2ED1A

Solution structure of the sh3 domain of 130 kda phosphatidylinositol 4,5-biphosphate-dependent arf1 gtpase-activating protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
GSSGSSGNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1
total genus 7
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed1A00
3LH5A 1AZGB 3EG2A 1UG1A 1AWXA 3VS1A 2FPEA 2RF0A 3UATA 1SHFA 5FWCA 4J9HA 2OAWA 3TVTA 3EG3A 1X6BA 1I0CA 1PNJA 3PVLA 4RTTA 4JZ3A 2CUDA 2X3WD 2HBWA 4Z88A 2F2WA 1WIEA 1CKAA 1TUDA 1K0SA 2CT4A 5GJVB 1T3SA 5FWBA 3REBB 3TSWA 2XMFA 1WLPB 2RNAA 2F2XA 2NUZA 1WFWA 3M0SA 3H41A 1NYFA 1RI9A 3EG0A 1ABOA 1M30A 4D8DA 1ZX6A 2ED1A 2ABLA 2JMAA 2W10A 1AWWA 1UUEA 5IHIA 1K0XA 1JXMA 1AVZC 2ENMA 1QLYA 2EVRA 3GBQA 4Z8AA 1GCQA 1JXOA 4OMMA 1OPKA 1SEMA 2JW4A 2LNHB 2YT6A 4IIOA 2MIOA 1W70A 2IIMA 4EIKA 2LQWA 2EPDA 4RTVA 2LJ1A 2LQNA 1QCFA 4CC3A 2HEQA 1BB9A 4JZ4A 2DVJA 3M0UA 2KRSA 1A0NB 1MUZA 2K9GA 2KXCA 3PE0A 3REAB 3CQTA 5IHNA 2CH4W 1J3TA 4A63B 5IXBA 1X2QA 1CSKA 1G2BA 1QWEA 2DF6A 2EKHA 2JM8A 2L2PA 2D8HA 3PVQA 1Z9ZA 2FRYA 2GTOA 4AFZC 1FYNA 4J9DA 1YCSB 2AKKA 2YSQA 1WA7A 2EGCA 1E6GA 2LCSA 2JTEA 2LJ3A 2A28A 2QDLA 2K3BA 3SHWA 1S1NA 3EHQA 2ED0A 2JM9A 2KT8A 3KFVA 2CT3A 2JT4A 2A37A 2DYBA 1SRMA 1Y57A 1IO6A 2A36A 2I0NA 1GFCA 2EYXA 2KNBB 2D8JA 1QKXA 2O9SA 1X6GA 4M4ZA 1WX6A 1UECA 3I5SA 1GBQA 2KRNA 1G83A 4X1VA 2EQIA 2CREA 1BBZA 4JJBA 5HCKA 1U06A 1ABQA 2W0ZA 1K1ZA 1GBRA 1H92A 2DL7A 2M51A 2AK5A 2V1RA 1UFFA 2BTTA 2PNIA 1VYUA 2OI3A 1H3HA 2DE0X 1PKTA 1JEGA 2YDLA 2DM1A 1W1FA 4RTYA 2DL8A 2RN8A 3THKA 1HJDA 2EBPA 2OJ2A 1UHFA 4R0KA 3VS0A 1GCQC 3IQLA 4RTZA 3I35A 1QWFA 2O88A 1OV3A 1JO8A 2DL5A 4ZNXA 2ROLA 4QT7A 2FPDA 4J9FA 1UTIA 1KJWA 2LX7A 4OMOA 4RTXA 3NHNA 1X69A 3VS4A 3VS7A 1PHTA 4OMNA 3H0HA 2DBMA 1SPKA 1K76A 3A98A 2HSPA 2DMOA 1X27A 4JJDA 4J9CA 1EFNA 2DL4A 1E6HA 2J6KA 2DNUA 1T0JA 1ZUKA 2CSQA 2BZ8A 2V1QA 4JJCA 4OMPA 2C0IA 5ECAA 1KFZA 4AG1C 4AFUC 2PZ1A 2ROTA 2DILA 1AEYA 1PRMC 2MCNA 1GRIA 2DL3A 2RQTA 4IIMA 2CSIA 1I07A 4Z89A 1TUCA 1KIKA 2FRWA 4RTUA 1YWOA 2GNCA 4JPBW 4AFQC 4CC4B 1H8KA 2KR3A 1BU1A 2RQRA 2L3QA 2LJ0A 1FMKA 2PTKA 2FO0A 3M0RA 3ZL7C 3UF4A 1WXUA 1M27C 3NGPA 1OPLA 1UGVA 1B3QA 1UJ0A 2GGRA 2L3PA 2EYYA 4AFSC 2YUNA 2P4RA 2MOXA 3EHRA 4K11A 1ARKA 5EC7A 1RLPC 2CDTA 4CC7A 3VRZA 4D8KA 3EG1A 1UHCA 5I11A 4HVVA 3UA7A 2GQIA 4RUGA 1JU5C 2AZSA 1YP5A 1YN8A 1VA7A 1K4US 3M0PA 1UE9A 1W6XA 1KSWA 2KT1A 3QWXX 3C0CA 3VS2A 1WXBA 4LE9A 4CC2A 2D1XA 4LN2A 4F16A 2C0TA 2J6OA 1CKBA 4GLMA 4RTWA 2AKLA 2C0OA 2K6DA 4OMLA 2JXBA 3VS3A 3U23A 2CUBA 3RBBB 1OEBA 2A08A 4FSSA 1PKSA 2H8HA 2O9VA 1TG0A 1ZLMA 1M8MA 4HCKA 2HDAA 2LZ6B 2J06A 5IHKA 1X43A 3FJ5A 3VS6A 2L0AA 1HD3A 1ZUUA 2ECZA 3SEMA 3H0IA 2D0NA 2AZVA 1LCKA 1MV0B 1V1CA 2RQWA 2KXDA 2VKNA 3M0QA 1WDXA 4HVWA 2NWMA 3I9QA 1NG2A 1K9AA 4HVUA 2YUQA 2DJQA 2VWFA 2DA9A 2BZYA 2K7AA 3RNJA 1VYTA 3R6NA 1M3BA 5I22A 3JV3A 2GTJA 4KRTA 2HCKA 2KE9A 2KRMA 2O31A 1NLOC 4E6RA 4J9GA 4ESRA 1AWJA 1M3CA 1AD5A 1PWTA 1X2KA 2LP5A 4WCIA 4AG2C 1NLPC 2GBQA 1RUWA 1NM7A 1GL5A 2X3XD 2RPNA 5IH2A 3H0FA 2E5KA 1U5SA 1Z9QA 3O5ZA 2J7IA 1MV3A 2JMCA 3TSZA 1NEGA 4F17A 2SRCA 1AZEA 2BZXA 4LUDA 2CH4A 2FG0A 2JS2A 2F2VA 2EYZA 4F14A 4DEXA 2DLPA 2JS0A 4GBQA 1BK2A 2RMOA 1M3AA 1SHGA 2B86A 2RQVA 2L3SA 1NEBA 2FPFA 4Y92A 1WI7A 2KEAA 1YNZA 2FEIA 1N5ZA 1GCPA 3UA6A 2J6FA 1UDLA 2RQUA 1XOVA 2DX1A 1RLQC 2EW3A 2YUOA 5GJWB 1WXTA 3M0TA 1E7OA 2KYBA 1OOTA 1ZSGA 1T3LA 2DBKA 2O2OA 1GFDA 4DEYA 2K2MA 1VYVA 1T0HA 4LNPA 1YWPA 1UJYA 2LMJA 3QWYA 1AOJA 1SRLA 4J9BA 2EGEA 5L23A 3VS5A 2EGAA 1NYGA 3I5RA 1JQQA 3NPFA 4LUEA 1B07A 1ZUYA 2KYMA 2G6FX 2KGTA 1I1JA 4OMQA 2KBTA 1Y0MA 2J05A 1ZBJA 4ORZA 3VRYA 1AWOA 4HXJA 3ULRB 1WYXA 5IXFA 2DRMA 2DRKA 3EGUA 4J9EA 5FW9A 2M0YA 1SSHA 2K79A 4J9IA 3NMZC 1PRLC 1QKWA 1U3OA 2ESWA 2VVKA 2KROA 2YUPA 2SEMA 2EYWA 1HSQA
chains in the Genus database with same CATH superfamily
4IUVA 2PUKB 4WF2A 1NBEB 4QVDA 5GANd 2OAWA 3TVTA 3EG3A 3OYHA 2QQ9A 5LJ5e 3E9FA 1TU0B 5LJ3d 2X3WD 3JCMX 1MMAA 4IURA 4Z88A 4OF1A 3OS2A 4MZTA 1WIEA 2E70A 1K0SA 4QKUA 1LVKA 5GJVB 1Q7YR 2F5KA 3REBB 1WLPB 3S6WA 2RNAA 2NUZA 2D6FA 3VJPA 2EJFA 3H41A 4FIBA 3CD6T 1YIJT 3CCRA 2H3JA 2ABLA 4KT0E 5IT9E 5IHIA 3CC2Q 1JXMA 4Z8AA 2V26A 4M75A 1YBYA 3HL8A 2EWNA 1OPKA 2JW4A 2LNHB 4L59A 5GAOl 1W70A 4EIKA 4M77A 3L42A 2RD1A 4ZTFA 1QCFA 4M78F 1U1SA 5KYYA 2DVJA 1VQ9Q 3JSCA 3QHSA 2K9GA 2LCLA 3PE0A 3REAB 5IHNA 4J8OA 3CBPA 1BI0A 1N9SA 1EIFA 2FZGB 2EKHA 2NUPA 3LGLA 2JM8A 1K73C 1KQSP 1C0MA 3TREA 3SWNC 4C5IA 4AFZC 4J9DA 2DZ9A 3A8GB 4KGVB 2AKKA 3CCVQ 5HY6A 2EGCA 2JN0A 1VQ8Q 2RI3A 4PFZA 3TCJA 2L8DA 4FT2A 5GAMh 4DBQA 2LJ3A 3PTAA 4KGZB 3VKIA 1MMNA 5KYYB 4FT4A 4QW2A 1Y57A 2XHCA 2XDDA 1UGQB 2A36A 2I0NA 1GFCA 3QZ5B 2DXTA 4F7UB 2D8JA 2DKGA 3KUFA 5GAMj 4M4ZA 3VYGA 2L89A 