 4RWYL 5GRUL 5F6IB 1TTGA 2YKLL 4G8IA 3TN0A 5MHSD 1MJ7L 5I75C 1EO8L 3BAEH 3HCVA 1YEIH 1VFAA 5C92A 2P46B 3CC5A 1HINL 3DURA 3IJSB 4GT7A 1RIUH 5ESQA 1UJ3A 1E4KA 1OVZA 1YJDC 2OL3H 1PJ9A 4MCZA 4F9PC 1IC5L 2HTLC 2IADA 4U1IB 3KPPB 5E2WH 3SDYH 3U7YH 5T1LD 4LF3A 1A7NL 3IJHB 3C9NA 1MIEH 1NGYB 2ATKA 1H15A 4OBRA 1DBKL 3WJJA 1YMMA 3ZO0A 4BQ6A 5BS0B 1X7QB 4G9FA 3GRWA 2HT4C 3F58L 1A1NB 3ARSA 4RFOL 2YRPA 1RZGA 1ADQL 2ZOLA 4ZUSB 1JL8A 3MA7B 5EDXA 3X13B 5DD5L 3GGWB 3RVXD 5LAXA 4P9HH 1IKNC 2VDPH 4WWKC 1T1ZA 3QUYD 3VD7A 3IDGA 2BZDA 3JWDC 5DJXB 1QPPA 3U0PB 5EZIL 3QULB 1YQVH 1H3TA 1JNHB 4TTGA 1T89C 1JHKH 3IDXL 4JQIL 5BXFB 2E7LC 3HC3L 2O26U 3FQRB 4MSWB 2V2TB 1UXSB 5JA8B 2WWKO 4KROD 3DOSA 3RKDD 5D2LF 1CXLA 5E7BA 3RVUC 5F7DB 5J56B 5DFVC 3ZHLA 2IANA 3QHZH 5JR1H 4G3YH 1WWAX 4XWOC 5LXGL 3SDXB 3TBSB 4ACPA 5L8JB 2IBGA 3B43A 1ZHBB 1BZQK 4EI6B 2E9IA 4U1KB 1GIGH 1GHFH 5C0BB 3SJVB 1MVFA 5I30H 1BQHB 3MLUH 4Y5XC 4U1SB 1NMBH 3FONA 1DUZA 3ZYZA 4OD2A 2WBJD 3LS4H 3GO1L 3MOAL 3Q6FA 1UACL 4KJPD 2MQCA 4R4BB 5ENWB 5KVGL 5FO7B 1QFOA 4WFEE 4HG4J 2GJJA 5KOVC 3HFML 2EIZB 3I9GH 1OTSC 4GMTH 3CPLB 3DGGA 4PRHD 4WHTB 4N1HB 3CVHB 3HR6A 1HHGB 1QFWH 3VDCA 1L6XA 5DI8A 4AEIL 4OLWL 1NCWH 4OZFB 1CDYA 1Q0XH 4OCWL 1INEH 1IZKA 5GGRA 3TN0D 1CD1B 2WWMC 3Q5TA 2NY3C 4OZIE 4GS7B 4YHPA 1Q8MA 3RGHA 4LDOB 5HGAB 1QPXA 2XQYK 1B88A 3QAZB 1L7IL 2KL6A 4NQCE 3UTSA 2QADD 4APQA 2CLRA 4X7DC 3KS0H 2NXZD 2H8PB 1DUYB 4YIQB 4PREB 3O3DB 2PNDA 1IAIH 4P59L 3V79C 3TP4A 1EA9C 1MCKA 2V5SA 3QUZC 3HUJF 4ODHH 1U8HB 4YWGL 3PL6C 3OJMB 2HMIC 3MROB 5ADOL 4MB4A 5ICYB 2GHWB 2P5EE 4NQDB 5FGBA 2EXYC 5D1ZB 4LPWA 1JF1A 1U8LB 3MLTA 1RIVL 1XCQB 4RDQG 1ZLVH 4ZSOB 1N0XL 4OD3L 1YA5A 3U0WL 2Y36L 1JV5B 4GW1B 3SQBA 4M5YL 1ITBB 3SCMD 4P2RB 5F7LB 1AJ7H 3L5WB 3MJ8A 3Q3GB 2VUYA 3RZWA 2LAGB 4WW1A 3L3HA 2FGWL 4WV1B 4JRYB 1NANH 4Q9QL 5L9DH 5JHDB 3X14B 1H5BB 1OGTA 2VXVH 2VWEE 3BEVA 4O5LH 4XMPH 5FGCB 2VR5A 4P46C 1T4KB 1KJMB 2DQFA 4IRZL 4J3UA 4G6KL 4MD0B 5ICZA 4EXKA 1JN6A 1QSVA 2FL5B 4OIAA 3D85D 4NC2B 5FKAB 2NY5L 3MO1B 4X5XB 4M8QA 2EYSA 3GKWH 1RK1A 4XBGB 3CVIL 5IFAL 1CFBA 5F7WC 4LCYB 3SKJH 1NUNB 4HUXB 1LO2L 2X4QA 3TO4C 3OR6A 2A6IA 1S9YA 3L3IB 15C8L 4FQ1L 4MXWH 4XVJL 4C59B 4PJIE 3RDTA 1XGPA 2QSQA 1I9JL 4FG6D 4JHAL 1I9EA 1MHHB 2NZ9D 3U9UA 5DRXB 1LE5B 1UXWA 3GMPA 1TVBB 4HXBL 3DV4A 1BEYH 2PXYA 1LE9A 1I1YB 4URTB 3M17B 2WWKT 1BZ9B 1X5XA 2DQIH 1AE6H 1J8HB 3C5JA 4OF0A 3C2AL 3FFCD 3WFHA 2BHYA 4HWBA 3UJTL 4CVXB 4KVCH 3FHAA 5CJXC 5FHAH 2E9WA 1IFHL 3GFUA 5BV7C 4HUVB 3M45A 4KVNH 3AM8C 3HI6L 5D6DC 3QUXD 3UO1L 1KPVA 4WFGD 2DQHL 4RFEA 1OSZB 1JPTL 5K9OB 2YK1L 1CXEA 4YO0B 5I8OH 1EVUA 1QNZH 1ETZB 1VPOH 1FFOB 1N59A 1CR9H 4LHUA 1ZLVK 1LO5B 1J1PH 3LZFH 1OAXL 4DVBA 4ODBD 3FO9A 4J4PA 4GKZB 1YYLL 4GKSA 4FQ2H 1DANT 4Y16C 4WIQA 4L8CB 3EZ8A 4K8RC 3MNVA 4XCFL 1HEZA 3QH3A 1T2QH 2NY6C 4Q0XH 2DKMA 3A67H 4D9QD 2O5YL 4WUUE 4X6FA 3O4LA 3MLSL 3JXAA 4NOFA 2XXCB 3K2UL 3WIIL 5CCKH 1JZ7A 3MNZB 3NN8A 3RQ3A 1ZMYA 1WIUA 5I15L 5LGKA 4UOW1 1EZVY 1F4XL 1UWGH 4K07A 1EEZB 1MCOL 4S1DC 4YEFA 1E27B 3BGMA 2CKBL 2YD6A 4FQIL 4CU6A 4MA7H 1T21B 4UINH 4XXDA 4HBCL 1HWHB 1WC7A 1EERB 3T0AA 5ECJE 1GYAA 3CNKA 3IU3B 4HT1L 4Z5RB 4P3WA 5KANI 3P9MA 3QFJE 1IGFH 3NCFB 4U1LB 1CF8H 1CGSH 1IKFH 1K4CB 4P99A 4E0RA 1AGDB 3DVGB 1QYGL 3OF6A 2J8UA 4L8BB 3QHFH 