2ED1A

Solution structure of the sh3 domain of 130 kda phosphatidylinositol 4,5-biphosphate-dependent arf1 gtpase-activating protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
b'GSSGSSGNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
molecule tags Signaling protein
source organism Homo sapiens
publication title Solution structure of the SH3 domain of 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein
rcsb
total genus 7
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed1A00
1OPKA 1AWWA 1GFCA 1PRMC 4F17A 2DRMA 2DMOA 3QWYA 1VA7A 2V1RA 4E6RA 2L3SA 1E6HA 3TSZA 4RTWA 1KIKA 1K0XA 2CUBA 1GFDA 2DVJA 2KRSA 3EHRA 2PNIA 1CSKA 5I22A 2C0TA 2O9VA 4CC4B 1UECA 3TVTA 1NYGA 1GL5A 1W6XA 1I0CA 2X3XD 1X27A 2SEMA 1M3BA 2K6DA 4ESRA 3C0CA 1YCSB 2DBMA 1UHCA 2RN8A 2L3QA 1PHTA 1PRLC 2BZ8A 4FSSA 4J9CA 2CDTA 2L2PA 1QKWA 1WLPB 2D8HA 2J7IA 3M0PA 2L0AA 1GCPA 5I11A 1JU5C 2DL8A 3M0RA 4RTVA 1NLOC 2RQRA 1K76A 1M3CA 1YWOA 2EQIA 3VS6A 2DE0X 2KT1A 1M3AA 2CSQA 2J6FA 4OMPA 3IQLA 4R0KA 2ESWA 1PKTA 2P4RA 2M51A 3M0UA 5IXBA 2KR3A 3I5RA 4JJDA 2KGTA 1UG1A 3RNJA 1K4US 2EW3A 2F2WA 1UDLA 1JXOA 3H41A 2CUDA 3REAB 3RBBB 1S1NA 3VS1A 2A37A 2KYBA 2MOXA 1H8KA 1KJWA 2DX1A 3VS3A 1Z9ZA 4ORZA 1AVZC 1Y0MA 4RTUA 2M0YA 2EYXA 2AK5A 1TUDA 2KBTA 2AZVA 2D0NA 2EPDA 2LJ1A 1ABQA 2EYYA 2DJQA 2L3PA 3VS0A 4EIKA 1AD5A 1JQQA 2NUZA 1WXBA 4K11A 2A28A 5FW9A 4LUEA 4J9BA 2HCKA 2DNUA 2ENMA 1PNJA 2JTEA 2JMAA 2OJ2A 3VS5A 3PE0A 4AFQC 3H0HA 3VS4A 5L23A 4HCKA 2IIMA 5IHIA 1I1JA 3VRZA 3VS7A 5IHNA 1UHFA 2LJ3A 2RPNA 3EG0A 2XMFA 1WDXA 1U5SA 1OV3A 3THKA 5IH2A 1WA7A 1AWJA 1QWFA 4GLMA 3A98A 2O9SA 4GBQA 4Z8AA 1RLQC 3FJ5A 3LH5A 3PVQA 2EGAA 4LUDA 4KRTA 4CC7A 4DEXA 1BB9A 1GCQC 2D8JA 1U3OA 2E5KA 2LX7A 4Z89A 3UATA 1B3QA 2KXCA 5GJWB 1M8MA 3ULRB 2J6OA 4A63B 1WYXA 1KSWA 1BK2A 4F14A 1I07A 3UF4A 2VWFA 2CH4A 5IXFA 2O31A 1X6BA 1QCFA 4OMMA 1Y57A 1YP5A 2LCSA 2D1XA 1GRIA 4D8KA 4M4ZA 1JEGA 2RQWA 1FYNA 1V1CA 2FPDA 2J06A 1PWTA 2GQIA 2ABLA 2KROA 1UGVA 2RQVA 2HSPA 2QDLA 4J9EA 1U06A 3QWXX 2DBKA 2LQWA 2RQUA 5GJVB 1X6GA 3I35A 3KFVA 2KRNA 4D8DA 2FRYA 1UE9A 1M27C 1RUWA 2JM8A 4CC2A 2DF6A 4JJCA 1ABOA 3EG2A 2LP5A 2EYWA 2JW4A 2YUNA 5IHKA 4RUGA 1X43A 1UJ0A 2GBQA 1RLPC 2A08A 2KE9A 2JM9A 2JMCA 1UJYA 2K3BA 1UFFA 2GTJA 1W1FA 2JT4A 4Y92A 4AG1C 4RTTA 2K9GA 2KRMA 1AOJA 2GNCA 1J3TA 3UA7A 1MUZA 1ZBJA 1X69A 1TUCA 3VRYA 1QLYA 3EG1A 5ECAA 1WXTA 2DM1A 2FRWA 2X3WD 2A36A 3O5ZA 4OMQA 1GBQA 2VVKA 1NLPC 1Z9QA 1EFNA 2AKKA 2GTOA 4AG2C 1WI7A 1NG2A 4F16A 2YDLA 3R6NA 2RF0A 1ZX6A 3NGPA 3EHQA 2J05A 1SPKA 1ZUYA 3UA6A 4J9GA 1UTIA 1BU1A 2CREA 1WX6A 1HSQA 2BZYA 2OI3A 4X1VA 1SSHA 1T0HA 2J6KA 3GBQA 1NEBA 3H0FA 2DA9A 4OMNA 1K9AA 4HVUA 1NYFA 1X2QA 2ROTA 2DL7A 4JJBA 3I5SA 2DILA 2O2OA 1K1ZA 4J9DA 1CKAA 1HJDA 4OMLA 1AZEA 2V1QA 4IIMA 2JS2A 2ED1A 3M0QA 2C0IA 2LQNA 2YSQA 1AEYA 1QKXA 2YUOA 2PZ1A 4J9HA 4J9IA 3NMZC 2KNBB 2FO0A 1VYVA 1W70A 3NHNA 4RTYA 2JXBA 1VYTA 2ROLA 1A0NB 2EBPA 4LE9A 1KFZA 2EKHA 2K79A 4QT7A 2O88A 1H92A 3SEMA 2CSIA 1B07A 1TG0A 1SHGA 2PTKA 3NPFA 1NM7A 2K7AA 4RTZA 2CT4A 2B86A 4IIOA 1UUEA 1E6GA 1IO6A 2HBWA 3M0SA 4HVWA 1RI9A 2AZSA 1AWXA 4WCIA 4ZNXA 1M30A 3PVLA 2FG0A 2DL5A 1T3LA 2KEAA 3VS2A 2CH4W 4JZ4A 4LNPA 1AWOA 2DYBA 1ZUUA 1ZLMA 2NWMA 2KYMA 1LCKA 4LN2A 4AFZC 1K0SA 2H8HA 2I0NA 2JS0A 4J9FA 4JPBW 2MIOA 5FWBA 2RMOA 3TSWA 1SEMA 2ECZA 3SHWA 1XOVA 2VKNA 2DLPA 1GBRA 2YT6A 4CC3A 2DL3A 2FPEA 3H0IA 1E7OA 4RTXA 3REBB 2DL4A 2EVRA 2CT3A 3CQTA 1SRLA 1BBZA 1PKSA 2FPFA 2RNAA 1GCQA 2HEQA 1MV3A 1YN8A 1T3SA 2BTTA 2K2MA 4Z88A 2AKLA 2GGRA 1WFWA 1H3HA 1YWPA 3EGUA 2KT8A 4JZ3A 2HDAA 1HD3A 1OPLA 5FWCA 2F2XA 5HCKA 2W10A 4AFSC 2LMJA 4OMOA 2EGCA 1T0JA 3M0TA 1G2BA 2KXDA 4DEYA 1YNZA 3U23A 2YUQA 2ED0A 1WIEA 1NEGA 2YUPA 2RQTA 2EYZA 1CKBA 1JXMA 1MV0B 1ARKA 2BZXA 2G6FX 3I9QA 1QWEA 1SHFA 1JO8A 2C0OA 2W0ZA 1ZSGA 2LZ6B 1SRMA 1FMKA 2DRKA 1X2KA 5EC7A 2EGEA 2LJ0A 3EG3A 1G83A 1AZGB 4AFUC 2FEIA 1OEBA 2F2VA 2SRCA 1N5ZA 1WXUA 2LNHB 3ZL7C 1ZUKA 1VYUA 4HXJA 1OOTA 3JV3A 2MCNA 4HVVA 2OAWA
chains in the Genus database with same CATH superfamily
1AWWA 4E7SA 1ACMB 3L2WA 4WF2A 2XK0A 2DMOA 4E6RA 2P84A 3EGXB 1E6HA 3TSZA 3JSCA 3X20B 1M2OA 2CUBA 2DJZA 3JB9H 3JCMf 1GFDA 3ZBDA 1CSKA 4PK4A 1M1KR 5GAMf 4FYWB 3BE3A 2K2VA 5GAN5 4IUTA 5GMKe 3RMQA 3QBYA 4IURA 1W6XA 4XTXA 2JOYA 1VQLQ 4ZGDB 2F5KA 2X4JA 3C0CA 3JCMc 3FLGA 2L3QA 4ZTFA 1PHTA 3GIBA 1Q95G 1VQ4T 1VQ7Q 1SKUB 3QYGB 1QKWA 4RCCA 1WLPB 3UWNA 2QGFB 4BY6B 2D8HA 2ZGWA 1W2BA 3CPWS 4E7LA 2DL8A 5FU6C 4C92F 4C92D 3SWNB 2KT1A 5KYWA 2YLCA 2CSQA 2OTJA 4OMPA 4R0KA 4M77B 4XAXB 2LDMA 1PKTA 2M51A 3KUFA 2MMPA 3MP6A 4KGXB 1D3BB 2BE9B 3CBOA 1QCNA 4BI4A 2DIQA 2KY9A 3ZEHA 1VQKT 1JXOA 4OGCA 1XNIA 1QVGA 2CUDA 1LOJA 3CCMQ 5FROA 4PJNA 3VS1A 2KYBA 3VS3A 4XU0A 3FDRA 1JB0E 5KYUA 1AVZC 5CKEA 4E7HA 2RO0A 2KBTA 3JCMX 2EPDA 4LDVA 3CCSQ 1Y07A 1AD5A 4KBMB 1WXBA 2RM4A 3OYMA 4J9BA 3OYDA 4M7DB 2CP3A 4QQDA 2JTEA 4EMKB 1VQ9A 2XDPA 3A8MB 4BI8B 4C5IA 5CK9A 4L5GA 3PE0A 2HNIA 4AFQC 3RKWA 3H0HA 1Q81C 1M5Q1 2IVWA 3VS4A 2QQSA 3OYHA 1WHJA 4HCKA 1WZOA 2KSSA 5IHIA 1I1JA 3PT9A 1UHFA 5GMKm 2RD1A 3E2UA 3EG0A 4MZPA 4NL2A 3SWNC 1NJIU 1BI2A 1V29B 1WA7A 1AWJA 3FIFA 1QWFA 1VQ7T 4GLMA 1M4ZA 4GBQA 1TH7A 3AHUA 3EFSA 1LNXA 3A8HB 3LH5A 5LJ3g 3PVQA 2EGAA 4CC7A 2QG9B 1GCQC 2E5KA 4MZTA 5A0LA 2XG8D 3V8LA 3BW1A 4A63B 5GAMh 1KSWA 4E7KA 1M1FA 1BK2A 4OMFB 4JLGA 4RG8A 2OTLA 1I07A 4E7IA 3CC2Q 2CH4A 3RESA 3JAME 3VUZA 3FB9A 2BIVA 3M57A 1Y57A 2KK4A 3PIOA 2LCSA 3DLMA 4M77D 2JN0A 1EX4A 5GAOl 3C94A 1X75C 4O5VA 1JEGA 3M55A 3CCVA 1N8RR 1KC8C 1S72T 2HZYA 3S3NA 4J9EA 1U06A 3I56Q 4M75D 2KRNA 4FW1A 1MMNA 1PD0A 4N4HA 4ELYC 2DAQA 2NUPB 1M27C 2B8AA 1PSFA 2DKGA 5C0MA 2DF6A 4JJCA 1IGQA 3EG2A 4CI0C 4XTYA 3CXCP 2E1HA 2RHYA 1X43A 2OTLQ 2GBQA 5A2QE 2A08A 2DZCA 1TU0B 1PSEA 4J83A 1SG5A 1W1FA 3DB3A 4M7DD 1D3BA 3GNFB 1QVPA 2HBPA 3R6OA 3UA7A 4HCCA 2LNVA 4M7AD 4BUGA 1YI2Q 4GY5A 4F7UG 3CD6Q 3O5ZA 1RADB 2DD4A 1ZHIA 1XQHA 1K8AR 2M02A 4M75F 2VVKA 4B9XA 2O4XB 2O01E 4A4HA 1NG2A 4EDUA 1M1KU 1OZ2A 4FYXB 2RF0A 3NGPA 4V2SA 3EHQA 2P4TA 4J9GA 3VJPA 3JB9I 1UTIA 1LJOA 1MNEA 1HSQA 2OI3A 4X1VA 5GANj 3NFCA 4E7JA 2A0FB 5GMKh 3EG9A 1T0HA 1Q86U 2J6KA 5CR2A 