1BI3A 2CP6A 3M9QA 3A8LB 2K2VA 1H92A 2DL7A 2E3HA 2QTXA 3VU3C 1VQOA 3I56Q 3JB9G 4M77C 3L1AA 2LC4A 2M51A 2V1RA 2QQSA 4E7IA 1YJNT 2OTJA 1VYUA 3CMEA 4IUTA 4X9DA 4B6MA 2DL8A 3THKA 2EBPA 4N4IA 1KHCA 4OGEA 3L2WA 3DB3A 4M75C 4QQGA 4BD3A 4CRIA 2CZ6B 2YRCA 4C5HA 5GMKe 4M7DA 2E6ZA 4IUQA 4J6WA 1C6VX 1WHJA 5C6SA 4DOVA 3RMQA 4E7HA 4PJNA 2KSSA 3SWNB 2M16A 2DZCA 4P5NA 3S3NA 1ZA1B 1BI2A 3EFRA 1D3BA 5I2MA 3VS7A 2H3EB 3KBGA 3TQ7P 1SPKA 1VQNT 1NJIC 4PL6A 4C8QG 2ZCFB 4B9XA 3OQ5A 3CCVT 3BY7A 2J6KA 1G3TA 1T0JA 2GQVA 2NUPB 1YJ9A 1UGSB 2CSQA 1VQ6Q 4IUPA 4OMPA 4AG1C 2PZ1A 3INZA 1PRMC 2MCNA 2RHUA 1GRIA 4L6V5 1JJ2S 5LJ3f 1I07A 4Z89A 4RTUA 4PJLA 1QP3A 2GNCA 3JCMe 2DD4A 4OP0A 1YI2Q 3X28B 5CQXA 2RQRA 2HZYA 2MWPA 1KQ1A 5LJ5j 5GAN6 1WXUA 3NGPA 4PJMA 1OPLA 5GAMg 2K5IA 1VQOT 1Q86U 3M59A 2GGRA 3QJYA 2EYYA 8ATCB 5GMKj 4AFSC 2YUNA 3E9GA 2P4RA 4JLGA 4LD6A 3S3MA 4M78B 5KYWB 1ARKA 3OW2S 3VRZA 4TVRA 1UHCA 5I11A 3CXCS 1M1FA 4XTZA 1RAGB 4M78A 5KYWA 1ZA2B 3OMCA 1JU5C 4M7AE 3URGA 3QYGB 5HKCA 4FW2A 3M0PA 2OTLT 2KT1A 2V8JA 3VS2A 1WXBA 4CC2A 5GANf 4LN2A 3MP8A 3QSUA 2RK1A 1M1KU 2RJCA 3PGGA 1CKBA 4LDVA 1N8RC 1WHHA 1VQ4A 2C0OA 1RAAB 3U23A 3HHTB 2CUBA 1ZQ1A 2CP2A 5LJ3e 3CCMQ 2O9VA 3CCUQ 1W4SA 1F1BB 1NE8A 1X43A 3O8VA 2LQKA 3QKJA 4RMOA 2MI6A 2E1HA 2ZGWA 4BE2A 2P4TA 3WXMB 1MNDA 1VQ6A 1LCKA 2RQWA 3MEWA 1UGRB 5FU7C 2NWMA 5GMKi 3CEYA 4F7UF 1K9AA 4XK8E 1VUBA 1GXIE 2DJQA 2DA9A 4EMHA 5GAMd 3RNJA 1YHQT 1QQJA 1VYTA 5I22A 1Q82U 4KRTA 2KE9A 1VQKQ 2KRMA 1RACB 1FMWA 1G5VA 1YJWA 1M3CA 4NL3A 1VQLQ 4M7DB 1VQLT 2QDYB 2X3XD 4PK4A 3O5ZA 5CR2A 2BZXA 4HCZA 3GNGA 1WJRA 4JJNK 1K9MU 3CCUA 1MGQA 1WNLA 3GP8A 4OB1B 2DLPA 2M0OA 1R0BG 2X4JA 4NS5A 5J26A 2E64A 4OB3B 3HRTA 4M7DC 2FPFA 5D6XA 2EFIA 1KC8R 3VV0A 1M2OA 1VQNQ 4AMCA 3A8HB 2YLCA 4V2SA 5GJWB 1WXTA 2IVWA 2KYBA 3N5BB 1OOTA 3A8OB 1ZSGA 5GANj 1GFDA 4DEYA 2RO0A 3OYNA 1T0HA 2E10A 1YWPA 2DXCA 2OX7A 5CKBA 1O9SA 2GFAA 1TS9A 5LJ3h 4C8QF 4LUEA 1JQQA 1JRIA 1VQMA 3RUXA 5GAOr 4BDZA 3CMEQ 4HT9A 4ORZA 5HK3A 1XJWB 1WYXA 5IXFA 5CKHA 1RAHB 1YI2A 1Q81R 4J9EA 3SD4A 1WQWA 5FW9A 2DVEA 5FU6B 1I4K1 2ESWA 2JNGA 2VVKA 4WTOB 2FL7A 2LRQA 2YLBA 1JJ2P 2YUPA 3JCMQ 1JB0E 4RG8A 1QVPA 2C06A 3OYDA 5IAYA 2MF2A 1Q95G 3VS1A 1R77A 2YXYA 3V7RA 3J81E 1BIAA 1SHFA 5FWCA 2XD0A 2RHIA 3G71T 3ASKA 1Y07A 3RIRA 1Q86R 2CZ7B 1BI1A 1TTHB 3LX7A 3PVLA 4RTTA 1Y96A 2L5QA 4NOYA 3EFOB 4N0AC 4DBFA 2DEUA 2CP0A 1W2BA 2QK0A 1TUDA 3HRUA 3CCJA 4C5GA 2PVGB 3CXCP 4J7IA 2JOYA 3TEEA 4DBHA 1QCNA 4MZPA 3TSWA 2ZPFB 2XMFA 1BKBA 4M7DG 1X6OA 5FRNA 4PJJA 4M75E 9ATCB 1AWWA 2JMAA 1MHNA 4C92C 2NYSA 4LDXA 4C0DC 1GCQA 2CYZB 4XTYA 3EGXA 1HYOA 2YT6A 5DY9A 1VQ9T 2MIOA 2LQWA 2CGHA 2EPDA 4RTVA 2LQNA 5IN1A 4CC3A 2HEQA 4BACA 4C0ZA 1ZSZA 3DB4A 2KRSA 1MUZA 1N8RR 5J3BA 2RI2A 4HCBA 2HQXA 3CQTA 5DLQE 1IHVA 3OB9A 2RJDA 3L2QA 2DYIA 3CC2A 1QVFS 5D7UA 5LJ5g 4X9CA 3RMSA 3VUBA 4R55A 3JCMh 1Z9ZA 4C0GA 1BCMA 1YCSB 2E65A 3RKYA 4BI8B 3META 3CPFA 2BE9B 4MDWA 1Q81C 4BY6B 2DIGA 4J7FA 2PVDB 5A2QE 4ATOA 1X01A 3SHWA 3G1JA 2B8AA 2ED0A 2KT8A 4E2FB 4DA4A 3DKMA 3EG9A 2A37A 4N4GA 3X20B 2LDMA 2VC8A 2EYXA 2MYSA 3MJXA 4M78G 4C92F 1M90U 4A4GA 2EQIA 1EX4A 3RKWA 2WSFE 4PLLA 4PJOG 2RJEA 1WGSA 3LLRA 3M57A 5A0GA 1VQPA 1VQ4Q 2QGGA 2BTTA 1H3HA 2OI3A 2YDLA 3QZ9B 2EJGA 3GNFB 4JRPA 4XU3A 4OMFB 5GAOn 1Q7YC 4M7AA 3PFSA 4C8QE 1N8RU 2EJ9A 3G7ZA 4OVAA 4BI4A 1UHFA 4C92E 3C94A 1S72A 3VS0A 1GCQC 1IHWA 4EMGA 4BB7A 3I35A 4E47A 1B34B 1QWFA 4VUBA 1WPYA 2DD5A 2FPDA 4M75G 4C8QB 5GMKl 3HRSA 4J6YA 4L5GA 3KXTA 3A1PA 1KD1C 2EAYA 3MCAB 3G4ST 3E2UA 2O4XB 3CCQQ 4BI3A 3G71A 2RB6A 6AT1B 3VS4A 1PHTA 3H0HA 3Q1JA 2E3IA 1K76A 2DMOA 1PCXA 3OYJA 4A4HA 5KYNA 4EMKB 1ZUKA 4II1A 1RAFB 1NJIR 4M7AD 5ECAA 1KFZA 3DLMA 1RADB 5FU6C 5FROA 3ZBDA 4A4FA 1M2VB 3NTKA 2RQTA 5KE3A 3SWNA 4KUDK 2FRWA 1ZBXA 2HD0A 3OMGA 5AYFA 1IGUA 3X24B 3UWNA 2NUTA 1M90R 2Y90A 5CK9A 3M0RA 3ZL7C 3MKDA 3I55Q 1G3YA 2RHYA 4PJOF 1M8VA 2A3LA 3OYFA 1OZ2A 2DO3A 2HQHA 1YIJA 4KGXB 2MOXA 2MWOA 4E7SA 1N9RA 1FWZA 1JJ2A 3CC7A 4HVVA 2FYKA 3UA7A 1W6XA 1KSWA 2KQWA 4LE9A 4F16A 2X35A 2GFUA 1U1TA 2D0QB 2HKQB 1YITT 3SDZA 4GLMA 2K6DA 2QGFB 3GIBA 1OEBA 3G4SA 2CP5A 1PKSA 1ZLMA 3VUZA 4BUGA 3CXCA 1TWBA 1NJIU 4QVZA 2L0AA 4JUVA 2D0NA 4XTWA 1NPPA 4HA8A 1VQ9A 1M1GA 1V1CA 1WDXA 2V8IA 4M78D 1B7TA 3G4SQ 2KY9A 2HBPA 4FCYA 5GAN5 3JRZA 2QEXA 2BZYA 2EQUA 5LJ3j 2ZPHB 3E19A 1M3BA 2RJFA 1VQKT 1QMCA 3M55A 3L2RA 4EDUA 1D1CA 4E6RA 3RERA 1WHLA 1PWTA 2LP5A 4WCIA 1VQ4T 3V7CA 5CKFA 5KCHA 2RHXA 3FC3A 2GBQA 1RUWA 1VQ7Q 1NM7A 1YJWT 4A53A 2K4YA 2DAQA 4KH0B 2X9HA 2K3XA 1QVFP 2J7IA 2JMCA 4F17A 4LUDA 5GAMf 3JCMV 2COYA 2FG0A 4M77E 1MMGA 2R57A 2F2VA 3NTHA 3X26B 4DEXA 4C92G 1N6AA 4B9WA 4PJOC 4GBQA 4HCCA 2RMOA 3SB2A 1M3AA 2RQVA 5KYXB 3FRNA 3OSVA 3EAEA 2OTLQ 1WI7A 5GANe 1YNZA 2FEIA 4Q5WA 3JB9D 