4O2CA 5C1MB 5IWLA 3MREA 1IM3A 4LGSB 3UTTA 3RX7A 2R0KH 4K71B 6CGTA 5JW5B 3EGSB 1AD0A 1LGVA 3RWGB 1F6LL 4MX7B 2PXYD 3ARTA 3L1OH 5IQ9A 5C0FB 1XIWC 1IQDA 4NZRL 4BH8A 1QP1A 3UPRB 4KQ4H 3NH7L 1QO3B 4HF5L 1FQ9C 3IS0X 2QSCH 4JY5H 3H9SE 3B6SB 4YAQB 1P69B 3MRFB 3QHTC 3PHQA 3QUMB 4GAYA 1UFUA 4QHUA 4KRPC 4UU9B 3PWLB 2EIEA 3DBXA 2VWEC 2VDKL 1U93A 3BKYH 1AY1H 4TVPD 4UV7L 2VLME 3IFPA 5EU5A 5ESAA 4N1EA 1YDPA 2VDMH 4LOUD 1AQDB 2XRAH 1HHJA 1I3UA 1BOGA 3SDDC 5IW1B 2PN5A 5D1XB 1KIQA 1R5IB 1WVZA 2YA2A 4MAYD 3PE9A 1VFBA 1UJTA 3DX6A 4HJGB 2IBZX 4HKZB 3V0WH 1LWRA 5MENA 5E00A 4ALAH 1DDHB 4J4PD 3ZKMD 4WO4B 3ARZA 3MODH 4X5LA 1WZLA 1NLBH 4OCRH 1Q0YH 4Y8AA 3O6KH 4XBEH 1TQCB 2GTWB 3D3VD 2AQ1A 4L4VB 3O4LD 3VRIB 1QSEB 2GCYA 1IGCH 4X0KB 35C8H 2Y06L 4ZFFA 3H7LA 5FYKL 4CN6A 3REVA 4CNIA 5JQ6L 1HH9A 4L8SC 1L9MA 4OF7A 2FX9H 2EICA 3QEQA 3VGBA 3S5LA 2VDQL 3RBGA 2DQUL 4M7LT 3MLXL 2AGJL 3S37X 1LD9A 2X1QA 4XB8A 5HI3D 4EIGB 3NABH 5GSRA 4NT6B 1U95A 3PGCB 2BHUA 5FYLE 5CINH 5JXEC 5D7LA 2GKIA 2YPLB 2C26A 3TNMA 3HC0A 1YY8B 2XN9D 4G6AD 1XGTA 5ICXA 2DMBA 4MQ7B 1CFVL 5GS3A 3D69B 1YEHH 1KPUA 2XZAL 3N1GC 3EYVB 2ILLA 3QDGE 4E41B 5BRZE 4CUCA 3LKNA 4JRXD 4JLRB 3OF6D 4MJIB 4Z78B 4JPWH 3T2NH 4NHUA 1GRWA 2ESVA 4M3JA 2W9EH 5DJZA 4ZS7H 4UDUB 2J8HA 4O9HL 4AZ8A 5I16B 5HYFA 2FBJH 2M2DA 3MLZH 1I7RB 2Q86A 3RZCB 3BHBA 3MA9H 2J6EA 3W81A 1VKXB 4GUPB 3U30B 3VWJB 5A40E 5BVPL 3DUSA 1U8MB 1NCTA 3E8UL 4FQXA 1WZ1H 5CEXA 3P73A 4FNLH 1YN6B 4MNQB 1A0QL 4UAOC 1MJ8L 2A6DB 4H88H 2BDNL 2F5AL 1Q9KA 1EJOH 1OL0A 1IGJB 1BECA 2JB5L 5DD0H 3T1FA 3HA0A 3I85A 5TDNB 4NQUA 3ILQC 3WFBH 5IMLA 5MEOA 4OJFH 3MV8E 3FO0L 2FO4B 4PJFF 5E8DL 2OP4L 1JYWA 4I5BA 1WUNT 4X7CC 3CFEB 5KVFH 4D8PB 3ARFC 3MV7E 4GSDL 1I1AB 4M1DL 3P0VL 4FQJH 1FYTE 2MCPH 4BFIA 3KR3H 2Z4QB 1S7SA 3WFDL 4LQFH 4QTIH 4OAWB 1PY9A 3GSOA 3WKML 5F70A 4R97C 5L2KA 1ZS8B 2MFNA 5IBUG 2Z92B 5DJDA 2WINA 3G6DH 4J3WA 3H0TA 2DI9A 4KK5D 3BPNB 3IETB 5T3ZL 4NZDA 4WI3A 1CK0H 2VLKA 4M6OH 1CZ8L 3SGEH 5TQ0L 4ZNCD 4LRNL 5I17B 5HPOA 2HKFL 1TQBB 1FFPB 4MAUL 4AM0B 3QEQD 3IGAB 5EN2B 3DPBA 3QRGH 1MHCB 1H3UA 4G6ML 2EECA 3ZDZF 4H8WL 3RIAF 5E95B 1FV1A 2VDRL 2X9YA 3QCTL 5EG6C 5D7LD 1HDMA 1X44A 4RZCA 3RWCA 1W72A 4P4KD 3S4SB 1KIUA 1Y6MR 1TTFA 4P5MA 1F2XK 3TH3T 4X83A 2D0GA 2F53B 2OTPA 4P23A 2JK5A 1AKJB 5EU4B 2A73A 3SKNB 3LN5B 1C5CH 2V2WA 1EHNA 2XKNA 3H9ZA 6FABL 2DKUA 5GGTL 4K3DH 4JN2B 4CVWA 3VW3L 4YHMH 5EOQH 4KXZI 4R9HA 3NTCL 3GJEA 4BUHA 2ESVD 1U3HA 5C08A 3UJJL 1AO7A 2HH0H 2BY0A 3N85H 4K94C 3W11C 1KC5H 1KENH 1JWSA 3OX8B 3GKZA 4LKCB 3VD9A 3VXQB 1PKOA 5I66B 5EC1A 4Z7UF 3TBYB 4MNGA 5JDSA 3S97C 3W5MA 5C9JA 5AWNH 3E6FB 4YBQC 4KJWD 4Y4FB 1MFDL 2XG4A 3O9WB 2HRPH 4Y5VA 1J0YA 5F96L 3ZTJG 1QRNA 1S9WB 3BE1H 2F74B 3UTQB 3GMNB 2VC2L 2YC1B 1DFBL 5C0CE 3TYGL 3I02B 4KK9D 2BVUA 3MJ9A 4P5TA 4PB9H 2MQ0A 1OOAA 3BQUA 3MRIB 3IDIB 1JGLH 1NMCB 2VUOA 3L9RA 2DLFH 3QZWA 5B8CB 4NO0B 1IGTB 4OZ4A 4ERSH 2D7OA 2NXYB 5ETUB 1MFEL 1UA6H 4Z7VF 5IB1A 3RGVB 5DK3A 2F15A 3O0RH 4NSKA 3P2TA 1F4YL 4G7VH 2IBBA 4NO2B 4QEGA 4JFHD 3IDUA 3EOTH 2VKXA 3ZKNC 1N5YL 1U6AL 3OKDB 1HYRC 4XCEB 3IDNA 4H1LH 1I8MB 2VXSH 3C08H 2GUOB 4X6CB 5F9OH 4X7TA 2X4TA 2APBA 3IRZA 4LLMB 2VLKD 1IC4H 5EUOB 5F72S 4HJ0D 4QRPE 4K7PY 4ONHB 5IM7A 4IMLB 3BP7B 1OAYH 5DHVB 4LLWA 5D9SA 3MUZ1 4AK1A 4RGOH 4BZ2L 4RQQA 3WS3B 