2ED1A

Solution structure of the sh3 domain of 130 kda phosphatidylinositol 4,5-biphosphate-dependent arf1 gtpase-activating protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
GSSGSSGNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
publication title Solution structure of the SH3 domain of 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed1A00
1UGVA 2K9GA 2EGEA 3IQLA 2EYWA 3M0SA 3VRZA 1QKXA 1M3CA 1X2KA 2K79A 4LUDA 2PNIA 3KFVA 2E5KA 2YSQA 1X6BA 1M3BA 3U23A 4AG2C 3CQTA 2L2PA 1UTIA 1QCFA 2ABLA 5GJVB 2GQIA 2W10A 3EG1A 2JXBA 2W0ZA 4RUGA 1FYNA 2GGRA 1MV0B 2AZVA 1AZEA 3VS0A 3EG0A 2DBKA 3VS2A 5L23A 1M30A 3NGPA 4E6RA 2K2MA 3ZL7C 1W6XA 4EIKA 4ZNXA 1M3AA 1RUWA 4AFSC 1WXTA 2EGAA 5FWCA 2HDAA 4LNPA 1HSQA 5IH2A 4J9IA 1AOJA 2J7IA 2DX1A 3I5SA 2LQNA 2I0NA 1JEGA 2JT4A 4GLMA 3TSWA 2RQTA 1X43A 1ZUUA 2D1XA 2OJ2A 1B07A 3M0PA 4RTWA 2GNCA 3PE0A 1OPKA 1ZLMA 2AK5A 2YUQA 2DL3A 4M4ZA 4CC7A 2A37A 2P4RA 1RLQC 2VVKA 2EVRA 2L0AA 2HCKA 3R6NA 4IIOA 4RTYA 1GCQC 2RQVA 1KSWA 2DMOA 1GFCA 2LP5A 1GFDA 1SRLA 4HVWA 2OI3A 2DNUA 4R0KA 1AWXA 4ORZA 1NYGA 1I0CA 1K76A 3UA6A 1UUEA 2EBPA 3ULRB 1Z9ZA 4K11A 1SHGA 3I9QA 2NWMA 3I5RA 1EFNA 1QWEA 2EQIA 3REBB 1PKTA 2RQUA 2J05A 1ZBJA 3M0RA 2IIMA 4AFUC 2JW4A 1H8KA 1PKSA 2CDTA 2A08A 3FJ5A 4X1VA 1M27C 1ARKA 2DRKA 2KRNA 4RTUA 2EGCA 1VYTA 5I11A 2KRSA 4KRTA 4OMLA 4CC4B 1AWOA 2LQWA 1T0HA 1FMKA 1JU5C 5ECAA 2KGTA 3EHRA 4HVVA 2EYYA 3VS7A 2DE0X 1BB9A 1ZUKA 2EW3A 4GBQA 3UF4A 1WYXA 2FRWA 1RI9A 2M0YA 2X3XD 4J9CA 2O88A 1UDLA 1G83A 2JMAA 1PRMC 1YNZA 2F2WA 2FPEA 2BZ8A 1PWTA 2X3WD 2YT6A 2KR3A 1GCPA 1OPLA 2BZYA 1TUCA 1MV3A 1NLPC 2CT3A 1WX6A 4RTVA 2MIOA 5GJWB 1SPKA 2F2XA 4IIMA 1W1FA 1H92A 1Y0MA 2K6DA 1H3HA 1X6GA 3UA7A 4Z8AA 1K0SA 1UECA 4JZ3A 2AZSA 2DLPA 4RTZA 1BK2A 1UE9A 2DL5A 2A36A 4Z88A 1E7OA 4J9EA 2ENMA 2K7AA 2QDLA 3NPFA 3REAB 1KJWA 3O5ZA 4OMNA 1OEBA 2JMCA 1YWOA 2RQRA 1WLPB 2YDLA 2MCNA 2CREA 1A0NB 2F2VA 2JM8A 3M0UA 1T3SA 2HBWA 4LE9A 1PHTA 2D8JA 2KE9A 2CUDA 2CH4A 2LZ6B 4LUEA 2DBMA 2FPDA 2RPNA 4CC3A 2DYBA 1WA7A 2LNHB 2D8HA 1AEYA 2J6FA 5IHKA 2VWFA 1CKAA 3VS6A 4J9GA 5HCKA 2RNAA 4WCIA 2KNBB 2CUBA 1UHCA 2KEAA 1E6HA 3M0QA 2CT4A 2MOXA 3VS1A 1SEMA 1WXUA 2V1RA 2GBQA 2KYBA 2LX7A 2AKKA 4Y92A 1I07A 1PRLC 3C0CA 2LJ1A 1ABOA 5IHIA 1JQQA 1GCQA 1V1CA 3JV3A 3NMZC 1OV3A 1VYVA 2J06A 1BU1A 1B3QA 1KIKA 1WI7A 1ZUYA 4J9BA 1AZGB 1U5SA 1UFFA 1G2BA 2KXDA 1WXBA 4F17A 3NHNA 1K4US 2SRCA 1AD5A 3EG3A 1X27A 2L3PA 4F16A 2GTOA 1OOTA 2KT1A 1UHFA 2VKNA 4JJBA 5IXFA 2LJ3A 1E6GA 2ESWA 2YUPA 2DF6A 1T3LA 2DM1A 5EC7A 2V1QA 1NG2A 3PVQA 3SEMA 2HEQA 4A63B 3H0IA 1VA7A 1SHFA 2LCSA 3A98A 1NM7A 4OMMA 2JS0A 2RQWA 2RN8A 2RF0A 2CH4W 1TG0A 2EKHA 4OMOA 2ECZA 1NEBA 4RTTA 1ZSGA 1AWWA 1BBZA 1Y57A 2EYXA 4ESRA 2A28A 3LH5A 1CKBA 3TSZA 1VYUA 4HVUA 2L3SA 2EYZA 3EG2A 1K0XA 2KYMA 4J9DA 2PTKA 1ZX6A 2SEMA 3RBBB 1UJYA 4DEXA 3THKA 4FSSA 1GBRA 4OMPA 4D8DA 1M8MA 1K9AA 1UJ0A 1WFWA 2H8HA 1QWFA 2KRMA 2PZ1A 1I1JA 1QLYA 1W70A 2KT8A 1Z9QA 1SSHA 1GL5A 1JXOA 3RNJA 2RMOA 1YCSB 1YWPA 2O2OA 3PVLA 3QWXX 3VS5A 2FO0A 4QT7A 3TVTA 5FW9A 1U06A 3EGUA 4CC2A 1X2QA 1GRIA 1AVZC 2DJQA 2L3QA 2NUZA 4AFQC 2O9VA 2FPFA 1QKWA 2J6KA 2YUNA 2DRMA 1KFZA 1HD3A 3VS3A 2FRYA 1X69A 4HXJA 4HCKA 2GTJA 1SRMA 1J3TA 4F14A 2FEIA 2OAWA 2O31A 2O9SA 1TUDA 4Z89A 1JXMA 4JPBW 3VRYA 2KBTA 1HJDA 1T0JA 1XOVA 1K1ZA 1NLOC 1RLPC 3H0HA 2YUOA 2C0OA 3VS4A 2DL7A 5FWBA 1PNJA 1UG1A 2C0TA 2HSPA 1LCKA 2LJ0A 2B86A 2C0IA 4RTXA 1NEGA 2J6OA 4AFZC 2G6FX 4DEYA 1S1NA 4J9HA 2LMJA 4AG1C 1MUZA 4JJDA 2M51A 1ABQA 4J9FA 3QWYA 4JZ4A 2DL8A 2EPDA 2XMFA 2JS2A 2BZXA 5IXBA 2ED1A 3M0TA 3UATA 2ROLA 1CSKA 2DILA 5I22A 1WDXA 1AWJA 2DA9A 2JM9A 5IHNA 2ED0A 1NYFA 2CSIA 2DVJA 1IO6A 1U3OA 2DL4A 4JJCA 1YN8A 2AKLA 2K3BA 3SHWA 3H41A 2ROTA 3GBQA 3H0FA 4LN2A 2CSQA 2BTTA 2D0NA 3EHQA 1GBQA 2KROA 4OMQA 2KXCA 1N5ZA 1YP5A 2FG0A 1WIEA 2JTEA 4D8KA 3I35A 1JO8A
chains in the Genus database with same CATH superfamily
1UGVA 4DBRA 2K9GA 3MO8A 2EYWA 4OGEA 2OTJA 2VXEA 1KQ1A 2RK1A 1M3CA 3ZEHA 1RI0A 2PNIA 3CCEA 2DIQA 5KYUB 3OYDA 2PU9B 2YLCA 2VXFA 2XDPA 1I8FA 3EG1A 4C92F 3CC2T 1MV0B 2AZVA 3CXCP 5L23A 2DBKA 3HP9A 4IUVA 3M59A 1UEBA 1WGSA 3ZL7C 2RM4A 4EIKA 1G3TA 2HD0A 2MWOA 2DTOA 1VQPA 2EGAA 5FWCA 4LNPA 3QZ5B 4M7AD 3I5SA 2I0NA 4QQGA 4GLMA 1YBYA 2RQTA 2QQBA 1ZUUA 1KD1C 1WHKA 2D1XA 2ZPIB 1YJNQ 3QIIA 2OAUA 2GNCA 1SKUB 2KK4A 1JJ2P 1YJNA 2LX9A 2LCLA 5IAYA 5DY9A 1PCXA 3UT1A 4CC7A 1UGQB 3G71Q 1M1KC 1YI2Q 2HCKA 2ZZDA 2V8KA 2XICA 2CYZB 2RQVA 2DMOA 2LP5A 2M02A 4HVWA 2DFUA 3J81E 1IXDA 4R0KA 2Y4XA 4O5VA 5LJ5f 5DLOA 1I0CA 2QYZA 1PSEA 4DA4A 3QYHB 5KE3A 2EBPA 1Z9ZA 4E7IA 4XTUA 1D09B 4MMLA 1FMWA 2KVQG 4EMKA 5LJ5g 3QHSA 2PUKB 4M78D 2RHUA 3RERA 3QG1A 2ZPEB 5FU6C 2MI6A 2CDTA 4XU1A 1M27C 3R6OA 1ARKA 4RTUA 4J7FA 3UPUA 1VYTA 2NYSA 4C0DB 3HSBA 2CZ1B 2LQWA 1X75C 3M56A 1FMKA 5GAOl 2YRCA 3OY9A 3HTRA 3I55T 3SD4A 4HVVA 5KYXB 3CCJQ 1UB4A 1BB9A 1ZUKA 2ZPBB 4ZGEB 1PM3A 4KT0E 4XQ3A 1RI9A 4J9CA 3QUIA 4A53A 2QQAA 1YNZA 1JBMA 2BZ8A 3HHTB 1M1KU 1N27A 3EGDA 1RAIB 4M77C 2ZAEA 1IGQA 1YJWA 2PQWA 3OBYA 2BKDN 5GJWB 1SPKA 5GAMj 1D1BA 2QTXA 3SWNC 2E1HA 4J8OA 4BY6C 1WHGA 2K6DA 1H92A 5D6XA 3JCMh 3CC2Q 3G4SA 2V8IA 4Y28E 5GAN6 5CKBA 2VASA 3CEYA 5HY6A 1YFNA 1Q82R 4RTZA 3JCMb 4PJOB 2K3YA 2DTHA 3OMCA 1LJOA 3P8HA 1Q81R 2ZPGB 1IRXA 1GXIE 5J39A 2RB6A 2CREA 4E7ZA 2RD1A 2F2VA 2JM8A 5GAMh 2X4JA 2VGMA 4LE9A 1WZOA 1IZ6A 4OP0A 3GF5A 2FPDA 4CC3A 4M7AE 1I5OB 1U8RA 1WA7A 2RI3A 3JCMP 1R0CB 1TS9A 1CKAA 3QZ9B 5A0LA 1OQKA 4PJMA 1B34A 1QVGS 1VOMA 3OYEA 1BYMA 2KEAA 4RG2A 2CT4A 4KUDK 1NJIR 4A4GA 5LJ3e 2GBQA 2MWPA 1UGPB 2AKKA 1I07A 3CCQT 1PRLC 2LJ1A 2EYQA 5IHIA 2L3RA 4XTXA 2X51A 4M7AG 3JV3A 3NMZC 1I5LA 5KYWA 3J7AF 4LDYA 1U5SA 4PKCC 1G2BA 4OB2B 1YJ9T 5GMKj 2CZ7B 1OYXA 2P0KA 2DVEA 3I56T 4A4KA 4F7UA 1NPRA 5GANd 1O75A 4JRKA 2M16A 2DERA 4F16A 2GFAA 1OOTA 2D9TA 2VKNA 3I55Q 3ASKA 5C6SA 2ESWA 3LLRA 2YUPA 4C5GA 2DF6A 3VV0A 3L2RA 2P0PA 1VQ8T 1IB8A 5A0GA 1VQ5A 4GLKA 3UDCA 3EH2A 3PVQA 4DBQA 1YHQA 1FX7A 3C4SA 3C95A 3H0IA 4BI3A 1VA7A 1QCOA 2JS0A 2RF0A 4RG8A 4VUBA 1TG0A 5GMKh 1BBZA 1BKBA 3RR6A 3A8LB 4M77A 3M53A 4J6XA 2HL3A 4FYXB 1WHJA 3EG2A 4J9DA 2LDMA 2SEMA 3RBBB 