3FJPA 4M78C 3QG1A 2RQUA 4F7UA 2ZZDA 2LCCA 2QXFA 4ME7A 1E7OA 5A0LA 5GAN3 3CC4Q 3J7AF 3P8BB 3T9NA 3BDUA 1T3LA 2DBKA 2RH2A 1AHJB 1OX9A 2HSEB 2K2MA 1VYVA 1TUGB 3HFOA 4XAXB 4LNPA 3C4SA 1UJYA 2LT4A 4J9BA 5CO7A 2EGEA 5L23A 1VQMT 1Q82R 1WHKA 2DTIA 2EGAA 4E7JA 1B07A 2KYMA 2G6FX 2OTLA 2KGTA 4OMQA 2KBTA 1TSFA 2BE7D 1Y0MA 2FHDA 1PM3A 3VRYA 2LVMA 4RKUE 4M7AB 3LWIA 2DRKA 3NMZC 1PRLC 1U3OA 2K3YA 1KD1R 1K73R 4M78E 4XU1A 5CVIA 2Y4YA 4C8QD 3MEUA 3OYEA 2EYWA 4AT1B 3J80E 3LH5A 3M53A 4MDXA 1PG5B 4PJOD 1UG1A 4C8QA 3UATA 4ELZC 3CCEA 2M02A 3PIOA 4ELYC 4J9HA 1VQOQ 2ZPBB 1VQPQ 3NTIA 2JTFA 2VXEA 1I0CA 2DIQA 4PFPA 4JZ3A 3TU4K 4M75B 1AT1B 2P0PA 5FU7B 1RAIB 1CKAA 1EZZB 2CT4A 4OB2B 1T3SA 5FWBA 1K8AC 3PMIA 2F2XA 1I5LA 3M0SA 3OY9A 1RI9A 1M9SA 1ABOA 1ZX6A 4DOWA 3F70A 4RG2A 2W10A 1YIJQ 1UUEA 1AVZC 2EVRA 1QLYA 3GBQA 4R56A 2QA4A 3M58A 1JXOA 3CPWA 1OQKA 1KG1A 4DQ2A 1B34A 2I2LA 2CKKA 2IIMA 5M9OA 4C92A 5LL6S 2LJ1A 2O4XA 1DJ7B 4UC4A 4D6WA 4Z02A 1A0NB 5LJ5d 2KXCA 4A63B 5IXBA 1G2BA 2DF6A 4ZN1A 7AT1B 2IG0A 5GAN7 2O01E 2FRYA 2PUOB 4EMKA 3OYAA 1FYNA 1WA7A 2X4XA 1YJWQ 2HMAA 2NUTB 1M1KC 2F1LA 1LPLA 2A28A 3OSSC 4Y28E 4ZGEB 2K3BA 1S1NA 3BE3A 3KFVA 2CT3A 1D0YA 2DYBA 1SRMA 5GAMe 1IO6A 2EQJA 4ZGDB 1VIEA 1D1AA 2IPOB 2KNBB 4BDYA 2O9SA 3CCJQ 1TOVA 1UECA 3L2VA 1SKUB 3I5SA 1GBQA 2KRNA 1G83A 4MZMA 4X1VA 5GAN4 3BFMA 3FEOA 1BBZA 4JDSA 4E7KA 1U06A 1KC8C 1K1ZA 5CCAA 4LDUA 2VV5A 1UFFA 3R6OA 2PNIA 3UPUA 3HP9A 2DE0X 1PKTA 1QW1A 2E5QA 2DFUA 2DM1A 1IGQA 1W1FA 3G71Q 2COWA 1VQPT 1HJDA 4R0KA 1KQSA 1RABB 3M4YA 3IQLA 4RTZA 1I5OB 1IRXA 4E7LA 3CCJT 2O88A 3HFNA 4O5VA 1YJ9T 2BUDA 5KCOA 1OV3A 4C0FA 3AHUA 1YJNA 1JO8A 4QT7A 5EG2A 3OW2A 1PSEA 2ATCB 1RL2A 1KHIA 1VOMA 2LX7A 2FZKB 3NFCA 2EQMA 4JS4A 4QQ6A 4OMOA 1X69A 4OMNA 2DBMA 2OTJT 3MP6A 3VYHB 3A98A 1QVGA 2HSPA 3GPLA 1X27A 4JJDA 4J9CA 2JZ2A 1Q7YU 1WQ7A 1E6HA 2DNUA 1VQ5Q 4M75F 2BZ8A 4KUIA 1S72Q 4JJCA 1OYXA 2HQEA 2ZPGB 1OU8A 3ME9A 4AFUC 1BIBA 2ROTA 2DILA 2QI2A 5GANh 4IIMA 3JB9J 1PD0A 1XQHA 1Q86C 1FMVA 1YWOA 3CCST 2CP7A 4AFQC 4CC4B 1UB4A 1H8KA 2KR3A 1VQ7T 1BU1A 1X75C 2ZAEA 2P0KA 1PSFA 4C92B 3MO8A 2L3QA 2LJ0A 2KI7A 4M7AF 2PTKA 3D7SB 5HK0A 3UF4A 2OAUA 4M7DF 2KAFA 5KH6A 1UGVA 1KC8U 2YHTA 1XTDA 3JCMJ 1VQ5T 1H641 4CI0C 2L3PA 2WSCE 4K11A 2R5MA 4D8KA 2RHZA 3EG1A 4DBRA 4RUGA 3CCLQ 1YP5A 2FZCB 2VB6A 3QYHB 3SFMA 3I55A 1UE9A 4M77F 3EFSA 3QWXX 5J39A 3C0CA 4FYYB 3M4GA 4O6JA 2D1XA 2MAMA 1JBMA 1QVGP 1Y96B 3CBOA 1Y71A 1W2BP 4RTWA 3VS3A 4OMLA 4PFOA 2A08A 4F04B 2QQAA 4FSSA 2H8HA 3G6ET 2E41A 3PNWC 2LZ6B 3H6ZA 2J06A 5IHKA 3VS6A 3JCMf 3OYMA 1WZOA 2HAXA 2COZA 1BCOA 1ZUUA 2ECZA 3SEMA 3H0IA 3RKXA 3AT1B 4IUUA 2AZVA 5CAIA 1MV0B 2VKNA 4XTUA 2KXDA 4HVWA 1VQLA 2DJZA 3CMAA 3HSBA 2YUQA 2VWFA 2P84A 2K7AA 3DLLA 2VYTA 3CCQA 2GTJA 2HCKA 1UGPB 1IB8A 4FYWB 1VQ8A 1WJQA 1AD5A 3CD6A 3OW2P 1YJNQ 1NZ9A 3CD6Q 2JUFA 3JCMW 2AT1B 1RAEB 4ZN3A 1HK9A 2RPNA 2DERA 3I56T 2VUBA 4X34A 3JB9F 2QQRA 1U5SA 1Z9QA 2AIRB 3C95A 1YITA 3TSZA 1NEGA 1UEBA 3P8DA 1K73U 1M2VA 2JS2A 4ZTJA 2CZ1B 2QG9B 3I55T 2A7YA 4M77G 4BE1A 4F14A 1NPRA 2LTOA 3EGDA 1WHGA 4GY5A 1BK2A 2XI9A 3L2ZA 1SHGA 2B86A 4NL2A 1NEBA 4Y92A 1OZ3A 4C8QC 2RM4A 1N5ZA 1GCPA 3UA6A 1RI0A 2GF7A 1XOVA 2DX1A 4PJOE 1SSFA 2EW3A 3EH2A 3M0TA 2X51A 3PT9A 3G6EQ 5CKEA 3FLGA 2DETA 1QCOA 3QWYA 2XKOC 1VQKA 1SRLA 4M75D 4ZGJB 3QDFA 4OB0B 1I1JA 2DEQA 2K5FA 1M1KR 1ZBJA 5GAN2 3RDVA 1OULA 3LWHA 1AWOA 1WHMA 3CMAQ 4HXJA 1Y7XA 4J83A 3V8LA 2PQWA 2DTOA 2DRMA 1HXDA 3EGUA 4J9IA 1SSHA 2MK5A 1R0CB 4JRQA 2RA2A 3JB9I 2CP3A 4M7DD 3V7SA 3PMTA 1HSQA 2RK2A 2EQKA 1AZGB 3EG2A 1AWXA 3FDRA 2FPEA 2RF0A 3M56A 2MMPA 1QVFA 4LDWA 3I56A 2MPXC 1X6BA 2X4YA 1PNJA 3CCSA 4M77B 2P0QA 2CUDA 4PJOB 1YITQ 3MPUB 5GANg 3OYLA 2HBWA 2KVQG 2F2WA 2QA4Q 4J6XA 4PLIA 4PKCC 4Y91A 3CCLA 5DLOA 3BW1A 4QVCA 1VQ5A 3G6EA 1WFWA 2G3RA 1NYFA 3CCMT 3EG0A 4FU6A 1M30A 2RI5A 4D8DA 1K9MR 2ED1A 1D0ZA 4M7AC 1VQMQ 1K0XA 2ENMA 2E6NA 2V8KA 5LJ3g 1MNEA 4OMMA 1SEMA 4M7DE 5D6YA 4A4EA 1VIFA 4FYXB 4IIOA 3OYIA 3CCVA 4RCCA 3H9NA 2QA4T 1PC0A 2NLUA 3LW5E 4YTLA 1BB9A 1LOJA 4JZ4A 2JVVA 5KE2A 2LT1A 3M0UA 4KBMB 3OYBA 1YFNA 4F7UG 2CH4W 3ER0A 1IREB 1VQNA 1J3TA 5I21A 1K9MC 3MEVA 1X2QA 1CSKA 1QWEA 2QEXT 5L8RE 1XNIA 3CPWS 2DK3A 2L2PA 2D8HA 3PVQA 3GF5A 2GTOA 3RESA 3V8JA 2YSQA 5KYUB 1D1BA 3EFOA 5FLXE 1O75A 1G3SA 3PIPA 4BE0A 1E6GA 3FB9A 1FXXA 2ZPIB 2FB7A 2LCSA 2JTEA 5A0DA 1LNXA 4M77D 2QDLA 3JB9H 2Y4XA 1SF9A 3E1SA 3EHQA 2VGNA 3JCMb 1P92A 2JM9A 2BIVA 1IXDA 1YCYA 5LJ5f 5FRMA 2JT4A 2QQBA 3OA6A 3HTRA 2HL5C 2QTVA 4MMLA 4XQ3A 4A54A 5GMKm 1M90C 3CCET 2VXFA 1R8OB 3CC2T 1QKXA 1TXQA 1X6GA 3EGXB 1WX6A 1BYMA 1ZSZC 2CREA 4JJBA 5HCKA 1ABQA 2W0ZA 1GBRA 3OS0A 5DM7R 3CPWP 4F7UE 2LX9A 2AK5A 4LDYA 3UDCA 2LNVA 3RR6A 4HT8A 1JEGA 2YWWA 5LJ5h 2XICA 4RTYA 2RN8A 3CMET 2XG8D 5C0MA 3L2UA 