2ECZA

Solution structure of the sh3 domain of sorbin and sh3 domain-containing protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbin and SH3 domain-containing protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Solution structure of the SH3 domain of Sorbin and SH3 domain-containing protein 1
rcsb
total genus 5
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eczA00
1XOVA 2FPFA 3VS7A 1FYNA 4CC2A 3EG0A 1QLYA 2YSQA 2RQWA 1YWOA 1H92A 1NLPC 4OMNA 3H41A 1NG2A 2ED0A 4F17A 4J9CA 1AWJA 2KROA 2KXCA 3QWYA 1WXTA 2LQNA 4LN2A 2DA9A 4E6RA 1SRMA 1T3LA 3R6NA 2I0NA 2FRYA 1TG0A 4J9HA 2GTOA 3M0UA 1GFDA 1QWEA 1WIEA 4Z8AA 2KNBB 1WXBA 1KJWA 1U5SA 4HXJA 1WX6A 2KBTA 2JMCA 2JTEA 2EGEA 2OAWA 3EHRA 2DBMA 1H3HA 2DL8A 1GL5A 2BZYA 3RNJA 2GBQA 4J9GA 1UHFA 4HVWA 2DL5A 3EG3A 1X6BA 2RQUA 3UA7A 1M27C 4IIOA 1NYGA 2A08A 4K11A 4IIMA 2CH4A 2C0OA 2PTKA 2O9VA 2W10A 4RTWA 3TSWA 1B07A 1V1CA 3I9QA 1TUDA 2DX1A 1BB9A 2LCSA 1SRLA 4OMOA 2FO0A 4AG2C 2DNUA 2DYBA 1AEYA 1T3SA 2M51A 2L3QA 3M0RA 1JEGA 1SSHA 1A0NB 3CQTA 1UJYA 2ED1A 5HCKA 4OMMA 2OJ2A 1AD5A 2G6FX 2A36A 4J9BA 1PHTA 1QWFA 2HDAA 4QT7A 4EIKA 5IXBA 3VS6A 2L2PA 5FWCA 2D8JA 3VS1A 3QWXX 4JZ4A 1VA7A 4DEXA 1UTIA 2MOXA 2BTTA 2A37A 2GTJA 1PNJA 2LX7A 3O5ZA 2L0AA 4JPBW 2FG0A 1QKWA 2JM9A 5IXFA 2K7AA 1RUWA 4ESRA 1K0SA 2VVKA 1OPKA 4RUGA 3EGUA 3ULRB 2HCKA 5I22A 1KIKA 2EYWA 1RLQC 1HSQA 2RQTA 4RTTA 4CC7A 1SHGA 1WDXA 2V1QA 1W6XA 2AKLA 3FJ5A 3SEMA 2CDTA 1WI7A 3THKA 2K3BA 2DL7A 1T0HA 4CC4B 2AZSA 2B86A 1MV0B 3EG2A 2JM8A 2AK5A 4OMPA 3VS5A 1Z9ZA 3IQLA 1M8MA 2O31A 1MUZA 2CT4A 1UFFA 3I5SA 1YNZA 1G83A 4RTYA 1I0CA 1PRMC 2ROTA 2JS0A 2CUDA 1VYTA 4ZNXA 2ABLA 4JZ3A 2EBPA 1S1NA 3I5RA 1JO8A 1VYUA 1Y0MA 4J9DA 1AOJA 1WFWA 4GLMA 4J9IA 5GJWB 1E6HA 2P4RA 3REBB 1T0JA 1OEBA 1SHFA 1CSKA 2EYXA 4JJDA 4LUEA 4LE9A 2VWFA 2YUNA 1K9AA 1NEBA 1EFNA 1U06A 2D8HA 2E5KA 2KRMA 4D8KA 5IHIA 1ZBJA 1X2KA 2EVRA 2KT8A 2J05A 3VRYA 2DF6A 2HEQA 2RF0A 5IHKA 4A63B 4AFSC 2ENMA 2DVJA 2NWMA 2CH4W 2VKNA 2FPEA 3KFVA 2X3XD 3RBBB 3REAB 5IHNA 1ZSGA 3PE0A 1ABOA 2RMOA 1LCKA 3I35A 2F2VA 1GBQA 2J6FA 1WXUA 5I11A 4OMQA 2DL4A 2LQWA 2AZVA 4DEYA 1RI9A 3U23A 3TVTA 3VS2A 3M0PA 2FEIA 3VRZA 4RTXA 4LNPA 5EC7A 1AWWA 2BZ8A 1KFZA 1UECA 4OMLA 1TUCA 1U3OA 3UA6A 3H0FA 1AZEA 1ABQA 3A98A 2DLPA 2A28A 1UUEA 2RN8A 1KSWA 2JW4A 1WYXA 1X43A 2O88A 4AG1C 2L3SA 4AFUC 1Z9QA 1J3TA 2PZ1A 2HBWA 2CUBA 2PNIA 2DL3A 1GCQC 2YT6A 4Z88A 2GQIA 2EKHA 1WA7A 1E6GA 2KRSA 1HJDA 2JXBA 2SEMA 2KT1A 2RNAA 2ROLA 2RQVA 2C0TA 2DMOA 2JT4A 3VS3A 2D1XA 2KEAA 2M0YA 2O2OA 4AFQC 2FRWA 2YUOA 1NLOC 1IO6A 1GBRA 1AVZC 2EW3A 1ZUKA 2J06A 3M0QA 2CSIA 2DE0X 4R0KA 2ECZA 1BBZA 1JQQA 2YDLA 2GNCA 1BU1A 2L3PA 1YP5A 1CKBA 3TSZA 1I1JA 1W1FA 1BK2A 2BZXA 1K1ZA 2K2MA 2KGTA 3GBQA 2LJ1A 4M4ZA 2KYBA 2J6KA 1MV3A 1NYFA 4AFZC 2MIOA 2EGAA 2K9GA 1Y57A 2H8HA 3ZL7C 4D8DA 2LJ3A 1AWXA 2JS2A 3UF4A 2CSQA 4GBQA 4RTVA 2J6OA 1SEMA 1SPKA 2K79A 1FMKA 2MCNA 1E7OA 4CC3A 3UATA 2XMFA 1AWOA 4Y92A 2CREA 4RTUA 1YWPA 1ZUUA 2IIMA 2X3WD 2K6DA 2QDLA 2SRCA 1M3AA 2OI3A 3JV3A 1QKXA 2DBKA 3PVQA 1AZGB 2DM1A 3H0HA 4FSSA 1M30A 2DILA 1W70A 2J7IA 1UGVA 1NM7A 1ARKA 3C0CA 2AKKA 1M3CA 2FPDA 3EG1A 2EYZA 4J9EA 2KE9A 1ZUYA 3M0SA 1NEGA 1X6GA 3LH5A 1PKSA 1UG1A 2F2XA 2EYYA 1JXOA 3NHNA 2LZ6B 1QCFA 1OPLA 3SHWA 1GCPA 1H8KA 1X69A 1K4US 1WLPB 2ESWA 3NGPA 2KR3A 2RPNA 3PVLA 1GCQA 3EHQA 4Z89A 4HVVA 2JMAA 1UJ0A 4ORZA 2LP5A 4LUDA 2RQRA 2DJQA 4HVUA 1YN8A 4F14A 1X27A 1G2BA 4F16A 2LMJA 1JU5C 1ZX6A 2W0ZA 2CT3A 4JJCA 2HSPA 3NMZC 1K76A 2F2WA 4HCKA 1UE9A 1B3QA 1PRLC 4J9FA 1UHCA 3NPFA 5L23A 1RLPC 3M0TA 2KYMA 2LNHB 5FWBA 2EQIA 1GRIA 1ZLMA 4X1VA 5IH2A 2DRMA 1PKTA 2LJ0A 2NUZA 1HD3A 1N5ZA 2DRKA 1OV3A 4KRTA 1VYVA 2KXDA 1K0XA 2EPDA 3VS0A 1X2QA 1M3BA 4JJBA 2KRNA 4WCIA 3VS4A 3H0IA 1OOTA 4RTZA 2YUQA 2O9SA 5ECAA 1PWTA 1CKAA 2C0IA 2EGCA 1GFCA 1I07A 2GGRA 1UDLA 1YCSB 2V1RA 2D0NA 2YUPA 5GJVB 5FW9A 1JXMA
chains in the Genus database with same CATH superfamily
1QVPA 1DJ7B 3CC4Q 1XOVA 5D6XA 3CCQQ 1FYNA 4CC2A 1VQ4A 2RQWA 1F1BB 4M78B 2K3XA 2HL3A 3A8HB 5LJ5f 3H41A 5CKHA 3RR6A 5CKDA 3CBOA 1M2VA 2ED0A 2A0FB 1SRMA 1Q86C 2FRYA 1BI0A 5I2MA 2OTJT 2FL7A 3BFMA 1QWEA 1WIEA 3I55A 2KNBB 1VQOA 2MWPA 2EFIA 1LOJA 3GIBA 2KMTA 2JMCA 2L5QA 2EGEA 2DBMA 3OYNA 4M7DD 2DYIA 3SB2A 4HT8A 2DL8A 2BZYA 4MDXA 2GBQA 2Y4YA 5A0LA 3GOXA 1IB8A 2NUPB 2RQUA 3UA7A 3I56A 2K5IA 1YHQT 4EDUA 2CH4A 1BI2A 3QKJA 1HYOA 2O9VA 2W10A 3TSWA 4CI0C 3G6EQ 1YIJT 1BB9A 1QVGA 1SRLA 4ELZC 3JCMh 3A8LB 1T3SA 3M0RA 2CYZB 4M77F 3JB9F 1UGRB 2OJ2A 1AD5A 2EQJA 2A36A 1QWFA 1Q81R 3OS5A 4EIKA 2IG0A 2MAMA 5IXBA 5FWCA 3QO3A 4E7KA 2DZCA 3VS1A 4C8QE 3QWXX 3TU4K 2VYTA 2RH2A 2A37A 3LX7A 2GTJA 2BIVA 2LX7A 4C92A 1YITA 2AHJB 4ESRA 2E65A 2RHYA 4C8QG 1VQOT 2YLCA 4LXCA 5I22A 1RI0A 4XU1A 1RLQC 1WQWA 4Y28E 4CC7A 4XTWA 1N6AA 4EMHA 5I21A 1VQNA 1X01A 2V1QA 1W6XA 2AKLA 3FJ5A 1WI7A 1YJWT 2K3BA 2HKQB 2QEXT 1T0HA 2F1LA 4GLKA 3PMIA 3M56A 3IQLA 2L89A 3EG9B 3RMQA 1UFFA 2CKKA 4RTYA 2JS0A 1R77A 3L2VA 1EZZB 1VQPA 3G7ZA 1XTDA 2VC8A 4JZ3A 2EBPA 3HFNA 3DLLA 3I5RA 3LWHA 4A4KA 1Y0MA 4LDVA 3CC4A 8ATCB 3ASKA 1KG1A 3MCAB 2P4RA 3OYIA 1SHFA 3RIRA 5CKBA 3CCUA 1WZOA 4LUEA 5GAN3 2VWFA 2X9HA 4M7AE 2YUNA 3DKMA 1VQLQ 2VV5A 4Y91A 4PJOD 1U06A 2E5KA 1PSEA 5GAOm 4BACA 4D8KA 5LJ5j 3VRYA 3CCMQ 1WHJA 3NTIA 4R55A 1BI3A 5IHKA 1KD1U 4E2FB 1BIBA 2DVJA 2DVEA 2CH4W 5GAOr 2FPEA 4JUVA 3RBBB 2YRDA 1G3TA 3REAB 3BDUA 3CC2Q 1LCKA 3CCUQ 4M77E 3ZEHA 1O75A 3PIOA 2DEUA 2OTLT 4XAXB 5GMKe 1WHGA 1M90R 1RAGB 2DL4A 2LQWA 1OX8A 4DEYA 3OYMA 3VS2A 5KCOA 2D9TA 3VRZA 5EC7A 2E70A 2BZ8A 3KBGA 1VQ6Q 3CBMA 1TUCA 1U3OA 2DLPA 3A8GB 4NL3A 3JB9H 1G8XA 1KSWA 3GLXA 3HP9A 1X43A 2L3SA 4LD6A 4RCBA 4YTLA 3CCEA 1Z9QA 2RHXA 3HPWA 2WSCE 2PNIA 1GXIE 3CCLT 4PNOA 1W2BP 1BCOA 2GQIA 4NL2A 2L8DA 1Y7XA 2HL5C 2V8JA 3OYFA 2M0OA 2KT1A 2RNAA 2DMOA 5AYFA 3R6OA 3VS3A 3JCMW 2X35A 2YUOA 4X9CA 2ATCB 1PSFA 2WACA 3M0QA 2VXFA 2XKOC 3I55T 2CP3A 4HT9A 1MNDA 2GNCA 1BU1A 2L3PA 4PJMA 2YHTA 3TSZA 2KGTA 4M4ZA 1NYFA 4AFZC 4MMLA 2EGAA 2K9GA 4OF1A 1ZSZB 1OZ3A 2GFUA 2E4HA 5GAMf 4RTVA 4KT0E 1SEMA 2OTJQ 2K79A 4BI8B 1FMKA 3OYHA 1OU8A 3NTKA 1H3ZA 2CREA 4C5EA 1YWPA 4FYWB 1ACMB 1YI2A 1Q7YU 