2R29L 3AMLA 3D1MC 5TE6L 3BP5A 1G1CA 1DE4A 4XP1L 2FRGP 4YHNB 5D70L 2O5XL 1BD2A 3HI1A 4PJ8B 4WCYH 1U8PA 2VXTL 4YBLC 3W0WB 1MF2H 4P23D 3TF7C 4DFHA 3TT1H 5IOPA 2R0WL 2HMID 1KCSH 4QRSA 1D9KB 5KZCB 1NBVL 2WP3O 2BNRB 4D9LL 4L3EA 5HI4C 2PF6A 4KK8C 4DVRL 5LJYH 1U3HD 4X9BA 3SDCD 2XKUA 2RBLA 2H2PC 5C08D 4KAQL 5JXAL 1DBAH 3ECBB 3IB4A 3Q2CA 5GRXG 5J12B 3QI9D 4NQTA 1ZLSH 4IRJC 3MRBB 4KK6D 3GSXB 1Z9MA 3IJSA 2AQ2A 4NQEB 3EKCA 3EDJA 3ARWA 4XNXL 1JHLL 4U1IA 3KPPA 1Z2KA 2APFA 2A6JB 5ALBH 1LEIB 3IJHA 1NGYA 1JGVL 3RKPA 4OLYH 4NKMB 3UYRH 3U4EB 3MQIA 3QQ9C 1X7QA 5BS0A 1ONQB 3MV11 5FKPB 1A1NA 4P5TD 4QT5B 4AMKH 4GG6F 3MRDB 3RVWD 4ZUSA 2VABB 3BQUD 1YEDB 3MA7A 3X13A 4AEHL 3GGWA 4K23L 4LSRL 5T3XL 5IF0B 4WI2A 2OZ4A 3F7YB 4RMSA 1U8JB 1JTTA 2BSED 3QO1B 4QOKE 7FABL 5IVNA 1G7LB 5DJXA 3U0PA 3QULA 1JNHA 2VZSA 3GRWH 1GH7A 1YEFL 4L3CB 5BXFA 4JR9H 3FQRA 4MSWA 3LB6D 2V2TA 1CDIA 1UXSA 3AFLA 2BJMH 3ZYIA 5GSVB 3HE6C 5F7DA 3CAFA 2BVOB 5J6GB 1MY7A 5DO2C 2KQMA 4Q2ZB 4WTXA 1RD6A 1MPAH 2BOBB 3ZDYF 3SDXA 1WAAF 3TBSA 4HFUL 1GPOL 1F42A 4G6FB 4Y8DC 1ZHBA 1N26A 4MXQD 3VI3F 4EI6A 4U1KA 5I1GH 1CL7H 1FPTH 4X7SH 2V6HA 1UT9A 5C0BA 3SJVA 3T2OA 4OLVH 5DD3H 3VG0L 1BQHA 1CD0A 2DICA 2QTEA 4U1SA 3C6LB 1MCWM 4F7PA 4R4BA 5ENWA 3MUHL 5FO7A 4RMWA 2EZ0C 1F11B 1BD2D 2KBGA 3I75B 4XB7A 4JG1H 2EIZA 1DEDA 3CPLA 1OAZH 3PWJB 4WHTA 5DJ2B 4BQ8A 5J13B 3CVHA 1HHGA 5DMGC 5H37H 3LD8C 2YR3A 2HFEB 4OZFA 4L3ED 5H2BB 4ORZC 2HKHH 4NC1E 4UZGA 1CD1A 2AV1B 3EOBB 4JM2C 2FEDC 1RU9H 3WIFB 5HGAA 3SN6N 4OI7A 4Y89A 1BQLL 3CXDL 1BFSA 4HIEB 1BQSA 2VDLH 5CBAB 4Y16D 5I1KL 1LO3H 4JHWL 2H8PA 4Z7UB 1DUYA 4YIQA 4ZFOL 1QSFB 4LVNB 4PREA 3O3DA 1P84J 4NWUH 4IRSC 5BOPA 4K3GA 4Y4KC 3LPWA 1YMHB 5A2LH 1NAML 1U8HA 4U2ZA 1WLHA 3MROA 3CDYA 1VB9A 5ICYA 3KYOB 1MRDL 4DUVA 4NQDA 5BS0D 1DQMH 4KHTH 5D1ZA 4S1DD 4ZO8A 4K7PH 1RZIB 1U8LA 4LSSH 1QACA 1XCQA 3QIWC 5C09B 4ZSOA 1J1XL 3BDXA 1JV5A 4KKLC 3RX8A 4GW1A 3H6JA 2WP3T 1IAII 3DTXB 4P2RA 1MQ8A 4GRWB 2ERJB 3Q3GA 3L5WA 5E6IC 3X17A 3ZDZE 4Z7VB 3ULUD 1MCPH 8FABB 1SY6A 4WV1A 4JRYA 4BM7A 5JHDA 3X14A 1H5BA 1U8IB 2W38A 3PL6B 1T80A 3VDAA 1C12B 1D6VL 5HI5C 4IDJH 3OB0H 1T4KA 1KJMA 4DW2L 4QWWD 4MD0A 2GEEA 4P4RB 3NCEB 4I0PD 5E9DE 2CD0A 5JMOC 4HH9B 4IIQB 2FL5A 5FKAA 4MQXC 3MO1A 3UBXG 4X5XA 3QQ3A 1TVDA 4XBGA 3ZE1E 1EGJL 4LCYA 1M7DB 4N0RA 3DMMB 4HUXA 3CFCH 4ORGB 3L3IA 2R8SH 5HGBA 3G6JF 1D7FA 4XNUH 3NIDF 4IJ3B 1H3GA 3TLRA 1NGXB 1RZJL 3MLRH 5IQ7L 3MYZA 3KPRE 3EW3B 4HV8B 2ZWLT 4XGZB 4WEUD 4EOWH 4ODUB 1MHHA 4HEPG 1J0HA 1V3KA 2NZIA 1MAKA 4R26L 1FGVH 3L5XL 5DRXA 4N90E 1LE5A 1D5ZB 1IEBB 4LIQH 5KSBF 4P49A 3SO5A 1TVBA 1RZ7L 5I8EB 1KBGH 3MLVL 4TVPL 2YRZA 4PJ7E 4Y0GA 3H42L 5BMFH 1EHLH 1I1YA 4TRPL 2VYRE 7CGTA 3IAGC 3M17A 5DEGB 3TIEB 1M1SA 3PP4H 1J8HA 4G8GD 4W6YB 4WW2F 2C3HA 2OI9C 3BZDA 3ULVH 1Y18B 4I8DA 1LQSR 3J7HA 1L7TH 4CVXA 4V2BA 5M95B 1A7PH 2IMNA 1H0DB 2R1WB 4HUVA 3X3FH 4R90H 2BY3A 4ZTOH 4F3FB 1LEGB 3TA3C 4F33B 4JRWA 4H26B 1OP5H 2B8OT 4D3CL 2CK2A 1OSZA 2P7TB 3GJFB 3SDAB 3FJTA 4XP4L 5K9OA 4YO0A 1K6QL 5FYJD 4HWBH 1FC2D 5D1ZD 4GG6B 1ETZA 3SE4C 1FFOA 3BJ91 2R2BB 1LO5A 25C8L 4Q9CA 1Z9OA 5ITFB 4OCXL 3O6FB 2X4PB 1SBSL 4GKZA 5C6TL 3HNSH 3BD4A 2XA8L 3KS0J 5FUOH 4DK3A 4L8CA 1Z9LA 4MS8D 2DOCA 4PJ9C 1PKQB 4MJ6B 3HNVH 3SGDH 1JCKA 2XICA 2AXFB 5BV7B 4JRYD 4U31A 4BKLB 3CSBA 3GI8H 