1IZ6A 2OJ2A 3QBYA 1C1AA 2EIFA 5D6WA 4PNOA 1U8RA 3HPWA 4E7ZA 2DTHA 2ZPEB 2XIDA 1Q82C 3OYCA 2X4WA 4OGCA 2DL5A 4ZNXA 2XDPA 2ROLA 3A8MB 3QPHA 4J9FA 4EMKC 1UTIA 2HNIA 3M5AA 5GAOq 3QO3A 1KJWA 2GCXA 3LH0A 3OS5A 4RTXA 3NHNA 3OBWA 8AT1B 1K8AU 4XTXA 3EH1A 1I8FA 4EPCA 1H3ZA 2M1HA 3S3OA 1KQSS 2QASA 1EFNA 4A4KA 2DL4A 1M5Q1 3OBYA 4C0DB 4ANJA 4XU0A 3LGFA 3CCEQ 2V1QA 2WSEE 2C0IA 4N4HA 1S72T 4XTVA 4FSXA 1YI2T 1AEYA 2DL3A 1V76A 3QUIA 2CSIA 1TUCA 3CCMA 1KIKA 3H8ZA 2OTJQ 4JPBW 4FL6A 2DXUA 5GMKh 1ACMB 2AHJB 5AT1B 3CC7T 4BY6C 1QVGS 3CCRT 3CBMA 3OYKA 1FMKA 3M54A 5GAOm 2FO0A 3JCMP 4LXCA 1M27C 1G3WA 1B3QA 1UJ0A 4HKEA 1VQ6T 1KK7A 3GLXA 3EHRA 1YJ9Q 1M4ZA 1D3BB 5EC7A 3EGDB 1RLPC 4KULA 2CDTA 5CQYA 4CC7A 3CC4A 3QJ6A 3JCMg 2GQIA 3JCMc 1KD1U 1ZSZB 2AZSA 4GLKA 5I2SA 2EKOA 1YN8A 2F5TX 1VA7A 2KMTA 4IKFA 1K4US 1OI1A 2CS7A 4QQDA 2D9TA 2PVOB 3CCLT 2C0TA 4KH1B 2J6OA 2AKLA 2JXBA 3UT1A 3RBBB 3CCUT 2LQ8A 3OYGA 2YRVA 3X25B 4LD9K 1TG0A 4J5YA 1M8MA 4HCKA 2HDAA 2XK0A 1D0XA 3FJ5A 3QDRB 3MP1A 1HD3A 2QYZA 3HKSA 1SG5A 2BKDN 2VASA 3M0QA 1VQ7A 5KYUA 3I9QA 1NG2A 1OX8A 2R5AA 4HVUA 2L3RA 2K5LA 1ZHIA 2KK4A 3R6NA 3OYYA 3JV3A 4C92D 3WVDB 1I81A 2PU9B 1YHQA 1G8XA 1LJOA 2O31A 1NLOC 1D09B 4J9GA 3QIIA 4ESRA 1AWJA 1X2KA 2KDSA 5CIUA 1V29B 3JCMd 4MMKA 2E12A 3WVEB 2A0FB 3QXEB 4AG2C 1NLPC 1OU9A 4XU2A 5CKDA 2QAZA 1VQ8T 1GL5A 4FW1A 3FIFA 1N27A 2CZ0B 5IH2A 3JAME 2YRDA 2M9UA 3H0FA 2E5KA 1MV3A 2SRCA 1AZEA 1PD1A 1WJSA 1MMDA 5KYXA 4JS5A 2DXBA 2CH4A 5GAN8 2XDBA 4N0AA 2EYZA 4C5EA 1Q81U 2JS0A 2WACA 2XU8A 2L3SA 3V8KA 2DPPB 2KEAA 2Z0WA 4RCBA 5GAOp 3CCQT 3MEAA 2J6FA 2HL3A 4PJOA 1UDLA 3BDLA 3P8HA 1RLQC 2EYQA 3A5ZB 2F69A 3C12A 2YUOA 3CMAT 2FVUA 2JTMA 3GOXA 1QP2A 2O2OA 3EG9B 4M7AG 4FM4B 2LMJA 1AOJA 3ZFJA 3ZEHA 1YHQQ 3VS5A 1NYGA 2R58A 3I5RA 3NPFA 1ZUYA 3OS1A 2QEXQ 2J05A 2JJ9A 3LYIA 3CCRQ 3CCSQ 3ULRB 1KQ2A 3CC7Q 3CC4T 2E4HA 2VGMA 2M0YA 2K79A 1QKWA 1W2BS 4JLIA 4JRKA 2K57A 4FYVB 1K8AR 1FX7A 2KROA 1TH7A 2HKNA 3MHXA 2SEMA 4JRIA
chains in the Genus database with same CATH topology
3LH5A 1AZGB 3EG2A 1UG1A 1AWXA 3VS1A 2FPEA 2RF0A 3UATA 1SHFA 5FWCA 4J9HA 2OAWA 3TVTA 3EG3A 1X6BA 1I0CA 1PNJA 3PVLA 4RTTA 4JZ3A 2CUDA 2X3WD 2HBWA 4Z88A 2F2WA 1WIEA 1CKAA 1TUDA 1K0SA 2CT4A 5GJVB 1T3SA 5FWBA 3REBB 3TSWA 2XMFA 1WLPB 2RNAA 2F2XA 2NUZA 1WFWA 3M0SA 3H41A 1NYFA 1RI9A 3EG0A 1ABOA 1M30A 4D8DA 1ZX6A 2ED1A 2ABLA 2JMAA 2W10A 1AWWA 1UUEA 5IHIA 1K0XA 1JXMA 1AVZC 2ENMA 1QLYA 2EVRA 3GBQA 4Z8AA 1GCQA 1JXOA 4OMMA 1OPKA 1SEMA 2JW4A 2LNHB 2YT6A 4IIOA 2MIOA 1W70A 2IIMA 4EIKA 2LQWA 2EPDA 4RTVA 2LJ1A 2LQNA 1QCFA 4CC3A 2HEQA 1BB9A 4JZ4A 2DVJA 3M0UA 2KRSA 1A0NB 1MUZA 2K9GA 2KXCA 3PE0A 3REAB 3CQTA 5IHNA 2CH4W 1J3TA 4A63B 5IXBA 1X2QA 1CSKA 1G2BA 1QWEA 2DF6A 2EKHA 2JM8A 2L2PA 2D8HA 3PVQA 1Z9ZA 2FRYA 2GTOA 4AFZC 1FYNA 4J9DA 1YCSB 2AKKA 2YSQA 1WA7A 2EGCA 1E6GA 2LCSA 2JTEA 2LJ3A 2A28A 2QDLA 2K3BA 3SHWA 1S1NA 3EHQA 2ED0A 2JM9A 2KT8A 3KFVA 2CT3A 2JT4A 2A37A 2DYBA 1SRMA 1Y57A 1IO6A 2A36A 2I0NA 1GFCA 2EYXA 2KNBB 2D8JA 1QKXA 2O9SA 1X6GA 4M4ZA 1WX6A 1UECA 3I5SA 1GBQA 2KRNA 1G83A 4X1VA 2EQIA 2CREA 1BBZA 4JJBA 5HCKA 1U06A 1ABQA 2W0ZA 1K1ZA 1GBRA 1H92A 2DL7A 2M51A 2AK5A 2V1RA 1UFFA 2BTTA 2PNIA 1VYUA 2OI3A 1H3HA 2DE0X 1PKTA 1JEGA 2YDLA 2DM1A 1W1FA 4RTYA 2DL8A 2RN8A 3THKA 1HJDA 2EBPA 2OJ2A 1UHFA 4R0KA 3VS0A 1GCQC 3IQLA 4RTZA 3I35A 1QWFA 2O88A 1OV3A 1JO8A 2DL5A 4ZNXA 2ROLA 4QT7A 2FPDA 4J9FA 1UTIA 1KJWA 2LX7A 4OMOA 4RTXA 3NHNA 1X69A 3VS4A 3VS7A 1PHTA 4OMNA 3H0HA 2DBMA 1SPKA 1K76A 3A98A 2HSPA 2DMOA 1X27A 4JJDA 4J9CA 1EFNA 2DL4A 1E6HA 2J6KA 2DNUA 1T0JA 1ZUKA 2CSQA 2BZ8A 2V1QA 4JJCA 4OMPA 2C0IA 5ECAA 1KFZA 4AG1C 4AFUC 2PZ1A 2ROTA 2DILA 1AEYA 1PRMC 2MCNA 1GRIA 2DL3A 2RQTA 4IIMA 2CSIA 1I07A 4Z89A 1TUCA 1KIKA 2FRWA 4RTUA 1YWOA 2GNCA 4JPBW 4AFQC 4CC4B 1H8KA 2KR3A 1BU1A 2RQRA 2L3QA 2LJ0A 1FMKA 2PTKA 2FO0A 3M0RA 3ZL7C 3UF4A 1WXUA 1M27C 3NGPA 1OPLA 1UGVA 1B3QA 1UJ0A 2GGRA 2L3PA 2EYYA 4AFSC 2YUNA 2P4RA 2MOXA 3EHRA 4K11A 1ARKA 5EC7A 1RLPC 2CDTA 4CC7A 3VRZA 4D8KA 3EG1A 1UHCA 5I11A 4HVVA 3UA7A 2GQIA 4RUGA 1JU5C 2AZSA 1YP5A 1YN8A 1VA7A 1K4US 3M0PA 1UE9A 1W6XA 1KSWA 2KT1A 3QWXX 3C0CA 3VS2A 1WXBA 4LE9A 4CC2A 2D1XA 4LN2A 4F16A 2C0TA 2J6OA 1CKBA 4GLMA 4RTWA 2AKLA 2C0OA 2K6DA 4OMLA 2JXBA 3VS3A 3U23A 2CUBA 3RBBB 1OEBA 2A08A 4FSSA 1PKSA 2H8HA 2O9VA 1TG0A 1ZLMA 1M8MA 4HCKA 2HDAA 2LZ6B 2J06A 5IHKA 1X43A 3FJ5A 3VS6A 2L0AA 1HD3A 1ZUUA 2ECZA 3SEMA 3H0IA 2D0NA 2AZVA 1LCKA 1MV0B 1V1CA 2RQWA 2KXDA 2VKNA 3M0QA 1WDXA 4HVWA 2NWMA 3I9QA 1NG2A 1K9AA 4HVUA 2YUQA 2DJQA 2VWFA 2DA9A 2BZYA 2K7AA 3RNJA 1VYTA 3R6NA 1M3BA 5I22A 3JV3A 2GTJA 4KRTA 2HCKA 2KE9A 2KRMA 2O31A 1NLOC 4E6RA 4J9GA 4ESRA 1AWJA 1M3CA 1AD5A 1PWTA 1X2KA 2LP5A 4WCIA 4AG2C 1NLPC 2GBQA 1RUWA 1NM7A 1GL5A 2X3XD 2RPNA 5IH2A 3H0FA 2E5KA 