4KULA 4FIBA 1IGUA 3G4SQ 4M78C 1NE8A 5LJ5e 2KI7A 3I56T 1WQ7A 1M3AA 3OYLA 1QKXA 1IZ6A 3PVQA 1AZGB 1IRXA 4JDSA 4FSSA 2DILA 2F5TX 5HY6A 1W70A 3CCJQ 1I81A 3HKSA 1NM7A 1ARKA 3OSVA 3GF5A 2OTLA 4RCCA 3MP1A 2HZYA 3G6ET 4BDZA 3FEOA 1VUBA 5LJ3f 2KE9A 1X6GA 3MHXA 5GMKl 2F2XA 2YRVA 4IUVA 5GAOn 3G1JA 3CCLA 1OPLA 3SHWA 1M1KR 1H8KA 1ZA2B 1S72T 5CK9A 3DB3A 4RKUE 4M7AB 2LQ8A 2I2LA 1UJ0A 2CP5A 1RAFB 4LUDA 2RQRA 3DB4A 4CRIA 2MMPA 3O8VA 4JLGA 4M77G 3JB9G 2X4XA 2XK0A 2DO3A 4MDWA 2FZKB 5GAOp 2F2WA 3GNGA 3X26B 3CCVA 5LJ5h 3AT1B 3V7CA 3NPFA 4PFZA 1VQ5Q 1D0ZA 3MEUA 3CXCA 5CKEA 1GRIA 1ZLMA 3OBYA 2XDBA 2NUZA 3UDCA 2RHIA 4PFOA 1SF9A 3SD4A 5KYNA 4IKFA 5KYWB 1TH7A 4C0ZA 1X2QA 1M3BA 2B8AA 1TOVA 1W2BA 2DIQA 5KE2A 2ZPBB 4JJNK 3TCJA 2Z0WA 5ECAA 1PWTA 2C0IA 2LQKA 4ANJA 2EGCA 5GANh 2GGRA 5GAN8 1UDLA 2V1RA 2D0NA 1C6VX 2DXTA 3OYDA 2QQSA 2EQKA 1TUGB 3QUIA 2CZ0B 1N8RR 4KUDK 1QLYA 2YSQA 4P5NA 4ZTFA 1H92A 5LJ3d 5A0DA 4O5VA 1M9SA 4N4HA 4A53A 4B9XA 4F17A 1AWJA 3RKYA 2KXCA 2A7YA 3QWYA 3C95A 1WXTA 2LQNA 5HK0A 1SG5A 5DLQE 1M1FA 5I2SA 4M78F 4E6RA 3M54A 4QQ6A 3CCRT 1VQ7A 1T3LA 1K73C 3EGDB 1TG0A 2QI2A 4JRQA 3MO8A 2CP2A 1PC0A 4Z8AA 5CQXA 1KK7A 3INZA 3CXCS 2FZGB 1WXBA 3TEEA 5FU6C 2PVDB 1K8AC 3BY7A 4HXJA 3OS1A 2OAWA 3EHRA 5GAOl 1G5VA 1M90C 2K57A 2QA4A 4C92F 1YHQQ 1UHFA 4HVWA 4C92D 3EG3A 1M27C 1D1BA 1KC8C 4D6WA 4IIOA 1NYGA 4OB0B 4IIMA 4KUIA 2DK3A 2LNVA 1B07A 3BE3A 4M75A 1TUDA 2DX1A 1M5Q1 2LCSA 4C8QB 3OMCA 2CP6A 1AEYA 2RJFA 2QDYB 1NPRA 2L3QA 5EG2A 5LJ3j 1JEGA 4OGCA 1UJYA 3ER0A 5HCKA 3QIIA 3D7SB 4J9BA 1PHTA 1D3BB 1JJ2P 1VQ9A 2HBPA 4M75F 2L2PA 3GPLA 4XU3A 1VA7A 3OSSC 3CC7Q 1UTIA 2BTTA 1N9RA 3OS0A 2L0AA 4JPBW 3I55Q 5IXFA 1NPPA 2VVKA 3EGUA 2HD0A 3KUFA 1G3SA 1KIKA 3JCMc 4F7UA 1HSQA 5FU7B 3HRSA 2HKNA 1AT1B 3ME9A 3VYGA 1WNLA 1M4ZA 3OYAA 3FB9A 2DL7A 3QBYA 4HA8A 1OX9A 1M90U 1VQKQ 4PJOB 2B86A 4FT2A 3EG2A 2VXEA 3PNWC 2LCCA 4LDWA 4M77C 3OYKA 4XTYA 2R5MA 2LRQA 2O31A 4XTVA 4BE2A 2QYZA 1RABB 2H3EB 2CGHA 1Y96B 1VYTA 4LD9K 3QHSA 1S1NA 2YRCA 1VYUA 2K3YA 3H9NA 3OA6A 4J9DA 2R57A 3MP6A 1OEBA 3RERA 4JJDA 1YBYA 1O9SA 3LW5E 4M78G 1EFNA 5IHIA 4DBQA 1LNXA 1Q86R 2RF0A 3X25B 4A63B 2ENMA 1WJQA 2EIFA 2DPPB 1Q82C 3KFVA 2BE7D 2P0PA 2EYQA 4M77B 3JCMe 5IHNA 1ZSGA 3QYHB 3VYHB 4M7AD 1EX4A 4E7ZA 4ZN3A 3I35A 4FYYB 2OTLQ 1VOMA 1AHJB 5KYUB 1QVFP 3J7AF 1WXUA 2LVMA 5GANd 5FLXE 4QVCA 2AZVA 5CVIA 1RI9A 3U23A 1B34B 2DETA 4E7IA 3L42A 2FEIA 4A54A 4RTXA 4LNPA 1VQPQ 1AWWA 3OW2S 3MEVA 4J6XA 3SWNC 1YITQ 1WJRA 1I5OB 4XK8E 3H0FA 1TWBA 1K9MC 5KYUA 1U8RA 2DD5A 1WYXA 3OQ5A 4AG1C 4AFUC 1J3TA 4M7AC 2CP7A 1KD1R 5FU6B 4AMCA 3OBWA 2DL3A 2E10A 2DTOA 3QDRB 5KYXB 4XTXA 2MI6A 4KGVB 4Z88A 3NFCA 2EKHA 1WA7A 2KRSA 3FRNA 1HJDA 1KD1C 5GAN2 2PQWA 3CCJA 4JS4A 2JT4A 2D1XA 1M1GA 3SFMA 2O2OA 4C5IA 3CC7A 4AFQC 1NLOC 4M75E 1IO6A 1GBRA 1AVZC 3CCQA 2J06A 2QQRA 3E9FA 3VUBA 3E9GA 4ZGJB 3JAME 2ECZA 3A5ZB 1BBZA 4TVRA 4BE1A 4M7DG 3DLMA 2RI3A 3G71Q 3CCSA 2HSEB 1CKBA 1W1FA 4BI4A 2BZXA 2K2MA 2LJ1A 2J6KA 2ZPGB 2NUPA 2M1HA 4BY6C 3CCRQ 2RHZA 2MIOA 2YLBA 1Y57A 3QSUA 4D8DA 4XU2A 2XIDA 1MMNA 3UF4A 3H6ZA 1PD0A 2CSQA 4B9WA 1SPKA 2ZZDA 1E7OA 1YCYA 3UATA 3OB9A 2XMFA 3OYBA 1YJWA 1VQLA 5GMKj 4M78D 3CCSQ 3OW2A 5GANj 2X3WD 4DBHA 3FDRA 4C5HA 1QCOA 2JN0A 3MEAA 1B7TA 3CCEQ 1D3BA 3CPWP 2P0KA 3S3NA 1KQSP 2DM1A 3H0HA 2M9UA 1QP3A 4B6MA 5CIUA 1UGVA 5DLOA 2WSEE 3C0CA 1M3CA 3JCMd 2BKDN 5GMKi 2E1HA 1ZUYA 3M0SA 3LH5A 5J26A 3EGXB 5CQYA 1WLPB 1Q82U 2D0QB 3GNFB 3NGPA 1LPLA 3OY9A 1GCQA 3Q1JA 3C12A 4ORZA 5KYYA 2ZGWA 4L5GA 2MYSA 4HCZA 4X9DA 3PFSA 4HVUA 5KYYB 1I5LA 4F14A 1K8AR 1RAIB 4F16A 4E47A 4ZGDB 2Y90A 2RJDA 4QQDA 4JJCA 1YI2Q 2DZ9A 3EH1A 1YJ9Q 5A2QE 4J9FA 2QQ9A 1RL2A 1UHCA 2FYKA 3LYIA 1RLPC 3V7SA 5FWBA 3M55A 4X1VA 3X28B 3OYGA 1PKTA 2LJ0A 2FHDA 1N5ZA 4PJOG 4LDXA 4PL6A 3URGA 1VYVA 2DFUA 1K0XA 1KQ1A 2XDDA 1JB0E 3VS0A 2CZ1B 3JCMV 2EQUA 2KRNA 1UB4A 2ZCFB 1QCNA 1YJ9A 3E1SA 5LJ5d 4J5YA 1BI1A 1MMGA 4BUGA 4N0AA 4BD3A 3CD6Q 3FLGA 1FWZA 1I07A 1OULA 1PM3A 2RO0A 3RKWA 2VASA 4AT1B 2KAFA 1R0BG 3N5BB 2YUPA 4ZTJA 3M9QA 4J6YA 2QTVA 5FW9A 2E12A 2HNIA 1NJIC 3VS7A 1VQMA 1VQNT 4C0DB 4OMNA 2P84A 2XI9A 1NG2A 1NJIU 2KDSA 2KROA 3A8MB 3CPWA 1OU9A 1VQ6T 2DA9A 3M4YA 1YJNT 1ZQ1A 4J8OA 2LC4A 3KXTA 4M7AG 2XG8D 4J9HA 2GTOA 3M0UA 1D1AA 2LDMA 2QGGA 4OMFB 3G6EA 3CCLQ 5KYWA 1VQMT 2KBTA 4HCCA 2M02A 5GANf 1VQ4T 3RDVA 1C1AA 2JTEA 2LT1A 4BB7A 4F7UG 1H3HA 3EH2A 4IUUA 1QW1A 1HXDA 1WHMA 2OX7A 3VKIA 1IREB 1GL5A 4JRKA 3PTAA 1IGQA 5FROA 3C94A 2DTHA 3PT9A 4E7SA 1VQ6A 2A08A 4K11A 3L2UA 3CMAT 2ZAEA 1VQOQ 1TTHB 2C0OA 4RTWA 4F7UF 1Q7YC 1V1CA 3WVDB 4OMOA 4KH1B 2FO0A 2DNUA 2DYBA 2DEQA 2YXYA 1Q7YR 2EJGA 2QK0A 3CQTA 2LT4A 2NYSA 4OMMA 1NBEB 2HDAA 1X75C 4QT7A 4ZN1A 3CC7T 3JCMP 3VS6A 2RD1A 4DEXA 3META 3S6WA 3CPWS 4E7HA 4O6JA 3MJXA 4PLLA 1SSFA 3O5ZA 4C8QA 6AT1B 3VUZA 1H641 4OB2B 2FG0A 2IPOB 1QKWA 4J7FA 2JM9A 2K7AA 3VU3C 3G71T 1RUWA 3M59A 3L2RA 4RUGA 3ULRB 4BE0A 1V76A 1M1KU 2K2VA 2EYWA 4RTTA 1YIJQ 1SHGA 2RA2A 2RK2A 5D6WA 2XDPA 3HHTB 3CCVT 2K5LA 4FT4A 2L3RA 4IURA 5IAYA 3SEMA 2CDTA 3P8HA 1U1SA 2AZSA 2JUFA 2ZPEB 3CMEQ 5GAMh 2JM8A 2AK5A 1QVGP 4OMPA 1Z9ZA 1YJNA 1MUZA 1YIJA 3I5SA 1G83A 3G4SA 3QZ9B 1PRMC 3G71A 4PJOF 2CUDA 1BIAA 2ABLA 3HSBA 1W4SA 4BI3A 1Y96A 4M77D 3JB9D 3X20B 1JO8A 4KH0B 2BE9B 4GLMA 1VQ7T 1BYMA 2DXCA 3ZBDA 3QZ5B 1PCXA 1CSKA 4OB1B 2EYXA 5CAIA 5GAN5 2XICA 4OP0A 1K9AA 2V26A 2EWNA 1NEBA 2D8HA 2QAZA 1VQ5T 2G3RA 1ZBJA 1D0XA 1YHQA 1X2KA 3VV0A 2EVRA 2KT8A 2DF6A 4E7LA 1WGSA 3EFOA 3C4SA 1KQSS 4AFSC 3JCMg 4QQGA 3HL8A 2VUBA 2M16A 3EGDA 1NJIR 2VKNA 4C5GA 2X3XD 4X34A 3PE0A 1ABOA 2FB7A 2V8KA 1WHHA 1QQJA 1X6OA 2F2VA 2J6FA 4M7DA 1OZ2A 1N27A 3CC4T 1QVGS 2JJ9A 4OB3B 2V8IA 2NLUA 3CXCP 2EAYA 2DERA 3CCRA 1PD1A 3TVTA 3M0PA 1VQ5A 2JOYA 1Q81U 3FIFA 2K5FA 2QTXA 1KFZA 3JCMf 4OMLA 4IUPA 4DOVA 2KY9A 1AZEA 1ABQA 3A98A 1QVFA 1OQKA 4DBRA 1UUEA 2JW4A 3JRZA 3RMSA 1VQ8T 2COYA 3BW1A 3UPUA 4MZPA 1JJ2A 2HBWA 2QGFB 3JCMb 2CUBA 1MMAA 3CD6T 4DQ2A 2XU8A 2SEMA 4ATOA 4A4FA 2RQVA 2PU9B 1FXXA 4MMKA 2KEAA 4N4GA 2FRWA 2X4YA 2EW3A 3BDLA 3UT1A 3G4ST 2DD4A 3OYJA 4NOYA 3QPHA 1M1KC 4A4EA 1RAAB 3M57A 2E3HA 1YP5A 5IT9E 3VJPA 3OW2P 3GBQA 3S3OA 3OMGA 2KYBA 2RI2A 