5FU7C 3HHTB 2ROTA 1VOMA 4JJBA 2PVGB 3OYIA 1HJDA 5KYYB 1AZEA 3CCRA 4XU1A 3RKYA 5HK0A 3CEYA 1K9MC 2F1LA 1N8RU 3HRUA 1N6AA 2YUOA 3NMZC 3QKJA 4Y28E 4E7ZA 2PUOB 2K3YA 2H3EB 2MWOA 1NPPA 2FO0A 3CXCS 1W70A 3V8KA 2ROLA 3X25B 1YCYA 4LE9A 5GMKj 4F04B 3PMIA 4FW2A 3CCJA 4M78A 2AIRB 3QZ5B 5GAMe 2CSIA 4M77E 3JB9G 1NM7A 4C5GA 5GAMj 1OZ3A 1R77A 1M90U 1M2VA 2RK1A 1UUEA 1E6GA 1Y71A 2HBWA 1RAHB 3H9NA 5I21A 3M0SA 4MDWA 1VQ6Q 2AZSA 5KYXB 4DOWA 1M30A 3VS2A 2E3HA 4JZ4A 2VXFA 4LNPA 3VYHB 2F69A 4P5NA 4LN2A 2KYMA 1RAIB 3J7AF 2XDBA 2JS0A 1S72A 1IXDA 4J9FA 1D1AA 4RG2A 3SHWA 3ER0A 1YIJQ 2E70A 1GBRA 2DL3A 3H0IA 2R57A 4M78D 3REBB 2DL4A 3GLXA 2CT3A 3TU4K 1YJNT 2OTJQ 5D6XA 3SFMA 1U8RA 1BBZA 2L5QA 2RHZA 3P8BB 2RNAA 1WQ7A 2XI9A 3PMTA 1T3SA 5LJ5f 3L2QA 4ATOA 3CC7A 1ZSZC 1BI3A 2HDAA 1VQ5T 2BE7D 2CGHA 2EGCA 3M0TA 5LJ5j 3JB9F 2KXDA 4DEYA 1VQ9Q 1RL2A 1NBEB 2X9HA 1WIEA 1NEGA 2YUPA 2EYZA 1VQMA 1CKBA 1JXMA 3EAEA 1O9SA 1VQ7A 1ARKA 1UGSB 1WQWA 3NTHA 2KVQG 3HFOA 5LJ5e 1HYOA 3RMSA 1I81A 1JO8A 3CMAA 2W0ZA 1ZSGA 4BDZA 1YIJA 2K5IA 2EGEA 4BE0A 2ZPIB 1SF9A 3G1JA 2LNHB 3CCRQ 8ATCB 2OAWA 2K57A 3PIPA 2FYKA 1PRMC 3HKSA 4LD9K 3OS5A 2JTMA 5CQXA 5GANh 1TUGB 2V1RA 4C92B 2QDYB 3GNGA 1KIKA 1KC8R 1VQ8Q 4X34A 4WTOB 2DVJA 2KRSA 4ZGJB 3EHRA 4LXCA 2PNIA 5I22A 4JJNK 2M1HA 4CC4B 1VQKQ 1KD1R 4M7AF 1R8OB 2X3XD 3ZFJA 2SEMA 1FMVA 3G4ST 4ESRA 3BFMA 4PLIA 3RDVA 1K73C 4R56A 1HK9A 3FC3A 2BZ8A 4J6YA 2R58A 2ZPBB 3M58A 3OS2A 4M7AG 3OW2A 2EJGA 3M0PA 2L0AA 3GF5A 4HKEA 1GCPA 3M56A 1JRIA 1JU5C 1OU9A 2ATCB 4RTVA 2RQRA 4M7DG 2DVEA 3V7SA 1S72Q 2EQIA 1QP2A 2DE0X 1VQPQ 1M3AA 1MNDA 1AHJB 2ZPGB 3E9GA 2EQKA 1IHVA 3IQLA 2NUTA 5LJ3f 3BDLA 2EJ9A 2ESWA 3L42A 3CCJT 4KH1B 1VQ5Q 1I8FA 2HQHA 4C8QB 1JJ2A 1UG1A 2QI2A 3RNJA 2EW3A 1Q82U 1UDLA 4IUVA 1RI0A 2D6FA 1X6OA 2MK5A 3EGDB 2A37A 2VB6A 1ZSZA 4M7AE 2MAMA 4QQ6A 4BD3A 2EQJA 2EYXA 5D6WA 2DTOA 3OS1A 1MGQA 5GAMg 4N4IA 1ABQA 5IT9E 2AHJB 2DJQA 2L3PA 3VS0A 1YHQA 2NUZA 2QTVA 3OS0A 4JLIA 3C95A 4IUUA 2HCKA 5LJ3h 3NTKA 5DLOA 1V76A 3V7CA 4PJOA 2IIMA 4HA8A 5IHNA 2EYQA 2EKOA 2LJ3A 2RPNA 2XMFA 5A0GA 1OV3A 1Q81U 3THKA 3QZ9B 3QG1A 4PJOF 1XTDA 4C92E 1YI2T 3PGGA 3CCUQ 4PJLA 2HAXA 7AT1B 3EGDA 3I55A 3CPWA 4DEXA 4PJOE 2MPXC 1YITQ 3HSBA 4Z89A 3OBYA 2YRVA 4DA4A 4C0ZA 2J6OA 3VV0A 5FLXE 2QEXA 3CCLT 5CKHA 3CPFA 2YRCA 4DQ2A 1EZZB 2L89A 3HFNA 2K3XA 2QA4A 3EFOA 1OYXA 4C0DC 1VQOA 1OX9A 1YP5A 3V8JA 2D1XA 1GRIA 4XQ3A 4M4ZA 1NE8A 2H3JA 2AT1B 1V1CA 2FPDA 2JVVA 3J80E 4BI3A 4M7AB 2GQIA 4BY6C 3OYJA 4DBFA 3UDCA 2E65A 4F7UE 2ABLA 4M7AA 4X9DA 3P8HA 1VIEA 2RQVA 2HSPA 2RI2A 3C12A 4XTZA 2DBKA 2LQWA 5GJVB 5CCAA 3KFVA 4X9CA 2KQWA 1BI1A 2LP5A 3H8ZA 5GAOq 2YUNA 1M90R 4M7DA 3G71Q 1JJ2S 4BDYA 4RUGA 3OYKA 1UJ0A 1RLPC 5KCHA 2QTXA 1W2BP 3QIIA 1WHLA 4LDYA 1UJYA 4C92G 1UFFA 4A4EA 4Y92A 4M7DF 2K9GA 4M75C 2ZPFB 1RACB 5LJ5g 2GNCA 1G3WA 2L3RA 3M4YA 2CZ0B 1M90C 3MCAB 3CCQT 4VUBA 4D6WA 4Q5WA 3CC2A 1YFNA 2DFUA 2O4XA 3VRYA 2K5FA 1QLYA 3OBWA 2YHTA 3SDZA 1WXTA 2FRWA 2X3WD 3I56T 2Y90A 4J7IA 1GBQA 5J26A 5GAN6 1ZBXA 2DTIA 4BACA 2PVDB 3OW2S 1EFNA 3GPLA 2GTOA 1D1BA 3CC4T 4C8QG 1R0BG 4F16A 3CCRT 1KD1C 1D0XA 3R6NA 1ZX6A 1QVGP 2J05A 1SPKA 2JNGA 3CMAQ 4M78F 1K73R 1KD1U 1SSHA 2D9TA 3JCMe 2K5LA 3M5AA 2NUPA 4FT2A 4IUQA 3TCJA 3T9NA 1NEBA 3GBQA 3H0FA 4OB0B 3RR6A 2PU9B 1NYFA 1X2QA 2Y4XA 2DILA 1D1CA 3G6EA 3BY7A 4A4GA 3MEUA 4OMLA 2LRQA 2OX7A 2VGNA 4IIMA 2JS2A 2V8IA 1UGPB 2ED1A 3M0QA 2QASA 1QKXA 2PZ1A 2QQ9A 4PFOA 3OA6A 1VUBA 4L59A 5I2SA 1PD1A 3CCSA 2QAZA 3X28B 3CCST 4FYVB 2HSEB 5CQYA 2EKHA 2HKNA 3MEVA 5FRMA 4J5YA 1Q81R 2E6ZA 1TG0A 1SHGA 2E41A 5GMKi 2LQKA 4C92A 4RTZA 1X01A 2B86A 4IIOA 1IO6A 3MP1A 4KULA 1VQ6A 1AWXA 1RAEB 1YBYA 4ZNXA 1WJSA 3M59A 5D7UA 3PVLA 2FG0A 3CCQQ 1VQNQ 1T3LA 5GAOp 1LCKA 4AFZC 1UGRB 3AT1B 4XU3A 1QQJA 4KUDK 1IGUA 4A4KA 3TSWA 3KXTA 2X4XA 2ECZA 4KGZB 1LVKA 2QQAA 2FZCB 1FWZA 1D0YA 2XU8A 3LGFA 1PC0A 3RIRA 4CC3A 5IN1A 4M77C 4GLKA 4EPCA 1E7OA 5GAOn 2EVRA 2OTLT 3CCMT 1PKSA 2FPFA 1GCQA 2ZCFB 2BUDA 2GGRA 5CVIA 1H3HA 2I2LA 2F2XA 5HCKA 3CXCA 6AT1B 3X26B 2X4WA 1BIAA 1T0JA 1VQNT 2YUQA 3RKXA 1OU8A 1IREB 1TSFA 1PM3A 2RQTA 3L2ZA 3CC4Q 2BZXA 1SHFA 3JCMQ 5GANe 5HK3A 3FEOA 1FMKA 4JS5A 1X2KA 1VQLT 4M7DC 3M54A 4C0GA 1VYUA 2OAUA 4PKCC 5HY6A 3C4SA 4M7AC 2DD5A 3EFRA 1OPKA 1GFCA 3SWNA 5LJ3e 2COZA 1YITA 2RJDA 3ASKA 2FZGB 3MEAA 1K0XA 2EIFA 1EIFA 1VIFA 2X51A 3HRTA 4PLLA 2C0TA 1UECA 3TVTA 3GOXA 4OB2B 2CS7A 4C8QD 1I0CA 2EQUA 1X27A 1M3BA 1ZSZB 1UHCA 4NS5A 2RN8A 4C8QE 2WSFE 1Q86R 3I56A 2CDTA 2L2PA 4ZGEB 1VQ4Q 1YHQQ 5GANd 3JCMV 2WSCE 4F7UA 5I11A 2PQWA 1Q7YU 4AT1B 1NLOC 1K76A 1M3CA 2DO3A 3L2UA 4OB1B 1VQPT 1KHIA 4JRPA 2DTHA 2J6FA 3FJPA 1Q7YC 3EFOB 3LX7A 2QQRA 3OQ5A 5J3BA 3M0UA 5IXBA 1VQ4A 1ZA2B 4M75G 3E19A 4JJDA 4M7DE 2KGTA 4RMOA 1K4US 5DY9A 3LWIA 2RB6A 5GAN7 3H41A 3M9QA 4CRIA 1YJ9A 3REAB 3WVEB 3OSSC 1S1NA 2RJFA 3QYHB 3CCUT 1WHHA 1H8KA 1Y7XA 4II1A 4JDSA 2EFIA 4ORZA 4RTUA 1OI1A 3QDFA 1TUDA 1Y96B 4UC4A 2GQVA 1WPYA 4M77G 2RJCA 4XTVA 2EYYA 3N5BB 1IZ6A 1JQQA 1U1SA 2A3LA 5FW9A 4LUEA 1KQSA 1NJIR 2DNUA 2ENMA 2HL3A 1PNJA 3DB4A 4C5HA 1UEBA 3CPWP 4RKUE 5L23A 1ZA1B 2R5AA 1M8VA 3VU3C 2NUTB 2EJFA 3VRZA 3VS7A 4A54A 1WDXA 1U5SA 4DOVA 4FIBA 4A53A 1VQ8A 2O9SA 4Z8AA 4J6XA 3FJ5A 4XTUA 1U3OA 5FU7B 3JCMW 4F7UB 1B3QA 2V8JA 2LVMA 5GJWB 4XTWA 1M8MA 2DPPB 1WYXA 2GF7A 2M16A 5I2MA 3G6ET 3PFSA 4ANJA 3UF4A 5GAN3 5CIUA 2DEUA 2O31A 4ELZC 3QDRB 1QW1A 4JRKA 1X6BA 4OMMA 4EMKA 5FU6B 3S6WA 1ZQ1A 2RI3A 2QYZA 1MMAA 1FYNA 1KK7A 4HCBA 1PWTA 2YXYA 1C1AA 5LJ3d 2KROA 4C5EA 3SD4A 1RAGB 1K9MU 2KAFA 2QDLA 4FCYA 4HT9A 2DERA 3I35A 5D6YA 1KC8U 4D8DA 1Y96A 1I5LA 1UE9A 4PJMA 2CZ1B 3MP8A 5KE2A 1RUWA 2V8KA 2C06A 4LDUA 2EYWA 3J81E 1VQPA 3KBGA 1YJWQ 3JB9D 5DM7R 2KE9A 1MMDA 2JMCA 1RAAB 2JT4A 1NJIC 2WACA 1IB8A 4TVRA 1J3TA 1G8XA 1MUZA 2PUKB 1YJNA 3OSVA 2RH2A 2DYIA 3EG1A 2X35A 2DM1A 4OMQA 5J39A 2YLBA 1W2BS 3MO8A 3EH1A 3CCEA 1U1TA 2GFAA 1NLPC 2AKKA 1WI7A 3L2RA 3G4SA 2YDLA 1YJWT 2ZPHB 3OYLA 4PL6A 2FHDA 1ZUYA 5KCOA 2ZAEA 5FRNA 4HCZA 2CREA 3EH2A 2BZYA 2CZ6B 2M0OA 2QA4T 1B34B 3CMEQ 2CP0A 2DZ9A 3TEEA 1Q82R 1N9RA 4OMNA 2LCCA 4HVUA 5GAOm 1DJ7B 2DL7A 3EG9B 5GANf 4FYYB 2CP5A 3OYCA 2A7YA 4J9DA 1CKAA 4DBRA 2CP7A 2QEXT 2V1QA 