1U5SA 1Z9QA 3O5ZA 2J7IA 1MV3A 2JMCA 3TSZA 1NEGA 4F17A 2SRCA 1AZEA 2BZXA 4LUDA 2CH4A 2FG0A 2JS2A 2F2VA 2EYZA 4F14A 4DEXA 2DLPA 2JS0A 4GBQA 1BK2A 2RMOA 1M3AA 1SHGA 2B86A 2RQVA 2L3SA 1NEBA 2FPFA 4Y92A 1WI7A 2KEAA 1YNZA 2FEIA 1N5ZA 1GCPA 3UA6A 2J6FA 1UDLA 2RQUA 1XOVA 2DX1A 1RLQC 2EW3A 2YUOA 5GJWB 1WXTA 3M0TA 1E7OA 2KYBA 1OOTA 1ZSGA 1T3LA 2DBKA 2O2OA 1GFDA 4DEYA 2K2MA 1VYVA 1T0HA 4LNPA 1YWPA 1UJYA 2LMJA 3QWYA 1AOJA 1SRLA 4J9BA 2EGEA 5L23A 3VS5A 2EGAA 1NYGA 3I5RA 1JQQA 3NPFA 4LUEA 1B07A 1ZUYA 2KYMA 2G6FX 2KGTA 1I1JA 4OMQA 2KBTA 1Y0MA 2J05A 1ZBJA 4ORZA 3VRYA 1AWOA 4HXJA 3ULRB 1WYXA 5IXFA 2DRMA 2DRKA 3EGUA 4J9EA 5FW9A 2M0YA 1SSHA 2K79A 4J9IA 3NMZC 1PRLC 1QKWA 1U3OA 2ESWA 2VVKA 2KROA 2YUPA 2SEMA 2EYWA 1HSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH5 A;  1AZG B;  3EG2 A;  1UG1 A;  1AWX A;  3VS1 A;  2FPE A;  2RF0 A;  3UAT A;  1SHF A;  5FWC A;  4J9H A;  2OAW A;  3TVT A;  3EG3 A;  1X6B A;  1I0C A;  1PNJ A;  3PVL A;  4RTT A;  4JZ3 A;  2CUD A;  2X3W D;  2HBW A;  4Z88 A;  2F2W A;  1WIE A;  1CKA A;  1TUD A;  1K0S A;  2CT4 A;  5GJV B;  1T3S A;  5FWB A;  3REB B;  3TSW A;  2XMF A;  1WLP B;  2RNA A;  2F2X A;  2NUZ A;  1WFW A;  3M0S A;  3H41 A;  1NYF A;  1RI9 A;  3EG0 A;  1ABO A;  1M30 A;  4D8D A;  1ZX6 A;  2ED1 A;  2ABL A;  2JMA A;  2W10 A;  1AWW A;  1UUE A;  5IHI A;  1K0X A;  1JXM A;  1AVZ C;  2ENM A;  1QLY A;  2EVR A;  3GBQ A;  4Z8A A;  1GCQ A;  1JXO A;  4OMM A;  1OPK A;  1SEM A;  2JW4 A;  2LNH B;  2YT6 A;  4IIO A;  2MIO A;  1W70 A;  2IIM A;  4EIK A;  2LQW A;  2EPD A;  4RTV A;  2LJ1 A;  2LQN A;  1QCF A;  4CC3 A;  2HEQ A;  1BB9 A;  4JZ4 A;  2DVJ A;  3M0U A;  2KRS A;  1A0N B;  1MUZ A;  2K9G A;  2KXC A;  3PE0 A;  3REA B;  3CQT A;  5IHN A;  2CH4 W;  1J3T A;  4A63 B;  5IXB A;  1X2Q A;  1CSK A;  1G2B A;  1QWE A;  2DF6 A;  2EKH A;  2JM8 A;  2L2P A;  2D8H A;  3PVQ A;  1Z9Z A;  2FRY A;  2GTO A;  4AFZ C;  1FYN A;  4J9D A;  1YCS B;  2AKK A;  2YSQ A;  1WA7 A;  2EGC A;  1E6G A;  2LCS A;  2JTE A;  2LJ3 A;  2A28 A;  2QDL A;  2K3B A;  3SHW A;  1S1N A;  3EHQ A;  2ED0 A;  2JM9 A;  2KT8 A;  3KFV A;  2CT3 A;  2JT4 A;  2A37 A;  2DYB A;  1SRM A;  1Y57 A;  1IO6 A;  2A36 A;  2I0N A;  1GFC A;  2EYX A;  2KNB B;  2D8J A;  1QKX A;  2O9S A;  1X6G A;  4M4Z A;  1WX6 A;  1UEC A;  3I5S A;  1GBQ A;  2KRN A;  1G83 A;  4X1V A;  2EQI A;  2CRE A;  1BBZ A;  4JJB A;  5HCK A;  1U06 A;  1ABQ A;  2W0Z A;  1K1Z A;  1GBR A;  1H92 A;  2DL7 A;  2M51 A;  2AK5 A;  2V1R A;  1UFF A;  2BTT A;  2PNI A;  1VYU A;  2OI3 A;  1H3H A;  2DE0 X;  1PKT A;  1JEG A;  2YDL A;  2DM1 A;  1W1F A;  4RTY A;  2DL8 A;  2RN8 A;  3THK A;  1HJD A;  2EBP A;  2OJ2 A;  1UHF A;  4R0K A;  3VS0 A;  1GCQ C;  3IQL A;  4RTZ A;  3I35 A;  1QWF A;  2O88 A;  1OV3 A;  1JO8 A;  2DL5 A;  4ZNX A;  2ROL A;  4QT7 A;  2FPD A;  4J9F A;  1UTI A;  1KJW A;  2LX7 A;  4OMO A;  4RTX A;  3NHN A;  1X69 A;  3VS4 A;  3VS7 A;  1PHT A;  4OMN A;  3H0H A;  2DBM A;  1SPK A;  1K76 A;  3A98 A;  2HSP A;  2DMO A;  1X27 A;  4JJD A;  4J9C A;  1EFN A;  2DL4 A;  1E6H A;  2J6K A;  2DNU A;  1T0J A;  1ZUK A;  2CSQ A;  2BZ8 A;  2V1Q A;  4JJC A;  4OMP A;  2C0I A;  5ECA A;  1KFZ A;  4AG1 C;  4AFU C;  2PZ1 A;  2ROT A;  2DIL A;  1AEY A;  1PRM C;  2MCN A;  1GRI A;  2DL3 A;  2RQT A;  4IIM A;  2CSI A;  1I07 A;  4Z89 A;  1TUC A;  1KIK A;  2FRW A;  4RTU A;  1YWO A;  2GNC A;  4JPB W;  4AFQ C;  4CC4 B;  1H8K A;  2KR3 A;  1BU1 A;  2RQR A;  2L3Q A;  2LJ0 A;  1FMK A;  2PTK A;  2FO0 A;  3M0R A;  3ZL7 C;  3UF4 A;  1WXU A;  1M27 C;  3NGP A;  1OPL A;  1UGV A;  1B3Q A;  1UJ0 A;  2GGR A;  2L3P A;  2EYY A;  4AFS C;  2YUN A;  2P4R A;  2MOX A;  3EHR A;  4K11 A;  1ARK A;  5EC7 A;  1RLP C;  2CDT A;  4CC7 A;  3VRZ A;  4D8K A;  3EG1 A;  1UHC A;  5I11 A;  4HVV A;  3UA7 A;  2GQI A;  4RUG A;  1JU5 C;  2AZS A;  1YP5 A;  1YN8 A;  1VA7 A;  1K4U S;  3M0P A;  1UE9 A;  1W6X A;  1KSW A;  2KT1 A;  3QWX X;  3C0C A;  3VS2 A;  1WXB A;  4LE9 A;  4CC2 A;  2D1X A;  4LN2 A;  4F16 A;  2C0T A;  2J6O A;  1CKB A;  4GLM A;  4RTW A;  2AKL A;  2C0O A;  2K6D A;  4OML A;  2JXB A;  3VS3 A;  3U23 A;  2CUB A;  3RBB B;  1OEB A;  2A08 A;  4FSS A;  1PKS A;  2H8H A;  2O9V A;  1TG0 A;  1ZLM A;  1M8M A;  4HCK A;  2HDA A;  2LZ6 B;  2J06 A;  5IHK A;  1X43 A;  3FJ5 A;  3VS6 A;  2L0A A;  1HD3 A;  1ZUU A;  2ECZ A;  3SEM A;  3H0I A;  2D0N A;  2AZV A;  1LCK A;  1MV0 B;  1V1C A;  2RQW A;  2KXD A;  2VKN A;  3M0Q A;  1WDX A;  4HVW A;  2NWM A;  3I9Q A;  1NG2 A;  1K9A A;  4HVU A;  2YUQ A;  2DJQ A;  2VWF A;  2DA9 A;  2BZY A;  2K7A A;  3RNJ A;  1VYT A;  3R6N A;  1M3B A;  5I22 A;  3JV3 A;  2GTJ A;  4KRT A;  2HCK A;  2KE9 A;  2KRM A;  2O31 A;  1NLO C;  4E6R A;  4J9G A;  4ESR A;  1AWJ A;  1M3C A;  1AD5 A;  1PWT A;  1X2K A;  