2FVUA 5FU7C 1TSFA 3NTHA 3CD6A 2BUDA 2LJ3A 3PMTA 4GBQA 2KSSA 4CC3A 2MCNA 2Y4XA 7AT1B 1AWOA 4RTUA 4RMOA 1ZUUA 2IIMA 4JRPA 1VQMQ 2DTIA 3RKXA 5GANe 2H3JA 4QW2A 4II1A 1ZSZC 2K6DA 2QDLA 2SRCA 2OI3A 3JV3A 3A1PA 2DBKA 1Q86U 2E64A 2R5AA 3P8DA 4WF2A 4M75G 1JJ2S 4FSXA 4KGZB 3QDFA 4RG2A 3MP8A 4J9EA 2VGNA 2MPXC 1NEGA 1VQ8A 4J7IA 4XTZA 2QEXQ 2K4YA 2EYYA 3JCMX 1JXOA 4OGEA 2O4XB 1QCFA 2RJCA 3A8OB 1GCPA 1K4US 1KQ2A 2EJFA 3MPUB 8AT1B 1VQ9Q 1MHNA 2KR3A 1KHCA 3EHQA 3OS2A 5GAOq 2D6FA 1JBMA 4HVVA 2JMAA 4C92G 3S3MA 1Y07A 5FRNA 3QG1A 1N8RC 3I56Q 1YN8A 1D1CA 1JU5C 3EFSA 2QEXA 4RG8A 4L6V5 4C8QD 2W0ZA 4UC4A 3UWNA 2HSPA 3NMZC 5D6YA 2CZ6B 3JSCA 4HCKA 1UE9A 1PRLC 4LDUA 5L23A 1WHKA 2E6ZA 3M0TA 2KYMA 1OI1A 2PVOB 2O01E 5CKFA 5IH2A 1K9MR 2DRMA 4PJOE 3LGLA 1HD3A 1SKUB 1M8VA 4KRTA 3JB9I 4OVAA 2KXDA 2LX9A 5A0GA 4M75B 1Q95G 1K8AU 4JJBA 4PFPA 4WCIA 2DIGA 3CCUT 1UGQB 3VS4A 3J81E 4DBFA 2E3IA 4Z02A 4C0GA 2YUQA 4J6WA 5LJ3g 1CKAA 1GFCA 4M7DE 1TXQA 1XQHA 5GJVB 1JXMA 1VQ7Q 2FPFA 1WJSA 3HTRA 4M7DC 3EG0A 3HFOA 1G3WA 1YWOA 1NLPC 4XU0A 2E41A 3P8BB 2CS7A 2OAUA 4J9CA 1IHWA 4FW1A 4LN2A 4EMKB 3EFOB 4M75D 4PJOC 4M78E 5HK3A 3R6NA 2I0NA 4V2SA 4M77A 1GFDA 5GAN4 3HRUA 3E2UA 2PUOB 3OYEA 1KJWA 4M7AF 1U5SA 2HQEA 2COWA 1WX6A 3LH0A 4LDYA 2X4JA 2P0QA 2EJ9A 2MWOA 2HQXA 5DY9A 2RI5A 3RNJA 2KK4A 4PK4A 3JCMQ 5KH6A 4J9GA 2HQHA 2DL5A 5GAMg 1X6BA 4WTOB 1Y71A 1KHIA 1Q81C 1UGPB 1NZ9A 2HAXA 1D09B 4XQ3A 4ME7A 2PTKA 1YFNA 3I9QA 2YWWA 1TU0B 4AG2C 1UEBA 1VQ8Q 2M51A 3EAEA 4FYVB 1BCMA 1SSHA 1I8FA 3QYGB 1A0NB 2ED1A 2X51A 2G6FX 2QG9B 3PGGA 1OYXA 1FX7A 5KYXA 2NUTB 1K73R 1ZSZA 2JTFA 3EFRA 2A3LA 2D8JA 2XHCA 1MNEA 4IUQA 4JZ4A 4VUBA 2QA4T 4EMKC 2MOXA 4EMGA 5GAN7 1PNJA 2JVVA 1XNIA 4Q5WA 5C0MA 1VQKA 3CCET 2GFAA 1RACB 1WHLA 1N9SA 2EKOA 1K0SA 1MGQA 1OPKA 1JRIA 2HCKA 2KQWA 2RQTA 4DOWA 2O4XA 3CCVQ 2DAQA 2VB6A 5LL6S 1R0CB 2ZPHB 2LTOA 1WDXA 3CPFA 5D7UA 3SWNA 5KCHA 4L59A 3PIPA 1S72Q 3CC2A 3THKA 1ZHIA 4FU6A 4N0AC 1XJWB 4FL6A 1KC8R 2GQVA 4MZTA 4CC4B 4F04B 1MV0B 2RB6A 1YJWQ 2DJZA 1ZBXA 3CEYA 3VS5A 1M8MA 2CT4A 1YNZA 1K73U 1I0CA 2ROTA 5CCAA 2RJEA 1I4K1 2RM4A 4ZNXA 3M58A 3SWNB 1S72A 5GAMd 3AHUA 2QQBA 1AOJA 1WFWA 4J9IA 5GJWB 3L1AA 1E6HA 4M78A 1YI2T 4JRIA 3REBB 1T0JA 3CCQT 1UGSB 3FJPA 1YJ9T 4LE9A 1FMVA 2CP0A 1VQPT 2KRMA 9ATCB 2HMAA 1VQKT 3QXEB 2J05A 2HEQA 2P4TA 2EQMA 1QMCA 3L2ZA 2R58A 1B34A 2NWMA 3CCMT 2JNGA 2COZA 3QJ6A 2RMOA 5C6SA 1RAEB 5KE3A 5J39A 3V8KA 4HCBA 4JS5A 4KGXB 1GBQA 3CC2T 3CBPA 1G3YA 2JZ2A 1PG5B 2QXFA 3MKDA 4M7DB 5I11A 4OMQA 4FM4B 2VGMA 5GMKm 4F7UE 2AIRB 3M4GA 5J3BA 2JTMA 3FC3A 2FZCB 4C0FA 2KVQG 2E5QA 5FRMA 1KQSA 4M7DF 1UECA 3LWIA 4PJOA 2GCXA 4C92E 5GAMj 2GF7A 5DM7R 4E7JA 3UA6A 4QKUA 2ZPFB 1W2BS 2A28A 2RN8A 4EPCA 2O88A 2ZPIB 2PZ1A 5CO7A 1IXDA 4C8QC 4A4GA 1GCQC 2YT6A 1LJOA 2LCLA 1E6GA 2JXBA 2ROLA 4FYXB 3V8LA 2C0TA 4PJLA 5CR2A 3CMAA 2XD0A 2M0YA 1WPYA 4BY6B 5HKCA 3CMEA 4N4IA 1ZUKA 3TQ7P 1IHVA 1VQ4Q 1RAHB 2CSIA 3WXMB 2DE0X 3ZFJA 4R0KA 1JQQA 2YDLA 1D0YA 4JLIA 5LJ3h 4C0DC 1QVFS 1I1JA 1QP2A 1YITT 3EG9A 1ZA1B 1BK2A 5M9OA 2MF2A 3TREA 1K1ZA 4QVZA 3CMAQ 1RADB 1MV3A 4PJNA 4ZGEB 3V7RA 2H8HA 3ZL7C 1AWXA 2JS2A 3GP8A 4PLIA 2J6OA 1VIFA 3M5AA 1MMDA 5GAMe 1P92A 2RK1A 4Y92A 3L2WA 4A4HA 5LJ5g 3CCMA 3E19A 4M75C 1R8OB 2X4WA 3JB9J 1K9MU 3EGXA 5GANg 1FMWA 5GMKh 4FCYA 3MEWA 1M30A 1U1TA 2J7IA 1KC8U 3JCMJ 2AKKA 1BKBA 2FPDA 2DXBA 3CCJT 4XTUA 1Q82R 3EG1A 2EYZA 3M53A 1V29B 4QVDA 4MZMA 5AT1B 1PKSA 3RUXA 1UG1A 5LJ3e 4R56A 1VQ9T 3T9NA 3NHNA 1VQLT 2LZ6B 4GY5A 4C92C 4PKCC 1X69A 2ESWA 2WSFE 3QJYA 3CCST 1HK9A 2RPNA 3PVLA 4BDYA 4Z89A 1M2OA 5GAN6 2NUTA 2F69A 3HRTA 3LGFA 2QA4Q 3CMET 2LP5A 2PVGB 2DJQA 2CZ7B 1X27A 2C06A 1G2BA 2LMJA 4FW2A 5IN1A 1ZX6A 3WVEB 4NS5A 4C92B 4ELYC 2CT3A 2AT1B 3F70A 2E6NA 1K76A 2QASA 1B3QA 3X24B 4F7UB 4PJJA 1VQNQ 4C8QF 2LNHB 2EQIA 4DA4A 4M7AA 1C0MA 2RHUA 1TS9A 2DRKA 1OV3A 2MK5A 4KBMB 2EPDA 2IVWA 3OYCA 2F5KA 2DXUA 3V8JA 1LVKA 3RESA 1YJNQ 4HKEA 5L8RE 3J80E 2QQAA 3L2QA 1M2VB 3H8ZA 4IUTA 3H0IA 1OOTA 4RTZA 2DKGA 1EIFA 2O9SA 3SDZA 1N8RU 1VIEA 3OYYA 2PUKB 3LLRA 4EMKA 2OTJA 1YCSB 4J83A
chains in the Genus database with same CATH topology
1XOVA 2FPFA 3VS7A 1FYNA 4CC2A 3EG0A 1QLYA 2YSQA 2RQWA 1YWOA 1H92A 1NLPC 4OMNA 3H41A 1NG2A 2ED0A 4F17A 4J9CA 1AWJA 2KROA 2KXCA 3QWYA 1WXTA 2LQNA 4LN2A 2DA9A 4E6RA 1SRMA 1T3LA 3R6NA 2I0NA 2FRYA 1TG0A 4J9HA 2GTOA 3M0UA 1GFDA 1QWEA 1WIEA 4Z8AA 2KNBB 1WXBA 1KJWA 1U5SA 4HXJA 1WX6A 2KBTA 2JMCA 2JTEA 2EGEA 2OAWA 3EHRA 2DBMA 1H3HA 2DL8A 1GL5A 2BZYA 3RNJA 2GBQA 4J9GA 1UHFA 4HVWA 2DL5A 3EG3A 1X6BA 2RQUA 3UA7A 1M27C 4IIOA 1NYGA 2A08A 4K11A 4IIMA 2CH4A 2C0OA 2PTKA 2O9VA 2W10A 4RTWA 3TSWA 1B07A 1V1CA 3I9QA 1TUDA 2DX1A 1BB9A 2LCSA 1SRLA 4OMOA 2FO0A 4AG2C 2DNUA 2DYBA 1AEYA 1T3SA 2M51A 2L3QA 3M0RA 1JEGA 1SSHA 1A0NB 3CQTA 1UJYA 2ED1A 5HCKA 4OMMA 2OJ2A 1AD5A 2G6FX 2A36A 4J9BA 1PHTA 1QWFA 2HDAA 4QT7A 4EIKA 5IXBA 3VS6A 2L2PA 5FWCA 2D8JA 3VS1A 3QWXX 4JZ4A 1VA7A 4DEXA 1UTIA 2MOXA 2BTTA 2A37A 2GTJA 1PNJA 2LX7A 3O5ZA 2L0AA 4JPBW 2FG0A 1QKWA 2JM9A 5IXFA 2K7AA 1RUWA 4ESRA 1K0SA 2VVKA 1OPKA 4RUGA 3EGUA 3ULRB 2HCKA 5I22A 1KIKA 2EYWA 1RLQC 1HSQA 2RQTA 4RTTA 4CC7A 1SHGA 1WDXA 2V1QA 1W6XA 2AKLA 3FJ5A 3SEMA 2CDTA 1WI7A 3THKA 2K3BA 2DL7A 1T0HA 4CC4B 2AZSA 2B86A 1MV0B 3EG2A 2JM8A 2AK5A 4OMPA 3VS5A 1Z9ZA 3IQLA 1M8MA 2O31A 1MUZA 2CT4A 1UFFA 3I5SA 1YNZA 1G83A 4RTYA 1I0CA 1PRMC 2ROTA 2JS0A 2CUDA 1VYTA 4ZNXA 2ABLA 4JZ3A 2EBPA 1S1NA 3I5RA 1JO8A 1VYUA 1Y0MA 4J9DA 1AOJA 1WFWA 4GLMA 4J9IA 5GJWB 1E6HA 2P4RA 3REBB 1T0JA 1OEBA 1SHFA 1CSKA 2EYXA 4JJDA 4LUEA 4LE9A 2VWFA 2YUNA 1K9AA 1NEBA 1EFNA 1U06A 2D8HA 2E5KA 2KRMA 4D8KA 5IHIA 1ZBJA 1X2KA 2EVRA 2KT8A 2J05A 3VRYA 2DF6A 2HEQA 2RF0A 5IHKA 4A63B 4AFSC 2ENMA 2DVJA 2NWMA 2CH4W 2VKNA 2FPEA 3KFVA 2X3XD 3RBBB 3REAB 5IHNA 1ZSGA 3PE0A 1ABOA 2RMOA 1LCKA 3I35A 2F2VA 1GBQA 2J6FA 1WXUA 5I11A 4OMQA 2DL4A 2LQWA 2AZVA 4DEYA 1RI9A 3U23A 3TVTA 3VS2A 3M0PA 2FEIA 3VRZA 4RTXA 4LNPA 5EC7A 1AWWA 2BZ8A 1KFZA 1UECA 4OMLA 1TUCA 1U3OA 3UA6A 3H0FA 1AZEA 1ABQA 3A98A 2DLPA 2A28A 1UUEA 2RN8A 1KSWA 2JW4A 1WYXA 1X43A 2O88A 4AG1C 2L3SA 4AFUC 1Z9QA 1J3TA 2PZ1A 2HBWA 2CUBA 2PNIA 2DL3A 1GCQC 2YT6A 4Z88A 2GQIA 