3T0ED 1ZTXL 5B3NA 3E2HC 4HXAL 2NW3B 5L6YH 3MNZA 1RZ8B 5FHBL 1QZ1A 4Y7MA 1PG7X 5FUZL 3FT2B 1EEZA 1U2HA 4NC1C 4HGKC 4B7IA 2WZPD 2JELH 3SKUD 1E27A 4U05A 4AIZB 3HE7B 4NN5C 1T21A 4JJ5B 2IGFH 5CUSL 3TV3L 3ZKXC 4EKXA 3EO1B 2CK0H 1DN0B 4XPFL 5D96C 3IU3A 2DD8H 4Z5RA 5D72L 4GAJH 2D03H 4U1LA 3V8CA 5JHLH 1K4CA 1AGDA 3DVGA 1UCTA 3QIUB 4U4BA 4A6YH 5KBNC 1KCUH 4L8BA 3KNBB 3BP4B 4NCC2 1RZKC 4HH8A 3EGSA 5E56A 5JW5A 2QSTA 3NPSB 4G9DB 1OQXA 5IVXF 4YFLI 3HRPA 3TH4T 2BXZA 3UTPD 5LWYL 3RWGA 4MX7A 3VXPB 4NN7C 4ZS6D 1OTTD 5C0FA 4KKAD 4NQCB 3UPRA 1J8HD 1QO3A 4RWYH 2JCCE 5GRUH 3B6SA 2XTLA 1IM9B 3MRFA 1INDH 1MJ7H 4K3EL 2OS7A 3QUMA 4JREC 5HVHC 2IG2L 3ALPA 4UU9A 3PWLA 1PZUB 4F8TA 1EMTH 2DS4A 3KPLB 2A0LC 2G60L 3JUYA 5IROC 1U2CA 1JZ4A 1G7IB 3MGAA 4C56B 5IFHL 4RIRB 4LEOB 4M62L 5LGHH 5M7QA 5KSVB 1HINH 3O3AB 5DA4A 1AQDA 2K3TA 5I1IL 1U91B 1TTUA 5IW1A 1CXIA 1CDCA 1OP5K 5D1XA 1LK3H 4PRDB 1R5IA 3UBXI 5DMKB 1A7NH 2NMSA 3ZDYE 1XIWB 2A6KB 5LBSL 2V5TA 1WAAE 4WVRA 5CEZD 1FAIL 2J88L 5DRZB 1G9MH 2EE9A 4HJGA 4HKZA 2VO5A 3F58H 4OF5A 2HT3C 4O00A 3UJIL 3B8YA 4X80L 1DDHA 3EJYC 1ADQH 2GJ6B 4WO4A 3ARGC 5DD5H 2R2CA 1F90L 1S9XB 2EDDA 2HLAB 1H3PL 2XWTB 3GSNL 2ZNXA 5GJSL 2GTWA 1WWCA 4HIXL 3IFOB 3QDAA 3LRSB 4L4VA 4TUJB 3GUTB 3VRIA 1QSEA 4RWHA 1GGCH 3TO2B 5C6WH 3FMGH 4JQIH 1MNUL 3HC3H 5E99H 1JFQH 3T2QA 1HHKB 4LARH 5EU3B 3ARBD 3R8QA 4FFVC 2CSPA 3ARDC 2DLIA 4PRBB 4NT6A 1FO0B 3PGCA 3ARED 1OD9A 2NR6C 5C70A 2PCPB 2YPLA 1YY8A 4DKEL 1NGQL 5IBUB 3G6JB 4MQ7A 3D69A 4OFDA 4Z8FL 4X8JB 3T0VA 3RU8H 3UZEA 1QVOB 4CJ0A 3HI5L 3WHXA 5IGXL 3EYVA 3GSRA 2OMNA 4E41A 3JWDL 4KMLB 4JLRA 4OCYL 2Y72A 4YQXH 4MJIA 1T6WA 3SKOB 4Z78A 3FN0L 4XX1G 2OM5A 4KKBC 2RR3A 5AD0B 3RAJL 4UDUA 5I16A 3PQYB 3ZTNH 3VI4F 3LS5L 1UACH 5KVGH 4L8SB 4Y2DB 3CXHJ 2KH2B 3HMWL 4KDWA 5DJAB 1I7RA 3SE9H 1YPZE 3BH8B 4DOHE 3RZCA 4FRWA 1BBJB 3LH2L 1WF5A 1QEWB 3NOIA 5HHXL 3S6CA 1AH1A 2OL3B 5E2TL 3QA3B 1VKXA 4GUPA 4YXKH 3VWJA 4AEIH 1P6AB 4OLWH 3ZHDA 1U8MA 4OCWH 1V7NL 5KS9F 4OCMC 2YRLA 1YN6A 4MNQA 4LGPB 2A6DA 3CDCA 4H1LG 4HFWB 2AK4E 1L7IH 1IGJA 1KCVL 4QXUL 4F9LA 1ZHNB 5TDNA 4KZDL 2VL4A 2WIIB 3D18B 2EDFA 2W60B 2I24N 2AI0L 1DLFL 4KKCD 4P3CL 4P59H 4UNTA 4YHZL 3CFEA 4P2OC 4XCCL 4D8PA 1I1AA 4YDVB 4PGCB 3VWKB 1DQLL 5ADOH 2R1XB 2Z4QA 5JIPA 1BHGA 5I18H 1C5BL 3EJZC 5DQDL 2NX5D 1C5DB 4OAWA 5GZOC 3TESA 1KXQE 1RIVH 4JKKA 3S37L 4OD3H 3U0WH 2Y36H 1P4LB 4XCYB 2WV3A 4OGAD 1ZS8A 4KTEH 2Z92A 4HWUA 4GBXA 4M5YH 3BW9B 2HJFB 3IETA 5B4MC 1QSED 1VERA 3KPQB 3MFFB 2FGWH 3RVTC 4Q9QH 5I17A 4ELME 1CICC 1FFPA 4PJGF 3MGOB 4AM0A 1XF3B 3IGAA 5EN2A 4OB5L 4OZHF 1MHCA 1PFCA 5C0RL 3S34L 4IRZH 4G6KH 1KFAL 4GRMB 1JYXA 3K0WA 4R97B 2YPLD 1YEJL 2P49B 3S4SA 2FX8L 2WW8A 5CWSB 1LO0L 2F53A 5EU4A 1AKJA 12E8H 1DVFC 4FXGB 3SGEI 1LO2H 3SKNA 3LN5A 3D9AL 2FSEB 3DX8B 5E6ZA 4ELKB 15C8H 4XVJH 4JN2A 4MJID 3I6GB 1PG7W 5IVXB 1XMWA 1I9JH 1GOHA 4JHAH 1EEYB 2XI9A 3F7RA 1PSKL 5EOCL 1TZHB 1U3YA 2FLBT 3O8XC 4RAUB 3OX8A 4WWID 2H26B 5LVEA 4F15C 4LSVL 1H9VA 4LKCA 4MZ3A 4WI5A 3VWJD 4HXBH 4N0UE 5FV1L 5C0AE 3VXQA 5I66A 2FGZA 3TBYA 3MOBL 4ONOA 3VXSE 4OCNC 2QQKL 3E6FA 4Y4FA 4MNQD 3G5XB 3O9WA 1I7ZB 3C2AH 1S9WA 2F74A 3NFSL 2PO6B 1J0ZA 3UTQA 2AJXL 3GMNA 2A9ML 3U79A 2EC9T 2IEPA 2YC1A 2B0SL 4RAHA 1DQJB 3I02A 3G5ZB 2RFXB 5AZEH 2NW2B 3EAKA 1IFHH 3PWVB 3VU2A 4B50A 