2LP5 A;  4WCI A;  4AG2 C;  1NLP C;  2GBQ A;  1RUW A;  1NM7 A;  1GL5 A;  2X3X D;  2RPN A;  5IH2 A;  3H0F A;  2E5K A;  1U5S A;  1Z9Q A;  3O5Z A;  2J7I A;  1MV3 A;  2JMC A;  3TSZ A;  1NEG A;  4F17 A;  2SRC A;  1AZE A;  2BZX A;  4LUD A;  2CH4 A;  2FG0 A;  2JS2 A;  2F2V A;  2EYZ A;  4F14 A;  4DEX A;  2DLP A;  2JS0 A;  4GBQ A;  1BK2 A;  2RMO A;  1M3A A;  1SHG A;  2B86 A;  2RQV A;  2L3S A;  1NEB A;  2FPF A;  4Y92 A;  1WI7 A;  2KEA A;  1YNZ A;  2FEI A;  1N5Z A;  1GCP A;  3UA6 A;  2J6F A;  1UDL A;  2RQU A;  1XOV A;  2DX1 A;  1RLQ C;  2EW3 A;  2YUO A;  5GJW B;  1WXT A;  3M0T A;  1E7O A;  2KYB A;  1OOT A;  1ZSG A;  1T3L A;  2DBK A;  2O2O A;  1GFD A;  4DEY A;  2K2M A;  1VYV A;  1T0H A;  4LNP A;  1YWP A;  1UJY A;  2LMJ A;  3QWY A;  1AOJ A;  1SRL A;  4J9B A;  2EGE A;  5L23 A;  3VS5 A;  2EGA A;  1NYG A;  3I5R A;  1JQQ A;  3NPF A;  4LUE A;  1B07 A;  1ZUY A;  2KYM A;  2G6F X;  2KGT A;  1I1J A;  4OMQ A;  2KBT A;  1Y0M A;  2J05 A;  1ZBJ A;  4ORZ A;  3VRY A;  1AWO A;  4HXJ A;  3ULR B;  1WYX A;  5IXF A;  2DRM A;  2DRK A;  3EGU A;  4J9E A;  5FW9 A;  2M0Y A;  1SSH A;  2K79 A;  4J9I A;  3NMZ C;  1PRL C;  1QKW A;  1U3O A;  2ESW A;  2VVK A;  2KRO A;  2YUP A;  2SEM A;  2EYW A;  1HSQ A; 
#chains in the Genus database with same CATH topology
 4IUV A;  2PUK B;  4WF2 A;  1NBE B;  4QVD A;  5GAN d;  2OAW A;  3TVT A;  3EG3 A;  3OYH A;  2QQ9 A;  5LJ5 e;  3E9F A;  1TU0 B;  5LJ3 d;  2X3W D;  3JCM X;  1MMA A;  4IUR A;  4Z88 A;  4OF1 A;  3OS2 A;  4MZT A;  1WIE A;  2E70 A;  1K0S A;  4QKU A;  1LVK A;  5GJV B;  1Q7Y R;  2F5K A;  3REB B;  1WLP B;  3S6W A;  2RNA A;  2NUZ A;  2D6F A;  3VJP A;  2EJF A;  3H41 A;  4FIB A;  3CD6 T;  1YIJ T;  3CCR A;  2H3J A;  2ABL A;  4KT0 E;  5IT9 E;  5IHI A;  3CC2 Q;  1JXM A;  4Z8A A;  2V26 A;  4M75 A;  1YBY A;  3HL8 A;  2EWN A;  1OPK A;  2JW4 A;  2LNH B;  4L59 A;  5GAO l;  1W70 A;  4EIK A;  4M77 A;  3L42 A;  2RD1 A;  4ZTF A;  1QCF A;  4M78 F;  1U1S A;  5KYY A;  2DVJ A;  1VQ9 Q;  3JSC A;  3QHS A;  2K9G A;  2LCL A;  3PE0 A;  3REA B;  5IHN A;  4J8O A;  3CBP A;  1BI0 A;  1N9S A;  1EIF A;  2FZG B;  2EKH A;  2NUP A;  3LGL A;  2JM8 A;  1K73 C;  1KQS P;  1C0M A;  3TRE A;  3SWN C;  4C5I A;  4AFZ C;  4J9D A;  2DZ9 A;  3A8G B;  4KGV B;  2AKK A;  3CCV Q;  5HY6 A;  2EGC A;  2JN0 A;  1VQ8 Q;  2RI3 A;  4PFZ A;  3TCJ A;  2L8D A;  4FT2 A;  5GAM h;  4DBQ A;  2LJ3 A;  3PTA A;  4KGZ B;  3VKI A;  1MMN A;  5KYY B;  4FT4 A;  4QW2 A;  1Y57 A;  2XHC A;  2XDD A;  1UGQ B;  2A36 A;  2I0N A;  1GFC A;  3QZ5 B;  2DXT A;  4F7U B;  2D8J A;  2DKG A;  3KUF A;  5GAM j;  4M4Z A;  3VYG A;  2L89 A;  1BI3 A;  2CP6 A;  3M9Q A;  3A8L B;  2K2V A;  1H92 A;  2DL7 A;  2E3H A;  2QTX A;  3VU3 C;  1VQO A;  3I56 Q;  3JB9 G;  4M77 C;  3L1A A;  2LC4 A;  2M51 A;  2V1R A;  2QQS A;  4E7I A;  1YJN T;  2OTJ A;  1VYU A;  3CME A;  4IUT A;  4X9D A;  4B6M A;  2DL8 A;  3THK A;  2EBP A;  4N4I A;  1KHC A;  4OGE A;  3L2W A;  3DB3 A;  4M75 C;  4QQG A;  4BD3 A;  4CRI A;  2CZ6 B;  2YRC A;  4C5H A;  5GMK e;  4M7D A;  2E6Z A;  4IUQ A;  4J6W A;  1C6V X;  1WHJ A;  5C6S A;  4DOV A;  3RMQ A;  4E7H A;  4PJN A;  2KSS A;  3SWN B;  2M16 A;  2DZC A;  4P5N A;  3S3N A;  1ZA1 B;  1BI2 A;  3EFR A;  1D3B A;  5I2M A;  3VS7 A;  2H3E B;  3KBG A;  3TQ7 P;  1SPK A;  1VQN T;  1NJI C;  4PL6 A;  4C8Q G;  2ZCF B;  4B9X A;  3OQ5 A;  3CCV T;  3BY7 A;  2J6K A;  1G3T A;  1T0J A;  2GQV A;  2NUP B;  1YJ9 A;  1UGS B;  2CSQ A;  1VQ6 Q;  4IUP A;  4OMP A;  4AG1 C;  2PZ1 A;  3INZ A;  1PRM C;  2MCN A;  2RHU A;  1GRI A;  4L6V 5;  1JJ2 S;  5LJ3 f;  1I07 A;  4Z89 A;  4RTU A;  4PJL A;  1QP3 A;  2GNC A;  3JCM e;  2DD4 A;  4OP0 A;  1YI2 Q;  3X28 B;  5CQX A;  2RQR A;  2HZY A;  2MWP A;  1KQ1 A;  5LJ5 j;  5GAN 6;  1WXU A;  3NGP A;  4PJM A;  1OPL A;  5GAM g;  2K5I A;  1VQO T;  1Q86 U;  3M59 A;  2GGR A;  3QJY A;  2EYY A;  8ATC B;  5GMK j;  4AFS C;  2YUN A;  3E9G A;  2P4R A;  4JLG A;  4LD6 A;  3S3M A;  4M78 B;  5KYW B;  1ARK A;  3OW2 S;  3VRZ A;  4TVR A;  1UHC A;  5I11 A;  3CXC S;  1M1F A;  4XTZ A;  1RAG B;  4M78 A;  5KYW A;  1ZA2 B;  3OMC A;  1JU5 C;  4M7A E;  3URG A;  3QYG B;  5HKC A;  4FW2 A;  3M0P A;  2OTL T;  2KT1 A;  2V8J A;  3VS2 A;  1WXB A;  4CC2 A;  5GAN f;  4LN2 A;  3MP8 A;  3QSU A;  2RK1 A;  1M1K U;  2RJC A;  3PGG A;  1CKB A;  4LDV A;  1N8R C;  1WHH A;  1VQ4 A;  2C0O A;  1RAA B;  3U23 A;  3HHT B;  2CUB A;  1ZQ1 A;  2CP2 A;  5LJ3 e;  3CCM Q;  2O9V A;  3CCU Q;  1W4S A;  1F1B B;  1NE8 A;  1X43 A;  3O8V A;  2LQK A;  3QKJ A;  4RMO A;  2MI6 A;  2E1H A;  2ZGW A;  4BE2 A;  2P4T A;  3WXM B;  1MND A;  1VQ6 A;  1LCK A;  2RQW A;  3MEW A;  1UGR B;  5FU7 C;  2NWM A;  5GMK i;  3CEY A;  4F7U F;  1K9A A;  4XK8 E;  1VUB A;  1GXI E;  2DJQ A;  2DA9 A;  