1BCOA 1YJWA 1RABB 2LQNA 2HKQB 5CO7A 2PVOB 5GAN2 4J9HA 1SSFA 3QUIA 1YIJT 1WHKA 2XDDA 1VQ8T 3BDUA 3I55T 4OGEA 3OYGA 3CMET 4B6MA 1VYTA 4PNOA 1A0NB 3CC2T 2CYZB 3M4GA 3OYNA 2K79A 2JTFA 5CKFA 1QP3A 1H92A 3SEMA 3PTAA 5L8RE 3OYFA 3OMCA 3CC7Q 4PJOC 3G71T 1O75A 2CT4A 4QQGA 4KUIA 1HXDA 3EGXA 2XKOC 4E47A 4C0FA 1WGSA 4M78G 5LL6S 2E5QA 3VKIA 2M9UA 3D7SB 1AWOA 2DYBA 1ZLMA 5GAMd 1K0SA 2H8HA 1YJ9Q 2E6NA 4JPBW 5AT1B 2RMOA 3CBPA 4F7UF 5CAIA 4FSXA 4HT8A 2VKNA 1VQOQ 5EG2A 2YT6A 2FPEA 4ZN3A 2COWA 2DETA 3CQTA 1PCXA 2VV5A 1SRLA 4JUVA 2DK3A 2HEQA 3QJYA 3G71A 4N4GA 3CCLA 1YN8A 4Z88A 2CP6A 2AKLA 2RHXA 2KT8A 4OF1A 2QEXQ 3OYAA 2W10A 4AFSC 4OMOA 1G2BA 2GCXA 1YNZA 2RK2A 3U23A 2ED0A 4PJOB 3E9FA 1QVFS 2G6FX 3I9QA 4OVAA 3E1SA 1QWEA 3LYIA 2C0OA 2LZ6B 4LD6A 4LDXA 1FX7A 2LJ0A 4AFUC 4JS4A 2HMAA 4M78E 9ATCB 1OEBA 2F2VA 1LPLA 4HXJA 3UPUA 3JCMg 2E64A 4F17A 2DRMA 3QWYA 1VA7A 2L3SA 1I4K1 4RTWA 2X4YA 1JBMA 3JCMJ 2LTOA 2O9VA 1NYGA 2EAYA 1GL5A 1QVFP 3TREA 3I55Q 2LCLA 3F70A 1YJ9T 2K6DA 4C92C 3LH0A 1FMWA 3CC4A 1C0MA 1YCSB 4J7FA 3L1AA 4A4FA 5LJ5h 3CCEQ 2DBMA 4XU2A 3JB9J 1PRLC 5DLQE 3Q1JA 4FSSA 4J9CA 3QSUA 1TXQA 2IG0A 4EMKC 1VQ6T 4MDXA 1VQNA 3CCQA 2J7IA 1G3SA 2G3RA 4AMCA 5A0DA 1WJQA 1GXIE 4C8QC 3JCMh 4C0DB 3M0RA 5LJ3j 1YWOA 3VS6A 2ZPEB 1VQ9T 3LWHA 1UB4A 2D0QB 2MI6A 2P4RA 3CCMA 5M9OA 4O6JA 4M77A 1R0CB 2KR3A 3I5RA 3CMEA 2RHUA 3URGA 2F2WA 2LQ8A 2VUBA 1G3YA 4L6V5 1WHGA 3MHXA 2VC8A 3MEWA 3RBBB 4XK8E 4QVDA 1KQSS 3CBMA 1KQSP 4DBQA 3CD6T 2DX1A 1KJWA 2MOXA 5KE3A 1Z9ZA 1IRXA 2LT4A 1F1BB 3P8DA 3CCVT 3QHSA 1TS9A 1RAFB 1Y0MA 2M0YA 3SB2A 4N0AC 2AK5A 1K8AU 3DKMA 4OP0A 2AZVA 3JCMP 1VQKA 2D0NA 2LJ1A 4BE1A 4E2FB 4QW2A 4EIKA 2QXFA 2XIDA 2CKKA 2YRDA 2R5MA 4K11A 2A28A 1TOVA 3S3MA 3LLRA 5GAN8 2VXEA 2EQMA 2JMAA 2OJ2A 3VS5A 1BCMA 2YWWA 2RJEA 1Q7YR 3H6ZA 4ZTJA 3HPWA 1VQLA 1IHWA 4QKUA 4EMHA 2P0KA 1FXXA 3CCET 3HRSA 4C8QF 2MWPA 1N27A 1MHNA 5IH2A 1VQMQ 2V26A 1BYMA 3O8VA 3A98A 1JJ2P 1RLQC 2CP2A 3DLLA 3M53A 3FRNA 4LUDA 1H3ZA 4KRTA 1BB9A 2DXCA 2D8JA 2LX7A 3UATA 2FVUA 5KH6A 4JRIA 2VASA 4YTLA 2GFUA 2KXCA 1XJWB 4M75E 3MKDA 3ULRB 5IAYA 4J8OA 3G6EQ 4FT4A 1P92A 2VGMA 4F14A 2VWFA 5IXFA 1YJNQ 1M2VB 3HTRA 2HQEA 1QCFA 2RI5A 4LDWA 1Q86C 5GAN4 3OW2P 4D8KA 4M78C 1MMGA 1NPRA 2COYA 2RQWA 2QK0A 2J06A 2QQBA 2HQXA 4KT0E 1OX8A 2LC4A 1NZ9A 3RUXA 2MYSA 8AT1B 1K8AC 3NTIA 4PJOG 1UGVA 4QVCA 5KYUB 3ME9A 1N8RC 5GAOr 4NOYA 2KMTA 2RHIA 1PG5B 4BB7A 3QWXX 2RQUA 4PFZA 3VYGA 1X6GA 1OULA 3JRZA 2FRYA 2JM8A 4CC2A 4NL3A 3V7RA 2DIGA 1ABOA 1B34A 2JW4A 2JJ9A 3WXMB 5IHKA 1C6VX 2OTJT 4M77F 3CC7T 4B9WA 2JM9A 5KYYA 2XD0A 2K3BA 2GTJA 4AG1C 3CCJQ 4RTTA 2KRMA 1AOJA 4MMLA 3S3OA 5GMKl 2DXTA 1ZBJA 3LW5E 1X69A 1TUCA 4OB3B 2EWNA 4MZMA 1YI2A 4Y91A 3A1PA 4QVZA 1WHMA 1BKBA 4RCBA 5ECAA 3INZA 2A36A 3A8GB 3RERA 2VYTA 4MMKA 3OYYA 3QJ6A 1Z9QA 4AG2C 4KH0B 1TWBA 4M75B 2XHCA 1OQKA 5C6SA 4EMGA 1WNLA 1QCOA 3QO3A 3UA6A 1G5VA 4IKFA 1BU1A 1WX6A 2FL7A 3UT1A 3QPHA 2QA4Q 2JUFA 1TTHB 3MPUB 2DA9A 1M1GA 3TQ7P 1K9AA 2E3IA 5KYXA 3G7ZA 1QVGS 5LJ5d 1W4SA 3I5SA 3OYBA 2O2OA 1KQ2A 4C8QA 3A8LB 4DBHA 1QMCA 1K1ZA 3L2VA 4BE2A 3HP9A 3CCVQ 1D09B 1M9SA 3WVDB 3X24B 1QVFA 2Y4YA 4Z02A 3CCUA 1AT1B 2C0IA 3PNWC 2YSQA 5GANg 1AEYA 4FL6A 1WJRA 5AYFA 4J9IA 5HKCA 2DXUA 4R55A 2KNBB 1VYVA 2MF2A 2DEQA 3NHNA 4RTYA 2JXBA 4IUPA 1VQMT 3OMGA 2ZZDA 2EBPA 1KFZA 1H641 2FB7A 4PJJA 4QT7A 2XICA 2O88A 2E10A 1N9SA 2P0QA 2BKDN 3OY9A 1B07A 1VQ5A 1D0ZA 2PTKA 3NPFA 5KYNA 1KG1A 2K7AA 2NYSA 2E12A 4FU6A 4HVWA 1YHQT 1RI9A 2LX9A 5KYWB 4WCIA 4JRQA 2DL5A 2P0PA 3HL8A 1K9MR 2KEAA 2HD0A 2CH4W 4KGVB 1ZUUA 1M1KC 2NWMA 2QGGA 5CKBA 2I0NA 4ME7A 4PJOD 2E4HA 4ZN1A 2CZ7B 2MIOA 5FWBA 1SEMA 1B7TA 3CD6A 1VQOT 2K4YA 4J6WA 1XOVA 4M75A 2DLPA 3CCLQ 2F5TX 2Z0WA 1UGQB 1K73U 4RTXA 3QXEB 4FM4B 3A5ZB 2KI7A 1YITT 2KDSA 1MV3A 2NLUA 1G3TA 2BTTA 2K2MA 3VUBA 1WFWA 1YWPA 3EGUA 4JZ3A 2IPOB 1HD3A 1OPLA 3MJXA 2LT1A 5FWCA 4N0AA 3META 2LMJA 2HL5C 3CMAT 4PFPA 1BIBA 1KHCA 1MV0B 3OB9A 3LGLA 3JCMb 3A8OB 5CKDA 2RA2A 2FZKB 1BI0A 1SRMA 2L8DA 2DRKA 5EC7A 1Q82C 1I5OB 3EG3A 3G4SQ 1G83A 1AZGB 3GP8A 2DXBA 2FEIA 2SRCA 2JZ2A 4M78B 3JCMd 1N5ZA 1WXUA 3ZL7C 1ZUKA 2WSEE 1KQ1A 1OOTA 3JV3A 2MCNA 4HVVA 3OYEA
chains in the Genus database with same CATH topology
1OPKA 1AWWA 1GFCA 1PRMC 4F17A 2DRMA 2DMOA 3QWYA 1VA7A 2V1RA 4E6RA 2L3SA 1E6HA 3TSZA 4RTWA 1KIKA 1K0XA 2CUBA 1GFDA 2DVJA 2KRSA 3EHRA 2PNIA 1CSKA 5I22A 2C0TA 2O9VA 4CC4B 1UECA 3TVTA 1NYGA 1GL5A 1W6XA 1I0CA 2X3XD 1X27A 2SEMA 1M3BA 2K6DA 4ESRA 3C0CA 1YCSB 2DBMA 1UHCA 2RN8A 2L3QA 1PHTA 1PRLC 2BZ8A 4FSSA 4J9CA 2CDTA 2L2PA 1QKWA 1WLPB 2D8HA 2J7IA 3M0PA 2L0AA 1GCPA 5I11A 1JU5C 2DL8A 3M0RA 4RTVA 1NLOC 2RQRA 1K76A 1M3CA 1YWOA 2EQIA 3VS6A 2DE0X 2KT1A 1M3AA 2CSQA 2J6FA 4OMPA 3IQLA 4R0KA 2ESWA 1PKTA 2P4RA 2M51A 3M0UA 5IXBA 2KR3A 3I5RA 4JJDA 2KGTA 1UG1A 3RNJA 1K4US 2EW3A 2F2WA 1UDLA 1JXOA 3H41A 2CUDA 3REAB 3RBBB 1S1NA 3VS1A 2A37A 2KYBA 2MOXA 1H8KA 1KJWA 2DX1A 3VS3A 1Z9ZA 4ORZA 1AVZC 1Y0MA 4RTUA 2M0YA 2EYXA 2AK5A 1TUDA 2KBTA 2AZVA 2D0NA 2EPDA 2LJ1A 1ABQA 2EYYA 2DJQA 2L3PA 3VS0A 4EIKA 1AD5A 1JQQA 2NUZA 1WXBA 4K11A 2A28A 5FW9A 4LUEA 4J9BA 2HCKA 2DNUA 2ENMA 1PNJA 2JTEA 2JMAA 2OJ2A 3VS5A 3PE0A 4AFQC 3H0HA 3VS4A 5L23A 4HCKA 2IIMA 5IHIA 1I1JA 3VRZA 3VS7A 5IHNA 1UHFA 2LJ3A 2RPNA 3EG0A 2XMFA 1WDXA 1U5SA 1OV3A 3THKA 5IH2A 1WA7A 1AWJA 1QWFA 4GLMA 3A98A 2O9SA 4GBQA 4Z8AA 1RLQC 3FJ5A 3LH5A 3PVQA 2EGAA 4LUDA 4KRTA 4CC7A 4DEXA 1BB9A 1GCQC 2D8JA 1U3OA 2E5KA 2LX7A 4Z89A 3UATA 1B3QA 2KXCA 5GJWB 1M8MA 3ULRB 2J6OA 4A63B 1WYXA 1KSWA 1BK2A 4F14A 1I07A 3UF4A 2VWFA 2CH4A 5IXFA 2O31A 1X6BA 1QCFA 4OMMA 1Y57A 1YP5A 2LCSA 2D1XA 1GRIA 4D8KA 4M4ZA 1JEGA 2RQWA 1FYNA 1V1CA 2FPDA 2J06A 1PWTA 2GQIA 2ABLA 2KROA 1UGVA 2RQVA 2HSPA 2QDLA 4J9EA 1U06A 3QWXX 2DBKA 2LQWA 2RQUA 5GJVB 1X6GA 3I35A 3KFVA 2KRNA 4D8DA 2FRYA 1UE9A 1M27C 1RUWA 2JM8A 4CC2A 2DF6A 4JJCA 1ABOA 3EG2A 2LP5A 2EYWA 2JW4A 2YUNA 5IHKA 4RUGA 1X43A 1UJ0A 2GBQA 1RLPC 2A08A 2KE9A 2JM9A 2JMCA 1UJYA 2K3BA 1UFFA 2GTJA 1W1FA 2JT4A 4Y92A 4AG1C 4RTTA 2K9GA 2KRMA 1AOJA 2GNCA 1J3TA 3UA7A 1MUZA 1ZBJA 1X69A 1TUCA 3VRYA 1QLYA 3EG1A 5ECAA 1WXTA 2DM1A 2FRWA 2X3WD 2A36A 3O5ZA 4OMQA 1GBQA 2VVKA 1NLPC 1Z9QA 1EFNA 