1E28B 3MRIA 4BA8A 3HI6H 2LV4A 5DRWB 3IDIA 2NYYD 4L29B 1JNNL 1I1AD 3HC4L 3UO1H 5B8CA 4NO0A 3UAJC 1IGTA 2DQHH 2AEQH 5ETUA 1MCIA 1OGAB 2YK1H 3DXAE 3RGVA 2EEDA 3KHQA 2NY2C 4XPHL 5INCB 4YC2C 1A22B 5H37G 3G5YB 1OAXH 4NO2A 2OTWB 5HHMB 3D39D 2UWEF 1YYLH 3OKDA 3IAPA 4HZAA 4XCEA 5LG1A 1I8MA 4XCFH 1RV6X 2VERN 2GUOA 4X6CA 1F4WL 3T65B 4LLMA 5EUOA 2O5YH 1L9NA 4PJHF 4NC0B 4H0HB 1T6VN 3MLSH 4MD5B 4XP9L 5CIPH 3K2UH 4ONHA 3WIIH 2FEDD 4IMLA 3BP7A 5DHVA 3BSZH 5I15H 4OFKA 1F4XH 2BVQB 3JVGA 3O2WL 2DQTH 1VESA 3UDWA 5F97E 1B3JA 4QYOB 3QDME 1R3JB 1TCRB 1OW0C 2FJGB 1W2KT 2P1YA 2CKBH 2XA3A 3VCLB 1QHPA 4PJ8A 4ONGL 4HBCH 3W0WA 1YECL 4Y4KD 2EXWD 3IU4L 3T04D 3V4PH 2F53D 1AKJD 4OQ1A 3L3KB 2B2XL 1Q72L 1D9KA 4POZC 3HMXL 2BNRA 4D0CB 4M5ZL 2XZQH 1KG0B 4JKLA 1KTRL 1OAKL 5IBTL 3ECBA 3B2UC 5IEHB 1Q1JL 4YE4L 3MRBA 4S1RH 3F6LA 1KTDB 3GSXA 4AENB 4LKXB 5IMOB 4RSVA 3RTQC 1AXIB 3NIFE 5AYQA 4NQEA 3ROOB 1DLHA 1J9CT 1FCGA 4ZPVB 4S1QL 1LEIA 2A6JA 4Y4FD 3W2DL 5KW9H 3O9WD 2Q7YB 3UC0H 3ULUL 1TJHL 4EN3B 4NKMA 3SGJC 3U4EA 3KPMA 1ONQA 2LTQC 5E1AA 4KMQA 1UADC 2Z8RA 1FHGA 3M07A 5FKPA 3MV7B 4QT5A 3MRDA 2VDKH 1L0YA 1FYTB 4LLAA 5I1JL 2VABA 1YEDA 2E6QA 3DLQR 5D7SL 2VRAA 3OBAA 2VLRD 3PWPE 5IB2B 5IF0A 4M03A 5FAAA 2DRUA 3F7YA 4IRJB 1U8JA 3LN4B 1JPGB 2R2EB 4WFHE 3QO1A 2NXYD 1G7LA 1A7QL 2W65B 1XAUA 4R2GB 5GGVL 4G5ZH 4L3CA 3FZUD 4F9PA 3NACL 2BNQD 1S9VB 4WUKL 3QWOB 2CIKB 5GSVA 4JFZL 1JYNA 2GTZB 2R9HD 1FZJB 1NFIB 2BVOA 5J6GA 4Q2ZA 2OZ4H 3BGFC 3ARXA 2BOBA 1MUJB 4J3TA 4UT9H 1EFXB 2Y25A 2X44D 4JZJC 3ROLB 3QXAB 3IDMB 3GHEL 5DC4B 1M4KA 5E8OB 4QXGL 4PJGB 2Y9RT 2Y06H 3NFNB 5FYKH 1ZE3C 1ZXQA 3TCXA 5IHUH 1GVIA 4JZOB 4N0FB 2QJDA 4MLSA 4PJEE 4GAGL 3CFIC 1QOKA 4N1CA 3C6LA 2ARJQ 3OXRB 2VDQH 1AR1C 1KLFA 1T89A 4DGYL 2AGJH 4XP6L 5E8NB 4LRIA 4EI5C 4NNYB 1F11A 3KJ6L 1DJSA 3I75A 3W0WD 2XTJE 2ZUWA 4ZOBA 3U2SB 1MFNA 3NGBB 3PWJA 1JZ2A 5DJ2A 1KJ2H 1CFVH 1CL7I 2RJMA 3UBXB 1FFQA 1AFVL 1FDLL 2H2SC 4I18B 2HFEA 3U83A 2XZAH 2J4WL 5SWZE 5H2BA 2FH6A 2DWDB 4KJQC 1DSFH 5SWSE 2AV1A 2F54E 3EOBA 4OSUL 4U6HB 3WIFA 1W0YT 4O9HH 2I5YL 4HIEA 3REWB 5CBAA 5KAQF 2NY0D 1WFTA 3HZKB 1ITCA 3I6LD 4Z7UA 4QNPF 1QSFA 1JTPA 4NQED 3FOMB 4C55A 5C07B 2IAMC 4QHKJ 5L8LB 1YMHA 3L3DB 3IJYB 1B2WL 2Q3AA 1KTKE 4NZUH 3E8UH 5C0CB 3DRTB 3OJVC 4TULL 4YGVB 3KYOA 1OD7A 3TJEL 1A0QH 4YR6B 1MJ8H 2BDNH 4LLVB 4O02L 2AKRB 1RZIA 3NBNA 5I74C 1NCUA 5C09A 5I8KL 3STLB 1CT8B 5ID0B 3S3SA 3MACL 2RHEA 3C8HA 5FM5M 4TSCL 4G43B 3O4OC 2OXHA 2YXFA 5DMIL 2QSVA 3DTXA 5MP6L 2CUIA 2QL1A 4OZHE 4GSDH 4M1DH 3GHBL 1GZQB 3P0VH 8FABA 4KDTC 3NIGE 2A77L 4QHNB 2GY5A 3THML 2IJ0C 3WFDH 2AW2A 3LHPH 1U8IA 3PL6A 4BQBA 2J8OA 4WTZA 1C12A 1NCAL 2DYPB 4TPRL 1ED3B 3E1F1 4P4RA 2I27N 4JM4L 3TBVB 3B5GA 4HH9A 4IIQA 4QRPB 1CXHA 5EUKB 4PYHA 5HYJB 3QIWB 3ISWA 2VLJB 5D1QD 1FL6B 5T3ZH 1QBBA 1M7DA 4YHKH 3DMMA 4O2EB 3O6LL 4OTXL 1CZ8H 2NCMA 4LRNH 4ORGA 2VXUH 3O81A 2HKFH 1IARB 3A6OA 4MAUH 3C6LD 1NGXA 1ZOXA 5CJ5A 4G6MH 4H8WH 4HV8A 4XGZA 3RI5K 3PXJA 2D4FA 4ODUA 5I73C 1SMOA 2VDRH 3N9GL 2DQDL 1IT9H 3QCTH 5DUML 4WHCA 1A6PA 2VZVA 1YY9D 1D5ZA 2P8PB 3KLSA 4OGYL 4WTWA 2YBRB 5ISZD 5I8EA 1FRGL 1G6RL 5DEGA 1OSPH 6FABH 5GGTH 3TIEA 4B41A 2CJUL 4W81A 5HYQB 2IH1B 2ED8A 4BJLA 3ZYJA 3NTCH 4CN4A 4PLOB 3B9KC 4XWGH 2I07B 4CN1A 1P5UA 1Y18A 2DTML 5F9WC 5CEZL 5DJYB 5FM8A 3QIBD 5D7KD 