4EMH A;  5GAM d;  3RNJ A;  1YHQ T;  1QQJ A;  1VYT A;  5I22 A;  1Q82 U;  4KRT A;  2KE9 A;  1VQK Q;  2KRM A;  1RAC B;  1FMW A;  1G5V A;  1YJW A;  1M3C A;  4NL3 A;  1VQL Q;  4M7D B;  1VQL T;  2QDY B;  2X3X D;  4PK4 A;  3O5Z A;  5CR2 A;  2BZX A;  4HCZ A;  3GNG A;  1WJR A;  4JJN K;  1K9M U;  3CCU A;  1MGQ A;  1WNL A;  3GP8 A;  4OB1 B;  2DLP A;  2M0O A;  1R0B G;  2X4J A;  4NS5 A;  5J26 A;  2E64 A;  4OB3 B;  3HRT A;  4M7D C;  2FPF A;  5D6X A;  2EFI A;  1KC8 R;  3VV0 A;  1M2O A;  1VQN Q;  4AMC A;  3A8H B;  2YLC A;  4V2S A;  5GJW B;  1WXT A;  2IVW A;  2KYB A;  3N5B B;  1OOT A;  3A8O B;  1ZSG A;  5GAN j;  1GFD A;  4DEY A;  2RO0 A;  3OYN A;  1T0H A;  2E10 A;  1YWP A;  2DXC A;  2OX7 A;  5CKB A;  1O9S A;  2GFA A;  1TS9 A;  5LJ3 h;  4C8Q F;  4LUE A;  1JQQ A;  1JRI A;  1VQM A;  3RUX A;  5GAO r;  4BDZ A;  3CME Q;  4HT9 A;  4ORZ A;  5HK3 A;  1XJW B;  1WYX A;  5IXF A;  5CKH A;  1RAH B;  1YI2 A;  1Q81 R;  4J9E A;  3SD4 A;  1WQW A;  5FW9 A;  2DVE A;  5FU6 B;  1I4K 1;  2ESW A;  2JNG A;  2VVK A;  4WTO B;  2FL7 A;  2LRQ A;  2YLB A;  1JJ2 P;  2YUP A;  3JCM Q;  1JB0 E;  4RG8 A;  1QVP A;  2C06 A;  3OYD A;  5IAY A;  2MF2 A;  1Q95 G;  3VS1 A;  1R77 A;  2YXY A;  3V7R A;  3J81 E;  1BIA A;  1SHF A;  5FWC A;  2XD0 A;  2RHI A;  3G71 T;  3ASK A;  1Y07 A;  3RIR A;  1Q86 R;  2CZ7 B;  1BI1 A;  1TTH B;  3LX7 A;  3PVL A;  4RTT A;  1Y96 A;  2L5Q A;  4NOY A;  3EFO B;  4N0A C;  4DBF A;  2DEU A;  2CP0 A;  1W2B A;  2QK0 A;  1TUD A;  3HRU A;  3CCJ A;  4C5G A;  2PVG B;  3CXC P;  4J7I A;  2JOY A;  3TEE A;  4DBH A;  1QCN A;  4MZP A;  3TSW A;  2ZPF B;  2XMF A;  1BKB A;  4M7D G;  1X6O A;  5FRN A;  4PJJ A;  4M75 E;  9ATC B;  1AWW A;  2JMA A;  1MHN A;  4C92 C;  2NYS A;  4LDX A;  4C0D C;  1GCQ A;  2CYZ B;  4XTY A;  3EGX A;  1HYO A;  2YT6 A;  5DY9 A;  1VQ9 T;  2MIO A;  2LQW A;  2CGH A;  2EPD A;  4RTV A;  2LQN A;  5IN1 A;  4CC3 A;  2HEQ A;  4BAC A;  4C0Z A;  1ZSZ A;  3DB4 A;  2KRS A;  1MUZ A;  1N8R R;  5J3B A;  2RI2 A;  4HCB A;  2HQX A;  3CQT A;  5DLQ E;  1IHV A;  3OB9 A;  2RJD A;  3L2Q A;  2DYI A;  3CC2 A;  1QVF S;  5D7U A;  5LJ5 g;  4X9C A;  3RMS A;  3VUB A;  4R55 A;  3JCM h;  1Z9Z A;  4C0G A;  1BCM A;  1YCS B;  2E65 A;  3RKY A;  4BI8 B;  3MET A;  3CPF A;  2BE9 B;  4MDW A;  1Q81 C;  4BY6 B;  2DIG A;  4J7F A;  2PVD B;  5A2Q E;  4ATO A;  1X01 A;  3SHW A;  3G1J A;  2B8A A;  2ED0 A;  2KT8 A;  4E2F B;  4DA4 A;  3DKM A;  3EG9 A;  2A37 A;  4N4G A;  3X20 B;  2LDM A;  2VC8 A;  2EYX A;  2MYS A;  3MJX A;  4M78 G;  4C92 F;  1M90 U;  4A4G A;  2EQI A;  1EX4 A;  3RKW A;  2WSF E;  4PLL A;  4PJO G;  2RJE A;  1WGS A;  3LLR A;  3M57 A;  5A0G A;  1VQP A;  1VQ4 Q;  2QGG A;  2BTT A;  1H3H A;  2OI3 A;  2YDL A;  3QZ9 B;  2EJG A;  3GNF B;  4JRP A;  4XU3 A;  4OMF B;  5GAO n;  1Q7Y C;  4M7A A;  3PFS A;  4C8Q E;  1N8R U;  2EJ9 A;  3G7Z A;  4OVA A;  4BI4 A;  1UHF A;  4C92 E;  3C94 A;  1S72 A;  3VS0 A;  1GCQ C;  1IHW A;  4EMG A;  4BB7 A;  3I35 A;  4E47 A;  1B34 B;  1QWF A;  4VUB A;  1WPY A;  2DD5 A;  2FPD A;  4M75 G;  4C8Q B;  5GMK l;  3HRS A;  4J6Y A;  4L5G A;  3KXT A;  3A1P A;  1KD1 C;  2EAY A;  3MCA B;  3G4S T;  3E2U A;  2O4X B;  3CCQ Q;  4BI3 A;  3G71 A;  2RB6 A;  6AT1 B;  3VS4 A;  1PHT A;  3H0H A;  3Q1J A;  2E3I A;  1K76 A;  2DMO A;  1PCX A;  3OYJ A;  4A4H A;  5KYN A;  4EMK B;  1ZUK A;  4II1 A;  1RAF B;  1NJI R;  4M7A D;  5ECA A;  1KFZ A;  3DLM A;  1RAD B;  5FU6 C;  5FRO A;  3ZBD A;  4A4F A;  1M2V B;  3NTK A;  2RQT A;  5KE3 A;  3SWN A;  4KUD K;  2FRW A;  1ZBX A;  2HD0 A;  3OMG A;  5AYF A;  1IGU A;  3X24 B;  3UWN A;  2NUT A;  1M90 R;  2Y90 A;  5CK9 A;  3M0R A;  3ZL7 C;  3MKD A;  3I55 Q;  1G3Y A;  2RHY A;  4PJO F;  1M8V A;  2A3L A;  3OYF A;  1OZ2 A;  2DO3 A;  2HQH A;  1YIJ A;  4KGX B;  2MOX A;  2MWO A;  4E7S A;  1N9R A;  1FWZ A;  1JJ2 A;  3CC7 A;  4HVV A;  2FYK A;  3UA7 A;  1W6X A;  1KSW A;  2KQW A;  4LE9 A;  4F16 A;  2X35 A;  2GFU A;  1U1T A;  2D0Q B;  2HKQ B;  1YIT T;  3SDZ A;  4GLM A;  2K6D A;  2QGF B;  3GIB A;  1OEB A;  3G4S A;  2CP5 A;  1PKS A;  1ZLM A;  3VUZ A;  4BUG A;  3CXC A;  1TWB A;  1NJI U;  4QVZ A;  2L0A A;  4JUV A;  2D0N A;  4XTW A;  1NPP A;  4HA8 A;  1VQ9 A;  1M1G A;  1V1C A;  1WDX A;  2V8I A;  4M78 D;  1B7T A;  3G4S Q;  2KY9 A;  2HBP A;  4FCY A;  5GAN 5;  3JRZ A;  2QEX A;  2BZY A;  2EQU A;  5LJ3 j;  2ZPH B;  3E19 A;  1M3B A;  2RJF A;  1VQK T;  1QMC A;  3M55 A;  3L2R A;  4EDU A;  1D1C A;  4E6R A;  3RER A;  1WHL A;  1PWT A;  2LP5 A;  4WCI A;  1VQ4 T;  3V7C A;  5CKF A;  5KCH A;  2RHX A;  3FC3 A;  2GBQ A;  1RUW A;  1VQ7 Q;  1NM7 A;  1YJW T;  4A53 A;  2K4Y A;  2DAQ A;  4KH0 B;  2X9H A;  2K3X A;  1QVF P;  2J7I A;  2JMC A;  4F17 A;  4LUD A;  5GAM f;  3JCM V;  2COY A;  2FG0 A;  4M77 E;  