2AKKA 2GTOA 4AG2C 1WI7A 1NG2A 4F16A 2YDLA 3R6NA 2RF0A 1ZX6A 3NGPA 3EHQA 2J05A 1SPKA 1ZUYA 3UA6A 4J9GA 1UTIA 1BU1A 2CREA 1WX6A 1HSQA 2BZYA 2OI3A 4X1VA 1SSHA 1T0HA 2J6KA 3GBQA 1NEBA 3H0FA 2DA9A 4OMNA 1K9AA 4HVUA 1NYFA 1X2QA 2ROTA 2DL7A 4JJBA 3I5SA 2DILA 2O2OA 1K1ZA 4J9DA 1CKAA 1HJDA 4OMLA 1AZEA 2V1QA 4IIMA 2JS2A 2ED1A 3M0QA 2C0IA 2LQNA 2YSQA 1AEYA 1QKXA 2YUOA 2PZ1A 4J9HA 4J9IA 3NMZC 2KNBB 2FO0A 1VYVA 1W70A 3NHNA 4RTYA 2JXBA 1VYTA 2ROLA 1A0NB 2EBPA 4LE9A 1KFZA 2EKHA 2K79A 4QT7A 2O88A 1H92A 3SEMA 2CSIA 1B07A 1TG0A 1SHGA 2PTKA 3NPFA 1NM7A 2K7AA 4RTZA 2CT4A 2B86A 4IIOA 1UUEA 1E6GA 1IO6A 2HBWA 3M0SA 4HVWA 1RI9A 2AZSA 1AWXA 4WCIA 4ZNXA 1M30A 3PVLA 2FG0A 2DL5A 1T3LA 2KEAA 3VS2A 2CH4W 4JZ4A 4LNPA 1AWOA 2DYBA 1ZUUA 1ZLMA 2NWMA 2KYMA 1LCKA 4LN2A 4AFZC 1K0SA 2H8HA 2I0NA 2JS0A 4J9FA 4JPBW 2MIOA 5FWBA 2RMOA 3TSWA 1SEMA 2ECZA 3SHWA 1XOVA 2VKNA 2DLPA 1GBRA 2YT6A 4CC3A 2DL3A 2FPEA 3H0IA 1E7OA 4RTXA 3REBB 2DL4A 2EVRA 2CT3A 3CQTA 1SRLA 1BBZA 1PKSA 2FPFA 2RNAA 1GCQA 2HEQA 1MV3A 1YN8A 1T3SA 2BTTA 2K2MA 4Z88A 2AKLA 2GGRA 1WFWA 1H3HA 1YWPA 3EGUA 2KT8A 4JZ3A 2HDAA 1HD3A 1OPLA 5FWCA 2F2XA 5HCKA 2W10A 4AFSC 2LMJA 4OMOA 2EGCA 1T0JA 3M0TA 1G2BA 2KXDA 4DEYA 1YNZA 3U23A 2YUQA 2ED0A 1WIEA 1NEGA 2YUPA 2RQTA 2EYZA 1CKBA 1JXMA 1MV0B 1ARKA 2BZXA 2G6FX 3I9QA 1QWEA 1SHFA 1JO8A 2C0OA 2W0ZA 1ZSGA 2LZ6B 1SRMA 1FMKA 2DRKA 1X2KA 5EC7A 2EGEA 2LJ0A 3EG3A 1G83A 1AZGB 4AFUC 2FEIA 1OEBA 2F2VA 2SRCA 1N5ZA 1WXUA 2LNHB 3ZL7C 1ZUKA 1VYUA 4HXJA 1OOTA 3JV3A 2MCNA 4HVVA 2OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPK A;  1AWW A;  1GFC A;  1PRM C;  4F17 A;  2DRM A;  2DMO A;  3QWY A;  1VA7 A;  2V1R A;  4E6R A;  2L3S A;  1E6H A;  3TSZ A;  4RTW A;  1KIK A;  1K0X A;  2CUB A;  1GFD A;  2DVJ A;  2KRS A;  3EHR A;  2PNI A;  1CSK A;  5I22 A;  2C0T A;  2O9V A;  4CC4 B;  1UEC A;  3TVT A;  1NYG A;  1GL5 A;  1W6X A;  1I0C A;  2X3X D;  1X27 A;  2SEM A;  1M3B A;  2K6D A;  4ESR A;  3C0C A;  1YCS B;  2DBM A;  1UHC A;  2RN8 A;  2L3Q A;  1PHT A;  1PRL C;  2BZ8 A;  4FSS A;  4J9C A;  2CDT A;  2L2P A;  1QKW A;  1WLP B;  2D8H A;  2J7I A;  3M0P A;  2L0A A;  1GCP A;  5I11 A;  1JU5 C;  2DL8 A;  3M0R A;  4RTV A;  1NLO C;  2RQR A;  1K76 A;  1M3C A;  1YWO A;  2EQI A;  3VS6 A;  2DE0 X;  2KT1 A;  1M3A A;  2CSQ A;  2J6F A;  4OMP A;  3IQL A;  4R0K A;  2ESW A;  1PKT A;  2P4R A;  2M51 A;  3M0U A;  5IXB A;  2KR3 A;  3I5R A;  4JJD A;  2KGT A;  1UG1 A;  3RNJ A;  1K4U S;  2EW3 A;  2F2W A;  1UDL A;  1JXO A;  3H41 A;  2CUD A;  3REA B;  3RBB B;  1S1N A;  3VS1 A;  2A37 A;  2KYB A;  2MOX A;  1H8K A;  1KJW A;  2DX1 A;  3VS3 A;  1Z9Z A;  4ORZ A;  1AVZ C;  1Y0M A;  4RTU A;  2M0Y A;  2EYX A;  2AK5 A;  1TUD A;  2KBT A;  2AZV A;  2D0N A;  2EPD A;  2LJ1 A;  1ABQ A;  2EYY A;  2DJQ A;  2L3P A;  3VS0 A;  4EIK A;  1AD5 A;  1JQQ A;  2NUZ A;  1WXB A;  4K11 A;  2A28 A;  5FW9 A;  4LUE A;  4J9B A;  2HCK A;  2DNU A;  2ENM A;  1PNJ A;  2JTE A;  2JMA A;  2OJ2 A;  3VS5 A;  3PE0 A;  4AFQ C;  3H0H A;  3VS4 A;  5L23 A;  4HCK A;  2IIM A;  5IHI A;  1I1J A;  3VRZ A;  3VS7 A;  5IHN A;  1UHF A;  2LJ3 A;  2RPN A;  3EG0 A;  2XMF A;  1WDX A;  1U5S A;  1OV3 A;  3THK A;  5IH2 A;  1WA7 A;  1AWJ A;  1QWF A;  4GLM A;  3A98 A;  2O9S A;  4GBQ A;  4Z8A A;  1RLQ C;  3FJ5 A;  3LH5 A;  3PVQ A;  2EGA A;  4LUD A;  4KRT A;  4CC7 A;  4DEX A;  1BB9 A;  1GCQ C;  2D8J A;  1U3O A;  2E5K A;  2LX7 A;  4Z89 A;  3UAT A;  1B3Q A;  2KXC A;  5GJW B;  1M8M A;  3ULR B;  2J6O A;  4A63 B;  1WYX A;  1KSW A;  1BK2 A;  4F14 A;  1I07 A;  3UF4 A;  2VWF A;  2CH4 A;  5IXF A;  2O31 A;  1X6B A;  1QCF A;  4OMM A;  1Y57 A;  1YP5 A;  2LCS A;  2D1X A;  1GRI A;  4D8K A;  4M4Z A;  1JEG A;  2RQW A;  1FYN A;  1V1C A;  2FPD A;  2J06 A;  1PWT A;  2GQI A;  2ABL A;  2KRO A;  1UGV A;  2RQV A;  2HSP A;  2QDL A;  4J9E A;  1U06 A;  3QWX X;  2DBK A;  2LQW A;  2RQU A;  5GJV B;  1X6G A;  3I35 A;  3KFV A;  2KRN A;  4D8D A;  2FRY A;  1UE9 A;  1M27 C;  1RUW A;  2JM8 A;  4CC2 A;  2DF6 A;  4JJC A;  1ABO A;  3EG2 A;  2LP5 A;  2EYW A;  2JW4 A;  2YUN A;  5IHK A;  4RUG A;  1X43 A;  1UJ0 A;  2GBQ A;  1RLP C;  2A08 A;  2KE9 A;  2JM9 A;  2JMC A;  1UJY A;  2K3B A;  1UFF A;  2GTJ A;  1W1F A;  2JT4 A;  4Y92 A;  4AG1 C;  4RTT A;  2K9G A;  2KRM A;  1AOJ A;  2GNC A;  1J3T A;  3UA7 A;  1MUZ A;  1ZBJ A;  1X69 A;  1TUC A;  3VRY A;  1QLY A;  3EG1 A;  5ECA A;  1WXT A;  2DM1 A;  2FRW A;  2X3W D;  2A36 A;  3O5Z A;  4OMQ A;  1GBQ A;  2VVK A;  1NLP C;  1Z9Q A;  1EFN A;  2AKK A;  2GTO A;  4AG2 C;  1WI7 A;  1NG2 A;  4F16 A;  2YDL A;  3R6N A;  2RF0 A;  1ZX6 A;  3NGP A;  3EHQ A;  2J05 A;  1SPK A;  1ZUY A;  3UA6 A;  4J9G A;  1UTI A;  1BU1 A;  2CRE A;  1WX6 A;  1HSQ A;  2BZY A;  2OI3 A;  4X1V A;  1SSH A;  1T0H A;  2J6K A;  3GBQ A;  1NEB A;  3H0F A;  2DA9 A;  4OMN A;  1K9A A;  4HVU A;  1NYF A;  1X2Q A;  2ROT A;  2DL7 A;  4JJB A;  3I5S A;  2DIL A;  2O2O A;  1K1Z A;  4J9D A;  1CKA A;  1HJD A;  4OML A;  1AZE A;  2V1Q A;  4IIM A;  2JS2 A;  2ED1 A;  3M0Q A;  2C0I A;  2LQN A;  2YSQ A;  1AEY A;  1QKX A;  2YUO A;  2PZ1 A;  4J9H A;  4J9I A;  3NMZ C;  2KNB B;  2FO0 A;  1VYV A;  1W70 A;  3NHN A;  4RTY A;  2JXB A;  1VYT A;  2ROL A;  1A0N B;  2EBP A;  4LE9 A;  1KFZ A;  2EKH A;  2K79 A;  4QT7 A;  2O88 A;  1H92 A;  3SEM A;  2CSI A;  1B07 A;  1TG0 A;  1SHG A;  2PTK A;  3NPF A;  1NM7 A;  2K7A A;  4RTZ A;  2CT4 A;  2B86 A;  4IIO A;  1UUE A;  1E6G A;  1IO6 A;  2HBW A;  3M0S A;  4HVW A;  1RI9 A;  2AZS A;  1AWX A;  4WCI A;  4ZNX A;  1M30 A;  3PVL A;  2FG0 A;  2DL5 A;  1T3L A;  2KEA A;  3VS2 A;  2CH4 W;  4JZ4 A;  4LNP A;  1AWO A;  2DYB A;  1ZUU A;  1ZLM A;  2NWM A;  2KYM A;  1LCK A;  4LN2 A;  4AFZ C;  1K0S A;  2H8H A;  2I0N A;  2JS0 A;  4J9F A;  4JPB W;  2MIO A;  5FWB A;  2RMO A;  3TSW A;  1SEM A;  2ECZ A;  3SHW A;  1XOV A;  2VKN A;  2DLP A;  1GBR A;  2YT6 A;  4CC3 A;  2DL3 A;  2FPE A;  3H0I A;  1E7O A;  4RTX A;  3REB B;  2DL4 A;  2EVR A;  2CT3 A;  3CQT A;  1SRL A;  1BBZ A;  1PKS A;  2FPF A;  2RNA A;  1GCQ A;  2HEQ A;  1MV3 A;  1YN8 A;  1T3S A;  2BTT A;  2K2M A;  4Z88 A;  2AKL A;  2GGR A;  1WFW A;  1H3H A;  1YWP A;  3EGU A;  2KT8 A;  4JZ3 A;  2HDA A;  1HD3 A;  1OPL A;  5FWC A;  2F2X A;  5HCK A;  2W10 A;  4AFS C;  2LMJ A;  4OMO A;  2EGC A;  1T0J A;  3M0T A;  1G2B A;  2KXD A;  4DEY A;  1YNZ A;  3U23 A;  2YUQ A;  2ED0 A;  1WIE A;  1NEG A;  2YUP A;  2RQT A;  2EYZ A;  1CKB A;  1JXM A;  1MV0 B;  1ARK A;  2BZX A;  2G6F X;  3I9Q A;  1QWE A;  1SHF A;  1JO8 A;  2C0O A;  2W0Z A;  1ZSG A;  2LZ6 B;  1SRM A;  1FMK A;  2DRK A;  1X2K A;  5EC7 A;  2EGE A;  2LJ0 A;  3EG3 A;  1G83 A;  1AZG B;  4AFU C;  2FEI A;  1OEB A;  2F2V A;  2SRC A;  1N5Z A;  1WXU A;  2LNH B;  3ZL7 C;  1ZUK A;  1VYU A;  4HXJ A;  1OOT A;  3JV3 A;  2MCN A;  4HVV A;  2OAW A; 