1I81A 3RKYA 3SWNA 1N9SA 4DEXA 4PLIA 2WSEE 4OB3B 5CO7A 2DJZA 4M75C 4OF1A 1QWFA 2KRMA 1I1JA 3E9FA 2L89A 3RNJA 2LC4A 4MZPA 4M7AB 3M4YA 3VS5A 2LQ8A 2FO0A 4QT7A 3CMAT 5FW9A 4FCYA 3MP6A 4CC2A 4BDZA 3CPWS 2DJQA 2NUZA 5HKCA 2COYA 3JB9J 1HD3A 3VS3A 3WVEB 1MMNA 1RADB 3VUBA 2Y4YA 2GFUA 4F14A 3MHXA 4NOYA 1TUDA 4HCCA 1JXMA 3VRYA 1VQ9A 1YIJT 3CCQQ 4QVCA 4PJOC 3EGDB 1K1ZA 3H0HA 2DL7A 3CCQA 5FWBA 1PG5B 2VC8A 1QVGP 1LCKA 2FZGB 2DD4A 1WHHA 3MKDA 3OYHA 4J9HA 4JS4A 2LMJA 1MNDA 1MUZA 4JJDA 3FC3A 3DB3A 4M78B 1YJ9Q 4DBFA 3HL8A 5GMKl 3OBWA 4L59A 4A4HA 3I56Q 5IXBA 4M7DD 3CCRT 4M77E 3CXCA 3V8LA 3E9GA 5GMKi 2QASA 4PJNA 4BB7A 2DA9A 2M9UA 2YLBA 4E7HA 1QVFP 5GANj 3S6WA 2E12A 1IO6A 4JJCA 1QVPA 1VQ8Q 4YTLA 4M75D 1OZ3A 3PFSA 3GBQA 4ANJA 1MHNA 4LN2A 3MEUA 3EHQA 4J5YA 2KY9A 5LJ3g 1KC8U 1BI2A 4M77G 1D1AA 2FG0A 1EIFA 5KH6A 1JJ2A 2OTJT 2GQVA 2E70A 2EGEA 3IQLA 3CCET 1QKXA 2K79A 2K57A 2YRDA 3KFVA 2MAMA 4FYWB 1Q82C 3U23A 4AG2C 2VYTA 5GANh 3QXEB 3OA6A 2MF2A 2XG8D 1Q81C 3EG0A 3JB9I 1M30A 5KYWB 3S3MA 4IUQA 3V8JA 3NGPA 4E6RA 1OZ2A 2IVWA 3KBGA 1VQPT 4ZNXA 1VQOA 3D7SB 1RUWA 4AFSC 3CMAQ 4RKUE 5C0MA 5KYXA 3OYLA 2D0QB 4C5HA 2JTMA 3OS2A 2LQNA 5GAOn 3TSWA 4J7IA 5FU6B 1MGQA 3CCVT 1X43A 5A2QE 4RTWA 3M0PA 1ZQ1A 5KYNA 4PNOA 2QEXT 3CPWP 1NJIC 4F7UF 3OSVA 3LGLA 5AYFA 1QQJA 1JRIA 4M4ZA 3BW1A 1YIJQ 3L2UA 2EVRA 4C0FA 3R6NA 2CGHA 4IIOA 3S3NA 3OYGA 1OX9A 4OGCA 3QSUA 3MEWA 1KK7A 2VUBA 2DNUA 4ORZA 3FJPA 1NYGA 4PJOA 1R0BG 2FVUA 4JDSA 1K76A 5KCOA 2YWWA 1UUEA 1S72T 2DKGA 1K9MU 3L2ZA 2KQWA 4ELYC 3I9QA 2NWMA 4BY6B 3QJ6A 3CCRQ 3REBB 4N4HA 5CK9A 3CCRA 1KQSP 3VYGA 1ZBJA 2C06A 2K4YA 2DRKA 2EGCA 5I11A 2JZ2A 2JTFA 4KRTA 4OMLA 4XK8E 1LOJA 2P4TA 2F5TX 4FYYB 5ECAA 3RMSA 1ZBXA 2HQHA 2K5FA 3EHRA 3X24B 4QVDA 2EW3A 4GBQA 2WACA 4CI0C 2FZCB 2O88A 3PMIA 4BDYA 4ATOA 2JMAA 6AT1B 2F2WA 3L42A 3BE3A 4M75E 1XNIA 2YT6A 2OTJQ 2KR3A 5CCAA 3CCMA 1YJWT 1RAGB 3QDFA 4M78C 3OQ5A 3CCEQ 2AT1B 1MV3A 2KMTA 4EMGA 1W2BP 1KG1A 1WX6A 4RTVA 4M7DG 4BE1A 2IG0A 1K73U 1W1FA 3G4ST 1Y0MA 1X6GA 5CR2A 3UA7A 1RAEB 1RACB 2EFIA 1K0SA 1UECA 4JZ3A 4A4EA 1IREB 1XQHA 2DLPA 4M75G 2RHXA 1YITT 3JCMf 2CP3A 1UE9A 2DL5A 3OYBA 1E7OA 2XD0A 4D6WA 1VQPQ 2ENMA 1WHLA 3SFMA 3PTAA 3JCMg 3NPFA 3BDLA 3REAB 4ZTFA 1KJWA 4OMNA 5LJ5d 1BIBA 4PJOE 3DKMA 1OEBA 2JMCA 1K8AU 2D6FA 1OI1A 2AIRB 2QDYB 2RQRA 1WLPB 3CCVQ 3M0UA 3CCVA 1WJSA 2HBWA 2KE9A 2V26A 2CP0A 2QEXQ 2DK3A 2RPNA 5GAMf 2QEXA 3FDRA 2D8HA 3HPWA 2DZ9A 3VKIA 5HCKA 4MDXA 4WCIA 2CUBA 2KNBB 4BD3A 4PJOG 5GAMg 2JJ9A 3M0QA 5I2MA 2MOXA 3V7RA 1WHMA 2V1RA 3HKSA 3JB9D 3C0CA 1TH7A 1BI1A 2DEQA 2QI2A 5J26A 1S72Q 3OYFA 2XHCA 3EAEA 1S72A 2FB7A 3CBMA 2LTOA 1I4K1 1KIKA 1WI7A 1ZUYA 3H8ZA 3H6ZA 3JB9H 4IKFA 4M7AA 4M7DB 1WXBA 4KBMB 3OYAA 2R57A 1B7TA 2X9HA 2HNIA 4RCCA 3BDUA 1K4US 4LD9K 2SRCA 3EG3A 3TU4K 3O8VA 4QVZA 2X4WA 3L1AA 2KT1A 1UHFA 3OYIA 4M75B 1PD1A 1E6GA 3KUFA 1KD1U 3A5ZB 2F1LA 2RJFA 1EZZB 1VQ5T 5GAN4 5KCHA 1YHQT 3HFNA 2QTVA 2GF7A 3M9QA 1G5VA 1YJWQ 2LNVA 3E2UA 3E19A 4PJLA 3GOXA 3OW2S 3CC7T 2RN8A 1PSFA 4JRIA 3LX7A 4XU3A 3OSSC 4RTTA 3PIPA 2E41A 3G4SQ 2CP2A 2JVVA 2EQJA 4M78A 1CKBA 4HVUA 1N8RR 2L3SA 2LT4A 3MJXA 2KYMA 3QDRB 1M2OA 1YITQ 1QVGA 1UJYA 1YITA 1V76A 5CKFA 4X34A 4D8DA 1M8MA 3X20B 1H3ZA 1ZSZB 3EFRA 4V2SA 1K9AA 1UJ0A 3MEAA 1QLYA 2RHYA 1QP2A 4ELZC 4PJOF 3F70A 3PVLA 4XTZA 1U06A 3OB9A 4QQ6A 2A3LA 2L3QA 4AFQC 2NLUA 3OYNA 2O9VA 4HA8A 1OULA 2DRMA 2CKKA 1QVFA 2JOYA 2CP5A 4HXJA 2K5LA 5FLXE 1J3TA 3CBPA 5HK0A 2OAWA 4BI8B 4C92C 1VQ9T 2O31A 2XI9A 5DLQE 1VQKA 1G3WA 4TVRA 1NLOC 4FSXA 3CD6T 2X35A 3QYGB 4EPCA 2QA4A 2A7YA 2H3JA 2B86A 2C0IA 2QQRA 2PVGB 4RTXA 5CKEA 3SDZA 4AFZC 3L2VA 2G6FX 3TREA 2JUFA 2LQKA 4ZTJA 2WSFE 2DL8A 1BI0A 4KGZB 3M0TA 4M78E 2ROLA 2AHJB 2P84A 3J80E 4LD6A 3JRZA 2HQEA 3CCSA 2JM9A 2ED0A 1VQ5Q 3EG9B 1NYFA 3GNGA 3A1PA 1Y96B 1YN8A 3M4GA 1PC0A 1YHQQ 2XIDA 2K3BA 3SHWA 3AT1B 3JB9G 4C8QD 2NUTB 1R77A 4XU0A 4ZGDB 1GBQA 1G3YA 3LH0A 3CC7Q 5CAIA 1N5ZA 2OTLT 4M78G 3CC7A 3M57A 2ZCFB 3OS0A 2QG9B 2KI7A 1WIEA 2EQKA 4D8KA 4GY5A 2LCCA 3CPWA 4J9BA 4M7DC 3M0SA 3VRZA 3NFCA 3ZBDA 3FIFA 2F5KA 2VGNA 1SF9A 3OW2P 3VYHB 1Y07A 2YSQA 5LL6S 5IT9E 1FWZA 3OS5A 1M3BA 5I21A 4MDWA 1UTIA 4FW2A 2RHZA 4C92D 2CS7A 2KAFA 4PLLA 4DOWA 3PMTA 2W0ZA 2XK0A 1FYNA 2GGRA 3N5BB 1TXQA 3VS0A 5GANf 4II1A 1VQOT 1ZA2B 4BE2A 3QPHA 1M3AA 5D6WA 1WXTA 2IPOB 3DLLA 5GAN5 1KQSA 2A0FB 4J9IA 4E7JA 1AOJA 3BY7A 1M9SA 1JEGA 4JLIA 4M7AF 2MYSA 2JN0A 4JRPA 3GIBA 1FMVA 3PE0A 1OPKA 1VQ9Q 2AK5A 3EFOB 5KE2A 2YUQA 2DL3A 2K2VA 2A37A 1ZA1B 2LVMA 3CD6Q 5LJ3d 4BE0A 1ZSZC 3TQ7P 4RTYA 3CD6A 5GAN8 5CQYA 5GAOq 4J83A 1GFCA 1SRLA 2KSSA 1TTHB 1AWXA 1W2BA 2YXYA 3RKWA 2L5QA 1QCNA 3LW5E 1SHGA 4K11A 1M90R 3FLGA 3QO3A 3I5RA 2YHTA 1PKTA 4M78F 2K5IA 2J05A 1OX8A 2A08A 4X1VA 3TEEA 4LDVA 1ACMB 3OYCA 2M0OA 1D3BA 3KXTA 3JCMe 2KRSA 4HCZA 4CC4B 1AWOA 1U1TA 4R56A 4PK4A 2R5MA 4EMHA 3CPFA 3VS7A 2I2LA 4J6WA 2R5AA 2M0YA 2OTLQ 1UDLA 1G83A 2OTLA 3CCMT 5FROA 1OPLA 4LDWA 2BZYA 3MP8A 2E64A 4C5EA 1N8RC 1NLPC 5GAMe 2MIOA 2ZGWA 5GAN2 1N6AA 3RDVA 4NL3A 4M7DA 2QQSA 3CXCS 2EQUA 1VQOQ 4UC4A 1BCMA 4C8QG 2XU8A 4B9WA 4J9EA 1VQNT 3G6EA 2PVDB 4XU2A 3X26B 2K7AA 1NZ9A 4M75A 2QDLA 3O5ZA 2COWA 1YWOA 1SG5A 1YCYA 3JSCA 2RI5A 1MMAA 4QKUA 2YDLA 4DOVA 2B8AA 4JUVA 3OYJA 5GAOm 1JB0E 1T3SA 4ZN1A 1PHTA 2D8JA 2CH4A 4PFZA 2LZ6B 5CKHA 4LUEA 2DBMA 3JCMV 2DTIA 2RK2A 4C92G 1AEYA 2J6FA 3TCJA 2MPXC 3VS6A 4J9GA 1MMDA 2RNAA 1M1GA 1E6HA 2FZKB 2QXFA 2RJCA 3INZA 4C5IA 1WXUA 1D1CA 2P0QA 1UGSB 1N8RU 2PUOB 5AT1B 5LJ3j 2LX7A 1BCOA 1Q82U 1X6OA 4Y92A 3T9NA 1IHWA 1ABOA 2HQXA 2V8JA 1ZSZA 2MK5A 4DQ2A 1Q81U 1V1CA 2RHIA 3OS1A 1OV3A 1VYVA 1D0YA 2J06A 3JCMc 3OYMA 1BU1A 1M8VA 3EH1A 4M77F 1AZGB 1UFFA 5GMKe 4N4GA 4F17A 3NHNA 1Y71A 1AD5A 1X27A 4M7DE 5GAN3 4BUGA 3HFOA 4JJBA 2DIGA 5KYYA 2E65A 1C6VX 2LJ3A 5LJ3h 3MP1A 4CRIA 3V7SA 4C8QB 4XTWA 5FRNA 1NJIU 2E6NA 3CCMQ 1NG2A 3SEMA 1Q86R 1H641 2BE7D 4FM4B 3GLXA 3JCMQ 2LCSA 3A98A 1NM7A 1LPLA 2F69A 2QK0A 4QQDA 2DXUA 2CH4W 2EKHA 1N9RA 4OMOA 4RCBA 4N0AC 1NEBA 2CP7A 1ZSGA 1AWWA 1Y57A 4RMOA 3NTKA 4ESRA 5EG2A 4KULA 5GAMd 2A28A 3LH5A 4C92B 3TSZA 3CMET 1VYUA 2EYZA 1K0XA 2PTKA 2EAYA 2MMPA 3UWNA 3OMGA 2EJFA 3M55A 3THKA 