2EKHA 1WA7A 1E6GA 2KRSA 1HJDA 2JXBA 2SEMA 2KT1A 2RNAA 2ROLA 2RQVA 2C0TA 2DMOA 2JT4A 3VS3A 2D1XA 2KEAA 2M0YA 2O2OA 4AFQC 2FRWA 2YUOA 1NLOC 1IO6A 1GBRA 1AVZC 2EW3A 1ZUKA 2J06A 3M0QA 2CSIA 2DE0X 4R0KA 2ECZA 1BBZA 1JQQA 2YDLA 2GNCA 1BU1A 2L3PA 1YP5A 1CKBA 3TSZA 1I1JA 1W1FA 1BK2A 2BZXA 1K1ZA 2K2MA 2KGTA 3GBQA 2LJ1A 4M4ZA 2KYBA 2J6KA 1MV3A 1NYFA 4AFZC 2MIOA 2EGAA 2K9GA 1Y57A 2H8HA 3ZL7C 4D8DA 2LJ3A 1AWXA 2JS2A 3UF4A 2CSQA 4GBQA 4RTVA 2J6OA 1SEMA 1SPKA 2K79A 1FMKA 2MCNA 1E7OA 4CC3A 3UATA 2XMFA 1AWOA 4Y92A 2CREA 4RTUA 1YWPA 1ZUUA 2IIMA 2X3WD 2K6DA 2QDLA 2SRCA 1M3AA 2OI3A 3JV3A 1QKXA 2DBKA 3PVQA 1AZGB 2DM1A 3H0HA 4FSSA 1M30A 2DILA 1W70A 2J7IA 1UGVA 1NM7A 1ARKA 3C0CA 2AKKA 1M3CA 2FPDA 3EG1A 2EYZA 4J9EA 2KE9A 1ZUYA 3M0SA 1NEGA 1X6GA 3LH5A 1PKSA 1UG1A 2F2XA 2EYYA 1JXOA 3NHNA 2LZ6B 1QCFA 1OPLA 3SHWA 1GCPA 1H8KA 1X69A 1K4US 1WLPB 2ESWA 3NGPA 2KR3A 2RPNA 3PVLA 1GCQA 3EHQA 4Z89A 4HVVA 2JMAA 1UJ0A 4ORZA 2LP5A 4LUDA 2RQRA 2DJQA 4HVUA 1YN8A 4F14A 1X27A 1G2BA 4F16A 2LMJA 1JU5C 1ZX6A 2W0ZA 2CT3A 4JJCA 2HSPA 3NMZC 1K76A 2F2WA 4HCKA 1UE9A 1B3QA 1PRLC 4J9FA 1UHCA 3NPFA 5L23A 1RLPC 3M0TA 2KYMA 2LNHB 5FWBA 2EQIA 1GRIA 1ZLMA 4X1VA 5IH2A 2DRMA 1PKTA 2LJ0A 2NUZA 1HD3A 1N5ZA 2DRKA 1OV3A 4KRTA 1VYVA 2KXDA 1K0XA 2EPDA 3VS0A 1X2QA 1M3BA 4JJBA 2KRNA 4WCIA 3VS4A 3H0IA 1OOTA 4RTZA 2YUQA 2O9SA 5ECAA 1PWTA 1CKAA 2C0IA 2EGCA 1GFCA 1I07A 2GGRA 1UDLA 1YCSB 2V1RA 2D0NA 2YUPA 5GJVB 5FW9A 1JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOV A;  2FPF A;  3VS7 A;  1FYN A;  4CC2 A;  3EG0 A;  1QLY A;  2YSQ A;  2RQW A;  1YWO A;  1H92 A;  1NLP C;  4OMN A;  3H41 A;  1NG2 A;  2ED0 A;  4F17 A;  4J9C A;  1AWJ A;  2KRO A;  2KXC A;  3QWY A;  1WXT A;  2LQN A;  4LN2 A;  2DA9 A;  4E6R A;  1SRM A;  1T3L A;  3R6N A;  2I0N A;  2FRY A;  1TG0 A;  4J9H A;  2GTO A;  3M0U A;  1GFD A;  1QWE A;  1WIE A;  4Z8A A;  2KNB B;  1WXB A;  1KJW A;  1U5S A;  4HXJ A;  1WX6 A;  2KBT A;  2JMC A;  2JTE A;  2EGE A;  2OAW A;  3EHR A;  2DBM A;  1H3H A;  2DL8 A;  1GL5 A;  2BZY A;  3RNJ A;  2GBQ A;  4J9G A;  1UHF A;  4HVW A;  2DL5 A;  3EG3 A;  1X6B A;  2RQU A;  3UA7 A;  1M27 C;  4IIO A;  1NYG A;  2A08 A;  4K11 A;  4IIM A;  2CH4 A;  2C0O A;  2PTK A;  2O9V A;  2W10 A;  4RTW A;  3TSW A;  1B07 A;  1V1C A;  3I9Q A;  1TUD A;  2DX1 A;  1BB9 A;  2LCS A;  1SRL A;  4OMO A;  2FO0 A;  4AG2 C;  2DNU A;  2DYB A;  1AEY A;  1T3S A;  2M51 A;  2L3Q A;  3M0R A;  1JEG A;  1SSH A;  1A0N B;  3CQT A;  1UJY A;  2ED1 A;  5HCK A;  4OMM A;  2OJ2 A;  1AD5 A;  2G6F X;  2A36 A;  4J9B A;  1PHT A;  1QWF A;  2HDA A;  4QT7 A;  4EIK A;  5IXB A;  3VS6 A;  2L2P A;  5FWC A;  2D8J A;  3VS1 A;  3QWX X;  4JZ4 A;  1VA7 A;  4DEX A;  1UTI A;  2MOX A;  2BTT A;  2A37 A;  2GTJ A;  1PNJ A;  2LX7 A;  3O5Z A;  2L0A A;  4JPB W;  2FG0 A;  1QKW A;  2JM9 A;  5IXF A;  2K7A A;  1RUW A;  4ESR A;  1K0S A;  2VVK A;  1OPK A;  4RUG A;  3EGU A;  3ULR B;  2HCK A;  5I22 A;  1KIK A;  2EYW A;  1RLQ C;  1HSQ A;  2RQT A;  4RTT A;  4CC7 A;  1SHG A;  1WDX A;  2V1Q A;  1W6X A;  2AKL A;  3FJ5 A;  3SEM A;  2CDT A;  1WI7 A;  3THK A;  2K3B A;  2DL7 A;  1T0H A;  4CC4 B;  2AZS A;  2B86 A;  1MV0 B;  3EG2 A;  2JM8 A;  2AK5 A;  4OMP A;  3VS5 A;  1Z9Z A;  3IQL A;  1M8M A;  2O31 A;  1MUZ A;  2CT4 A;  1UFF A;  3I5S A;  1YNZ A;  1G83 A;  4RTY A;  1I0C A;  1PRM C;  2ROT A;  2JS0 A;  2CUD A;  1VYT A;  4ZNX A;  2ABL A;  4JZ3 A;  2EBP A;  1S1N A;  3I5R A;  1JO8 A;  1VYU A;  1Y0M A;  4J9D A;  1AOJ A;  1WFW A;  4GLM A;  4J9I A;  5GJW B;  1E6H A;  2P4R A;  3REB B;  1T0J A;  1OEB A;  1SHF A;  1CSK A;  2EYX A;  4JJD A;  4LUE A;  4LE9 A;  2VWF A;  2YUN A;  1K9A A;  1NEB A;  1EFN A;  1U06 A;  2D8H A;  2E5K A;  2KRM A;  4D8K A;  5IHI A;  1ZBJ A;  1X2K A;  2EVR A;  2KT8 A;  2J05 A;  3VRY A;  2DF6 A;  2HEQ A;  2RF0 A;  5IHK A;  4A63 B;  4AFS C;  2ENM A;  2DVJ A;  2NWM A;  2CH4 W;  2VKN A;  2FPE A;  3KFV A;  2X3X D;  3RBB B;  3REA B;  5IHN A;  1ZSG A;  3PE0 A;  1ABO A;  2RMO A;  1LCK A;  3I35 A;  2F2V A;  1GBQ A;  2J6F A;  1WXU A;  5I11 A;  4OMQ A;  2DL4 A;  2LQW A;  2AZV A;  4DEY A;  1RI9 A;  3U23 A;  3TVT A;  3VS2 A;  3M0P A;  2FEI A;  3VRZ A;  4RTX A;  4LNP A;  5EC7 A;  1AWW A;  2BZ8 A;  1KFZ A;  1UEC A;  4OML A;  1TUC A;  1U3O A;  3UA6 A;  3H0F A;  1AZE A;  1ABQ A;  3A98 A;  2DLP A;  2A28 A;  1UUE A;  2RN8 A;  1KSW A;  2JW4 A;  1WYX A;  1X43 A;  2O88 A;  4AG1 C;  2L3S A;  4AFU C;  1Z9Q A;  1J3T A;  2PZ1 A;  2HBW A;  2CUB A;  2PNI A;  2DL3 A;  1GCQ C;  2YT6 A;  4Z88 A;  2GQI A;  2EKH A;  1WA7 A;  1E6G A;  2KRS A;  1HJD A;  2JXB A;  2SEM A;  2KT1 A;  2RNA A;  2ROL A;  2RQV A;  2C0T A;  2DMO A;  2JT4 A;  3VS3 A;  2D1X A;  2KEA A;  2M0Y A;  2O2O A;  4AFQ C;  2FRW A;  2YUO A;  1NLO C;  1IO6 A;  1GBR A;  1AVZ C;  2EW3 A;  1ZUK A;  2J06 A;  3M0Q A;  2CSI A;  2DE0 X;  4R0K A;  2ECZ A;  1BBZ A;  1JQQ A;  2YDL A;  2GNC A;  1BU1 A;  2L3P A;  1YP5 A;  1CKB A;  3TSZ A;  1I1J A;  1W1F A;  1BK2 A;  2BZX A;  1K1Z A;  2K2M A;  2KGT A;  3GBQ A;  2LJ1 A;  4M4Z A;  2KYB A;  2J6K A;  1MV3 A;  1NYF A;  4AFZ C;  2MIO A;  2EGA A;  2K9G A;  1Y57 A;  2H8H A;  3ZL7 C;  4D8D A;  2LJ3 A;  1AWX A;  2JS2 A;  3UF4 A;  2CSQ A;  4GBQ A;  4RTV A;  2J6O A;  1SEM A;  1SPK A;  2K79 A;  1FMK A;  2MCN A;  1E7O A;  4CC3 A;  3UAT A;  2XMF A;  1AWO A;  4Y92 A;  2CRE A;  4RTU A;  1YWP A;  1ZUU A;  2IIM A;  2X3W D;  2K6D A;  2QDL A;  2SRC A;  1M3A A;  2OI3 A;  3JV3 A;  1QKX A;  2DBK A;  3PVQ A;  1AZG B;  2DM1 A;  3H0H A;  4FSS A;  1M30 A;  2DIL A;  1W70 A;  2J7I A;  1UGV A;  1NM7 A;  1ARK A;  3C0C A;  2AKK A;  1M3C A;  2FPD A;  3EG1 A;  2EYZ A;  4J9E A;  2KE9 A;  1ZUY A;  3M0S A;  1NEG A;  1X6G A;  3LH5 A;  1PKS A;  1UG1 A;  2F2X A;  2EYY A;  1JXO A;  3NHN A;  2LZ6 B;  1QCF A;  1OPL A;  3SHW A;  1GCP A;  1H8K A;  1X69 A;  1K4U S;  1WLP B;  2ESW A;  3NGP A;  2KR3 A;  2RPN A;  3PVL A;  1GCQ A;  3EHQ A;  4Z89 A;  4HVV A;  2JMA A;  1UJ0 A;  4ORZ A;  2LP5 A;  4LUD A;  2RQR A;  2DJQ A;  4HVU A;  1YN8 A;  4F14 A;  1X27 A;  1G2B A;  4F16 A;  2LMJ A;  1JU5 C;  1ZX6 A;  2W0Z A;  2CT3 A;  4JJC A;  2HSP A;  3NMZ C;  1K76 A;  2F2W A;  4HCK A;  1UE9 A;  1B3Q A;  1PRL C;  4J9F A;  1UHC A;  3NPF A;  5L23 A;  1RLP C;  3M0T A;  2KYM A;  2LNH B;  5FWB A;  2EQI A;  1GRI A;  1ZLM A;  4X1V A;  5IH2 A;  2DRM A;  1PKT A;  2LJ0 A;  2NUZ A;  1HD3 A;  1N5Z A;  2DRK A;  1OV3 A;  4KRT A;  1VYV A;  2KXD A;  1K0X A;  2EPD A;  3VS0 A;  1X2Q A;  1M3B A;  4JJB A;  2KRN A;  4WCI A;  3VS4 A;  3H0I A;  1OOT A;  4RTZ A;  2YUQ A;  2O9S A;  5ECA A;  1PWT A;  1CKA A;  2C0I A;  2EGC A;  1GFC A;  1I07 A;  2GGR A;  1UDL A;  1YCS B;  2V1R A;  2D0N A;  2YUP A;  5GJV B;  5FW9 A;  1JXM A; 