#chains in the Genus database with same CATH topology
 1AWW A;  4E7S A;  1ACM B;  3L2W A;  4WF2 A;  2XK0 A;  2DMO A;  4E6R A;  2P84 A;  3EGX B;  1E6H A;  3TSZ A;  3JSC A;  3X20 B;  1M2O A;  2CUB A;  2DJZ A;  3JB9 H;  3JCM f;  1GFD A;  3ZBD A;  1CSK A;  4PK4 A;  1M1K R;  5GAM f;  4FYW B;  3BE3 A;  2K2V A;  5GAN 5;  4IUT A;  5GMK e;  3RMQ A;  3QBY A;  4IUR A;  1W6X A;  4XTX A;  2JOY A;  1VQL Q;  4ZGD B;  2F5K A;  2X4J A;  3C0C A;  3JCM c;  3FLG A;  2L3Q A;  4ZTF A;  1PHT A;  3GIB A;  1Q95 G;  1VQ4 T;  1VQ7 Q;  1SKU B;  3QYG B;  1QKW A;  4RCC A;  1WLP B;  3UWN A;  2QGF B;  4BY6 B;  2D8H A;  2ZGW A;  1W2B A;  3CPW S;  4E7L A;  2DL8 A;  5FU6 C;  4C92 F;  4C92 D;  3SWN B;  2KT1 A;  5KYW A;  2YLC A;  2CSQ A;  2OTJ A;  4OMP A;  4R0K A;  4M77 B;  4XAX B;  2LDM A;  1PKT A;  2M51 A;  3KUF A;  2MMP A;  3MP6 A;  4KGX B;  1D3B B;  2BE9 B;  3CBO A;  1QCN A;  4BI4 A;  2DIQ A;  2KY9 A;  3ZEH A;  1VQK T;  1JXO A;  4OGC A;  1XNI A;  1QVG A;  2CUD A;  1LOJ A;  3CCM Q;  5FRO A;  4PJN A;  3VS1 A;  2KYB A;  3VS3 A;  4XU0 A;  3FDR A;  1JB0 E;  5KYU A;  1AVZ C;  5CKE A;  4E7H A;  2RO0 A;  2KBT A;  3JCM X;  2EPD A;  4LDV A;  3CCS Q;  1Y07 A;  1AD5 A;  4KBM B;  1WXB A;  2RM4 A;  3OYM A;  4J9B A;  3OYD A;  4M7D B;  2CP3 A;  4QQD A;  2JTE A;  4EMK B;  1VQ9 A;  2XDP A;  3A8M B;  4BI8 B;  4C5I A;  5CK9 A;  4L5G A;  3PE0 A;  2HNI A;  4AFQ C;  3RKW A;  3H0H A;  1Q81 C;  1M5Q 1;  2IVW A;  3VS4 A;  2QQS A;  3OYH A;  1WHJ A;  4HCK A;  1WZO A;  2KSS A;  5IHI A;  1I1J A;  3PT9 A;  1UHF A;  5GMK m;  2RD1 A;  3E2U A;  3EG0 A;  4MZP A;  4NL2 A;  3SWN C;  1NJI U;  1BI2 A;  1V29 B;  1WA7 A;  1AWJ A;  3FIF A;  1QWF A;  1VQ7 T;  4GLM A;  1M4Z A;  4GBQ A;  1TH7 A;  3AHU A;  3EFS A;  1LNX A;  3A8H B;  3LH5 A;  5LJ3 g;  3PVQ A;  2EGA A;  4CC7 A;  2QG9 B;  1GCQ C;  2E5K A;  4MZT A;  5A0L A;  2XG8 D;  3V8L A;  3BW1 A;  4A63 B;  5GAM h;  1KSW A;  4E7K A;  1M1F A;  1BK2 A;  4OMF B;  4JLG A;  4RG8 A;  2OTL A;  1I07 A;  4E7I A;  3CC2 Q;  2CH4 A;  3RES A;  3JAM E;  3VUZ A;  3FB9 A;  2BIV A;  3M57 A;  1Y57 A;  2KK4 A;  3PIO A;  2LCS A;  3DLM A;  4M77 D;  2JN0 A;  1EX4 A;  5GAO l;  3C94 A;  1X75 C;  4O5V A;  1JEG A;  3M55 A;  3CCV A;  1N8R R;  1KC8 C;  1S72 T;  2HZY A;  3S3N A;  4J9E A;  1U06 A;  3I56 Q;  4M75 D;  2KRN A;  4FW1 A;  1MMN A;  1PD0 A;  4N4H A;  4ELY C;  2DAQ A;  2NUP B;  1M27 C;  2B8A A;  1PSF A;  2DKG A;  5C0M A;  2DF6 A;  4JJC A;  1IGQ A;  3EG2 A;  4CI0 C;  4XTY A;  3CXC P;  2E1H A;  2RHY A;  1X43 A;  2OTL Q;  2GBQ A;  5A2Q E;  2A08 A;  2DZC A;  1TU0 B;  1PSE A;  4J83 A;  1SG5 A;  1W1F A;  3DB3 A;  4M7D D;  1D3B A;  3GNF B;  1QVP A;  2HBP A;  3R6O A;  3UA7 A;  4HCC A;  2LNV A;  4M7A D;  4BUG A;  1YI2 Q;  4GY5 A;  4F7U G;  3CD6 Q;  3O5Z A;  1RAD B;  2DD4 A;  1ZHI A;  1XQH A;  1K8A R;  2M02 A;  4M75 F;  2VVK A;  4B9X A;  2O4X B;  2O01 E;  4A4H A;  1NG2 A;  4EDU A;  1M1K U;  1OZ2 A;  4FYX B;  2RF0 A;  3NGP A;  4V2S A;  3EHQ A;  2P4T A;  4J9G A;  3VJP A;  3JB9 I;  1UTI A;  1LJO A;  1MNE A;  1HSQ A;  2OI3 A;  4X1V A;  5GAN j;  3NFC A;  4E7J A;  2A0F B;  5GMK h;  3EG9 A;  1T0H A;  1Q86 U;  2J6K A;  5CR2 A;  5FU7 C;  3HHT B;  2ROT A;  1VOM A;  4JJB A;  2PVG B;  3OYI A;  1HJD A;  5KYY B;  1AZE A;  3CCR A;  4XU1 A;  3RKY A;  5HK0 A;  3CEY A;  1K9M C;  2F1L A;  1N8R U;  3HRU A;  1N6A A;  2YUO A;  3NMZ C;  3QKJ A;  4Y28 E;  4E7Z A;  2PUO B;  2K3Y A;  2H3E B;  2MWO A;  1NPP A;  2FO0 A;  3CXC S;  1W70 A;  3V8K A;  2ROL A;  3X25 B;  1YCY A;  4LE9 A;  5GMK j;  4F04 B;  3PMI A;  4FW2 A;  3CCJ A;  4M78 A;  2AIR B;  3QZ5 B;  5GAM e;  2CSI A;  4M77 E;  3JB9 G;  1NM7 A;  4C5G A;  5GAM j;  1OZ3 A;  1R77 A;  1M90 U;  1M2V A;  2RK1 A;  1UUE A;  1E6G A;  1Y71 A;  2HBW A;  1RAH B;  3H9N A;  5I21 A;  3M0S A;  4MDW A;  1VQ6 Q;  2AZS A;  5KYX B;  4DOW A;  1M30 A;  3VS2 A;  2E3H A;  4JZ4 A;  2VXF A;  4LNP A;  3VYH B;  2F69 A;  4P5N A;  4LN2 A;  2KYM A;  1RAI B;  3J7A F;  2XDB A;  2JS0 A;  1S72 A;  1IXD A;  4J9F A;  1D1A A;  4RG2 A;  3SHW A;  3ER0 A;  1YIJ Q;  2E70 A;  1GBR A;  2DL3 A;  3H0I A;  2R57 A;  4M78 D;  3REB B;  2DL4 A;  3GLX A;  2CT3 A;  3TU4 K;  1YJN T;  2OTJ Q;  5D6X A;  3SFM A;  1U8R A;  1BBZ A;  2L5Q A;  2RHZ A;  3P8B B;  2RNA A;  1WQ7 A;  2XI9 A;  3PMT A;  1T3S A;  5LJ5 f;  3L2Q A;  4ATO A;  3CC7 A;  1ZSZ C;  1BI3 A;  2HDA A;  1VQ5 T;  2BE7 D;  2CGH A;  2EGC A;  3M0T A;  5LJ5 j;  3JB9 F;  2KXD A;  4DEY A;  1VQ9 Q;  1RL2 A;  1NBE B;  2X9H A;  1WIE A;  1NEG A;  2YUP A;  2EYZ A;  1VQM A;  1CKB A;  1JXM A;  3EAE A;  1O9S A;  1VQ7 A;  1ARK A;  1UGS B;  1WQW A;  3NTH A;  2KVQ G;  3HFO A;  5LJ5 e;  1HYO A;  3RMS A;  1I81 A;  1JO8 A;  3CMA A;  2W0Z A;  1ZSG A;  4BDZ A;  1YIJ A;  2K5I A;  2EGE A;  4BE0 A;  2ZPI B;  1SF9 A;  3G1J A;  2LNH B;  3CCR Q;  8ATC B;  2OAW A;  2K57 A;  3PIP A;  2FYK A;  1PRM C;  3HKS A;  4LD9 K;  3OS5 A;  2JTM A;  5CQX A;  5GAN h;  1TUG B;  2V1R A;  4C92 B;  2QDY B;  3GNG A;  1KIK A;  1KC8 R;  1VQ8 Q;  4X34 A;  4WTO B;  2DVJ A;  2KRS A;  4ZGJ B;  3EHR A;  4LXC A;  2PNI A;  5I22 A;  4JJN K;  2M1H A;  4CC4 B;  1VQK Q;  1KD1 R;  4M7A F;  1R8O B;  2X3X D;  3ZFJ A;  2SEM A;  1FMV A;  3G4S T;  4ESR A;  3BFM A;  4PLI A;  3RDV A;  1K73 C;  4R56 A;  1HK9 A;  3FC3 A;  2BZ8 A;  4J6Y A;  2R58 A;  2ZPB B;  3M58 A;  3OS2 A;  4M7A G;  3OW2 A;  2EJG A;  3M0P A;  2L0A A;  3GF5 A;  4HKE A;  1GCP A;  3M56 A;  1JRI A;  1JU5 C;  1OU9 A;  2ATC B;  4RTV A;  2RQR A;  4M7D