1D0ZA 4FSSA 4OMPA 1VQNQ 4R55A 1VQNA 2H8HA 1M2VB 2PZ1A 1Q95G 1W70A 3EG9A 2KT8A 2HAXA 1SSHA 1GL5A 2ATCB 1Y96A 3CCUT 2RMOA 1VQ7T 1YWPA 2R58A 2NUTA 3TVTA 3GPLA 3P8DA 1D3BB 2E4HA 1AVZC 3AHUA 5M9OA 4AT1B 1QKWA 2J6KA 2YUNA 3QJYA 1KFZA 3VJPA 3JCMX 1X69A 1WNLA 2GTJA 1FXXA 2FEIA 3QKJA 1VQKT 2O9SA 4Z89A 7AT1B 3M54A 4JPBW 2DYIA 4PJJA 3M58A 5GAOp 4XAXB 2QA4T 1RLPC 2YUOA 1KHIA 3G71A 1KC8R 1VQ6T 3META 2C0TA 3JCMW 1YI2A 2HSPA 2E3HA 3C94A 1NEGA 2J6OA 3X28B 5L8RE 1M90C 2KDSA 5CKDA 2BIVA 2EQMA 2EJ9A 3OW2A 4AG1C 4KH1B 2M51A 2DD5A 2ZPHB 1C0MA 4J9FA 2EPDA 2FYKA 1AHJB 2BZXA 1VUBA 2ED1A 3UATA 4XTYA 2QGFB 1CSKA 4C0ZA 2DILA 3CCST 1W4SA 5J3BA 4M7DF 3MEVA 4JS5A 1WJQA 2CZ6B 1AWJA 5IHNA 5GANe 5IN1A 2DEUA 3BFMA 3PT9A 3JAME 1M5Q1 1C1AA 3L2QA 2DL4A 2DXTA 2ZPFB 2AKLA 3EFOA 3H41A 2DXBA 1G8XA 5FU7C 4M75F 2KROA 3CCJA 4JRQA 2KXCA 3M5AA 4E7KA 1YP5A 2RJEA 1NBEB 4LXCA 3HRUA 1U1SA 2NUPB 2JTEA 4FL6A 4KGXB 1R8OB 1JO8A 3DLMA 4OB0B 2HKQB 1SSFA 1PD0A 3CMEQ 2XDBA 3RKXA 1X2KA 2COZA 4LUDA 3CMEA 2E5KA 4N0AA 5HK3A 4FW1A 1X6BA 3CQTA 2L2PA 3URGA 1QCFA 1M90U 2ABLA 2HBPA 4N4IA 2LT1A 5GJVB 2GQIA 2W10A 2JXBA 2H3EB 3LWHA 4OB1B 2BE9B 4RUGA 1AZEA 4C8QC 3VS2A 3CC2A 3C12A 3HRTA 1M4ZA 4X9DA 2K2MA 4WF2A 1W6XA 5GMKm 3CCUQ 4HT8A 4C0GA 1VQ7Q 1DJ7B 3SB2A 3CCUA 5LJ5j 1VQ7A 1K9MR 3Q1JA 3RIRA 8AT1B 4PFPA 3PNWC 4XTVA 2HDAA 1QMCA 1HSQA 5IH2A 2J7IA 3VUZA 2DX1A 2M1HA 4KUIA 2JT4A 2X4YA 2HL5C 5KYYB 4OVAA 2OJ2A 1WQWA 1B07A 1KQ2A 3RESA 1ZLMA 2PVOB 1VQKQ 1Q7YR 2Y90A 3JCMJ 3E1SA 2HZYA 3PIOA 2P4RA 1RLQC 2VVKA 3LYIA 2QA4Q 2L0AA 3X25B 3G1JA 3RUXA 3LGFA 1VQ6Q 2VB6A 5CVIA 1GCQC 5LJ5h 1VQ6A 1KSWA 1GFDA 4F04B 2DXCA 2OI3A 4LDXA 3L2WA 3UA6A 3ULRB 4OMFB 3OYKA 1K73R 4M77D 1EFNA 1QWEA 2EQIA 3ME9A 3EFSA 2RQUA 3CCSQ 1VQ4T 4AFUC 3M0RA 2IIMA 2JW4A 1H8KA 1PKSA 4PL6A 3FJ5A 2KRNA 1XTDA 1QVFS 2YRVA 1T0HA 1RABB 1JU5C 4X9CA 3H9NA 1Q86C 3LWIA 2X4XA 2RH2A 4IURA 2KGTA 4Y91A 2EYYA 2DE0X 2DETA 4MMKA 3UF4A 3I55A 1WYXA 1K8AR 2FRWA 2X3XD 4P5NA 4JJNK 1TU0B 3FRNA 1PRMC 1MMGA 2FPEA 1PWTA 2X3WD 1GCPA 4KGVB 1TUCA 2O01E 5I2SA 2CT3A 1IGUA 2F2XA 2FHDA 4IIMA 4Q5WA 1H3HA 2O4XA 2QQ9A 4L6V5 3QBYA 4Z8AA 1RAAB 3ZFJA 2AZSA 4HT9A 2RA2A 1TOVA 4C0DC 3G6ET 1BK2A 3EGXA 4O6JA 2A36A 4Z88A 5GANg 3CCLT 3V8KA 4C8QA 1QP3A 4NS5A 4EMKB 3S3OA 1TSFA 4BI4A 3ER0A 2MCNA 4A54A 1A0NB 1Q86U 4HKEA 2CUDA 3MPUB 2EIFA 2DYBA 2LNHB 5GAOr 5IHKA 4E47A 2VWFA 1LNXA 3CC4T 1MNEA 1AT1B 2E10A 1KD1R 1KC8C 1UHCA 4C92A 4F7UE 3VS1A 2DZCA 1SEMA 2BUDA 1V29B 4ME7A 2KYBA 1M1KR 2DAQA 5KYUA 2OX7A 1RAFB 3CBOA 4DBHA 2E6ZA 2VV5A 3JB9F 1X01A 1JQQA 4MZMA 1GCQA 1ZHIA 1BIAA 1M2VA 1NPPA 3V7CA 1B3QA 1WJRA 1KQSS 2RO0A 1O9SA 9ATCB 1VQ4Q 2KXDA 3RMQA 4F7UG 1EX4A 1VQMT 1TUGB 1VQ4A 4NL2A 4IUTA 3OYYA 4B6MA 3GNFB 5DM7R 1YJ9A 1XJWB 2RI2A 1P92A 2XDDA 5D6YA 8ATCB 2HSEB 5A0DA 3I56A 3A8GB 2L3PA 2GTOA 2K3XA 2G3RA 5IXFA 4E7SA 1KHCA 1T3LA 1VQLT 1F1BB 4QW2A 5FRMA 2DM1A 5EC7A 5LJ3f 2V1QA 2HEQA 4HCBA 4C8QE 1VQ8A 3DB4A 1OU9A 4A63B 1HXDA 1SHFA 2DO3A 4OMMA 2Z0WA 2RQWA 1W2BS 3MCAB 1UGRB 2ECZA 3PGGA 1B34B 2EYXA 2EJGA 1HK9A 4IUPA 2QAZA 2HMAA 4WTOB 4FT4A 1BI3A 1ZX6A 3G6EQ 2E5QA 1M1FA 4C92E 1GBRA 2HKNA 1RAHB 1K9MC 1IHVA 4Z02A 3HRSA 1RL2A 1WFWA 2LRQA 3CCLQ 3FEOA 4KH0B 4EDUA 3CCLA 4PJOD 1Z9QA 1JXOA 2E3IA 1VIEA 1YCSB 2DPPB 5LJ5e 2O2OA 3QWXX 4FYVB 3EGUA 1X2QA 1GRIA 1JJ2S 1WPYA 3CMAA 1HYOA 5GAN7 4FU6A 2FPFA 1Q7YC 4F7UB 4J6YA 4FIBA 5D7UA 4E2FB 2NUPA 4FT2A 4ZN3A 2FRYA 3CC4Q 3WVDB 2EKOA 2QGGA 4HCKA 3CC4A 1YJNT 1G3SA 1NE8A 1SRMA 4IUUA 1VIFA 4ZGJB 5CQXA 3WXMB 4AMCA 2KBTA 5FU7B 3G71T 1HJDA 1T0JA 1YI2T 1XOVA 2XKOC 2C0OA 3VS4A 4LDUA 1YIJA 1PNJA 1UG1A 3GP8A 2WSCE 4A4FA 2LJ0A 2CZ0B 4JLGA 4E7LA 4EMKC 1K73C 2GCXA 3A8HB 3FB9A 4DEYA 1S1NA 1TWBA 2O4XB 4MZTA 1ABQA 4M7AC 4M77B 4BACA 2RJDA 1VQMQ 3QWYA 4JZ4A 3NTHA 2XMFA 1VQMA 2JS2A 3EGXB 3SWNB 2CP6A 3A8MB 1WQ7A 3G7ZA 5I22A 3JCMd 1WDXA 1D0XA 1QW1A 4B9XA 2DVJA 2CSIA 1K8AC 1VQLQ 1U3OA 3A8OB 1VQLA 3P8BB 2ROTA 4PFOA 1Q7YU 3H0FA 1Y7XA 3NTIA 3CCJT 4L5GA 2CSQA 4C8QF 2BTTA 2D0NA 2JNGA 3VU3C 4OMQA 2L8DA 2EWNA 5CIUA 1OU8A 1LVKA 2FL7A 3I35A
chains in the Genus database with same CATH topology
1UGVA 2K9GA 2EGEA 3IQLA 2EYWA 3M0SA 3VRZA 1QKXA 1M3CA 1X2KA 2K79A 4LUDA 2PNIA 3KFVA 2E5KA 2YSQA 1X6BA 1M3BA 3U23A 4AG2C 3CQTA 2L2PA 1UTIA 1QCFA 2ABLA 5GJVB 2GQIA 2W10A 3EG1A 2JXBA 2W0ZA 4RUGA 1FYNA 2GGRA 1MV0B 2AZVA 1AZEA 3VS0A 3EG0A 2DBKA 3VS2A 5L23A 1M30A 3NGPA 4E6RA 2K2MA 3ZL7C 1W6XA 4EIKA 4ZNXA 1M3AA 1RUWA 4AFSC 1WXTA 2EGAA 5FWCA 2HDAA 4LNPA 1HSQA 5IH2A 4J9IA 1AOJA 2J7IA 2DX1A 3I5SA 2LQNA 2I0NA 1JEGA 2JT4A 4GLMA 3TSWA 2RQTA 1X43A 1ZUUA 2D1XA 2OJ2A 1B07A 3M0PA 4RTWA 2GNCA 3PE0A 1OPKA 1ZLMA 2AK5A 2YUQA 2DL3A 4M4ZA 4CC7A 2A37A 2P4RA 1RLQC 2VVKA 2EVRA 2L0AA 2HCKA 3R6NA 4IIOA 4RTYA 1GCQC 2RQVA 1KSWA 2DMOA 1GFCA 2LP5A 1GFDA 1SRLA 4HVWA 2OI3A 2DNUA 4R0KA 1AWXA 4ORZA 1NYGA 1I0CA 1K76A 3UA6A 1UUEA 2EBPA 3ULRB 1Z9ZA 4K11A 1SHGA 3I9QA 2NWMA 3I5RA 1EFNA 1QWEA 2EQIA 3REBB 1PKTA 2RQUA 2J05A 1ZBJA 3M0RA 2IIMA 4AFUC 2JW4A 1H8KA 1PKSA 2CDTA 2A08A 3FJ5A 4X1VA 1M27C 1ARKA 2DRKA 2KRNA 4RTUA 2EGCA 1VYTA 5I11A 2KRSA 4KRTA 4OMLA 4CC4B 1AWOA 2LQWA 1T0HA 1FMKA 1JU5C 5ECAA 2KGTA 3EHRA 4HVVA 2EYYA 3VS7A 2DE0X 1BB9A 1ZUKA 2EW3A 4GBQA 3UF4A 1WYXA 2FRWA 1RI9A 2M0YA 2X3XD 4J9CA 2O88A 1UDLA 1G83A 2JMAA 1PRMC 1YNZA 2F2WA 2FPEA 2BZ8A 1PWTA 2X3WD 2YT6A 2KR3A 1GCPA 1OPLA 2BZYA 1TUCA 1MV3A 1NLPC 2CT3A 1WX6A 4RTVA 2MIOA 5GJWB 1SPKA 2F2XA 4IIMA 1W1FA 1H92A 1Y0MA 2K6DA 1H3HA 1X6GA 3UA7A 4Z8AA 1K0SA 1UECA 4JZ3A 2AZSA 2DLPA 4RTZA 1BK2A 1UE9A 2DL5A 2A36A 4Z88A 1E7OA 4J9EA 2ENMA 2K7AA 2QDLA 3NPFA 3REAB 1KJWA 3O5ZA 4OMNA 1OEBA 2JMCA 1YWOA 2RQRA 1WLPB 2YDLA 2MCNA 2CREA 1A0NB 2F2VA 2JM8A 3M0UA 1T3SA 2HBWA 4LE9A 1PHTA 2D8JA 2KE9A 2CUDA 2CH4A 2LZ6B 4LUEA 2DBMA 2FPDA 2RPNA 4CC3A 2DYBA 1WA7A 2LNHB 2D8HA 1AEYA 2J6FA 5IHKA 2VWFA 1CKAA 3VS6A 4J9GA 5HCKA 2RNAA 4WCIA 2KNBB 2CUBA 1UHCA 2KEAA 1E6HA 3M0QA 2CT4A 2MOXA 3VS1A 1SEMA 1WXUA 2V1RA 2GBQA 2KYBA 2LX7A 2AKKA 4Y92A 1I07A 1PRLC 3C0CA 2LJ1A 1ABOA 5IHIA 1JQQA 1GCQA 1V1CA 3JV3A 3NMZC 1OV3A 1VYVA 2J06A 1BU1A 1B3QA 1KIKA 1WI7A 1ZUYA 4J9BA 1AZGB 1U5SA 1UFFA 1G2BA 2KXDA 1WXBA 4F17A 3NHNA 1K4US 