2V5YA 5GXBB 1FIEA 3I50L 1H0DA 1QSFD 4Y1AE 3G6AB 2XNAB 2PYED 4P2QB 4F3FA 1LEGA 4F33A 5C0JB 1OQOA 4H26A 5E0QA 3GJFA 2P7TA 3QJFB 1MFDH 3SDAA 3VXUE 4R0LB 5F96H 1OP3H 2NY5C 5D93B 2C9AA 5I1CL 4GG6A 2Z9TA 1HSAB 4PJ5B 5C09D 2C3GA 2R2BA 1DFBH 1SEBB 5ITFA 1GGIL 2X4PA 3JTSB 3O6FA 3TYGH 2CLVB 3VFTB 3V5DA 1SM3H 4JO1L 2YOCA 3RHWF 2B4CH 3L7FA 1K8DB 1PKQA 5CJXA 4MJ6A 2C1OB 4TTDD 2FR4B 3UYPA 1TENA 2D4DA 1VADB 4IOFD 2AXFA 2XTJC 4BKLA 3AM8A 3C5SB 3C60C 4ZFZB 4NQXB 3SGKA 2NW3A 1NCBL 4YHIB 1ORSB 3TA3B 1RZ8A 2R0LH 3BMWA 3NCBB 4DGVH 4XAWL 3BDBA 3FT2A 1WBYB 1F4YH 4I48B 3ZT6A 3KJ4B 1A7RH 1U6AH 4AIZA 3HE7A 5CGTA 3JV6B 1R3LB 2CIIB 4JJ5A 3LQAL 2GITB 1Z0MA 3NA4A 3SGDI 3EO1A 1BLNB 1FG9C 3KPNB 3DMMD 1DN0A 4F37K 3MJ6A 4Z7NF 4PJ9B 5F88B 4OT1L 3EBAA 3PIQB 3P30L 1I3RB 1FL3B 1A21A 2ZCHL 3MOQA 4BZ2H 5JMRA 1FH5L 3QIUA 2R29H 4UBDC 4H0IA 5TJWK 3E2HB 3EYSL 3KNBA 3BP4A 1Q38A 3O2DL 3HB3C 4G9DA 5J1AA 1CVSC 5D70H 4KMTH 4OF6A 5D8JL 3F62A 1EEQA 1CN4A 3NAAL 2EC8A 3VXPA 5F1KC 5JIKA 2R0WH 5DDHB 5HHNB 2VOTA 1GL4B 1O7VA 4NN5B 1NBVH 3VXOB 3UP1A 1ZANL 3IDYC 4NQCA 2E5EA 5ALCL 4D9LH 5LKNA 5GHWL 1E4XI 4GOSA 5D96B 4FN0A 1IM9A 4ZAKC 3A6BL 1TITA 2XZZA 3OMZA 4LVOC 5JXAH 4MQTB 4ZQKB 2VL5B 4FTVE 1NSNH 3KPLA 4ZYKB 4HMEA 4AYFA 1G7IA 1XZ0B 4C56A 2ZZUT 4RIRA 5EIVA 4LEOA 5KSVA 1FL5B 3O3AA 4HDIB 3BYTA 2FD6L 3BT2L 1U91A 2E7BA 1VCAA 1JHLH 3GI9H 4LEXL 5EORL 1SYVB 4PRDA 3SDAD 5DMKA 1NFDE 1T0MB 4X98B 4J3VA 5E4EB 2V7NB 1XIWA 2A6KA 3GBLA 1UWEL 4JVWA 4POYA 1BM3L 1CLZL 1FG2B 1PG7L 3GIZH 4Q6IC 5DRZA 5TE7L 3O6FD 4JN1L 2KQNA 3EOAB 1ZAGA 4H1LB 2GJ6A 3BP6B 1LDPH 2WNGA 5E5UB 4K23H 1IBGL 4JY6A 5T3XH 2HLAA 4N8PA 2XWTA 3KXFE 1GAFL 3H3PL 4AIXA 3FN3A 3GUTA 4R4FL 3LRSA 4MD4B 4TUJA 3U4AA 3AROA 3BIBX 3MV9E 7FABH 3Q6GL 2GAZB 3TO2A 3O3EB 1YEFH 3T0WA 4AQOA 1HHKA 1P4IL 4WU7B 5EU3A 5DS8B 4PRBA 3PWUB 1S7UB 1B0RB 2VITB 4MB5A 1FO0A 5IW6B 3CX2A 5MHSE 4K2UL 3B5TA 2PCPA 3NCCB 4HFUH 1SQ2N 3TIDB 1HCFX 2NY4B 1NCNA 2EH8L 3KPRB 4X8JA 1QVOA 5FGRA 3VG0H 2X4UB 1FZOB 4KWUA 3QIUD 3SKOA 3MLWL 4YUEH 5GS0H 5AD0A 3PQYA 4L8SA 2LU7A 4Y2DA 1X4YA 5DJAA 4YBHA 3SE3C 4GO6B 3BH8A 1BBJA 1PEWA 2Q76B 1QEWA 4JDTL 4QXWA 3ARDB 2OL3A 2JTDA 3DO3A 2YWZA 4L8DB 1NUGA 1RUQH 1R3HB 2C5DC 5TDOB 3VMNA 2ADFL 4RBPK 4HFWA 1BQLH 3CXDH 1ZHNA 3QJHB 2AJ3B 2W1NA 4NFBA 5I1KH 4C56D 4JHWH 2WIIA 3D18A 2W60A 1Y0LB 2X1XR 1T83A 4HK0B 2BC4A 1SJHB 1IC7H 1ZVYA 2JIXB 3QQ4B 5E5RB 4WY7H 4YDVA 4PGCA 3VWKA 4IDLA 2R1XA 2VR4A 1MRDH 1E4JA 1ES0B 2H6PB 4PD4K 3S35X 4H5SB 4LQ1A 3QEGL 4ZD3L 1C5DA 2GJ6D 3UPCA 1P4LA 4XCYA 2E27L 3BW9A 1UH3A 3WIHL 5JTWA 1JRHL 2HJFA 5JPMB 1U8NB 1AD9A 4EBQL 3KPQA 3BKJL 4Z9KB 5TDPB 3MFFA 4GG8A 2WUBL 3QSKB 5J1SC 3BN3B 5E7FA 2CGRL 2YHGA 2OX5A 3QPQC 4PRHE 4JPVL 3MGOA 1D6VH 1XF3A 5AZ2H 3KPSB 2BOCB 4KRPB 4MGXA 4DW2H 5ACLA 3LEVL 4NUGL 3EZJB 1CQYA 3K81A 4GRMA 4E9LA 5DC0A 4W6WB 2H32H 4RNRB 5KSUB 4S11A 5HXMA 5CWSA 1EGJH 4DGIL 1AI1L 4FXGA 4W70A 4KY1L 2FSEA 1T2XA 2P8LB 4R4ND 4ELKA 4CVUA 4UNUA 3PGFH 1Q9WB 3I6GA 4FFYL 5IVXA 1MCFA 1RZJH 1XCTB 5IQ7H 3PQYD 3QPXL 3LY6A 4JPKL 3FT3B 1A14L 1EEYA 4R26H 3L5XH 1TZHA 4EDXB 5KJRH 4RAUA 2FHFA 4HX1B 5AAWA 2H26A 1FE8H 3DVIA 5D7JB 3WN5C 1RZ7H 1FNLA 1Z6JT 4FQLL 1T0NB 1WEJL 3HHRB 4HS6B 3H42H 4TRPH 1X5YA 1FLTX 1WZKA 1XR8A 3K8LA 5L7XL 2DQJL 1T7VA 3G5XA 1I7ZA 5J06A 4WNQB 4ODWB 5HGHB 5DSCB 2HT2C 