#chains in the Genus database with same CATH topology
 1QVP A;  1DJ7 B;  3CC4 Q;  1XOV A;  5D6X A;  3CCQ Q;  1FYN A;  4CC2 A;  1VQ4 A;  2RQW A;  1F1B B;  4M78 B;  2K3X A;  2HL3 A;  3A8H B;  5LJ5 f;  3H41 A;  5CKH A;  3RR6 A;  5CKD A;  3CBO A;  1M2V A;  2ED0 A;  2A0F B;  1SRM A;  1Q86 C;  2FRY A;  1BI0 A;  5I2M A;  2OTJ T;  2FL7 A;  3BFM A;  1QWE A;  1WIE A;  3I55 A;  2KNB B;  1VQO A;  2MWP A;  2EFI A;  1LOJ A;  3GIB A;  2KMT A;  2JMC A;  2L5Q A;  2EGE A;  2DBM A;  3OYN A;  4M7D D;  2DYI A;  3SB2 A;  4HT8 A;  2DL8 A;  2BZY A;  4MDX A;  2GBQ A;  2Y4Y A;  5A0L A;  3GOX A;  1IB8 A;  2NUP B;  2RQU A;  3UA7 A;  3I56 A;  2K5I A;  1YHQ T;  4EDU A;  2CH4 A;  1BI2 A;  3QKJ A;  1HYO A;  2O9V A;  2W10 A;  3TSW A;  4CI0 C;  3G6E Q;  1YIJ T;  1BB9 A;  1QVG A;  1SRL A;  4ELZ C;  3JCM h;  3A8L B;  1T3S A;  3M0R A;  2CYZ B;  4M77 F;  3JB9 F;  1UGR B;  2OJ2 A;  1AD5 A;  2EQJ A;  2A36 A;  1QWF A;  1Q81 R;  3OS5 A;  4EIK A;  2IG0 A;  2MAM A;  5IXB A;  5FWC A;  3QO3 A;  4E7K A;  2DZC A;  3VS1 A;  4C8Q E;  3QWX X;  3TU4 K;  2VYT A;  2RH2 A;  2A37 A;  3LX7 A;  2GTJ A;  2BIV A;  2LX7 A;  4C92 A;  1YIT A;  2AHJ B;  4ESR A;  2E65 A;  2RHY A;  4C8Q G;  1VQO T;  2YLC A;  4LXC A;  5I22 A;  1RI0 A;  4XU1 A;  1RLQ C;  1WQW A;  4Y28 E;  4CC7 A;  4XTW A;  1N6A A;  4EMH A;  5I21 A;  1VQN A;  1X01 A;  2V1Q A;  1W6X A;  2AKL A;  3FJ5 A;  1WI7 A;  1YJW T;  2K3B A;  2HKQ B;  2QEX T;  1T0H A;  2F1L A;  4GLK A;  3PMI A;  3M56 A;  3IQL A;  2L89 A;  3EG9 B;  3RMQ A;  1UFF A;  2CKK A;  4RTY A;  2JS0 A;  1R77 A;  3L2V A;  1EZZ B;  1VQP A;  3G7Z A;  1XTD A;  2VC8 A;  4JZ3 A;  2EBP A;  3HFN A;  3DLL A;  3I5R A;  3LWH A;  4A4K A;  1Y0M A;  4LDV A;  3CC4 A;  8ATC B;  3ASK A;  1KG1 A;  3MCA B;  2P4R A;  3OYI A;  1SHF A;  3RIR A;  5CKB A;  3CCU A;  1WZO A;  4LUE A;  5GAN 3;  2VWF A;  2X9H A;  4M7A E;  2YUN A;  3DKM A;  1VQL Q;  2VV5 A;  4Y91 A;  4PJO D;  1U06 A;  2E5K A;  1PSE A;  5GAO m;  4BAC A;  4D8K A;  5LJ5 j;  3VRY A;  3CCM Q;  1WHJ A;  3NTI A;  4R55 A;  1BI3 A;  5IHK A;  1KD1 U;  4E2F B;  1BIB A;  2DVJ A;  2DVE A;  2CH4 W;  5GAO r;  2FPE A;  4JUV A;  3RBB B;  2YRD A;  1G3T A;  3REA B;  3BDU A;  3CC2 Q;  1LCK A;  3CCU Q;  4M77 E;  3ZEH A;  1O75 A;  3PIO A;  2DEU A;  2OTL T;  4XAX B;  5GMK e;  1WHG A;  1M90 R;  1RAG B;  2DL4 A;  2LQW A;  1OX8 A;  4DEY A;  3OYM A;  3VS2 A;  5KCO A;  2D9T A;  3VRZ A;  5EC7 A;  2E70 A;  2BZ8 A;  3KBG A;  1VQ6 Q;  3CBM A;  1TUC A;  1U3O A;  2DLP A;  3A8G B;  4NL3 A;  3JB9 H;  1G8X A;  1KSW A;  3GLX A;  3HP9 A;  1X43 A;  2L3S A;  4LD6 A;  4RCB A;  4YTL A;  3CCE A;  1Z9Q A;  2RHX A;  3HPW A;  2WSC E;  2PNI A;  1GXI E;  3CCL T;  4PNO A;  1W2B P;  1BCO A;  2GQI A;  4NL2 A;  2L8D A;  1Y7X A;  2HL5 C;  2V8J A;  3OYF A;  2M0O A;  2KT1 A;  2RNA A;  2DMO A;  5AYF A;  3R6O A;  3VS3 A;  3JCM W;  2X35 A;  2YUO A;  4X9C A;  2ATC B;  1PSF A;  2WAC A;  3M0Q A;  2VXF A;  2XKO C;  3I55 T;  2CP3 A;  4HT9 A;  1MND A;  2GNC A;  1BU1 A;  2L3P A;  4PJM A;  2YHT A;  3TSZ A;  2KGT A;  4M4Z A;  1NYF A;  4AFZ C;  4MML A;  2EGA A;  2K9G A;  4OF1 A;  1ZSZ B;  1OZ3 A;  2GFU A;  2E4H A;  5GAM f;  4RTV A;  4KT0 E;  1SEM A;  2OTJ Q;  2K79 A;  4BI8 B;  1FMK A;  3OYH A;  1OU8 A;  3NTK A;  1H3Z A;  2CRE A;  4C5E A;  1YWP A;  4FYW B;  1ACM B;  1YI2 A;  1Q7Y U;  4KUL A;  4FIB A;  1IGU A;  3G4S Q;  4M78 C;  1NE8 A;  5LJ5 e;  2KI7 A;  3I56 T;  1WQ7 A;  1M3A A;  3OYL A;  1QKX A;  1IZ6 A;  3PVQ A;  1AZG B;  1IRX A;  4JDS A;  4FSS A;  2DIL A;  2F5T X;  5HY6 A;  1W70 A;  3CCJ Q;  1I81 A;  3HKS A;  1NM7 A;  1ARK A;  3OSV A;  3GF5 A;  2OTL A;  4RCC A;  3MP1 A;  2HZY A;  3G6E T;  4BDZ A;  3FEO A;  1VUB A;  5LJ3 f;  2KE9 A;  1X6G A;  3MHX A;  5GMK l;  2F2X A;  2YRV A;  4IUV A;  5GAO n;  3G1J A;  3CCL A;  1OPL A;  3SHW A;  1M1K R;  1H8K A;  1ZA2 B;  1S72 T;  5CK9 A;  3DB3 A;  4RKU E;  4M7A B;  2LQ8 A;  2I2L A;  1UJ0 A;  2CP5 A;  1RAF B;  4LUD A;  2RQR A;  3DB4 A;  4CRI A;  2MMP A;  3O8V A;  4JLG A;  4M77 G;  3JB9 G;  2X4X A;  2XK0 A;  2DO3 A;  4MDW A;  2FZK B;  5GAO p;  2F2W A;  3GNG A;  3X26 B;  3CCV A;  5LJ5 h;  3AT1 B;  3V7C A;  3NPF A;  4PFZ A;  1VQ5 Q;  1D0Z A;  3MEU A;  3CXC A;  5CKE A;  1GRI A;  1ZLM A;  3OBY A;  2XDB A;  2NUZ A;  3UDC A;  2RHI A;  4PFO A;  1SF9 A;  3SD4 A;  5KYN A;  4IKF A;  5KYW B;  1TH7 A;  4C0Z A;  1X2Q A;  1M3B A;  2B8A A;  1TOV A;  1W2B A;  2DIQ A;  5KE2 A;  2ZPB B;  4JJN K;  3TCJ A;  2Z0W A;  5ECA A;  1PWT A;  2C0I A;  2LQK A;  4ANJ A;  2EGC A;  5GAN h;  2GGR A;  5GAN 8;  1UDL A;  2V1R A;  2D0N A;  1C6V X;  2DXT A;  3OYD A;  2QQS A;  2EQK A;  1TUG B;  3QUI A;  2CZ0 B;  1N8R R;  4KUD K;  1QLY A;  2YSQ A;  4P5N A;  4ZTF A;  1H92 A;  5LJ3 d;  5A0D A;  4O5V A;  1M9S A;  4N4H A;  4A53 A;  4B9X A;  4F17 A;  1AWJ A;  3RKY A;  2KXC A;  2A7Y A;  3QWY A;  3C95 A;  1WXT A;  2LQN A;  5HK0 A;  1SG5 A;  5DLQ E;  1M1F A;  5I2S A;  4M78 F;  4E6R A;  3M54 A;  4QQ6 A;  3CCR T;  1VQ7 A;  1T3L A;  1K73 C;  3EGD B;  1TG0 A;  2QI2 A;  4JRQ A;  3MO8 A;  2CP2 A;  1PC0 A;  4Z8A A;  5CQX A;  1KK7 A;  3INZ A;  3CXC S;  2FZG B;  1WXB A;  3TEE A;  5FU6 C;  2PVD B;  1K8A C;  3BY7 A;  4HXJ A;  3OS1 A;  2OAW A;  3EHR A;  5GAO l;  1G5V A;  1M90 C;  2K57 A;  2QA4 A;  4C92 F;  1YHQ Q;  1UHF A;  4HVW A;  4C92 D;  3EG3 A;  1M27 C;  1D1B A;  1KC8 C;  4D6W A;  4IIO A;  1NYG A;  4OB0 B;  4IIM A;  4KUI A;  2DK3 A;  2LNV A;  1B07 A;  3BE3 A;  4M75 A;  1TUD A;  2DX1 A;  1M5Q 1;  2LCS A;  4C8Q B;  3OMC A;  2CP6 A;  1AEY A;  2RJF