2SRCA 1AD5A 3EG3A 1X27A 2L3PA 4F16A 2GTOA 1OOTA 2KT1A 1UHFA 2VKNA 4JJBA 5IXFA 2LJ3A 1E6GA 2ESWA 2YUPA 2DF6A 1T3LA 2DM1A 5EC7A 2V1QA 1NG2A 3PVQA 3SEMA 2HEQA 4A63B 3H0IA 1VA7A 1SHFA 2LCSA 3A98A 1NM7A 4OMMA 2JS0A 2RQWA 2RN8A 2RF0A 2CH4W 1TG0A 2EKHA 4OMOA 2ECZA 1NEBA 4RTTA 1ZSGA 1AWWA 1BBZA 1Y57A 2EYXA 4ESRA 2A28A 3LH5A 1CKBA 3TSZA 1VYUA 4HVUA 2L3SA 2EYZA 3EG2A 1K0XA 2KYMA 4J9DA 2PTKA 1ZX6A 2SEMA 3RBBB 1UJYA 4DEXA 3THKA 4FSSA 1GBRA 4OMPA 4D8DA 1M8MA 1K9AA 1UJ0A 1WFWA 2H8HA 1QWFA 2KRMA 2PZ1A 1I1JA 1QLYA 1W70A 2KT8A 1Z9QA 1SSHA 1GL5A 1JXOA 3RNJA 2RMOA 1YCSB 1YWPA 2O2OA 3PVLA 3QWXX 3VS5A 2FO0A 4QT7A 3TVTA 5FW9A 1U06A 3EGUA 4CC2A 1X2QA 1GRIA 1AVZC 2DJQA 2L3QA 2NUZA 4AFQC 2O9VA 2FPFA 1QKWA 2J6KA 2YUNA 2DRMA 1KFZA 1HD3A 3VS3A 2FRYA 1X69A 4HXJA 4HCKA 2GTJA 1SRMA 1J3TA 4F14A 2FEIA 2OAWA 2O31A 2O9SA 1TUDA 4Z89A 1JXMA 4JPBW 3VRYA 2KBTA 1HJDA 1T0JA 1XOVA 1K1ZA 1NLOC 1RLPC 3H0HA 2YUOA 2C0OA 3VS4A 2DL7A 5FWBA 1PNJA 1UG1A 2C0TA 2HSPA 1LCKA 2LJ0A 2B86A 2C0IA 4RTXA 1NEGA 2J6OA 4AFZC 2G6FX 4DEYA 1S1NA 4J9HA 2LMJA 4AG1C 1MUZA 4JJDA 2M51A 1ABQA 4J9FA 3QWYA 4JZ4A 2DL8A 2EPDA 2XMFA 2JS2A 2BZXA 5IXBA 2ED1A 3M0TA 3UATA 2ROLA 1CSKA 2DILA 5I22A 1WDXA 1AWJA 2DA9A 2JM9A 5IHNA 2ED0A 1NYFA 2CSIA 2DVJA 1IO6A 1U3OA 2DL4A 4JJCA 1YN8A 2AKLA 2K3BA 3SHWA 3H41A 2ROTA 3GBQA 3H0FA 4LN2A 2CSQA 2BTTA 2D0NA 3EHQA 1GBQA 2KROA 4OMQA 2KXCA 1N5ZA 1YP5A 2FG0A 1WIEA 2JTEA 4D8KA 3I35A 1JO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGV A;  2K9G A;  2EGE A;  3IQL A;  2EYW A;  3M0S A;  3VRZ A;  1QKX A;  1M3C A;  1X2K A;  2K79 A;  4LUD A;  2PNI A;  3KFV A;  2E5K A;  2YSQ A;  1X6B A;  1M3B A;  3U23 A;  4AG2 C;  3CQT A;  2L2P A;  1UTI A;  1QCF A;  2ABL A;  5GJV B;  2GQI A;  2W10 A;  3EG1 A;  2JXB A;  2W0Z A;  4RUG A;  1FYN A;  2GGR A;  1MV0 B;  2AZV A;  1AZE A;  3VS0 A;  3EG0 A;  2DBK A;  3VS2 A;  5L23 A;  1M30 A;  3NGP A;  4E6R A;  2K2M A;  3ZL7 C;  1W6X A;  4EIK A;  4ZNX A;  1M3A A;  1RUW A;  4AFS C;  1WXT A;  2EGA A;  5FWC A;  2HDA A;  4LNP A;  1HSQ A;  5IH2 A;  4J9I A;  1AOJ A;  2J7I A;  2DX1 A;  3I5S A;  2LQN A;  2I0N A;  1JEG A;  2JT4 A;  4GLM A;  3TSW A;  2RQT A;  1X43 A;  1ZUU A;  2D1X A;  2OJ2 A;  1B07 A;  3M0P A;  4RTW A;  2GNC A;  3PE0 A;  1OPK A;  1ZLM A;  2AK5 A;  2YUQ A;  2DL3 A;  4M4Z A;  4CC7 A;  2A37 A;  2P4R A;  1RLQ C;  2VVK A;  2EVR A;  2L0A A;  2HCK A;  3R6N A;  4IIO A;  4RTY A;  1GCQ C;  2RQV A;  1KSW A;  2DMO A;  1GFC A;  2LP5 A;  1GFD A;  1SRL A;  4HVW A;  2OI3 A;  2DNU A;  4R0K A;  1AWX A;  4ORZ A;  1NYG A;  1I0C A;  1K76 A;  3UA6 A;  1UUE A;  2EBP A;  3ULR B;  1Z9Z A;  4K11 A;  1SHG A;  3I9Q A;  2NWM A;  3I5R A;  1EFN A;  1QWE A;  2EQI A;  3REB B;  1PKT A;  2RQU A;  2J05 A;  1ZBJ A;  3M0R A;  2IIM A;  4AFU C;  2JW4 A;  1H8K A;  1PKS A;  2CDT A;  2A08 A;  3FJ5 A;  4X1V A;  1M27 C;  1ARK A;  2DRK A;  2KRN A;  4RTU A;  2EGC A;  1VYT A;  5I11 A;  2KRS A;  4KRT A;  4OML A;  4CC4 B;  1AWO A;  2LQW A;  1T0H A;  1FMK A;  1JU5 C;  5ECA A;  2KGT A;  3EHR A;  4HVV A;  2EYY A;  3VS7 A;  2DE0 X;  1BB9 A;  1ZUK A;  2EW3 A;  4GBQ A;  3UF4 A;  1WYX A;  2FRW A;  1RI9 A;  2M0Y A;  2X3X D;  4J9C A;  2O88 A;  1UDL A;  1G83 A;  2JMA A;  1PRM C;  1YNZ A;  2F2W A;  2FPE A;  2BZ8 A;  1PWT A;  2X3W D;  2YT6 A;  2KR3 A;  1GCP A;  1OPL A;  2BZY A;  1TUC A;  1MV3 A;  1NLP C;  2CT3 A;  1WX6 A;  4RTV A;  2MIO A;  5GJW B;  1SPK A;  2F2X A;  4IIM A;  1W1F A;  1H92 A;  1Y0M A;  2K6D A;  1H3H A;  1X6G A;  3UA7 A;  4Z8A A;  1K0S A;  1UEC A;  4JZ3 A;  2AZS A;  2DLP A;  4RTZ A;  1BK2 A;  1UE9 A;  2DL5 A;  2A36 A;  4Z88 A;  1E7O A;  4J9E A;  2ENM A;  2K7A A;  2QDL A;  3NPF A;  3REA B;  1KJW A;  3O5Z A;  4OMN A;  1OEB A;  2JMC A;  1YWO A;  2RQR A;  1WLP B;  2YDL A;  2MCN A;  2CRE A;  1A0N B;  2F2V A;  2JM8 A;  3M0U A;  1T3S A;  2HBW A;  4LE9 A;  1PHT A;  2D8J A;  2KE9 A;  2CUD A;  2CH4 A;  2LZ6 B;  4LUE A;  2DBM A;  2FPD A;  2RPN A;  4CC3 A;  2DYB A;  1WA7 A;  2LNH B;  2D8H A;  1AEY A;  2J6F A;  5IHK A;  2VWF A;  1CKA A;  3VS6 A;  4J9G A;  5HCK A;  2RNA A;  4WCI A;  2KNB B;  2CUB A;  1UHC A;  2KEA A;  1E6H A;  3M0Q A;  2CT4 A;  2MOX A;  3VS1 A;  1SEM A;  1WXU A;  2V1R A;  2GBQ A;  2KYB A;  2LX7 A;  2AKK A;  4Y92 A;  1I07 A;  1PRL C;  3C0C A;  2LJ1 A;  1ABO A;  5IHI A;  1JQQ A;  1GCQ A;  1V1C A;  3JV3 A;  3NMZ C;  1OV3 A;  1VYV A;  2J06 A;  1BU1 A;  1B3Q A;  1KIK A;  1WI7 A;  1ZUY A;  4J9B A;  1AZG B;  1U5S A;  1UFF A;  1G2B A;  2KXD A;  1WXB A;  4F17 A;  3NHN A;  1K4U S;  2SRC A;  1AD5 A;  3EG3 A;  1X27 A;  2L3P A;  4F16 A;  2GTO A;  1OOT A;  2KT1 A;  1UHF A;  2VKN A;  4JJB A;  5IXF A;  2LJ3 A;  1E6G A;  2ESW A;  2YUP A;  2DF6 A;  1T3L A;  2DM1 A;  5EC7 A;  2V1Q A;  1NG2 A;  3PVQ A;  3SEM A;  2HEQ A;  4A63 B;  3H0I A;  1VA7 A;  1SHF A;  2LCS A;  3A98 A;  1NM7 A;  4OMM A;  2JS0 A;  2RQW A;  2RN8 A;  2RF0 A;  2CH4 W;  1TG0 A;  2EKH A;  4OMO A;  2ECZ A;  1NEB A;  4RTT A;  1ZSG A;  1AWW A;  1BBZ A;  1Y57 A;  2EYX A;  4ESR A;  2A28 A;  3LH5 A;  1CKB A;  3TSZ A;  1VYU A;  4HVU A;  2L3S A;  2EYZ A;  3EG2 A;  1K0X A;  2KYM A;  4J9D A;  2PTK A;  1ZX6 A;  2SEM A;  3RBB B;  1UJY A;  4DEX A;  3THK A;  4FSS A;  1GBR A;  4OMP A;  4D8D A;  1M8M A;  1K9A A;  1UJ0 A;  1WFW A;  2H8H A;  1QWF A;  2KRM A;  2PZ1 A;  1I1J A;  1QLY A;  1W70 A;  2KT8 A;  1Z9Q A;  1SSH A;  1GL5 A;  1JXO A;  3RNJ A;  2RMO A;  1YCS B;  1YWP A;  2O2O A;  3PVL A;  3QWX X;  3VS5 A;  2FO0 A;  4QT7 A;  3TVT A;  5FW9 A;  1U06 A;  3EGU A;  4CC2 A;  1X2Q A;  1GRI A;  1AVZ C;  2DJQ A;  2L3Q A;  2NUZ A;  4AFQ C;  2O9V A;  2FPF A;  1QKW A;  2J6K A;  2YUN A;  2DRM A;  1KFZ A;  1HD3 A;  3VS3 A;  2FRY A;  1X69 A;  4HXJ A;  4HCK A;  2GTJ A;  1SRM A;  1J3T A;  4F14 A;  2FEI A;  2OAW A;  2O31 A;  2O9S A;  1TUD A;  4Z89 A;  1JXM A;  4JPB W;  3VRY A;  2KBT A;  1HJD A;  1T0J A;  1XOV A;  1K1Z A;  1NLO C;  1RLP C;  3H0H A;  2YUO A;  2C0O A;  3VS4 A;  2DL7 A;  5FWB A;  1PNJ A;  1UG1 A;  2C0T A;  2HSP A;  1LCK A;  2LJ0 A;  2B86 A;  2C0I A;  4RTX A;  1NEG A;  2J6O A;  4AFZ C;  2G6F X;  4DEY A;  1S1N A;  4J9H A;  2LMJ A;  4AG1 C;  1MUZ A;  4JJD A;  2M51 A;  1ABQ A;  4J9F A;  3QWY A;  4JZ4 A;  2DL8 A;  2EPD A;  2XMF A;  2JS2 A;  2BZX A;  5IXB A;  2ED1 A;  3M0T A;  3UAT A;  2ROL A;  1CSK A;  2DIL A;  5I22 A;  1WDX A;  1AWJ A;  2DA9 A;  2JM9 A;  5IHN A;  2ED0 A;  1NYF A;  2CSI A;  2DVJ A;  1IO6 A;  1U3O A;  2DL4 A;  4JJC A;  1YN8 A;  2AKL A;  2K3B A;  3SHW A;  3H41 A;  2ROT A;  3GBQ A;  3H0F A;  4LN2 A;  2CSQ A;  2BTT A;  2D0N A;  3EHQ A;  1GBQ A;  2KRO A;  4OMQ A;  2KXC A;  1N5Z A;  1YP5 A;  2FG0 A;  1WIE A;  2JTE A;  4D8K A;  3I35 A;  1JO8 A; 