G;  2DVE A;  3V7S A;  1S72 Q;  2EQI A;  1QP2 A;  2DE0 X;  1VQP Q;  1M3A A;  1MND A;  1AHJ B;  2ZPG B;  3E9G A;  2EQK A;  1IHV A;  3IQL A;  2NUT A;  5LJ3 f;  3BDL A;  2EJ9 A;  2ESW A;  3L42 A;  3CCJ T;  4KH1 B;  1VQ5 Q;  1I8F A;  2HQH A;  4C8Q B;  1JJ2 A;  1UG1 A;  2QI2 A;  3RNJ A;  2EW3 A;  1Q82 U;  1UDL A;  4IUV A;  1RI0 A;  2D6F A;  1X6O A;  2MK5 A;  3EGD B;  2A37 A;  2VB6 A;  1ZSZ A;  4M7A E;  2MAM A;  4QQ6 A;  4BD3 A;  2EQJ A;  2EYX A;  5D6W A;  2DTO A;  3OS1 A;  1MGQ A;  5GAM g;  4N4I A;  1ABQ A;  5IT9 E;  2AHJ B;  2DJQ A;  2L3P A;  3VS0 A;  1YHQ A;  2NUZ A;  2QTV A;  3OS0 A;  4JLI A;  3C95 A;  4IUU A;  2HCK A;  5LJ3 h;  3NTK A;  5DLO A;  1V76 A;  3V7C A;  4PJO A;  2IIM A;  4HA8 A;  5IHN A;  2EYQ A;  2EKO A;  2LJ3 A;  2RPN A;  2XMF A;  5A0G A;  1OV3 A;  1Q81 U;  3THK A;  3QZ9 B;  3QG1 A;  4PJO F;  1XTD A;  4C92 E;  1YI2 T;  3PGG A;  3CCU Q;  4PJL A;  2HAX A;  7AT1 B;  3EGD A;  3I55 A;  3CPW A;  4DEX A;  4PJO E;  2MPX C;  1YIT Q;  3HSB A;  4Z89 A;  3OBY A;  2YRV A;  4DA4 A;  4C0Z A;  2J6O A;  3VV0 A;  5FLX E;  2QEX A;  3CCL T;  5CKH A;  3CPF A;  2YRC A;  4DQ2 A;  1EZZ B;  2L89 A;  3HFN A;  2K3X A;  2QA4 A;  3EFO A;  1OYX A;  4C0D C;  1VQO A;  1OX9 A;  1YP5 A;  3V8J A;  2D1X A;  1GRI A;  4XQ3 A;  4M4Z A;  1NE8 A;  2H3J A;  2AT1 B;  1V1C A;  2FPD A;  2JVV A;  3J80 E;  4BI3 A;  4M7A B;  2GQI A;  4BY6 C;  3OYJ A;  4DBF A;  3UDC A;  2E65 A;  4F7U E;  2ABL A;  4M7A A;  4X9D A;  3P8H A;  1VIE A;  2RQV A;  2HSP A;  2RI2 A;  3C12 A;  4XTZ A;  2DBK A;  2LQW A;  5GJV B;  5CCA A;  3KFV A;  4X9C A;  2KQW A;  1BI1 A;  2LP5 A;  3H8Z A;  5GAO q;  2YUN A;  1M90 R;  4M7D A;  3G71 Q;  1JJ2 S;  4BDY A;  4RUG A;  3OYK A;  1UJ0 A;  1RLP C;  5KCH A;  2QTX A;  1W2B P;  3QII A;  1WHL A;  4LDY A;  1UJY A;  4C92 G;  1UFF A;  4A4E A;  4Y92 A;  4M7D F;  2K9G A;  4M75 C;  2ZPF B;  1RAC B;  5LJ5 g;  2GNC A;  1G3W A;  2L3R A;  3M4Y A;  2CZ0 B;  1M90 C;  3MCA B;  3CCQ T;  4VUB A;  4D6W A;  4Q5W A;  3CC2 A;  1YFN A;  2DFU A;  2O4X A;  3VRY A;  2K5F A;  1QLY A;  3OBW A;  2YHT A;  3SDZ A;  1WXT A;  2FRW A;  2X3W D;  3I56 T;  2Y90 A;  4J7I A;  1GBQ A;  5J26 A;  5GAN 6;  1ZBX A;  2DTI A;  4BAC A;  2PVD B;  3OW2 S;  1EFN A;  3GPL A;  2GTO A;  1D1B A;  3CC4 T;  4C8Q G;  1R0B G;  4F16 A;  3CCR T;  1KD1 C;  1D0X A;  3R6N A;  1ZX6 A;  1QVG P;  2J05 A;  1SPK A;  2JNG A;  3CMA Q;  4M78 F;  1K73 R;  1KD1 U;  1SSH A;  2D9T A;  3JCM e;  2K5L A;  3M5A A;  2NUP A;  4FT2 A;  4IUQ A;  3TCJ A;  3T9N A;  1NEB A;  3GBQ A;  3H0F A;  4OB0 B;  3RR6 A;  2PU9 B;  1NYF A;  1X2Q A;  2Y4X A;  2DIL A;  1D1C A;  3G6E A;  3BY7 A;  4A4G A;  3MEU A;  4OML A;  2LRQ A;  2OX7 A;  2VGN A;  4IIM A;  2JS2 A;  2V8I A;  1UGP B;  2ED1 A;  3M0Q A;  2QAS A;  1QKX A;  2PZ1 A;  2QQ9 A;  4PFO A;  3OA6 A;  1VUB A;  4L59 A;  5I2S A;  1PD1 A;  3CCS A;  2QAZ A;  3X28 B;  3CCS T;  4FYV B;  2HSE B;  5CQY A;  2EKH A;  2HKN A;  3MEV A;  5FRM A;  4J5Y A;  1Q81 R;  2E6Z A;  1TG0 A;  1SHG A;  2E41 A;  5GMK i;  2LQK A;  4C92 A;  4RTZ A;  1X01 A;  2B86 A;  4IIO A;  1IO6 A;  3MP1 A;  4KUL A;  1VQ6 A;  1AWX A;  1RAE B;  1YBY A;  4ZNX A;  1WJS A;  3M59 A;  5D7U A;  3PVL A;  2FG0 A;  3CCQ Q;  1VQN Q;  1T3L A;  5GAO p;  1LCK A;  4AFZ C;  1UGR B;  3AT1 B;  4XU3 A;  1QQJ A;  4KUD K;  1IGU A;  4A4K A;  3TSW A;  3KXT A;  2X4X A;  2ECZ A;  4KGZ B;  1LVK A;  2QQA A;  2FZC B;  1FWZ A;  1D0Y A;  2XU8 A;  3LGF A;  1PC0 A;  3RIR A;  4CC3 A;  5IN1 A;  4M77 C;  4GLK A;  4EPC A;  1E7O A;  5GAO n;  2EVR A;  2OTL T;  3CCM T;  1PKS A;  2FPF A;  1GCQ A;  2ZCF B;  2BUD A;  2GGR A;  5CVI A;  1H3H A;  2I2L A;  2F2X A;  5HCK A;  3CXC A;  6AT1 B;  3X26 B;  2X4W A;  1BIA A;  1T0J A;  1VQN T;  2YUQ A;  3RKX A;  1OU8 A;  1IRE B;  1TSF A;  1PM3 A;  2RQT A;  3L2Z A;  3CC4 Q;  2BZX A;  1SHF A;  3JCM Q;  5GAN e;  5HK3 A;  3FEO A;  1FMK A;  4JS5 A;  1X2K A;  1VQL T;  4M7D C;  3M54 A;  4C0G A;  1VYU A;  2OAU A;  4PKC C;  5HY6 A;  3C4S A;  4M7A C;  2DD5 A;  3EFR A;  1OPK A;  1GFC A;  3SWN A;  5LJ3 e;  2COZ A;  1YIT A;  2RJD A;  3ASK A;  2FZG B;  3MEA A;  1K0X A;  2EIF A;  1EIF A;  1VIF A;  2X51 A;  3HRT A;  4PLL A;  2C0T A;  1UEC A;  3TVT A;  3GOX A;  4OB2 B;  2CS7 A;  4C8Q D;  1I0C A;  2EQU A;  1X27 A;  1M3B A;  1ZSZ B;  1UHC A;  4NS5 A;  2RN8 A;  4C8Q E;  2WSF E;  1Q86 R;  3I56 A;  2CDT A;  2L2P A;  4ZGE B;  1VQ4 Q;  1YHQ Q;  5GAN d;  3JCM V;  2WSC E;  4F7U A;  5I11 A;  2PQW A;  1Q7Y U;  4AT1 B;  1NLO C;  1K76 A;  1M3C A;  2DO3 A;  3L2U A;  4OB1 B;  1VQP T;  1KHI A;  4JRP A;  2DTH A;  2J6F A;  3FJP A;  1Q7Y C;  3EFO B;  3LX7 A;  2QQR A;  3OQ5 A;  5J3B A;  3M0U A;  5IXB A;  1VQ4 A;  1ZA2 B;  4M75 G;  3E19 A;  4JJD A;  4M7D E;  2KGT A;  4RMO A;  1K4U S;  5DY9 A;  3LWI A;  2RB6 A;  5GAN 7;  3H41 A;  3M9Q A;  4CRI A;  1YJ9 A;  3REA B;  3WVE B;  3OSS C;  1S1N A;  2RJF A;  3QYH B;  3CCU T;  1WHH A;  1H8K A;  1Y7X A;  4II1 A;  4JDS A;  2EFI A;  4ORZ A;  4RTU A;  1OI1 A;  3QDF A;  1TUD A;  1Y96 B;  4UC4 A;  2GQV A;  1WPY A;  4M77 G;  2RJC A;  4XTV A;  2EYY A;  3N5B B;  1IZ6 A;  1JQQ A;  1U1S A;  2A3L A;  5FW9 A;  4LUE A;  1KQS A;  1NJI R;  2DNU A;  2ENM A;  2HL3 A;  1PNJ A;  3DB4 A;  4C5H A;  1UEB A;  3CPW P;  4RKU E;  5L23 A;  1ZA1 B;  2R5A A;  1M8V A;  3VU3 C;  2NUT B;  2EJF A;  3VRZ A;  3VS7 A;  4A54 A;  1WDX A;  1U5S A;  4DOV A;  4FIB A;  4A53 A;  1VQ8 A;  2O9S A;  4Z8A A;  4J6X A;  3FJ5 A;  4XTU A;  1U3O A;  5FU7 B;  3JCM W;  4F7U B;  1B3Q A;  2V8J A;  2LVM A;  5GJW B;  4XTW A;  1M8M A;  2DPP B;  1WYX A;  2GF7 A;  2M16 A;  5I2M A;  3G6E T;  3PFS A;  4ANJ A;  3UF4 A;  5GAN 3;  5CIU A;  2DEU A;  2O31 A;  4ELZ C;  3QDR B;  1QW1 A;  4JRK A;  1X6B A;  4OMM A;  4EMK A;  5FU6 B;  3S6W A;  1ZQ1 A;  2RI3 A;  2QYZ A;  1MMA A;  1FYN A;  1KK7 A;  4HCB A;  1PWT A;  2YXY A;  1C1A A;  5LJ3 d;  2KRO A;  4C5E A;  3SD4 A;  1RAG B;  1K9M U;  2KAF A;  2QDL A;  4FCY A;  4HT9 A;  2DER A;  3I35 A;  5D6Y A;  1KC8 U;  4D8D A;  1Y96 A;  1I5L A;  1UE9 A;  4PJM A;  2CZ1 B;  3MP8 A;  5KE2 A;  1RUW A;  2V8K A;  2C06 A;  4LDU A;  2EYW A;  3J81 E;  1VQP A;  3KBG