A;  2QDY B;  1NPR A;  2L3Q A;  5EG2 A;  5LJ3 j;  1JEG A;  4OGC A;  1UJY A;  3ER0 A;  5HCK A;  3QII A;  3D7S B;  4J9B A;  1PHT A;  1D3B B;  1JJ2 P;  1VQ9 A;  2HBP A;  4M75 F;  2L2P A;  3GPL A;  4XU3 A;  1VA7 A;  3OSS C;  3CC7 Q;  1UTI A;  2BTT A;  1N9R A;  3OS0 A;  2L0A A;  4JPB W;  3I55 Q;  5IXF A;  1NPP A;  2VVK A;  3EGU A;  2HD0 A;  3KUF A;  1G3S A;  1KIK A;  3JCM c;  4F7U A;  1HSQ A;  5FU7 B;  3HRS A;  2HKN A;  1AT1 B;  3ME9 A;  3VYG A;  1WNL A;  1M4Z A;  3OYA A;  3FB9 A;  2DL7 A;  3QBY A;  4HA8 A;  1OX9 A;  1M90 U;  1VQK Q;  4PJO B;  2B86 A;  4FT2 A;  3EG2 A;  2VXE A;  3PNW C;  2LCC A;  4LDW A;  4M77 C;  3OYK A;  4XTY A;  2R5M A;  2LRQ A;  2O31 A;  4XTV A;  4BE2 A;  2QYZ A;  1RAB B;  2H3E B;  2CGH A;  1Y96 B;  1VYT A;  4LD9 K;  3QHS A;  1S1N A;  2YRC A;  1VYU A;  2K3Y A;  3H9N A;  3OA6 A;  4J9D A;  2R57 A;  3MP6 A;  1OEB A;  3RER A;  4JJD A;  1YBY A;  1O9S A;  3LW5 E;  4M78 G;  1EFN A;  5IHI A;  4DBQ A;  1LNX A;  1Q86 R;  2RF0 A;  3X25 B;  4A63 B;  2ENM A;  1WJQ A;  2EIF A;  2DPP B;  1Q82 C;  3KFV A;  2BE7 D;  2P0P A;  2EYQ A;  4M77 B;  3JCM e;  5IHN A;  1ZSG A;  3QYH B;  3VYH B;  4M7A D;  1EX4 A;  4E7Z A;  4ZN3 A;  3I35 A;  4FYY B;  2OTL Q;  1VOM A;  1AHJ B;  5KYU B;  1QVF P;  3J7A F;  1WXU A;  2LVM A;  5GAN d;  5FLX E;  4QVC A;  2AZV A;  5CVI A;  1RI9 A;  3U23 A;  1B34 B;  2DET A;  4E7I A;  3L42 A;  2FEI A;  4A54 A;  4RTX A;  4LNP A;  1VQP Q;  1AWW A;  3OW2 S;  3MEV A;  4J6X A;  3SWN C;  1YIT Q;  1WJR A;  1I5O B;  4XK8 E;  3H0F A;  1TWB A;  1K9M C;  5KYU A;  1U8R A;  2DD5 A;  1WYX A;  3OQ5 A;  4AG1 C;  4AFU C;  1J3T A;  4M7A C;  2CP7 A;  1KD1 R;  5FU6 B;  4AMC A;  3OBW A;  2DL3 A;  2E10 A;  2DTO A;  3QDR B;  5KYX B;  4XTX A;  2MI6 A;  4KGV B;  4Z88 A;  3NFC A;  2EKH A;  1WA7 A;  2KRS A;  3FRN A;  1HJD A;  1KD1 C;  5GAN 2;  2PQW A;  3CCJ A;  4JS4 A;  2JT4 A;  2D1X A;  1M1G A;  3SFM A;  2O2O A;  4C5I A;  3CC7 A;  4AFQ C;  1NLO C;  4M75 E;  1IO6 A;  1GBR A;  1AVZ C;  3CCQ A;  2J06 A;  2QQR A;  3E9F A;  3VUB A;  3E9G A;  4ZGJ B;  3JAM E;  2ECZ A;  3A5Z B;  1BBZ A;  4TVR A;  4BE1 A;  4M7D G;  3DLM A;  2RI3 A;  3G71 Q;  3CCS A;  2HSE B;  1CKB A;  1W1F A;  4BI4 A;  2BZX A;  2K2M A;  2LJ1 A;  2J6K A;  2ZPG B;  2NUP A;  2M1H A;  4BY6 C;  3CCR Q;  2RHZ A;  2MIO A;  2YLB A;  1Y57 A;  3QSU A;  4D8D A;  4XU2 A;  2XID A;  1MMN A;  3UF4 A;  3H6Z A;  1PD0 A;  2CSQ A;  4B9W A;  1SPK A;  2ZZD A;  1E7O A;  1YCY A;  3UAT A;  3OB9 A;  2XMF A;  3OYB A;  1YJW A;  1VQL A;  5GMK j;  4M78 D;  3CCS Q;  3OW2 A;  5GAN j;  2X3W D;  4DBH A;  3FDR A;  4C5H A;  1QCO A;  2JN0 A;  3MEA A;  1B7T A;  3CCE Q;  1D3B A;  3CPW P;  2P0K A;  3S3N A;  1KQS P;  2DM1 A;  3H0H A;  2M9U A;  1QP3 A;  4B6M A;  5CIU A;  1UGV A;  5DLO A;  2WSE E;  3C0C A;  1M3C A;  3JCM d;  2BKD N;  5GMK i;  2E1H A;  1ZUY A;  3M0S A;  3LH5 A;  5J26 A;  3EGX B;  5CQY A;  1WLP B;  1Q82 U;  2D0Q B;  3GNF B;  3NGP A;  1LPL A;  3OY9 A;  1GCQ A;  3Q1J A;  3C12 A;  4ORZ A;  5KYY A;  2ZGW A;  4L5G A;  2MYS A;  4HCZ A;  4X9D A;  3PFS A;  4HVU A;  5KYY B;  1I5L A;  4F14 A;  1K8A R;  1RAI B;  4F16 A;  4E47 A;  4ZGD B;  2Y90 A;  2RJD A;  4QQD A;  4JJC A;  1YI2 Q;  2DZ9 A;  3EH1 A;  1YJ9 Q;  5A2Q E;  4J9F A;  2QQ9 A;  1RL2 A;  1UHC A;  2FYK A;  3LYI A;  1RLP C;  3V7S A;  5FWB A;  3M55 A;  4X1V A;  3X28 B;  3OYG A;  1PKT A;  2LJ0 A;  2FHD A;  1N5Z A;  4PJO G;  4LDX A;  4PL6 A;  3URG A;  1VYV A;  2DFU A;  1K0X A;  1KQ1 A;  2XDD A;  1JB0 E;  3VS0 A;  2CZ1 B;  3JCM V;  2EQU A;  2KRN A;  1UB4 A;  2ZCF B;  1QCN A;  1YJ9 A;  3E1S A;  5LJ5 d;  4J5Y A;  1BI1 A;  1MMG A;  4BUG A;  4N0A A;  4BD3 A;  3CD6 Q;  3FLG A;  1FWZ A;  1I07 A;  1OUL A;  1PM3 A;  2RO0 A;  3RKW A;  2VAS A;  4AT1 B;  2KAF A;  1R0B G;  3N5B B;  2YUP A;  4ZTJ A;  3M9Q A;  4J6Y A;  2QTV A;  5FW9 A;  2E12 A;  2HNI A;  1NJI C;  3VS7 A;  1VQM A;  1VQN T;  4C0D B;  4OMN A;  2P84 A;  2XI9 A;  1NG2 A;  1NJI U;  2KDS A;  2KRO A;  3A8M B;  3CPW A;  1OU9 A;  1VQ6 T;  2DA9 A;  3M4Y A;  1YJN T;  1ZQ1 A;  4J8O A;  2LC4 A;  3KXT A;  4M7A G;  2XG8 D;  4J9H A;  2GTO A;  3M0U A;  1D1A A;  2LDM A;  2QGG A;  4OMF B;  3G6E A;  3CCL Q;  5KYW A;  1VQM T;  2KBT A;  4HCC A;  2M02 A;  5GAN f;  1VQ4 T;  3RDV A;  1C1A A;  2JTE A;  2LT1 A;  4BB7 A;  4F7U G;  1H3H A;  3EH2 A;  4IUU A;  1QW1 A;  1HXD A;  1WHM A;  2OX7 A;  3VKI A;  1IRE B;  1GL5 A;  4JRK A;  3PTA A;  1IGQ A;  5FRO A;  3C94 A;  2DTH A;  3PT9 A;  4E7S A;  1VQ6 A;  2A08 A;  4K11 A;  3L2U A;  3CMA T;  2ZAE A;  1VQO Q;  1TTH B;  2C0O A;  4RTW A;  4F7U F;  1Q7Y C;  1V1C A;  3WVD B;  4OMO A;  4KH1 B;  2FO0 A;  2DNU A;  2DYB A;  2DEQ A;  2YXY A;  1Q7Y R;  2EJG A;  2QK0 A;  3CQT A;  2LT4 A;  2NYS A;  4OMM A;  1NBE B;  2HDA A;  1X75 C;  4QT7 A;  4ZN1 A;  3CC7 T;  3JCM P;  3VS6 A;  2RD1 A;  4DEX A;  3MET A;  3S6W A;  3CPW S;  4E7H A;  4O6J A;  3MJX A;  4PLL A;  1SSF A;  3O5Z A;  4C8Q A;  6AT1 B;  3VUZ A;  1H64 1;  4OB2 B;  2FG0 A;  2IPO B;  1QKW A;  4J7F A;  2JM9 A;  2K7A A;  3VU3 C;  3G71 T;  1RUW A;  3M59 A;  3L2R A;  4RUG A;  3ULR B;  4BE0 A;  1V76 A;  1M1K U;  2K2V A;  2EYW A;  4RTT A;  1YIJ Q;  1SHG A;  2RA2 A;  2RK2 A;  5D6W A;  2XDP A;  3HHT B;  3CCV T;  2K5L A;  4FT4 A;  2L3R A;  4IUR A;  5IAY A;  3SEM A;  2CDT A;  3P8H A;  1U1S A;  2AZS A;  2JUF A;  2ZPE B;  3CME Q;  5GAM h;  2JM8 A;  2AK5 A;  1QVG P;  4OMP A;  1Z9Z A;  1YJN A;  1MUZ A;  1YIJ A;  3I5S A;  1G83 A;  3G4S A;  3QZ9 B;  1PRM C;  3G71 A;  4PJO F;  2CUD A;  1BIA A;  2ABL A;  3HSB A;  1W4S A;  4BI3 A;  1Y96 A;  4M77 D;  3JB9 D;  3X20 B;  1JO8 A;  4KH0 B;  2BE9 B;  4GLM A;  1VQ7 T;  1BYM A;  2DXC A;  3ZBD A;  3QZ5 B;  1PCX A;  1CSK A;  4OB1 B;  2EYX A;  5CAI A;  5GAN 5;  2XIC A;  4OP0 A;  1K9A A;  2V26 A;  2EWN A;  1NEB A;  2D8H A;  2QAZ A;  1VQ5 T;  2G3R A;  1ZBJ A;  1D0X A;  1YHQ A;  1X2K A;  3VV0 A;  2EVR A;  2KT8 A;  2DF6 A;  4E7L A;  1WGS A;  3EFO A;  3C4S A;  1KQS S;  4AFS C;  3JCM g;  4QQG A;  3HL8 A;  2VUB A;  2M16 A;  3EGD A;  1NJI R;  2VKN A;  4C5G A;  2X3X D;  4X34 A;  3PE0 A;  1ABO A;  2FB7 A;  2V8K A;  