#chains in the Genus database with same CATH topology
 1UGV A;  4DBR A;  2K9G A;  3MO8 A;  2EYW A;  4OGE A;  2OTJ A;  2VXE A;  1KQ1 A;  2RK1 A;  1M3C A;  3ZEH A;  1RI0 A;  2PNI A;  3CCE A;  2DIQ A;  5KYU B;  3OYD A;  2PU9 B;  2YLC A;  2VXF A;  2XDP A;  1I8F A;  3EG1 A;  4C92 F;  3CC2 T;  1MV0 B;  2AZV A;  3CXC P;  5L23 A;  2DBK A;  3HP9 A;  4IUV A;  3M59 A;  1UEB A;  1WGS A;  3ZL7 C;  2RM4 A;  4EIK A;  1G3T A;  2HD0 A;  2MWO A;  2DTO A;  1VQP A;  2EGA A;  5FWC A;  4LNP A;  3QZ5 B;  4M7A D;  3I5S A;  2I0N A;  4QQG A;  4GLM A;  1YBY A;  2RQT A;  2QQB A;  1ZUU A;  1KD1 C;  1WHK A;  2D1X A;  2ZPI B;  1YJN Q;  3QII A;  2OAU A;  2GNC A;  1SKU B;  2KK4 A;  1JJ2 P;  1YJN A;  2LX9 A;  2LCL A;  5IAY A;  5DY9 A;  1PCX A;  3UT1 A;  4CC7 A;  1UGQ B;  3G71 Q;  1M1K C;  1YI2 Q;  2HCK A;  2ZZD A;  2V8K A;  2XIC A;  2CYZ B;  2RQV A;  2DMO A;  2LP5 A;  2M02 A;  4HVW A;  2DFU A;  3J81 E;  1IXD A;  4R0K A;  2Y4X A;  4O5V A;  5LJ5 f;  5DLO A;  1I0C A;  2QYZ A;  1PSE A;  4DA4 A;  3QYH B;  5KE3 A;  2EBP A;  1Z9Z A;  4E7I A;  4XTU A;  1D09 B;  4MML A;  1FMW A;  2KVQ G;  4EMK A;  5LJ5 g;  3QHS A;  2PUK B;  4M78 D;  2RHU A;  3RER A;  3QG1 A;  2ZPE B;  5FU6 C;  2MI6 A;  2CDT A;  4XU1 A;  1M27 C;  3R6O A;  1ARK A;  4RTU A;  4J7F A;  3UPU A;  1VYT A;  2NYS A;  4C0D B;  3HSB A;  2CZ1 B;  2LQW A;  1X75 C;  3M56 A;  1FMK A;  5GAO l;  2YRC A;  3OY9 A;  3HTR A;  3I55 T;  3SD4 A;  4HVV A;  5KYX B;  3CCJ Q;  1UB4 A;  1BB9 A;  1ZUK A;  2ZPB B;  4ZGE B;  1PM3 A;  4KT0 E;  4XQ3 A;  1RI9 A;  4J9C A;  3QUI A;  4A53 A;  2QQA A;  1YNZ A;  1JBM A;  2BZ8 A;  3HHT B;  1M1K U;  1N27 A;  3EGD A;  1RAI B;  4M77 C;  2ZAE A;  1IGQ A;  1YJW A;  2PQW A;  3OBY A;  2BKD N;  5GJW B;  1SPK A;  5GAM j;  1D1B A;  2QTX A;  3SWN C;  2E1H A;  4J8O A;  4BY6 C;  1WHG A;  2K6D A;  1H92 A;  5D6X A;  3JCM h;  3CC2 Q;  3G4S A;  2V8I A;  4Y28 E;  5GAN 6;  5CKB A;  2VAS A;  3CEY A;  5HY6 A;  1YFN A;  1Q82 R;  4RTZ A;  3JCM b;  4PJO B;  2K3Y A;  2DTH A;  3OMC A;  1LJO A;  3P8H A;  1Q81 R;  2ZPG B;  1IRX A;  1GXI E;  5J39 A;  2RB6 A;  2CRE A;  4E7Z A;  2RD1 A;  2F2V A;  2JM8 A;  5GAM h;  2X4J A;  2VGM A;  4LE9 A;  1WZO A;  1IZ6 A;  4OP0 A;  3GF5 A;  2FPD A;  4CC3 A;  4M7A E;  1I5O B;  1U8R A;  1WA7 A;  2RI3 A;  3JCM P;  1R0C B;  1TS9 A;  1CKA A;  3QZ9 B;  5A0L A;  1OQK A;  4PJM A;  1B34 A;  1QVG S;  1VOM A;  3OYE A;  1BYM A;  2KEA A;  4RG2 A;  2CT4 A;  4KUD K;  1NJI R;  4A4G A;  5LJ3 e;  2GBQ A;  2MWP A;  1UGP B;  2AKK A;  1I07 A;  3CCQ T;  1PRL C;  2LJ1 A;  2EYQ A;  5IHI A;  2L3R A;  4XTX A;  2X51 A;  4M7A G;  3JV3 A;  3NMZ C;  1I5L A;  5KYW A;  3J7A F;  4LDY A;  1U5S A;  4PKC C;  1G2B A;  4OB2 B;  1YJ9 T;  5GMK j;  2CZ7 B;  1OYX A;  2P0K A;  2DVE A;  3I56 T;  4A4K A;  4F7U A;  1NPR A;  5GAN d;  1O75 A;  4JRK A;  2M16 A;  2DER A;  4F16 A;  2GFA A;  1OOT A;  2D9T A;  2VKN A;  3I55 Q;  3ASK A;  5C6S A;  2ESW A;  3LLR A;  2YUP A;  4C5G A;  2DF6 A;  3VV0 A;  3L2R A;  2P0P A;  1VQ8 T;  1IB8 A;  5A0G A;  1VQ5 A;  4GLK A;  3UDC A;  3EH2 A;  3PVQ A;  4DBQ A;  1YHQ A;  1FX7 A;  3C4S A;  3C95 A;  3H0I A;  4BI3 A;  1VA7 A;  1QCO A;  2JS0 A;  2RF0 A;  4RG8 A;  4VUB A;  1TG0 A;  5GMK h;  1BBZ A;  1BKB A;  3RR6 A;  3A8L B;  4M77 A;  3M53 A;  4J6X A;  2HL3 A;  4FYX B;  1WHJ A;  3EG2 A;  4J9D A;  2LDM A;  2SEM A;  3RBB B;  1I81 A;  3RKY A;  3SWN A;  1N9S A;  4DEX A;  4PLI A;  2WSE E;  4OB3 B;  5CO7 A;  2DJZ A;  4M75 C;  4OF1 A;  1QWF A;  2KRM A;  1I1J A;  3E9F A;  2L89 A;  3RNJ A;  2LC4 A;  4MZP A;  4M7A B;  3M4Y A;  3VS5 A;  2LQ8 A;  2FO0 A;  4QT7 A;  3CMA T;  5FW9 A;  4FCY A;  3MP6 A;  4CC2 A;  4BDZ A;  3CPW S;  2DJQ A;  2NUZ A;  5HKC A;  2COY A;  3JB9 J;  1HD3 A;  3VS3 A;  3WVE B;  1MMN A;  1RAD B;  3VUB A;  2Y4Y A;  2GFU A;  4F14 A;  3MHX A;  4NOY A;  1TUD A;  4HCC A;  1JXM A;  3VRY A;  1VQ9 A;  1YIJ T;  3CCQ Q;  4QVC A;  4PJO C;  3EGD B;  1K1Z A;  3H0H A;  2DL7 A;  3CCQ A;  5FWB A;  1PG5 B;  2VC8 A;  1QVG P;  1LCK A;  2FZG B;  2DD4 A;  1WHH A;  3MKD A;  3OYH A;  4J9H A;  4JS4 A;  2LMJ A;  1MND A;  1MUZ A;  4JJD A;  3FC3 A;  3DB3 A;  4M78 B;  1YJ9 Q;  4DBF A;  3HL8 A;  5GMK l;  3OBW A;  4L59 A;  4A4H A;  3I56 Q;  5IXB A;  4M7D D;  3CCR T;  4M77 E;  3CXC A;  3V8L A;  3E9G A;  5GMK i;  2QAS A;  4PJN A;  4BB7 A;  2DA9 A;  2M9U A;  2YLB A;  4E7H A;  1QVF P;  5GAN j;  3S6W A;  2E12 A;  1IO6 A;  4JJC A;  1QVP A;  1VQ8 Q;  4YTL A;  4M75 D;  1OZ3 A;  3PFS A;  3GBQ A;  4ANJ A;  1MHN A;  4LN2 A;  3MEU A;  3EHQ A;  4J5Y A;  2KY9 A;  5LJ3 g;  1KC8 U;  1BI2 A;  4M77 G;  1D1A A;  2FG0 A;  1EIF A;  5KH6 A;  1JJ2 A;  2OTJ T;  2GQV A;  2E70 A;  2EGE A;  3IQL A;  3CCE T;  1QKX A;  2K79 A;  2K57 A;  2YRD A;  3KFV A;  2MAM A;  4FYW B;  1Q82 C;  3U23 A;  4AG2 C;  2VYT A;  5GAN h;  3QXE B;  3OA6 A;  2MF2 A;  2XG8 D;  1Q81 C;  3EG0 A;  3JB9 I;  1M30 A;  5KYW B;  3S3M A;  4IUQ A;  3V8J A;  3NGP A;  4E6R A;  1OZ2 A;  2IVW A;  3KBG A;  1VQP T;  4ZNX A;  1VQO A;  3D7S B;  1RUW A;  4AFS C;  3CMA Q;  4RKU E;  5C0M A;  5KYX A;  3OYL A;  2D0Q B;  4C5H A;  2JTM A;  3OS2 A;  2LQN A;  5GAO n;  3TSW A;  4J7I A;  5FU6 B;  1MGQ A;  3CCV T;  1X43 A;  5A2Q E;  4RTW A;  3M0P A;  1ZQ1 A;  5KYN A;  4PNO A;  2QEX T;  3CPW P;  1NJI C;  4F7U F;  3OSV A;  3LGL A;  5AYF A;  1QQJ A;  1JRI A;  4M4Z A;  3BW1 A;  1YIJ Q;  3L2U A;  2EVR A;  4C0F A;  3R6N A;  2CGH A;  4IIO A;  3S3N A;  3OYG A;  1OX9 A;  4OGC A;  3QSU A;  3MEW A;  1KK7 A;  2VUB A;  2DNU A;  4ORZ A;  3FJP A;  1NYG A;  4PJO A;  1R0B