A;  1YJW Q;  3JB9 D;  5DM7 R;  2KE9 A;  1MMD A;  2JMC A;  1RAA B;  2JT4 A;  1NJI C;  2WAC A;  1IB8 A;  4TVR A;  1J3T A;  1G8X A;  1MUZ A;  2PUK B;  1YJN A;  3OSV A;  2RH2 A;  2DYI A;  3EG1 A;  2X35 A;  2DM1 A;  4OMQ A;  5J39 A;  2YLB A;  1W2B S;  3MO8 A;  3EH1 A;  3CCE A;  1U1T A;  2GFA A;  1NLP C;  2AKK A;  1WI7 A;  3L2R A;  3G4S A;  2YDL A;  1YJW T;  2ZPH B;  3OYL A;  4PL6 A;  2FHD A;  1ZUY A;  5KCO A;  2ZAE A;  5FRN A;  4HCZ A;  2CRE A;  3EH2 A;  2BZY A;  2CZ6 B;  2M0O A;  2QA4 T;  1B34 B;  3CME Q;  2CP0 A;  2DZ9 A;  3TEE A;  1Q82 R;  1N9R A;  4OMN A;  2LCC A;  4HVU A;  5GAO m;  1DJ7 B;  2DL7 A;  3EG9 B;  5GAN f;  4FYY B;  2CP5 A;  3OYC A;  2A7Y A;  4J9D A;  1CKA A;  4DBR A;  2CP7 A;  2QEX T;  2V1Q A;  1BCO A;  1YJW A;  1RAB B;  2LQN A;  2HKQ B;  5CO7 A;  2PVO B;  5GAN 2;  4J9H A;  1SSF A;  3QUI A;  1YIJ T;  1WHK A;  2XDD A;  1VQ8 T;  3BDU A;  3I55 T;  4OGE A;  3OYG A;  3CME T;  4B6M A;  1VYT A;  4PNO A;  1A0N B;  3CC2 T;  2CYZ B;  3M4G A;  3OYN A;  2K79 A;  2JTF A;  5CKF A;  1QP3 A;  1H92 A;  3SEM A;  3PTA A;  5L8R E;  3OYF A;  3OMC A;  3CC7 Q;  4PJO C;  3G71 T;  1O75 A;  2CT4 A;  4QQG A;  4KUI A;  1HXD A;  3EGX A;  2XKO C;  4E47 A;  4C0F A;  1WGS A;  4M78 G;  5LL6 S;  2E5Q A;  3VKI A;  2M9U A;  3D7S B;  1AWO A;  2DYB A;  1ZLM A;  5GAM d;  1K0S A;  2H8H A;  1YJ9 Q;  2E6N A;  4JPB W;  5AT1 B;  2RMO A;  3CBP A;  4F7U F;  5CAI A;  4FSX A;  4HT8 A;  2VKN A;  1VQO Q;  5EG2 A;  2YT6 A;  2FPE A;  4ZN3 A;  2COW A;  2DET A;  3CQT A;  1PCX A;  2VV5 A;  1SRL A;  4JUV A;  2DK3 A;  2HEQ A;  3QJY A;  3G71 A;  4N4G A;  3CCL A;  1YN8 A;  4Z88 A;  2CP6 A;  2AKL A;  2RHX A;  2KT8 A;  4OF1 A;  2QEX Q;  3OYA A;  2W10 A;  4AFS C;  4OMO A;  1G2B A;  2GCX A;  1YNZ A;  2RK2 A;  3U23 A;  2ED0 A;  4PJO B;  3E9F A;  1QVF S;  2G6F X;  3I9Q A;  4OVA A;  3E1S A;  1QWE A;  3LYI A;  2C0O A;  2LZ6 B;  4LD6 A;  4LDX A;  1FX7 A;  2LJ0 A;  4AFU C;  4JS4 A;  2HMA A;  4M78 E;  9ATC B;  1OEB A;  2F2V A;  1LPL A;  4HXJ A;  3UPU A;  3JCM g;  2E64 A;  4F17 A;  2DRM A;  3QWY A;  1VA7 A;  2L3S A;  1I4K 1;  4RTW A;  2X4Y A;  1JBM A;  3JCM J;  2LTO A;  2O9V A;  1NYG A;  2EAY A;  1GL5 A;  1QVF P;  3TRE A;  3I55 Q;  2LCL A;  3F70 A;  1YJ9 T;  2K6D A;  4C92 C;  3LH0 A;  1FMW A;  3CC4 A;  1C0M A;  1YCS B;  4J7F A;  3L1A A;  4A4F A;  5LJ5 h;  3CCE Q;  2DBM A;  4XU2 A;  3JB9 J;  1PRL C;  5DLQ E;  3Q1J A;  4FSS A;  4J9C A;  3QSU A;  1TXQ A;  2IG0 A;  4EMK C;  1VQ6 T;  4MDX A;  1VQN A;  3CCQ A;  2J7I A;  1G3S A;  2G3R A;  4AMC A;  5A0D A;  1WJQ A;  1GXI E;  4C8Q C;  3JCM h;  4C0D B;  3M0R A;  5LJ3 j;  1YWO A;  3VS6 A;  2ZPE B;  1VQ9 T;  3LWH A;  1UB4 A;  2D0Q B;  2MI6 A;  2P4R A;  3CCM A;  5M9O A;  4O6J A;  4M77 A;  1R0C B;  2KR3 A;  3I5R A;  3CME A;  2RHU A;  3URG A;  2F2W A;  2LQ8 A;  2VUB A;  1G3Y A;  4L6V 5;  1WHG A;  3MHX A;  2VC8 A;  3MEW A;  3RBB B;  4XK8 E;  4QVD A;  1KQS S;  3CBM A;  1KQS P;  4DBQ A;  3CD6 T;  2DX1 A;  1KJW A;  2MOX A;  5KE3 A;  1Z9Z A;  1IRX A;  2LT4 A;  1F1B B;  3P8D A;  3CCV T;  3QHS A;  1TS9 A;  1RAF B;  1Y0M A;  2M0Y A;  3SB2 A;  4N0A C;  2AK5 A;  1K8A U;  3DKM A;  4OP0 A;  2AZV A;  3JCM P;  1VQK A;  2D0N A;  2LJ1 A;  4BE1 A;  4E2F B;  4QW2 A;  4EIK A;  2QXF A;  2XID A;  2CKK A;  2YRD A;  2R5M A;  4K11 A;  2A28 A;  1TOV A;  3S3M A;  3LLR A;  5GAN 8;  2VXE A;  2EQM A;  2JMA A;  2OJ2 A;  3VS5 A;  1BCM A;  2YWW A;  2RJE A;  1Q7Y R;  3H6Z A;  4ZTJ A;  3HPW A;  1VQL A;  1IHW A;  4QKU A;  4EMH A;  2P0K A;  1FXX A;  3CCE T;  3HRS A;  4C8Q F;  2MWP A;  1N27 A;  1MHN A;  5IH2 A;  1VQM Q;  2V26 A;  1BYM A;  3O8V A;  3A98 A;  1JJ2 P;  1RLQ C;  2CP2 A;  3DLL A;  3M53 A;  3FRN A;  4LUD A;  1H3Z A;  4KRT A;  1BB9 A;  2DXC A;  2D8J A;  2LX7 A;  3UAT A;  2FVU A;  5KH6 A;  4JRI A;  2VAS A;  4YTL A;  2GFU A;  2KXC A;  1XJW B;  4M75 E;  3MKD A;  3ULR B;  5IAY A;  4J8O A;  3G6E Q;  4FT4 A;  1P92 A;  2VGM A;  4F14 A;  2VWF A;  5IXF A;  1YJN Q;  1M2V B;  3HTR A;  2HQE A;  1QCF A;  2RI5 A;  4LDW A;  1Q86 C;  5GAN 4;  3OW2 P;  4D8K A;  4M78 C;  1MMG A;  1NPR A;  2COY A;  2RQW A;  2QK0 A;  2J06 A;  2QQB A;  2HQX A;  4KT0 E;  1OX8 A;  2LC4 A;  1NZ9 A;  3RUX A;  2MYS A;  8AT1 B;  1K8A C;  3NTI A;  4PJO G;  1UGV A;  4QVC A;  5KYU B;  3ME9 A;  1N8R C;  5GAO r;  4NOY A;  2KMT A;  2RHI A;  1PG5 B;  4BB7 A;  3QWX X;  2RQU A;  4PFZ A;  3VYG A;  1X6G A;  1OUL A;  3JRZ A;  2FRY A;  2JM8 A;  4CC2 A;  4NL3 A;  3V7R A;  2DIG A;  1ABO A;  1B34 A;  2JW4 A;  2JJ9 A;  3WXM B;  5IHK A;  1C6V X;  2OTJ T;  4M77 F;  3CC7 T;  4B9W A;  2JM9 A;  5KYY A;  2XD0 A;  2K3B A;  2GTJ A;  4AG1 C;  3CCJ Q;  4RTT A;  2KRM A;  1AOJ A;  4MML A;  3S3O A;  5GMK l;  2DXT A;  1ZBJ A;  3LW5 E;  1X69 A;  1TUC A;  4OB3 B;  2EWN A;  4MZM A;  1YI2 A;  4Y91 A;  3A1P A;  4QVZ A;  1WHM A;  1BKB A;  4RCB A;  5ECA A;  3INZ A;  2A36 A;  3A8G B;  3RER A;  2VYT A;  4MMK A;  3OYY A;  3QJ6 A;  1Z9Q A;  4AG2 C;  4KH0 B;  1TWB A;  4M75 B;  2XHC A;  1OQK A;  5C6S A;  4EMG A;  1WNL A;  1QCO A;  3QO3 A;  3UA6 A;  1G5V A;  4IKF A;  1BU1 A;  1WX6 A;  2FL7 A;  3UT1 A;  3QPH A;  2QA4 Q;  2JUF A;  1TTH B;  3MPU B;  2DA9 A;  1M1G A;  3TQ7 P;  1K9A A;  2E3I A;  5KYX A;  3G7Z A;  1QVG S;  5LJ5 d;  1W4S A;  3I5S A;  3OYB A;  2O2O A;  1KQ2 A;  4C8Q A;  3A8L B;  4DBH A;  1QMC A;  1K1Z A;  3L2V A;  4BE2 A;  3HP9 A;  3CCV Q;  1D09 B;  1M9S A;  3WVD B;  3X24 B;  1QVF A;  2Y4Y A;  4Z02 A;  3CCU A;  1AT1 B;  2C0I A;  3PNW C;  2YSQ A;  5GAN g;  1AEY A;  4FL6 A;  1WJR A;  5AYF A;  4J9I A;  5HKC A;  2DXU A;  4R55 A;  2KNB B;  1VYV A;  2MF2 A;  2DEQ A;  3NHN A;  4RTY A;  2JXB A;  4IUP A;  1VQM T;  3OMG A;  2ZZD A;  2EBP A;  1KFZ A;  1H64 1;  2FB7 A;  4PJJ A;  4QT7 A;  2XIC A;  2O88 A;  2E10 A;  1N9S A;  2P0Q A;  2BKD N;  3OY9 A;  1B07 A;  1VQ5 A;  1D0Z A;  2PTK A;  3NPF A;  5KYN A;  1KG1 A;  2K7A A;  2NYS A;  2E12 A;  4FU6 A;  4HVW A;  1YHQ T;  1RI9 A;  2LX9 A;  5KYW B;  4WCI A;  4JRQ A;  2DL5 A;  2P0P A;  3HL8 A;  1K9M R;  2KEA A;  2HD0 A;  2CH4 W;  4KGV B;  1ZUU A;  1M1K C;  2NWM A;  2QGG A;  5CKB A;  2I0N A;  4ME7 A;  4PJO D;  2E4H A;  4ZN1 A;  2CZ7 B;  2MIO A;  5FWB A;  1SEM A;  1B7T A;  3CD6 A;  1VQO T;  2K4Y A;  4J6W A;  1XOV A;  4M75 A;  2DLP A;  3CCL Q;  2F5T X;  2Z0W A;  1UGQ B;  1K73 U;  4RTX A;  3QXE B;  4FM4 B;  3A5Z B;  2KI7 A;  1YIT T;  2KDS A;  1MV3 A;  2NLU A;  1G3T A;  2BTT A;  2K2M A;  3VUB A;  1WFW A;  1YWP A;  3EGU A;  4JZ3 A;  2IPO B;  1HD3 A;  1OPL A;  3MJX A;  2LT1 A;  5FWC A;  4N0A A;  3MET A;  2LMJ A;  2HL5 C;  3CMA T;  4PFP A;  1BIB A;  1KHC A;  1MV0 B;  3OB9 A;  3LGL A;  3JCM b;  3A8O B;  5CKD A;  2RA2 A;  2FZK B;  1BI0 A;  1SRM A;  2L8D A;  2DRK A;  5EC7 A;  1Q82 C;  1I5O B;  3EG3 A;  3G4S Q;  1G83 A;  1AZG B;  3GP8 A;  2DXB A;  2FEI A;  2SRC A;  2JZ2 A;  4M78 B;  3JCM d;  1N5Z A;  1WXU A;  3ZL7 C;  1ZUK A;  2WSE E;  1KQ1 A;  1OOT A;  3JV3 A;  2MCN A;  4HVV A;  3OYE A; 