3GIVB 2PO6A 4NZJA 3S8WA 3LRGA 4X5WB 1K3IA 2J5LB 5DURB 2BNUB 1DQJA 2JLLA 3G5ZA 1HE7A 3VGAB 2RFXA 1NMAH 2NW2A 3PWVA 5CS7A 1E28A 3M8OL 2MKLC 4M6NL 5DRWA 1IQWL 4L29A 3TEUA 3O8XB 3VWKD 1JF1B 4D3CH 1FJ1B 1OGAA 4XP4H 5GRZA 1V8HA 5INCA 4HGMA 3TVMC 25C8H 4TVSa 4OCXH 3G5YA 3GSUB 2OTWA 1BQHG 5C6TH 5D7IF 3TFKD 5DEFB 3VRLF 3RL1B 3T65A 3NMEA 4U0QB 5KSAB 4UUJB 5F9DC 1OP9A 3SPVB 1ZTXH 2IBZY 4XP5L 4U0RC 1J0IA 4MD5A 4XHJD 4HXAH 4JCMA 4N9OB 4PG2C 4PGZA 2BVQA 4MXVE 4B5EA 4YXLL 5D71L 5FUZH 3LDBC 4QYOA 4NKQB 1R3JA 1TCRA 2FJGA 3S88H 4MLIA 3VCLA 2HA1A 4TNVF 1J1OL 3FQNB 3JWOL 5CUSH 1S9YB 4JQXC 3TV3H 3QUYC 4OLEA 2CQVA 3FFCE 5J11C 3P3YA 2A83B 2BFVL 4JGUA 4U6VH 4XPFH 3TBTB 5I71B 2XKSA 3L3KA 1X5JA 5D72H 5DLMH 1T5XB 2AAVA 4I13B 4D0CA 2D7QA 4KROC 3RKDC 1CU4L 4KI1A 1KG0A 4L4TE 1JZ6A 1YPZB 2CDEB 3U9UB 4DOHB 4GRLD 2GQHA 2BSRB 4JDZB 5JOEA 5I1DB 1A7OH 4ZXBB 4WFGE 5IEHA 5LWYH 4XI5D 3BO8B 1KTDA 4AENA 4LKXA 5IMOA 5B38G 2PR4L 1HOCB 1UZ8B 3ZKQD 3ROOA 4UIMB 4ZPVA 3DX9B 3FB5B 3OZ9H 2WBJC 2Q7YA 4BH7B 1I7UB 4KJPC 5FDWB 4EN3A 4K3EH 4IOSD 4RMRA 3WLBB 1JNLL 3LKPB 1FCCA 4D9QE 3GMLB 2OR9L 2UVFA 5EPMB 4L9DA 2G60H 3MV7A 5DVKA 4RX4D 3QDJD 1RZKL 1FYTA 2YN3A 4NYLB 5IFHH 3NCJL 1A4KB 4M62H 4L9LB 4PP2B 1S7XB 5IB2A 4IRJA 3TN0C 3LN4A 1JPGA 3RTQB 2R2EA 1MCEA 1OGAD 4X8XA 2W65A 1VEPA 5JQHC 4U1HB 1J0JA 5LBSH 2QADC 3NA9L 2X7LB 1FAIH 2Z91B 1MFBH 1S9VA 2J88H 2NXZC 2VDOL 3QWOA 2P47B 2CIKA 1YNLL 3UJIH 1YC8A 2GTZA 5HHMD 1FZJA 1NFIA 1CLYL 1UJ3C 1E4KC 4NHCL 5IUSA 1WSST 1F90H 1MUJA 4ELMB 4L5FL 1S7TB 2EYRB 1EFXA 1H3PH 2YPKB 3QFDB 3GSNH 1D3CA 5GJSH 3WJJC 5DD1L 3ROLA 3QXAA 3IDMA 4HIXH 5E8OA 4DZBB 5HHVL 4R8WL 1YJDH 5F7EL 2M26A 5C86A 2X40A 4A6YB 3NFNA 2EDRA 4G7YL 2O61B 4ZNEE 1MNUH 4OLZL 4JZOA 4N0FA 4CMHC 2EDYA 2GFBB 2LU3A 1OM3H 3OXRA 2J3SA 5E8NA 3OWEA 2FHCA 4NNYA 5HVFB 3CFJB 4K7FB 3NPZB 1PLGL 2UZXB 2KZWA 1JGUL 4DKEH 1NGQH 4CAGA 5TF1L 1HXMB 2EEBA 4Z8FH 4MMXC 3UBXA 4I18A 5C2BL 3HI5H 5IGXH 4TVPE 3JWDH 1QD0A 2DWDA 4JZJB 4YLQT 2F5BL 4OCYH 3FN0H 4U6HA 2XQBL 3RAJH 5C0AB 3LS5H 1JZ8A 3OV6A 3RY6C 3REWA 3HMWH 1JF5A 3HZKA 3VXSB 1ZT4B 4HC1A 1LMKA 1SVZA 5E2TH 1MJJB 2YA1A 3OKEA 2G2RB 3FOMA 4MJ2A 4RGMB 4LVHB 5C07A 5IG7B 1VFUA 4GXVH 3WD5L 3VXTB 1KTLB 2Z31B 1A6VL 4LSTL 3IJYA 3L3DA 3MRNB 5C0EB 5C0CA 2ADJB 3DRTA 1V7NH 3F65A 4YGVA 2C3XA 1KJ3L 4FG6C 4EN3D 3MUY1 2BVYA 3LKRB 4YR6A 2NZ9C 5F9AC 3MCLL 3D3VE 4LLVA 5E8EB 3QEHB 2AKRA 2Y7QB 1KCVH 3O4LE 4QXUH 3MV7D 4S1SL 1MFAL 3STLA 1CT8A 4KZDH 5ID0A 3ZL4H 4G43A 4UOJA 1DLFH 3TCLB 4P3CH 4ESKA 4MVBD 1MIML 4YHZH 2OBGA 4XCCH 2XIDA 2VIRB 1GZQA 3EDEA 1P2CB 4QHNA 4R2GD 2IAMB 4APQC 2MCG1 1C5BH 1D5BB 5ACMA 2XN9E 5T1DL 1A3QA 1VGEH 3GMMB 3O6ML 2DYPA 5CSZB 5D7IB 4EDWL 1ED3A 3GMQB 4X4XA 1UC6A 3DYPA 4KH2A 3RWDB 3TBVA 3T3PE 4JRXE 2J8UE 2LABA 4QRPA 4E5XB 4LCCC 1EFXD 5EUKA 5HYJA 1GC1L 3QIWA 4PR5B 1RUKL 2VLJA 3PWNB 1NUFA 2ITDB 1FL6A 43CAB 5FGBC 3O4OB 4PPTA 1ODAA 4O2EA 3SO3C 3QDMB 3U7WL 1AR2A 1OHQA 4OLUL 4Z0XB 4I77L 1W0WB 4G80B 4X4YB 3UZQA 3BPOC 5C0RH 3S34H 4IMKC 4LAQL 4QF1B 3W39B 2XZCL 5KVDH 2AV7B 5FCSH 1YEJH 2P8PA 5CILH 2FX8H 3ARQA 2YBRA 5GGVY 3GM0A 3BPCB 4QHLB 1D6EB 5H8DA 3D9AH 2P24B 4PJXE 5L0QB 1X5KA 2N56A 5HYQA 5JA9A 2IH1A 2EDBA 1AXTL 3O2VL 3QB7C 3R0NA 3EYQD 2I07A 32C2B 5DJYA 1PSKH 1WJ3A 5EOCH 4PRNB 5T5NF 3G6AA 2XNAA 3V6ZB 4LSVH 1B6DA 