G;  2FVU A;  4JDS A;  1K76 A;  5KCO A;  2YWW A;  1UUE A;  1S72 T;  2DKG A;  1K9M U;  3L2Z A;  2KQW A;  4ELY C;  3I9Q A;  2NWM A;  4BY6 B;  3QJ6 A;  3CCR Q;  3REB B;  4N4H A;  5CK9 A;  3CCR A;  1KQS P;  3VYG A;  1ZBJ A;  2C06 A;  2K4Y A;  2DRK A;  2EGC A;  5I11 A;  2JZ2 A;  2JTF A;  4KRT A;  4OML A;  4XK8 E;  1LOJ A;  2P4T A;  2F5T X;  4FYY B;  5ECA A;  3RMS A;  1ZBX A;  2HQH A;  2K5F A;  3EHR A;  3X24 B;  4QVD A;  2EW3 A;  4GBQ A;  2WAC A;  4CI0 C;  2FZC B;  2O88 A;  3PMI A;  4BDY A;  4ATO A;  2JMA A;  6AT1 B;  2F2W A;  3L42 A;  3BE3 A;  4M75 E;  1XNI A;  2YT6 A;  2OTJ Q;  2KR3 A;  5CCA A;  3CCM A;  1YJW T;  1RAG B;  3QDF A;  4M78 C;  3OQ5 A;  3CCE Q;  2AT1 B;  1MV3 A;  2KMT A;  4EMG A;  1W2B P;  1KG1 A;  1WX6 A;  4RTV A;  4M7D G;  4BE1 A;  2IG0 A;  1K73 U;  1W1F A;  3G4S T;  1Y0M A;  1X6G A;  5CR2 A;  3UA7 A;  1RAE B;  1RAC B;  2EFI A;  1K0S A;  1UEC A;  4JZ3 A;  4A4E A;  1IRE B;  1XQH A;  2DLP A;  4M75 G;  2RHX A;  1YIT T;  3JCM f;  2CP3 A;  1UE9 A;  2DL5 A;  3OYB A;  1E7O A;  2XD0 A;  4D6W A;  1VQP Q;  2ENM A;  1WHL A;  3SFM A;  3PTA A;  3JCM g;  3NPF A;  3BDL A;  3REA B;  4ZTF A;  1KJW A;  4OMN A;  5LJ5 d;  1BIB A;  4PJO E;  3DKM A;  1OEB A;  2JMC A;  1K8A U;  2D6F A;  1OI1 A;  2AIR B;  2QDY B;  2RQR A;  1WLP B;  3CCV Q;  3M0U A;  3CCV A;  1WJS A;  2HBW A;  2KE9 A;  2V26 A;  2CP0 A;  2QEX Q;  2DK3 A;  2RPN A;  5GAM f;  2QEX A;  3FDR A;  2D8H A;  3HPW A;  2DZ9 A;  3VKI A;  5HCK A;  4MDX A;  4WCI A;  2CUB A;  2KNB B;  4BD3 A;  4PJO G;  5GAM g;  2JJ9 A;  3M0Q A;  5I2M A;  2MOX A;  3V7R A;  1WHM A;  2V1R A;  3HKS A;  3JB9 D;  3C0C A;  1TH7 A;  1BI1 A;  2DEQ A;  2QI2 A;  5J26 A;  1S72 Q;  3OYF A;  2XHC A;  3EAE A;  1S72 A;  2FB7 A;  3CBM A;  2LTO A;  1I4K 1;  1KIK A;  1WI7 A;  1ZUY A;  3H8Z A;  3H6Z A;  3JB9 H;  4IKF A;  4M7A A;  4M7D B;  1WXB A;  4KBM B;  3OYA A;  2R57 A;  1B7T A;  2X9H A;  2HNI A;  4RCC A;  3BDU A;  1K4U S;  4LD9 K;  2SRC A;  3EG3 A;  3TU4 K;  3O8V A;  4QVZ A;  2X4W A;  3L1A A;  2KT1 A;  1UHF A;  3OYI A;  4M75 B;  1PD1 A;  1E6G A;  3KUF A;  1KD1 U;  3A5Z B;  2F1L A;  2RJF A;  1EZZ B;  1VQ5 T;  5GAN 4;  5KCH A;  1YHQ T;  3HFN A;  2QTV A;  2GF7 A;  3M9Q A;  1G5V A;  1YJW Q;  2LNV A;  3E2U A;  3E19 A;  4PJL A;  3GOX A;  3OW2 S;  3CC7 T;  2RN8 A;  1PSF A;  4JRI A;  3LX7 A;  4XU3 A;  3OSS C;  4RTT A;  3PIP A;  2E41 A;  3G4S Q;  2CP2 A;  2JVV A;  2EQJ A;  4M78 A;  1CKB A;  4HVU A;  1N8R R;  2L3S A;  2LT4 A;  3MJX A;  2KYM A;  3QDR B;  1M2O A;  1YIT Q;  1QVG A;  1UJY A;  1YIT A;  1V76 A;  5CKF A;  4X34 A;  4D8D A;  1M8M A;  3X20 B;  1H3Z A;  1ZSZ B;  3EFR A;  4V2S A;  1K9A A;  1UJ0 A;  3MEA A;  1QLY A;  2RHY A;  1QP2 A;  4ELZ C;  4PJO F;  3F70 A;  3PVL A;  4XTZ A;  1U06 A;  3OB9 A;  4QQ6 A;  2A3L A;  2L3Q A;  4AFQ C;  2NLU A;  3OYN A;  2O9V A;  4HA8 A;  1OUL A;  2DRM A;  2CKK A;  1QVF A;  2JOY A;  2CP5 A;  4HXJ A;  2K5L A;  5FLX E;  1J3T A;  3CBP A;  5HK0 A;  2OAW A;  4BI8 B;  4C92 C;  1VQ9 T;  2O31 A;  2XI9 A;  5DLQ E;  1VQK A;  1G3W A;  4TVR A;  1NLO C;  4FSX A;  3CD6 T;  2X35 A;  3QYG B;  4EPC A;  2QA4 A;  2A7Y A;  2H3J A;  2B86 A;  2C0I A;  2QQR A;  2PVG B;  4RTX A;  5CKE A;  3SDZ A;  4AFZ C;  3L2V A;  2G6F X;  3TRE A;  2JUF A;  2LQK A;  4ZTJ A;  2WSF E;  2DL8 A;  1BI0 A;  4KGZ B;  3M0T A;  4M78 E;  2ROL A;  2AHJ B;  2P84 A;  3J80 E;  4LD6 A;  3JRZ A;  2HQE A;  3CCS A;  2JM9 A;  2ED0 A;  1VQ5 Q;  3EG9 B;  1NYF A;  3GNG A;  3A1P A;  1Y96 B;  1YN8 A;  3M4G A;  1PC0 A;  1YHQ Q;  2XID A;  2K3B A;  3SHW A;  3AT1 B;  3JB9 G;  4C8Q D;  2NUT B;  1R77 A;  4XU0 A;  4ZGD B;  1GBQ A;  1G3Y A;  3LH0 A;  3CC7 Q;  5CAI A;  1N5Z A;  2OTL T;  4M78 G;  3CC7 A;  3M57 A;  2ZCF B;  3OS0 A;  2QG9 B;  2KI7 A;  1WIE A;  2EQK A;  4D8K A;  4GY5 A;  2LCC A;  3CPW A;  4J9B A;  4M7D C;  3M0S A;  3VRZ A;  3NFC A;  3ZBD A;  3FIF A;  2F5K A;  2VGN A;  1SF9 A;  3OW2 P;  3VYH B;  1Y07 A;  2YSQ A;  5LL6 S;  5IT9 E;  1FWZ A;  3OS5 A;  1M3B A;  5I21 A;  4MDW A;  1UTI A;  4FW2 A;  2RHZ A;  4C92 D;  2CS7 A;  2KAF A;  4PLL A;  4DOW A;  3PMT A;  2W0Z A;  2XK0 A;  1FYN A;  2GGR A;  3N5B B;  1TXQ A;  3VS0 A;  5GAN f;  4II1 A;  1VQO T;  1ZA2 B;  4BE2 A;  3QPH A;  1M3A A;  5D6W A;  1WXT A;  2IPO B;  3DLL A;  5GAN 5;  1KQS A;  2A0F B;  4J9I A;  4E7J A;  1AOJ A;  3BY7 A;  1M9S A;  1JEG A;  4JLI A;  4M7A F;  2MYS A;  2JN0 A;  4JRP A;  3GIB A;  1FMV A;  3PE0 A;  1OPK A;  1VQ9 Q;  2AK5 A;  3EFO B;  5KE2 A;  2YUQ A;  2DL3 A;  2K2V A;  2A37 A;  1ZA1 B;  2LVM A;  3CD6 Q;  5LJ3 d;  4BE0 A;  1ZSZ C;  3TQ7 P;  4RTY A;  3CD6 A;  5GAN 8;  5CQY A;  5GAO q;  4J83 A;  1GFC A;  1SRL A;  2KSS A;  1TTH B;  1AWX A;  1W2B A;  2YXY A;  3RKW A;  2L5Q A;  1QCN A;  3LW5 E;  1SHG A;  4K11 A;  1M90 R;  3FLG A;  3QO3 A;  3I5R A;  2YHT A;  1PKT A;  4M78 F;  2K5I A;  2J05 A;  1OX8 A;  2A08 A;  4X1V A;  3TEE A;  4LDV A;  1ACM B;  3OYC A;  2M0O A;  1D3B A;  3KXT A;  3JCM e;  2KRS A;  4HCZ A;  4CC4 B;  1AWO A;  1U1T A;  4R56 A;  4PK4 A;  2R5M A;  4EMH A;  3CPF A;  3VS7 A;  2I2L A;  4J6W A;  2R5A A;  2M0Y A;  2OTL Q;  1UDL A;  1G83 A;  2OTL A;  3CCM T;  5FRO A;  1OPL A;  4LDW A;  2BZY A;  3MP8 A;  2E64 A;  4C5E A;  1N8R C;  1NLP C;  5GAM e;  2MIO A;  2ZGW A;  5GAN 2;  1N6A A;  3RDV A;  4NL3 A;  4M7D A;  2QQS A;  3CXC S;  2EQU A;  1VQO Q;  4UC4 A;  1BCM A;  4C8Q G;  2XU8 A;  4B9W A;  4J9E A;  1VQN T;  3G6E A;  2PVD B;  4XU2 A;  3X26 B;  2K7A A;  1NZ9 A;  4M75 A;  2QDL A;  3O5Z A;  2COW A;  1YWO A;  1SG5 A;  1YCY A;  3JSC A;  2RI5 A;  1MMA A;  4QKU A;  2YDL A;  4DOV A;  2B8A A;  4JUV A;  3OYJ A;  5GAO m;  1JB0 E;  1T3S A;  4ZN1 A;  1PHT A;  2D8J A;  2CH4 A;  4PFZ A;  2LZ6 B;  5CKH A;  4LUE A;  2DBM A;  3JCM V;  2DTI A;  2RK2 A;  4C92 G;  1AEY A;  2J6F A;  3TCJ A;  2MPX C;  3VS6 A;  4J9G A;  1MMD A;  2RNA A;  1M1G A;  1E6H A;  2FZK B;  2QXF A;  2RJC A;  3INZ A;  4C5I A;  1WXU A;  1D1C A;  2P0Q A;  1UGS B;  1N8R U;  2PUO B;  5AT1 B;  5LJ3 j;  2LX7 A;  1BCO A;  1Q82 U;  1X6O A;  4Y92 A;  3T9N A;  1IHW A;  1ABO A;  2HQX A;  2V8J A;  1ZSZ A;  2MK5 A;  4DQ2 