#chains in the Genus database with same CATH homology
 1OPK A;  1AWW A;  1GFC A;  1PRM C;  4F17 A;  2DRM A;  2DMO A;  3QWY A;  1VA7 A;  2V1R A;  4E6R A;  2L3S A;  1E6H A;  3TSZ A;  4RTW A;  1KIK A;  1K0X A;  2CUB A;  1GFD A;  2DVJ A;  2KRS A;  3EHR A;  2PNI A;  1CSK A;  5I22 A;  2C0T A;  2O9V A;  4CC4 B;  1UEC A;  3TVT A;  1NYG A;  1GL5 A;  1W6X A;  1I0C A;  2X3X D;  1X27 A;  2SEM A;  1M3B A;  2K6D A;  4ESR A;  3C0C A;  1YCS B;  2DBM A;  1UHC A;  2RN8 A;  2L3Q A;  1PHT A;  1PRL C;  2BZ8 A;  4FSS A;  4J9C A;  2CDT A;  2L2P A;  1QKW A;  1WLP B;  2D8H A;  2J7I A;  3M0P A;  2L0A A;  1GCP A;  5I11 A;  1JU5 C;  2DL8 A;  3M0R A;  4RTV A;  1NLO C;  2RQR A;  1K76 A;  1M3C A;  1YWO A;  2EQI A;  3VS6 A;  2DE0 X;  2KT1 A;  1M3A A;  2CSQ A;  2J6F A;  4OMP A;  3IQL A;  4R0K A;  2ESW A;  1PKT A;  2P4R A;  2M51 A;  3M0U A;  5IXB A;  2KR3 A;  3I5R A;  4JJD A;  2KGT A;  1UG1 A;  3RNJ A;  1K4U S;  2EW3 A;  2F2W A;  1UDL A;  1JXO A;  3H41 A;  2CUD A;  3REA B;  3RBB B;  1S1N A;  3VS1 A;  2A37 A;  2KYB A;  2MOX A;  1H8K A;  1KJW A;  2DX1 A;  3VS3 A;  1Z9Z A;  4ORZ A;  1AVZ C;  1Y0M A;  4RTU A;  2M0Y A;  2EYX A;  2AK5 A;  1TUD A;  2KBT A;  2AZV A;  2D0N A;  2EPD A;  2LJ1 A;  1ABQ A;  2EYY A;  2DJQ A;  2L3P A;  3VS0 A;  4EIK A;  1AD5 A;  1JQQ A;  2NUZ A;  1WXB A;  4K11 A;  2A28 A;  5FW9 A;  4LUE A;  4J9B A;  2HCK A;  2DNU A;  2ENM A;  1PNJ A;  2JTE A;  2JMA A;  2OJ2 A;  3VS5 A;  3PE0 A;  4AFQ C;  3H0H A;  3VS4 A;  5L23 A;  4HCK A;  2IIM A;  5IHI A;  1I1J A;  3VRZ A;  3VS7 A;  5IHN A;  1UHF A;  2LJ3 A;  2RPN A;  3EG0 A;  2XMF A;  1WDX A;  1U5S A;  1OV3 A;  3THK A;  5IH2 A;  1WA7 A;  1AWJ A;  1QWF A;  4GLM A;  3A98 A;  2O9S A;  4GBQ A;  4Z8A A;  1RLQ C;  3FJ5 A;  3LH5 A;  3PVQ A;  2EGA A;  4LUD A;  4KRT A;  4CC7 A;  4DEX A;  1BB9 A;  1GCQ C;  2D8J A;  1U3O A;  2E5K A;  2LX7 A;  4Z89 A;  3UAT A;  1B3Q A;  2KXC A;  5GJW B;  1M8M A;  3ULR B;  2J6O A;  4A63 B;  1WYX A;  1KSW A;  1BK2 A;  4F14 A;  1I07 A;  3UF4 A;  2VWF A;  2CH4 A;  5IXF A;  2O31 A;  1X6B A;  1QCF A;  4OMM A;  1Y57 A;  1YP5 A;  2LCS A;  2D1X A;  1GRI A;  4D8K A;  4M4Z A;  1JEG A;  2RQW A;  1FYN A;  1V1C A;  2FPD A;  2J06 A;  1PWT A;  2GQI A;  2ABL A;  2KRO A;  1UGV A;  2RQV A;  2HSP A;  2QDL A;  4J9E A;  1U06 A;  3QWX X;  2DBK A;  2LQW A;  2RQU A;  5GJV B;  1X6G A;  3I35 A;  3KFV A;  2KRN A;  4D8D A;  2FRY A;  1UE9 A;  1M27 C;  1RUW A;  2JM8 A;  4CC2 A;  2DF6 A;  4JJC A;  1ABO A;  3EG2 A;  2LP5 A;  2EYW A;  2JW4 A;  2YUN A;  5IHK A;  4RUG A;  1X43 A;  1UJ0 A;  2GBQ A;  1RLP C;  2A08 A;  2KE9 A;  2JM9 A;  2JMC A;  1UJY A;  2K3B A;  1UFF A;  2GTJ A;  1W1F A;  2JT4 A;  4Y92 A;  4AG1 C;  4RTT A;  2K9G A;  2KRM A;  1AOJ A;  2GNC A;  1J3T A;  3UA7 A;  1MUZ A;  1ZBJ A;  1X69 A;  1TUC A;  3VRY A;  1QLY A;  3EG1 A;  5ECA A;  1WXT A;  2DM1 A;  2FRW A;  2X3W D;  2A36 A;  3O5Z A;  4OMQ A;  1GBQ A;  2VVK A;  1NLP C;  1Z9Q A;  1EFN A;  2AKK A;  2GTO A;  4AG2 C;  1WI7 A;  1NG2 A;  4F16 A;  2YDL A;  3R6N A;  2RF0 A;  1ZX6 A;  3NGP A;  3EHQ A;  2J05 A;  1SPK A;  1ZUY A;  3UA6 A;  4J9G A;  1UTI A;  1BU1 A;  2CRE A;  1WX6 A;  1HSQ A;  2BZY A;  2OI3 A;  4X1V A;  1SSH A;  1T0H A;  2J6K A;  3GBQ A;  1NEB A;  3H0F A;  2DA9 A;  4OMN A;  1K9A A;  4HVU A;  1NYF A;  1X2Q A;  2ROT A;  2DL7 A;  4JJB A;  3I5S A;  2DIL A;  2O2O A;  1K1Z A;  4J9D A;  1CKA A;  1HJD A;  4OML A;  1AZE A;  2V1Q A;  4IIM A;  2JS2 A;  2ED1 A;  3M0Q A;  2C0I A;  2LQN A;  2YSQ A;  1AEY A;  1QKX A;  2YUO A;  2PZ1 A;  4J9H A;  4J9I A;  3NMZ C;  2KNB B;  2FO0 A;  1VYV A;  1W70 A;  3NHN A;  4RTY A;  2JXB A;  1VYT A;  2ROL A;  1A0N B;  2EBP A;  4LE9 A;  1KFZ A;  2EKH A;  2K79 A;  4QT7 A;  2O88 A;  1H92 A;  3SEM A;  2CSI A;  1B07 A;  1TG0 A;  1SHG A;  2PTK A;  3NPF A;  1NM7 A;  2K7A A;  4RTZ A;  2CT4 A;  2B86 A;  4IIO A;  1UUE A;  1E6G A;  1IO6 A;  2HBW A;  3M0S A;  4HVW A;  1RI9 A;  2AZS A;  1AWX A;  4WCI A;  4ZNX A;  1M30 A;  3PVL A;  2FG0 A;  2DL5 A;  1T3L A;  2KEA A;  3VS2 A;  2CH4 W;  4JZ4 A;  4LNP A;  1AWO A;  2DYB A;  1ZUU A;  1ZLM A;  2NWM A;  2KYM A;  1LCK A;  4LN2 A;  4AFZ C;  1K0S A;  2H8H A;  2I0N A;  2JS0 A;  4J9F A;  4JPB W;  2MIO A;  5FWB A;  2RMO A;  3TSW A;  1SEM A;  2ECZ A;  3SHW A;  1XOV A;  2VKN A;  2DLP A;  1GBR A;  2YT6 A;  4CC3 A;  2DL3 A;  2FPE A;  3H0I A;  1E7O A;  4RTX A;  3REB B;  2DL4 A;  2EVR A;  2CT3 A;  3CQT A;  1SRL A;  1BBZ A;  1PKS A;  2FPF A;  2RNA A;  1GCQ A;  2HEQ A;  1MV3 A;  1YN8 A;  1T3S A;  2BTT A;  2K2M A;  4Z88 A;  2AKL A;  2GGR A;  1WFW A;  1H3H A;  1YWP A;  3EGU A;  2KT8 A;  4JZ3 A;  2HDA A;  1HD3 A;  1OPL A;  5FWC A;  2F2X A;  5HCK A;  2W10 A;  4AFS C;  2LMJ A;  4OMO A;  2EGC A;  1T0J A;  3M0T A;  1G2B A;  2KXD A;  4DEY A;  1YNZ A;  3U23 A;  2YUQ A;  2ED0 A;  1WIE A;  1NEG A;  2YUP A;  2RQT A;  2EYZ A;  1CKB A;  1JXM A;  1MV0 B;  1ARK A;  2BZX A;  2G6F X;  3I9Q A;  1QWE A;  1SHF A;  1JO8 A;  2C0O A;  2W0Z A;  1ZSG A;  2LZ6 B;  1SRM A;  1FMK A;  2DRK A;  1X2K A;  5EC7 A;  2EGE A;  2LJ0 A;  3EG3 A;  1G83 A;  1AZG B;  4AFU C;  2FEI A;  1OEB A;  2F2V A;  2SRC A;  1N5Z A;  1WXU A;  2LNH B;  3ZL7 C;  1ZUK A;  1VYU A;  4HXJ A;  1OOT A;  3JV3 A;  2MCN A;  4HVV A;  2OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...