4TNWK 1EPFA 5I73B 5C07D 1JPSH 4GW5B 1XF2B 5F6HI 4P2QA 4KJYB 5C0JA 3MOBH 4DN4H 3FTGB 2QQKH 3QJFA 4R0LA 3ZSSA 5ADPL 5DT1H 1QFWM 1HSAA 2ICWJ 1JHTA 4PJ5A 3QUKB 2AJXH 2A9MH 4KI5D 4MZ2A 4GKNB 1SEBA 2DMCA 2B0SH 3JTSA 3BUTA 3VFTA 2CLVA 1J87A 2PXYC 4QRQB 1UQSB 4PJDB 3WFEL 4V2CB 1CGWA 3QEQE 3K4DA 1K8DA 2B7DT 2WIMA 1JNNH 2C1OA 2FR4A 3HC4H 4JKPL 2YD5A 1VADA 3MBED 3C5SA 1D5IL 4ZFZA 4F57L 4Z76B 5L88L 1DQTA 2ADGB 5D7LE 4NQXA 4OV6F 5K9KB 4YHIA 1ORSA 3TA3A 4FZ8L 4XPHH 4WGWB 2CRMA 1G0YR 1WBYA 1SEQL 4I48A 4MA1C 4BYHA 4LOUC 5GISL 2DBLL 3MC0A 3SE4A 3SDXF 5HYJD 1OF2B 2EKSB 3JV6A 3ZE0F 1R3LA 3OR7B 1ZA6B 2ESVE 2CIIA 2VLJD 4LP4A 2GITA 2AJUL 4PJEB 2QQQA 3K3QA 1BLNA 1F4WH 1RZFH 4MAYC 3KPNA 1T2JA 4KXZH 4L1HA 3IVKA 2ZSVB 4JO4H 4PJ9A 5F88A 4J6RL 3PIQA 5KVMC 1I3RA 1ULVA 1YQ2A 1FL3A 1F3DH 4TUKL 1HILB 3LQMA 5K9QG 4U6TA 4J4PC 2DQGL 3O2WH 4LLQB 3UYOD 1INQB 3ZKMC 3RIFF 3TBWB 3GB7B 4BSWB 4X6DE 5C7XL 3BGAA 4OGZA 3PF2A 1BWWA 3N50A 1QG3A 1NGPL 4U3CA 1GOGA 1N6UA 1I8IB 1CS6A 3ALXA 3ES6B 3ABZA 4ONGH 2PKDA 4JFEE 3IU4H 1KACB 3VD3A 5SWSB 4HUKB 1BJ1H 4NPYB 4K8RH 4JG0L 5DDHA 5HHNA 3QNZB 2B2XH 1KEML 1Q72H 3VXOA 5IK3B 5DHYB 2CUMA 4M5ZH 1D5XB 4ODSL 3RUGF 3S96B 2G9HB 5HI3C 3RWHB 3SY0B 4J7RA 4RFNC 1CFSB 3J8F7 4ZQKA 4PB0L 2VL5A 2K7PA 4TOYL 3OGOE 4ZYKA 1Q1JH 4G6AC 4YE4H 1CDHA 3WLWD 1XZ0A 3O41B 5HBBA 2IQAB 1FL5A 4P2QD 2YD4A 4HDIA 1DCLA 2G75B 4JFHE 2CLZB 3C8KB 1SYVA 5IWLC 1T0MA 5HDQH 4X98A 5BO1L 5F6HJ 3ULUH 2V7NA 4YXHL 1OT2A 3IDYB 4PJ5D 1FG2A 1A1OB 1U41A 2VLKE 5FCUL 4JFDD 4XC3L 3EOAA 4ZAKB 1A8JH 4H1LA 4NKIL 5C0ND 2DKSA 3BP6A 3KYAA 3PV7A 3BFOA 5D7SH 4QCIB 4M6AA 1QFUL 1QRKA 5CIPB 3F8UB 4MD4A 1GCFA 4F7EB 2GAZA 1A7QH 1MCHA 5DJ8B 5E9DA 3O3EA 4QO1A 1A6ZB 3NACH 3T3ME 4WU7A 2Y1VA 2CKBB 3BAEL 1V7ML 2Q3ZA 4I3SH 3F12B 1TZIB 5DS8A 4F2MB 2MOVA 3PWUA 1S7UA 1B0RA 2VITA 5ERWB 1NC2D 1MREL 1A5FL 5IW6A 3F7QA 4J3XA 5C08E 4P5KB 3TIDA 3V4UL 4RQQB 4QXGH 4TN9A 3KPRA 5E2WL 3CIQA 1MIEL 4KHXL 5BW7A 2DIBA 2X4UA 4PBVC 1FZOA 3BZ4B 5DZOA 2Z0BA 4GAGH 2BY2A 3CLEL 1WWBX 5EO1B 4FQHB 4DGYH 4XP6H 1MCRA 1LVEA 3VFMB 2XOTA 4KK5C 1ZEAH 3N1FC 1F4AA 2DI7A 4OLXL 1JGDB 1G7PB 3AU1A 4HPOL 2Q76A 4P9HL 5AYUH 3RRQA 1VGKB 3ARDA 1UM5L 1I75A 1P7HL 4HPYL 1AFVH 1FDLH 4L8DA 5IHZB 2J4WH 5F7KC 3FKUS 5J7CC 3RY5A 1R3HA 3IAQA 5HY9B 5IIEB 5TDOA 1CYGA 3TVMD 4CDGC 1QKZL 4HZLB 3DI3B 5I1AB 4ETQB 4P4KC 1MSPA 1EDQA 3QJHA 2AJ3A 3QHZL 5JR1L 2EIDA 1NAKH 1Y0LA 5E08L 4HK0A 2QV2A 1SJHA 1P53A 5J89A 2ITCB 1S3KL 2JIXA 3AS1A 4OF8A 1P7QB 1B2WH 2CDFB 3EHBD 3QQ4A 3EDKA 2D7TL 1GHFL 2R69L 4TULH 1F3JB 1MI5B 3MBXL 3WS6C 1ES0A 2H6PA 3TJEH 4H5SA 5CLWA 1N3NB 4PUBH 5JZ7D 1A6TB 4MB3A 4P57B 1Y6KR 1DANU 1GGTA 1RFDH 5I8KH 2VN4A 3MACH 1Z0NA 1QLRB 5HYSG 5K9QI 4TSCH 1HIML 4GMTL 5FB8B 2C3VB 2UYLB 4HW6A 5DK2A 3C6SB 4BSJA 2OK0L 5JPMA 1QFWL 3TZVD 5I1LB 1U8NA 5F7FA 1IJ9A 4KJWC 4WFFD 1NCWL 3GHBH 1Q0XL 5TDPA 4NM4L 2A77H 1BD2E 1FZKB 4Z7WB 5IMMB 1FNHA 3THMH 2AJYL 2EDWA 1M7XA 3DI2B 3P0GB 1NCAH 4KK9C 3KPSA 2BOCA 2APTA 4TPRH 4EJ1C 4L3EE 4JM4H 1I7TB 2IFFL 1KPRB 1KJ2B 2D31B 4RNRA 3GZKA 5KSUA 3BN9D 2D2OA 2NY4D 1KOAA 1ZSDB 4CADB 2ICWB 3QXWA 3WCYA 1JF6A 4U33A 1AQKL 3V0VB 4F7PB 2VQ1B 2P8LA 2ZSWB 3WO4B 5F1NB 1Q9WA 1U92B 1G9NL 3LAFA 1XCTA 4M7KL 3FT3A 4B53A 2VAAB 3N9GH 2DQDH 1XF4B 2X10A 5DUMH 2VN7A 3L3OB 3UTOA 4EDXA 5BS0E 4OGYH 3WBDA 4HX1A