A;  1Q81 U;  1V1C A;  2RHI A;  3OS1 A;  1OV3 A;  1VYV A;  1D0Y A;  2J06 A;  3JCM c;  3OYM A;  1BU1 A;  1M8V A;  3EH1 A;  4M77 F;  1AZG B;  1UFF A;  5GMK e;  4N4G A;  4F17 A;  3NHN A;  1Y71 A;  1AD5 A;  1X27 A;  4M7D E;  5GAN 3;  4BUG A;  3HFO A;  4JJB A;  2DIG A;  5KYY A;  2E65 A;  1C6V X;  2LJ3 A;  5LJ3 h;  3MP1 A;  4CRI A;  3V7S A;  4C8Q B;  4XTW A;  5FRN A;  1NJI U;  2E6N A;  3CCM Q;  1NG2 A;  3SEM A;  1Q86 R;  1H64 1;  2BE7 D;  4FM4 B;  3GLX A;  3JCM Q;  2LCS A;  3A98 A;  1NM7 A;  1LPL A;  2F69 A;  2QK0 A;  4QQD A;  2DXU A;  2CH4 W;  2EKH A;  1N9R A;  4OMO A;  4RCB A;  4N0A C;  1NEB A;  2CP7 A;  1ZSG A;  1AWW A;  1Y57 A;  4RMO A;  3NTK A;  4ESR A;  5EG2 A;  4KUL A;  5GAM d;  2A28 A;  3LH5 A;  4C92 B;  3TSZ A;  3CME T;  1VYU A;  2EYZ A;  1K0X A;  2PTK A;  2EAY A;  2MMP A;  3UWN A;  3OMG A;  2EJF A;  3M55 A;  3THK A;  1D0Z A;  4FSS A;  4OMP A;  1VQN Q;  4R55 A;  1VQN A;  2H8H A;  1M2V B;  2PZ1 A;  1Q95 G;  1W70 A;  3EG9 A;  2KT8 A;  2HAX A;  1SSH A;  1GL5 A;  2ATC B;  1Y96 A;  3CCU T;  2RMO A;  1VQ7 T;  1YWP A;  2R58 A;  2NUT A;  3TVT A;  3GPL A;  3P8D A;  1D3B B;  2E4H A;  1AVZ C;  3AHU A;  5M9O A;  4AT1 B;  1QKW A;  2J6K A;  2YUN A;  3QJY A;  1KFZ A;  3VJP A;  3JCM X;  1X69 A;  1WNL A;  2GTJ A;  1FXX A;  2FEI A;  3QKJ A;  1VQK T;  2O9S A;  4Z89 A;  7AT1 B;  3M54 A;  4JPB W;  2DYI A;  4PJJ A;  3M58 A;  5GAO p;  4XAX B;  2QA4 T;  1RLP C;  2YUO A;  1KHI A;  3G71 A;  1KC8 R;  1VQ6 T;  3MET A;  2C0T A;  3JCM W;  1YI2 A;  2HSP A;  2E3H A;  3C94 A;  1NEG A;  2J6O A;  3X28 B;  5L8R E;  1M90 C;  2KDS A;  5CKD A;  2BIV A;  2EQM A;  2EJ9 A;  3OW2 A;  4AG1 C;  4KH1 B;  2M51 A;  2DD5 A;  2ZPH B;  1C0M A;  4J9F A;  2EPD A;  2FYK A;  1AHJ B;  2BZX A;  1VUB A;  2ED1 A;  3UAT A;  4XTY A;  2QGF B;  1CSK A;  4C0Z A;  2DIL A;  3CCS T;  1W4S A;  5J3B A;  4M7D F;  3MEV A;  4JS5 A;  1WJQ A;  2CZ6 B;  1AWJ A;  5IHN A;  5GAN e;  5IN1 A;  2DEU A;  3BFM A;  3PT9 A;  3JAM E;  1M5Q 1;  1C1A A;  3L2Q A;  2DL4 A;  2DXT A;  2ZPF B;  2AKL A;  3EFO A;  3H41 A;  2DXB A;  1G8X A;  5FU7 C;  4M75 F;  2KRO A;  3CCJ A;  4JRQ A;  2KXC A;  3M5A A;  4E7K A;  1YP5 A;  2RJE A;  1NBE B;  4LXC A;  3HRU A;  1U1S A;  2NUP B;  2JTE A;  4FL6 A;  4KGX B;  1R8O B;  1JO8 A;  3DLM A;  4OB0 B;  2HKQ B;  1SSF A;  1PD0 A;  3CME Q;  2XDB A;  3RKX A;  1X2K A;  2COZ A;  4LUD A;  3CME A;  2E5K A;  4N0A A;  5HK3 A;  4FW1 A;  1X6B A;  3CQT A;  2L2P A;  3URG A;  1QCF A;  1M90 U;  2ABL A;  2HBP A;  4N4I A;  2LT1 A;  5GJV B;  2GQI A;  2W10 A;  2JXB A;  2H3E B;  3LWH A;  4OB1 B;  2BE9 B;  4RUG A;  1AZE A;  4C8Q C;  3VS2 A;  3CC2 A;  3C12 A;  3HRT A;  1M4Z A;  4X9D A;  2K2M A;  4WF2 A;  1W6X A;  5GMK m;  3CCU Q;  4HT8 A;  4C0G A;  1VQ7 Q;  1DJ7 B;  3SB2 A;  3CCU A;  5LJ5 j;  1VQ7 A;  1K9M R;  3Q1J A;  3RIR A;  8AT1 B;  4PFP A;  3PNW C;  4XTV A;  2HDA A;  1QMC A;  1HSQ A;  5IH2 A;  2J7I A;  3VUZ A;  2DX1 A;  2M1H A;  4KUI A;  2JT4 A;  2X4Y A;  2HL5 C;  5KYY B;  4OVA A;  2OJ2 A;  1WQW A;  1B07 A;  1KQ2 A;  3RES A;  1ZLM A;  2PVO B;  1VQK Q;  1Q7Y R;  2Y90 A;  3JCM J;  3E1S A;  2HZY A;  3PIO A;  2P4R A;  1RLQ C;  2VVK A;  3LYI A;  2QA4 Q;  2L0A A;  3X25 B;  3G1J A;  3RUX A;  3LGF A;  1VQ6 Q;  2VB6 A;  5CVI A;  1GCQ C;  5LJ5 h;  1VQ6 A;  1KSW A;  1GFD A;  4F04 B;  2DXC A;  2OI3 A;  4LDX A;  3L2W A;  3UA6 A;  3ULR B;  4OMF B;  3OYK A;  1K73 R;  4M77 D;  1EFN A;  1QWE A;  2EQI A;  3ME9 A;  3EFS A;  2RQU A;  3CCS Q;  1VQ4 T;  4AFU C;  3M0R A;  2IIM A;  2JW4 A;  1H8K A;  1PKS A;  4PL6 A;  3FJ5 A;  2KRN A;  1XTD A;  1QVF S;  2YRV A;  1T0H A;  1RAB B;  1JU5 C;  4X9C A;  3H9N A;  1Q86 C;  3LWI A;  2X4X A;  2RH2 A;  4IUR A;  2KGT A;  4Y91 A;  2EYY A;  2DE0 X;  2DET A;  4MMK A;  3UF4 A;  3I55 A;  1WYX A;  1K8A R;  2FRW A;  2X3X D;  4P5N A;  4JJN K;  1TU0 B;  3FRN A;  1PRM C;  1MMG A;  2FPE A;  1PWT A;  2X3W D;  1GCP A;  4KGV B;  1TUC A;  2O01 E;  5I2S A;  2CT3 A;  1IGU A;  2F2X A;  2FHD A;  4IIM A;  4Q5W A;  1H3H A;  2O4X A;  2QQ9 A;  4L6V 5;  3QBY A;  4Z8A A;  1RAA B;  3ZFJ A;  2AZS A;  4HT9 A;  2RA2 A;  1TOV A;  4C0D C;  3G6E T;  1BK2 A;  3EGX A;  4O6J A;  2A36 A;  4Z88 A;  5GAN g;  3CCL T;  3V8K A;  4C8Q A;  1QP3 A;  4NS5 A;  4EMK B;  3S3O A;  1TSF A;  4BI4 A;  3ER0 A;  2MCN A;  4A54 A;  1A0N B;  1Q86 U;  4HKE A;  2CUD A;  3MPU B;  2EIF A;  2DYB A;  2LNH B;  5GAO r;  5IHK A;  4E47 A;  2VWF A;  1LNX A;  3CC4 T;  1MNE A;  1AT1 B;  2E10 A;  1KD1 R;  1KC8 C;  1UHC A;  4C92 A;  4F7U E;  3VS1 A;  2DZC A;  1SEM A;  2BUD A;  1V29 B;  4ME7 A;  2KYB A;  1M1K R;  2DAQ A;  5KYU A;  2OX7 A;  1RAF B;  3CBO A;  4DBH A;  2E6Z A;  2VV5 A;  3JB9 F;  1X01 A;  1JQQ A;  4MZM A;  1GCQ A;  1ZHI A;  1BIA A;  1M2V A;  1NPP A;  3V7C A;  1B3Q A;  1WJR A;  1KQS S;  2RO0 A;  1O9S A;  9ATC B;  1VQ4 Q;  2KXD A;  3RMQ A;  4F7U G;  1EX4 A;  1VQM T;  1TUG B;  1VQ4 A;  4NL2 A;  4IUT A;  3OYY A;  4B6M A;  3GNF B;  5DM7 R;  1YJ9 A;  1XJW B;  2RI2 A;  1P92 A;  2XDD A;  5D6Y A;  8ATC B;  2HSE B;  5A0D A;  3I56 A;  3A8G B;  2L3P A;  2GTO A;  2K3X A;  2G3R A;  5IXF A;  4E7S A;  1KHC A;  1T3L A;  1VQL T;  1F1B B;  4QW2 A;  5FRM A;  2DM1 A;  5EC7 A;  5LJ3 f;  2V1Q A;  2HEQ A;  4HCB A;  4C8Q E;  1VQ8 A;  3DB4 A;  1OU9 A;  4A63 B;  1HXD A;  1SHF A;  2DO3 A;  4OMM A;  2Z0W A;  2RQW A;  1W2B S;  3MCA B;  1UGR B;  2ECZ A;  3PGG A;  1B34 B;  2EYX A;  2EJG A;  1HK9 A;  4IUP A;  2QAZ A;  2HMA A;  4WTO B;  4FT4 A;  1BI3 A;  1ZX6 A;  3G6E Q;  2E5Q A;  1M1F A;  4C92 E;  1GBR A;  2HKN A;  1RAH B;  1K9M C;  1IHV A;  4Z02 A;  3HRS A;  1RL2 A;  1WFW A;  2LRQ A;  3CCL Q;  3FEO A;  4KH0 B;  4EDU A;  3CCL A;  4PJO D;  1Z9Q A;  1JXO A;  2E3I A;  1VIE A;  1YCS B;  2DPP B;  5LJ5 e;  2O2O A;  3QWX X;  4FYV B;  3EGU A;  1X2Q A;  1GRI A;  1JJ2 S;  1WPY A;  3CMA A;  1HYO A;  5GAN 7;  4FU6 A;  2FPF A;  1Q7Y C;  4F7U B;  4J6Y A;  4FIB A;  5D7U A;  4E2F B;  2NUP A;  4FT2 A;  4ZN3 A;  2FRY A;  3CC4 Q;  3WVD B;  2EKO A;  2QGG A;  4HCK A;  3CC4 A;  1YJN T;  1G3S A;  1NE8 A;  1SRM A;  4IUU A;  1VIF A;  4ZGJ B;  5CQX A;  3WXM B;  4AMC A;  2KBT A;  5FU7 B;  3G71 T;  1HJD A;  1T0J A;  1YI2 T;  1XOV A;  2XKO C;  2C0O A;  3VS4 A;  4LDU A;  1YIJ A;  1PNJ A;  1UG1 A;  3GP8 A;  2WSC E;  4A4F A;  2LJ0 A;  2CZ0 B;  4JLG A;  4E7L A;  4EMK C;  1K73 C;  2GCX A;  3A8H B;  3FB9 A;  4DEY A;  1S1N A;  1TWB A;  2O4X B;  4MZT A;  1ABQ A;  4M7A C;  4M77 B;  4BAC A;  2RJD A;  1VQM Q;  3QWY A;  4JZ4 A;  3NTH A;  2XMF A;  1VQM A;  2JS2 A;  3EGX B;  3SWN B;  2CP6 A;  3A8M B;  1WQ7 A;  3G7Z A;  5I22 A;  3JCM d;  1WDX A;  1D0X A;  1QW1 A;  4B9X A;  2DVJ A;  2CSI A;  1K8A C;  1VQL Q;  1U3O A;  3A8O B;  1VQL A;  3P8B B;  2ROT A;  4PFO A;  1Q7Y U;  3H0F A;  1Y7X A;  3NTI A;  3CCJ T;  4L5G A;  2CSQ A;  4C8Q F;  2BTT A;  2D0N A;  2JNG A;  3VU3 C;  4OMQ A;  2L8D A;  2EWN A;  5CIU A;  1OU8 A;  1LVK A;  2FL7 A;  3I35 A; 