1WHH A;  1QQJ A;  1X6O A;  2F2V A;  2J6F A;  4M7D A;  1OZ2 A;  1N27 A;  3CC4 T;  1QVG S;  2JJ9 A;  4OB3 B;  2V8I A;  2NLU A;  3CXC P;  2EAY A;  2DER A;  3CCR A;  1PD1 A;  3TVT A;  3M0P A;  1VQ5 A;  2JOY A;  1Q81 U;  3FIF A;  2K5F A;  2QTX A;  1KFZ A;  3JCM f;  4OML A;  4IUP A;  4DOV A;  2KY9 A;  1AZE A;  1ABQ A;  3A98 A;  1QVF A;  1OQK A;  4DBR A;  1UUE A;  2JW4 A;  3JRZ A;  3RMS A;  1VQ8 T;  2COY A;  3BW1 A;  3UPU A;  4MZP A;  1JJ2 A;  2HBW A;  2QGF B;  3JCM b;  2CUB A;  1MMA A;  3CD6 T;  4DQ2 A;  2XU8 A;  2SEM A;  4ATO A;  4A4F A;  2RQV A;  2PU9 B;  1FXX A;  4MMK A;  2KEA A;  4N4G A;  2FRW A;  2X4Y A;  2EW3 A;  3BDL A;  3UT1 A;  3G4S T;  2DD4 A;  3OYJ A;  4NOY A;  3QPH A;  1M1K C;  4A4E A;  1RAA B;  3M57 A;  2E3H A;  1YP5 A;  5IT9 E;  3VJP A;  3OW2 P;  3GBQ A;  3S3O A;  3OMG A;  2KYB A;  2RI2 A;  2FVU A;  5FU7 C;  1TSF A;  3NTH A;  3CD6 A;  2BUD A;  2LJ3 A;  3PMT A;  4GBQ A;  2KSS A;  4CC3 A;  2MCN A;  2Y4X A;  7AT1 B;  1AWO A;  4RTU A;  4RMO A;  1ZUU A;  2IIM A;  4JRP A;  1VQM Q;  2DTI A;  3RKX A;  5GAN e;  2H3J A;  4QW2 A;  4II1 A;  1ZSZ C;  2K6D A;  2QDL A;  2SRC A;  2OI3 A;  3JV3 A;  3A1P A;  2DBK A;  1Q86 U;  2E64 A;  2R5A A;  3P8D A;  4WF2 A;  4M75 G;  1JJ2 S;  4FSX A;  4KGZ B;  3QDF A;  4RG2 A;  3MP8 A;  4J9E A;  2VGN A;  2MPX C;  1NEG A;  1VQ8 A;  4J7I A;  4XTZ A;  2QEX Q;  2K4Y A;  2EYY A;  3JCM X;  1JXO A;  4OGE A;  2O4X B;  1QCF A;  2RJC A;  3A8O B;  1GCP A;  1K4U S;  1KQ2 A;  2EJF A;  3MPU B;  8AT1 B;  1VQ9 Q;  1MHN A;  2KR3 A;  1KHC A;  3EHQ A;  3OS2 A;  5GAO q;  2D6F A;  1JBM A;  4HVV A;  2JMA A;  4C92 G;  3S3M A;  1Y07 A;  5FRN A;  3QG1 A;  1N8R C;  3I56 Q;  1YN8 A;  1D1C A;  1JU5 C;  3EFS A;  2QEX A;  4RG8 A;  4L6V 5;  4C8Q D;  2W0Z A;  4UC4 A;  3UWN A;  2HSP A;  3NMZ C;  5D6Y A;  2CZ6 B;  3JSC A;  4HCK A;  1UE9 A;  1PRL C;  4LDU A;  5L23 A;  1WHK A;  2E6Z A;  3M0T A;  2KYM A;  1OI1 A;  2PVO B;  2O01 E;  5CKF A;  5IH2 A;  1K9M R;  2DRM A;  4PJO E;  3LGL A;  1HD3 A;  1SKU B;  1M8V A;  4KRT A;  3JB9 I;  4OVA A;  2KXD A;  2LX9 A;  5A0G A;  4M75 B;  1Q95 G;  1K8A U;  4JJB A;  4PFP A;  4WCI A;  2DIG A;  3CCU T;  1UGQ B;  3VS4 A;  3J81 E;  4DBF A;  2E3I A;  4Z02 A;  4C0G A;  2YUQ A;  4J6W A;  5LJ3 g;  1CKA A;  1GFC A;  4M7D E;  1TXQ A;  1XQH A;  5GJV B;  1JXM A;  1VQ7 Q;  2FPF A;  1WJS A;  3HTR A;  4M7D C;  3EG0 A;  3HFO A;  1G3W A;  1YWO A;  1NLP C;  4XU0 A;  2E41 A;  3P8B B;  2CS7 A;  2OAU A;  4J9C A;  1IHW A;  4FW1 A;  4LN2 A;  4EMK B;  3EFO B;  4M75 D;  4PJO C;  4M78 E;  5HK3 A;  3R6N A;  2I0N A;  4V2S A;  4M77 A;  1GFD A;  5GAN 4;  3HRU A;  3E2U A;  2PUO B;  3OYE A;  1KJW A;  4M7A F;  1U5S A;  2HQE A;  2COW A;  1WX6 A;  3LH0 A;  4LDY A;  2X4J A;  2P0Q A;  2EJ9 A;  2MWO A;  2HQX A;  5DY9 A;  2RI5 A;  3RNJ A;  2KK4 A;  4PK4 A;  3JCM Q;  5KH6 A;  4J9G A;  2HQH A;  2DL5 A;  5GAM g;  1X6B A;  4WTO B;  1Y71 A;  1KHI A;  1Q81 C;  1UGP B;  1NZ9 A;  2HAX A;  1D09 B;  4XQ3 A;  4ME7 A;  2PTK A;  1YFN A;  3I9Q A;  2YWW A;  1TU0 B;  4AG2 C;  1UEB A;  1VQ8 Q;  2M51 A;  3EAE A;  4FYV B;  1BCM A;  1SSH A;  1I8F A;  3QYG B;  1A0N B;  2ED1 A;  2X51 A;  2G6F X;  2QG9 B;  3PGG A;  1OYX A;  1FX7 A;  5KYX A;  2NUT B;  1K73 R;  1ZSZ A;  2JTF A;  3EFR A;  2A3L A;  2D8J A;  2XHC A;  1MNE A;  4IUQ A;  4JZ4 A;  4VUB A;  2QA4 T;  4EMK C;  2MOX A;  4EMG A;  5GAN 7;  1PNJ A;  2JVV A;  1XNI A;  4Q5W A;  5C0M A;  1VQK A;  3CCE T;  2GFA A;  1RAC B;  1WHL A;  1N9S A;  2EKO A;  1K0S A;  1MGQ A;  1OPK A;  1JRI A;  2HCK A;  2KQW A;  2RQT A;  4DOW A;  2O4X A;  3CCV Q;  2DAQ A;  2VB6 A;  5LL6 S;  1R0C B;  2ZPH B;  2LTO A;  1WDX A;  3CPF A;  5D7U A;  3SWN A;  5KCH A;  4L59 A;  3PIP A;  1S72 Q;  3CC2 A;  3THK A;  1ZHI A;  4FU6 A;  4N0A C;  1XJW B;  4FL6 A;  1KC8 R;  2GQV A;  4MZT A;  4CC4 B;  4F04 B;  1MV0 B;  2RB6 A;  1YJW Q;  2DJZ A;  1ZBX A;  3CEY A;  3VS5 A;  1M8M A;  2CT4 A;  1YNZ A;  1K73 U;  1I0C A;  2ROT A;  5CCA A;  2RJE A;  1I4K 1;  2RM4 A;  4ZNX A;  3M58 A;  3SWN B;  1S72 A;  5GAM d;  3AHU A;  2QQB A;  1AOJ A;  1WFW A;  4J9I A;  5GJW B;  3L1A A;  1E6H A;  4M78 A;  1YI2 T;  4JRI A;  3REB B;  1T0J A;  3CCQ T;  1UGS B;  3FJP A;  1YJ9 T;  4LE9 A;  1FMV A;  2CP0 A;  1VQP T;  2KRM A;  9ATC B;  2HMA A;  1VQK T;  3QXE B;  2J05 A;  2HEQ A;  2P4T A;  2EQM A;  1QMC A;  3L2Z A;  2R58 A;  1B34 A;  2NWM A;  3CCM T;  2JNG A;  2COZ A;  3QJ6 A;  2RMO A;  5C6S A;  1RAE B;  5KE3 A;  5J39 A;  3V8K A;  4HCB A;  4JS5 A;  4KGX B;  1GBQ A;  3CC2 T;  3CBP A;  1G3Y A;  2JZ2 A;  1PG5 B;  2QXF A;  3MKD A;  4M7D B;  5I11 A;  4OMQ A;  4FM4 B;  2VGM A;  5GMK m;  4F7U E;  2AIR B;  3M4G A;  5J3B A;  2JTM A;  3FC3 A;  2FZC B;  4C0F A;  2KVQ G;  2E5Q A;  5FRM A;  1KQS A;  4M7D F;  1UEC A;  3LWI A;  4PJO A;  2GCX A;  4C92 E;  5GAM j;  2GF7 A;  5DM7 R;  4E7J A;  3UA6 A;  4QKU A;  2ZPF B;  1W2B S;  2A28 A;  2RN8 A;  4EPC A;  2O88 A;  2ZPI B;  2PZ1 A;  5CO7 A;  1IXD A;  4C8Q C;  4A4G A;  1GCQ C;  2YT6 A;  1LJO A;  2LCL A;  1E6G A;  2JXB A;  2ROL A;  4FYX B;  3V8L A;  2C0T A;  4PJL A;  5CR2 A;  3CMA A;  2XD0 A;  2M0Y A;  1WPY A;  4BY6 B;  5HKC A;  3CME A;  4N4I A;  1ZUK A;  3TQ7 P;  1IHV A;  1VQ4 Q;  1RAH B;  2CSI A;  3WXM B;  2DE0 X;  3ZFJ A;  4R0K A;  1JQQ A;  2YDL A;  1D0Y A;  4JLI A;  5LJ3 h;  4C0D C;  1QVF S;  1I1J A;  1QP2 A;  1YIT T;  3EG9 A;  1ZA1 B;  1BK2 A;  5M9O A;  2MF2 A;  3TRE A;  1K1Z A;  4QVZ A;  3CMA Q;  1RAD B;  1MV3 A;  4PJN A;  4ZGE B;  3V7R A;  2H8H A;  3ZL7 C;  1AWX A;  2JS2 A;  3GP8 A;  4PLI A;  2J6O A;  1VIF A;  3M5A A;  1MMD A;  5GAM e;  1P92 A;  2RK1 A;  4Y92 A;  3L2W A;  4A4H A;  5LJ5 g;  3CCM A;  3E19 A;  4M75 C;  1R8O B;  2X4W A;  3JB9 J;  1K9M U;  3EGX A;  5GAN g;  1FMW A;  5GMK h;  4FCY A;  3MEW A;  1M30 A;  1U1T A;  2J7I A;  1KC8 U;  3JCM J;  2AKK A;  1BKB A;  2FPD A;  2DXB A;  3CCJ T;  4XTU A;  1Q82 R;  3EG1 A;  2EYZ A;  3M53 A;  1V29 B;  4QVD A;  4MZM A;  5AT1 B;  1PKS A;  3RUX A;  1UG1 A;  5LJ3 e;  4R56 A;  1VQ9 T;  3T9N A;  3NHN A;  1VQL T;  2LZ6 B;  4GY5 A;  4C92 C;  4PKC C;  1X69 A;  2ESW A;  2WSF E;  3QJY A;  3CCS T;  1HK9 A;  2RPN A;  3PVL A;  4BDY A;  4Z89 A;  1M2O A;  5GAN 6;  2NUT A;  2F69 A;  3HRT A;  3LGF A;  2QA4 Q;  3CME T;  2LP5 A;  2PVG B;  2DJQ A;  2CZ7 B;  1X27 A;  2C06 A;  1G2B A;  2LMJ A;  4FW2 A;  5IN1 A;  1ZX6 A;  3WVE B;  4NS5 A;  4C92 B;  4ELY C;  2CT3 A;  2AT1 B;  3F70 A;  2E6N A;  1K76 A;  2QAS A;  1B3Q A;  3X24 B;  4F7U B;  4PJJ A;  1VQN Q;  4C8Q F;  2LNH B;  2EQI A;  4DA4 A;  4M7A A;  1C0M A;  2RHU A;  1TS9 A;  2DRK A;  1OV3 A;  2MK5 A;  4KBM B;  2EPD A;  2IVW A;  3OYC A;  2F5K A;  2DXU A;  3V8J A;  1LVK A;  3RES A;  1YJN Q;  4HKE A;  5L8R E;  3J80 E;  2QQA A;  3L2Q A;  1M2V B;  3H8Z A;  4IUT A;  3H0I A;  1OOT A;  4RTZ A;  2DKG A;  1EIF A;  2O9S A;  3SDZ A;  1N8R U;  1VIE A;  3OYY A;  2PUK B;  3LLR A;  4EMK A;  2OTJ A;  1YCS B;  4J83 A; 