#chains in the Genus database with same CATH homology
 1UGV A;  2K9G A;  2EGE A;  3IQL A;  2EYW A;  3M0S A;  3VRZ A;  1QKX A;  1M3C A;  1X2K A;  2K79 A;  4LUD A;  2PNI A;  3KFV A;  2E5K A;  2YSQ A;  1X6B A;  1M3B A;  3U23 A;  4AG2 C;  3CQT A;  2L2P A;  1UTI A;  1QCF A;  2ABL A;  5GJV B;  2GQI A;  2W10 A;  3EG1 A;  2JXB A;  2W0Z A;  4RUG A;  1FYN A;  2GGR A;  1MV0 B;  2AZV A;  1AZE A;  3VS0 A;  3EG0 A;  2DBK A;  3VS2 A;  5L23 A;  1M30 A;  3NGP A;  4E6R A;  2K2M A;  3ZL7 C;  1W6X A;  4EIK A;  4ZNX A;  1M3A A;  1RUW A;  4AFS C;  1WXT A;  2EGA A;  5FWC A;  2HDA A;  4LNP A;  1HSQ A;  5IH2 A;  4J9I A;  1AOJ A;  2J7I A;  2DX1 A;  3I5S A;  2LQN A;  2I0N A;  1JEG A;  2JT4 A;  4GLM A;  3TSW A;  2RQT A;  1X43 A;  1ZUU A;  2D1X A;  2OJ2 A;  1B07 A;  3M0P A;  4RTW A;  2GNC A;  3PE0 A;  1OPK A;  1ZLM A;  2AK5 A;  2YUQ A;  2DL3 A;  4M4Z A;  4CC7 A;  2A37 A;  2P4R A;  1RLQ C;  2VVK A;  2EVR A;  2L0A A;  2HCK A;  3R6N A;  4IIO A;  4RTY A;  1GCQ C;  2RQV A;  1KSW A;  2DMO A;  1GFC A;  2LP5 A;  1GFD A;  1SRL A;  4HVW A;  2OI3 A;  2DNU A;  4R0K A;  1AWX A;  4ORZ A;  1NYG A;  1I0C A;  1K76 A;  3UA6 A;  1UUE A;  2EBP A;  3ULR B;  1Z9Z A;  4K11 A;  1SHG A;  3I9Q A;  2NWM A;  3I5R A;  1EFN A;  1QWE A;  2EQI A;  3REB B;  1PKT A;  2RQU A;  2J05 A;  1ZBJ A;  3M0R A;  2IIM A;  4AFU C;  2JW4 A;  1H8K A;  1PKS A;  2CDT A;  2A08 A;  3FJ5 A;  4X1V A;  1M27 C;  1ARK A;  2DRK A;  2KRN A;  4RTU A;  2EGC A;  1VYT A;  5I11 A;  2KRS A;  4KRT A;  4OML A;  4CC4 B;  1AWO A;  2LQW A;  1T0H A;  1FMK A;  1JU5 C;  5ECA A;  2KGT A;  3EHR A;  4HVV A;  2EYY A;  3VS7 A;  2DE0 X;  1BB9 A;  1ZUK A;  2EW3 A;  4GBQ A;  3UF4 A;  1WYX A;  2FRW A;  1RI9 A;  2M0Y A;  2X3X D;  4J9C A;  2O88 A;  1UDL A;  1G83 A;  2JMA A;  1PRM C;  1YNZ A;  2F2W A;  2FPE A;  2BZ8 A;  1PWT A;  2X3W D;  2YT6 A;  2KR3 A;  1GCP A;  1OPL A;  2BZY A;  1TUC A;  1MV3 A;  1NLP C;  2CT3 A;  1WX6 A;  4RTV A;  2MIO A;  5GJW B;  1SPK A;  2F2X A;  4IIM A;  1W1F A;  1H92 A;  1Y0M A;  2K6D A;  1H3H A;  1X6G A;  3UA7 A;  4Z8A A;  1K0S A;  1UEC A;  4JZ3 A;  2AZS A;  2DLP A;  4RTZ A;  1BK2 A;  1UE9 A;  2DL5 A;  2A36 A;  4Z88 A;  1E7O A;  4J9E A;  2ENM A;  2K7A A;  2QDL A;  3NPF A;  3REA B;  1KJW A;  3O5Z A;  4OMN A;  1OEB A;  2JMC A;  1YWO A;  2RQR A;  1WLP B;  2YDL A;  2MCN A;  2CRE A;  1A0N B;  2F2V A;  2JM8 A;  3M0U A;  1T3S A;  2HBW A;  4LE9 A;  1PHT A;  2D8J A;  2KE9 A;  2CUD A;  2CH4 A;  2LZ6 B;  4LUE A;  2DBM A;  2FPD A;  2RPN A;  4CC3 A;  2DYB A;  1WA7 A;  2LNH B;  2D8H A;  1AEY A;  2J6F A;  5IHK A;  2VWF A;  1CKA A;  3VS6 A;  4J9G A;  5HCK A;  2RNA A;  4WCI A;  2KNB B;  2CUB A;  1UHC A;  2KEA A;  1E6H A;  3M0Q A;  2CT4 A;  2MOX A;  3VS1 A;  1SEM A;  1WXU A;  2V1R A;  2GBQ A;  2KYB A;  2LX7 A;  2AKK A;  4Y92 A;  1I07 A;  1PRL C;  3C0C A;  2LJ1 A;  1ABO A;  5IHI A;  1JQQ A;  1GCQ A;  1V1C A;  3JV3 A;  3NMZ C;  1OV3 A;  1VYV A;  2J06 A;  1BU1 A;  1B3Q A;  1KIK A;  1WI7 A;  1ZUY A;  4J9B A;  1AZG B;  1U5S A;  1UFF A;  1G2B A;  2KXD A;  1WXB A;  4F17 A;  3NHN A;  1K4U S;  2SRC A;  1AD5 A;  3EG3 A;  1X27 A;  2L3P A;  4F16 A;  2GTO A;  1OOT A;  2KT1 A;  1UHF A;  2VKN A;  4JJB A;  5IXF A;  2LJ3 A;  1E6G A;  2ESW A;  2YUP A;  2DF6 A;  1T3L A;  2DM1 A;  5EC7 A;  2V1Q A;  1NG2 A;  3PVQ A;  3SEM A;  2HEQ A;  4A63 B;  3H0I A;  1VA7 A;  1SHF A;  2LCS A;  3A98 A;  1NM7 A;  4OMM A;  2JS0 A;  2RQW A;  2RN8 A;  2RF0 A;  2CH4 W;  1TG0 A;  2EKH A;  4OMO A;  2ECZ A;  1NEB A;  4RTT A;  1ZSG A;  1AWW A;  1BBZ A;  1Y57 A;  2EYX A;  4ESR A;  2A28 A;  3LH5 A;  1CKB A;  3TSZ A;  1VYU A;  4HVU A;  2L3S A;  2EYZ A;  3EG2 A;  1K0X A;  2KYM A;  4J9D A;  2PTK A;  1ZX6 A;  2SEM A;  3RBB B;  1UJY A;  4DEX A;  3THK A;  4FSS A;  1GBR A;  4OMP A;  4D8D A;  1M8M A;  1K9A A;  1UJ0 A;  1WFW A;  2H8H A;  1QWF A;  2KRM A;  2PZ1 A;  1I1J A;  1QLY A;  1W70 A;  2KT8 A;  1Z9Q A;  1SSH A;  1GL5 A;  1JXO A;  3RNJ A;  2RMO A;  1YCS B;  1YWP A;  2O2O A;  3PVL A;  3QWX X;  3VS5 A;  2FO0 A;  4QT7 A;  3TVT A;  5FW9 A;  1U06 A;  3EGU A;  4CC2 A;  1X2Q A;  1GRI A;  1AVZ C;  2DJQ A;  2L3Q A;  2NUZ A;  4AFQ C;  2O9V A;  2FPF A;  1QKW A;  2J6K A;  2YUN A;  2DRM A;  1KFZ A;  1HD3 A;  3VS3 A;  2FRY A;  1X69 A;  4HXJ A;  4HCK A;  2GTJ A;  1SRM A;  1J3T A;  4F14 A;  2FEI A;  2OAW A;  2O31 A;  2O9S A;  1TUD A;  4Z89 A;  1JXM A;  4JPB W;  3VRY A;  2KBT A;  1HJD A;  1T0J A;  1XOV A;  1K1Z A;  1NLO C;  1RLP C;  3H0H A;  2YUO A;  2C0O A;  3VS4 A;  2DL7 A;  5FWB A;  1PNJ A;  1UG1 A;  2C0T A;  2HSP A;  1LCK A;  2LJ0 A;  2B86 A;  2C0I A;  4RTX A;  1NEG A;  2J6O A;  4AFZ C;  2G6F X;  4DEY A;  1S1N A;  4J9H A;  2LMJ A;  4AG1 C;  1MUZ A;  4JJD A;  2M51 A;  1ABQ A;  4J9F A;  3QWY A;  4JZ4 A;  2DL8 A;  2EPD A;  2XMF A;  2JS2 A;  2BZX A;  5IXB A;  2ED1 A;  3M0T A;  3UAT A;  2ROL A;  1CSK A;  2DIL A;  5I22 A;  1WDX A;  1AWJ A;  2DA9 A;  2JM9 A;  5IHN A;  2ED0 A;  1NYF A;  2CSI A;  2DVJ A;  1IO6 A;  1U3O A;  2DL4 A;  4JJC A;  1YN8 A;  2AKL A;  2K3B A;  3SHW A;  3H41 A;  2ROT A;  3GBQ A;  3H0F A;  4LN2 A;  2CSQ A;  2BTT A;  2D0N A;  3EHQ A;  1GBQ A;  2KRO A;  4OMQ A;  2KXC A;  1N5Z A;  1YP5 A;  2FG0 A;  1WIE A;  2JTE A;  4D8K A;  3I35 A;  1JO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...