#chains in the Genus database with same CATH homology
 1XOV A;  2FPF A;  3VS7 A;  1FYN A;  4CC2 A;  3EG0 A;  1QLY A;  2YSQ A;  2RQW A;  1YWO A;  1H92 A;  1NLP C;  4OMN A;  3H41 A;  1NG2 A;  2ED0 A;  4F17 A;  4J9C A;  1AWJ A;  2KRO A;  2KXC A;  3QWY A;  1WXT A;  2LQN A;  4LN2 A;  2DA9 A;  4E6R A;  1SRM A;  1T3L A;  3R6N A;  2I0N A;  2FRY A;  1TG0 A;  4J9H A;  2GTO A;  3M0U A;  1GFD A;  1QWE A;  1WIE A;  4Z8A A;  2KNB B;  1WXB A;  1KJW A;  1U5S A;  4HXJ A;  1WX6 A;  2KBT A;  2JMC A;  2JTE A;  2EGE A;  2OAW A;  3EHR A;  2DBM A;  1H3H A;  2DL8 A;  1GL5 A;  2BZY A;  3RNJ A;  2GBQ A;  4J9G A;  1UHF A;  4HVW A;  2DL5 A;  3EG3 A;  1X6B A;  2RQU A;  3UA7 A;  1M27 C;  4IIO A;  1NYG A;  2A08 A;  4K11 A;  4IIM A;  2CH4 A;  2C0O A;  2PTK A;  2O9V A;  2W10 A;  4RTW A;  3TSW A;  1B07 A;  1V1C A;  3I9Q A;  1TUD A;  2DX1 A;  1BB9 A;  2LCS A;  1SRL A;  4OMO A;  2FO0 A;  4AG2 C;  2DNU A;  2DYB A;  1AEY A;  1T3S A;  2M51 A;  2L3Q A;  3M0R A;  1JEG A;  1SSH A;  1A0N B;  3CQT A;  1UJY A;  2ED1 A;  5HCK A;  4OMM A;  2OJ2 A;  1AD5 A;  2G6F X;  2A36 A;  4J9B A;  1PHT A;  1QWF A;  2HDA A;  4QT7 A;  4EIK A;  5IXB A;  3VS6 A;  2L2P A;  5FWC A;  2D8J A;  3VS1 A;  3QWX X;  4JZ4 A;  1VA7 A;  4DEX A;  1UTI A;  2MOX A;  2BTT A;  2A37 A;  2GTJ A;  1PNJ A;  2LX7 A;  3O5Z A;  2L0A A;  4JPB W;  2FG0 A;  1QKW A;  2JM9 A;  5IXF A;  2K7A A;  1RUW A;  4ESR A;  1K0S A;  2VVK A;  1OPK A;  4RUG A;  3EGU A;  3ULR B;  2HCK A;  5I22 A;  1KIK A;  2EYW A;  1RLQ C;  1HSQ A;  2RQT A;  4RTT A;  4CC7 A;  1SHG A;  1WDX A;  2V1Q A;  1W6X A;  2AKL A;  3FJ5 A;  3SEM A;  2CDT A;  1WI7 A;  3THK A;  2K3B A;  2DL7 A;  1T0H A;  4CC4 B;  2AZS A;  2B86 A;  1MV0 B;  3EG2 A;  2JM8 A;  2AK5 A;  4OMP A;  3VS5 A;  1Z9Z A;  3IQL A;  1M8M A;  2O31 A;  1MUZ A;  2CT4 A;  1UFF A;  3I5S A;  1YNZ A;  1G83 A;  4RTY A;  1I0C A;  1PRM C;  2ROT A;  2JS0 A;  2CUD A;  1VYT A;  4ZNX A;  2ABL A;  4JZ3 A;  2EBP A;  1S1N A;  3I5R A;  1JO8 A;  1VYU A;  1Y0M A;  4J9D A;  1AOJ A;  1WFW A;  4GLM A;  4J9I A;  5GJW B;  1E6H A;  2P4R A;  3REB B;  1T0J A;  1OEB A;  1SHF A;  1CSK A;  2EYX A;  4JJD A;  4LUE A;  4LE9 A;  2VWF A;  2YUN A;  1K9A A;  1NEB A;  1EFN A;  1U06 A;  2D8H A;  2E5K A;  2KRM A;  4D8K A;  5IHI A;  1ZBJ A;  1X2K A;  2EVR A;  2KT8 A;  2J05 A;  3VRY A;  2DF6 A;  2HEQ A;  2RF0 A;  5IHK A;  4A63 B;  4AFS C;  2ENM A;  2DVJ A;  2NWM A;  2CH4 W;  2VKN A;  2FPE A;  3KFV A;  2X3X D;  3RBB B;  3REA B;  5IHN A;  1ZSG A;  3PE0 A;  1ABO A;  2RMO A;  1LCK A;  3I35 A;  2F2V A;  1GBQ A;  2J6F A;  1WXU A;  5I11 A;  4OMQ A;  2DL4 A;  2LQW A;  2AZV A;  4DEY A;  1RI9 A;  3U23 A;  3TVT A;  3VS2 A;  3M0P A;  2FEI A;  3VRZ A;  4RTX A;  4LNP A;  5EC7 A;  1AWW A;  2BZ8 A;  1KFZ A;  1UEC A;  4OML A;  1TUC A;  1U3O A;  3UA6 A;  3H0F A;  1AZE A;  1ABQ A;  3A98 A;  2DLP A;  2A28 A;  1UUE A;  2RN8 A;  1KSW A;  2JW4 A;  1WYX A;  1X43 A;  2O88 A;  4AG1 C;  2L3S A;  4AFU C;  1Z9Q A;  1J3T A;  2PZ1 A;  2HBW A;  2CUB A;  2PNI A;  2DL3 A;  1GCQ C;  2YT6 A;  4Z88 A;  2GQI A;  2EKH A;  1WA7 A;  1E6G A;  2KRS A;  1HJD A;  2JXB A;  2SEM A;  2KT1 A;  2RNA A;  2ROL A;  2RQV A;  2C0T A;  2DMO A;  2JT4 A;  3VS3 A;  2D1X A;  2KEA A;  2M0Y A;  2O2O A;  4AFQ C;  2FRW A;  2YUO A;  1NLO C;  1IO6 A;  1GBR A;  1AVZ C;  2EW3 A;  1ZUK A;  2J06 A;  3M0Q A;  2CSI A;  2DE0 X;  4R0K A;  2ECZ A;  1BBZ A;  1JQQ A;  2YDL A;  2GNC A;  1BU1 A;  2L3P A;  1YP5 A;  1CKB A;  3TSZ A;  1I1J A;  1W1F A;  1BK2 A;  2BZX A;  1K1Z A;  2K2M A;  2KGT A;  3GBQ A;  2LJ1 A;  4M4Z A;  2KYB A;  2J6K A;  1MV3 A;  1NYF A;  4AFZ C;  2MIO A;  2EGA A;  2K9G A;  1Y57 A;  2H8H A;  3ZL7 C;  4D8D A;  2LJ3 A;  1AWX A;  2JS2 A;  3UF4 A;  2CSQ A;  4GBQ A;  4RTV A;  2J6O A;  1SEM A;  1SPK A;  2K79 A;  1FMK A;  2MCN A;  1E7O A;  4CC3 A;  3UAT A;  2XMF A;  1AWO A;  4Y92 A;  2CRE A;  4RTU A;  1YWP A;  1ZUU A;  2IIM A;  2X3W D;  2K6D A;  2QDL A;  2SRC A;  1M3A A;  2OI3 A;  3JV3 A;  1QKX A;  2DBK A;  3PVQ A;  1AZG B;  2DM1 A;  3H0H A;  4FSS A;  1M30 A;  2DIL A;  1W70 A;  2J7I A;  1UGV A;  1NM7 A;  1ARK A;  3C0C A;  2AKK A;  1M3C A;  2FPD A;  3EG1 A;  2EYZ A;  4J9E A;  2KE9 A;  1ZUY A;  3M0S A;  1NEG A;  1X6G A;  3LH5 A;  1PKS A;  1UG1 A;  2F2X A;  2EYY A;  1JXO A;  3NHN A;  2LZ6 B;  1QCF A;  1OPL A;  3SHW A;  1GCP A;  1H8K A;  1X69 A;  1K4U S;  1WLP B;  2ESW A;  3NGP A;  2KR3 A;  2RPN A;  3PVL A;  1GCQ A;  3EHQ A;  4Z89 A;  4HVV A;  2JMA A;  1UJ0 A;  4ORZ A;  2LP5 A;  4LUD A;  2RQR A;  2DJQ A;  4HVU A;  1YN8 A;  4F14 A;  1X27 A;  1G2B A;  4F16 A;  2LMJ A;  1JU5 C;  1ZX6 A;  2W0Z A;  2CT3 A;  4JJC A;  2HSP A;  3NMZ C;  1K76 A;  2F2W A;  4HCK A;  1UE9 A;  1B3Q A;  1PRL C;  4J9F A;  1UHC A;  3NPF A;  5L23 A;  1RLP C;  3M0T A;  2KYM A;  2LNH B;  5FWB A;  2EQI A;  1GRI A;  1ZLM A;  4X1V A;  5IH2 A;  2DRM A;  1PKT A;  2LJ0 A;  2NUZ A;  1HD3 A;  1N5Z A;  2DRK A;  1OV3 A;  4KRT A;  1VYV A;  2KXD A;  1K0X A;  2EPD A;  3VS0 A;  1X2Q A;  1M3B A;  4JJB A;  2KRN A;  4WCI A;  3VS4 A;  3H0I A;  1OOT A;  4RTZ A;  2YUQ A;  2O9S A;  5ECA A;  1PWT A;  1CKA A;  2C0I A;  2EGC A;  1GFC A;  1I07 A;  2GGR A;  1UDL A;  1YCS B;  2V1R A;  2D0N A;  2YUP A;  5GJV B;  5FW9 A;  1JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...