1MMG A;  2R57 A;  2F2V A;  3NTH A;  3X26 B;  4DEX A;  4C92 G;  1N6A A;  4B9W A;  4PJO C;  4GBQ A;  4HCC A;  2RMO A;  3SB2 A;  1M3A A;  2RQV A;  5KYX B;  3FRN A;  3OSV A;  3EAE A;  2OTL Q;  1WI7 A;  5GAN e;  1YNZ A;  2FEI A;  4Q5W A;  3JB9 D;  3FJP A;  4M78 C;  3QG1 A;  2RQU A;  4F7U A;  2ZZD A;  2LCC A;  2QXF A;  4ME7 A;  1E7O A;  5A0L A;  5GAN 3;  3CC4 Q;  3J7A F;  3P8B B;  3T9N A;  3BDU A;  1T3L A;  2DBK A;  2RH2 A;  1AHJ B;  1OX9 A;  2HSE B;  2K2M A;  1VYV A;  1TUG B;  3HFO A;  4XAX B;  4LNP A;  3C4S A;  1UJY A;  2LT4 A;  4J9B A;  5CO7 A;  2EGE A;  5L23 A;  1VQM T;  1Q82 R;  1WHK A;  2DTI A;  2EGA A;  4E7J A;  1B07 A;  2KYM A;  2G6F X;  2OTL A;  2KGT A;  4OMQ A;  2KBT A;  1TSF A;  2BE7 D;  1Y0M A;  2FHD A;  1PM3 A;  3VRY A;  2LVM A;  4RKU E;  4M7A B;  3LWI A;  2DRK A;  3NMZ C;  1PRL C;  1U3O A;  2K3Y A;  1KD1 R;  1K73 R;  4M78 E;  4XU1 A;  5CVI A;  2Y4Y A;  4C8Q D;  3MEU A;  3OYE A;  2EYW A;  4AT1 B;  3J80 E;  3LH5 A;  3M53 A;  4MDX A;  1PG5 B;  4PJO D;  1UG1 A;  4C8Q A;  3UAT A;  4ELZ C;  3CCE A;  2M02 A;  3PIO A;  4ELY C;  4J9H A;  1VQO Q;  2ZPB B;  1VQP Q;  3NTI A;  2JTF A;  2VXE A;  1I0C A;  2DIQ A;  4PFP A;  4JZ3 A;  3TU4 K;  4M75 B;  1AT1 B;  2P0P A;  5FU7 B;  1RAI B;  1CKA A;  1EZZ B;  2CT4 A;  4OB2 B;  1T3S A;  5FWB A;  1K8A C;  3PMI A;  2F2X A;  1I5L A;  3M0S A;  3OY9 A;  1RI9 A;  1M9S A;  1ABO A;  1ZX6 A;  4DOW A;  3F70 A;  4RG2 A;  2W10 A;  1YIJ Q;  1UUE A;  1AVZ C;  2EVR A;  1QLY A;  3GBQ A;  4R56 A;  2QA4 A;  3M58 A;  1JXO A;  3CPW A;  1OQK A;  1KG1 A;  4DQ2 A;  1B34 A;  2I2L A;  2CKK A;  2IIM A;  5M9O A;  4C92 A;  5LL6 S;  2LJ1 A;  2O4X A;  1DJ7 B;  4UC4 A;  4D6W A;  4Z02 A;  1A0N B;  5LJ5 d;  2KXC A;  4A63 B;  5IXB A;  1G2B A;  2DF6 A;  4ZN1 A;  7AT1 B;  2IG0 A;  5GAN 7;  2O01 E;  2FRY A;  2PUO B;  4EMK A;  3OYA A;  1FYN A;  1WA7 A;  2X4X A;  1YJW Q;  2HMA A;  2NUT B;  1M1K C;  2F1L A;  1LPL A;  2A28 A;  3OSS C;  4Y28 E;  4ZGE B;  2K3B A;  1S1N A;  3BE3 A;  3KFV A;  2CT3 A;  1D0Y A;  2DYB A;  1SRM A;  5GAM e;  1IO6 A;  2EQJ A;  4ZGD B;  1VIE A;  1D1A A;  2IPO B;  2KNB B;  4BDY A;  2O9S A;  3CCJ Q;  1TOV A;  1UEC A;  3L2V A;  1SKU B;  3I5S A;  1GBQ A;  2KRN A;  1G83 A;  4MZM A;  4X1V A;  5GAN 4;  3BFM A;  3FEO A;  1BBZ A;  4JDS A;  4E7K A;  1U06 A;  1KC8 C;  1K1Z A;  5CCA A;  4LDU A;  2VV5 A;  1UFF A;  3R6O A;  2PNI A;  3UPU A;  3HP9 A;  2DE0 X;  1PKT A;  1QW1 A;  2E5Q A;  2DFU A;  2DM1 A;  1IGQ A;  1W1F A;  3G71 Q;  2COW A;  1VQP T;  1HJD A;  4R0K A;  1KQS A;  1RAB B;  3M4Y A;  3IQL A;  4RTZ A;  1I5O B;  1IRX A;  4E7L A;  3CCJ T;  2O88 A;  3HFN A;  4O5V A;  1YJ9 T;  2BUD A;  5KCO A;  1OV3 A;  4C0F A;  3AHU A;  1YJN A;  1JO8 A;  4QT7 A;  5EG2 A;  3OW2 A;  1PSE A;  2ATC B;  1RL2 A;  1KHI A;  1VOM A;  2LX7 A;  2FZK B;  3NFC A;  2EQM A;  4JS4 A;  4QQ6 A;  4OMO A;  1X69 A;  4OMN A;  2DBM A;  2OTJ T;  3MP6 A;  3VYH B;  3A98 A;  1QVG A;  2HSP A;  3GPL A;  1X27 A;  4JJD A;  4J9C A;  2JZ2 A;  1Q7Y U;  1WQ7 A;  1E6H A;  2DNU A;  1VQ5 Q;  4M75 F;  2BZ8 A;  4KUI A;  1S72 Q;  4JJC A;  1OYX A;  2HQE A;  2ZPG B;  1OU8 A;  3ME9 A;  4AFU C;  1BIB A;  2ROT A;  2DIL A;  2QI2 A;  5GAN h;  4IIM A;  3JB9 J;  1PD0 A;  1XQH A;  1Q86 C;  1FMV A;  1YWO A;  3CCS T;  2CP7 A;  4AFQ C;  4CC4 B;  1UB4 A;  1H8K A;  2KR3 A;  1VQ7 T;  1BU1 A;  1X75 C;  2ZAE A;  2P0K A;  1PSF A;  4C92 B;  3MO8 A;  2L3Q A;  2LJ0 A;  2KI7 A;  4M7A F;  2PTK A;  3D7S B;  5HK0 A;  3UF4 A;  2OAU A;  4M7D F;  2KAF A;  5KH6 A;  1UGV A;  1KC8 U;  2YHT A;  1XTD A;  3JCM J;  1VQ5 T;  1H64 1;  4CI0 C;  2L3P A;  2WSC E;  4K11 A;  2R5M A;  4D8K A;  2RHZ A;  3EG1 A;  4DBR A;  4RUG A;  3CCL Q;  1YP5 A;  2FZC B;  2VB6 A;  3QYH B;  3SFM A;  3I55 A;  1UE9 A;  4M77 F;  3EFS A;  3QWX X;  5J39 A;  3C0C A;  4FYY B;  3M4G A;  4O6J A;  2D1X A;  2MAM A;  1JBM A;  1QVG P;  1Y96 B;  3CBO A;  1Y71 A;  1W2B P;  4RTW A;  3VS3 A;  4OML A;  4PFO A;  2A08 A;  4F04 B;  2QQA A;  4FSS A;  2H8H A;  3G6E T;  2E41 A;  3PNW C;  2LZ6 B;  3H6Z A;  2J06 A;  5IHK A;  3VS6 A;  3JCM f;  3OYM A;  1WZO A;  2HAX A;  2COZ A;  1BCO A;  1ZUU A;  2ECZ A;  3SEM A;  3H0I A;  3RKX A;  3AT1 B;  4IUU A;  2AZV A;  5CAI A;  1MV0 B;  2VKN A;  4XTU A;  2KXD A;  4HVW A;  1VQL A;  2DJZ A;  3CMA A;  3HSB A;  2YUQ A;  2VWF A;  2P84 A;  2K7A A;  3DLL A;  2VYT A;  3CCQ A;  2GTJ A;  2HCK A;  1UGP B;  1IB8 A;  4FYW B;  1VQ8 A;  1WJQ A;  1AD5 A;  3CD6 A;  3OW2 P;  1YJN Q;  1NZ9 A;  3CD6 Q;  2JUF A;  3JCM W;  2AT1 B;  1RAE B;  4ZN3 A;  1HK9 A;  2RPN A;  2DER A;  3I56 T;  2VUB A;  4X34 A;  3JB9 F;  2QQR A;  1U5S A;  1Z9Q A;  2AIR B;  3C95 A;  1YIT A;  3TSZ A;  1NEG A;  1UEB A;  3P8D A;  1K73 U;  1M2V A;  2JS2 A;  4ZTJ A;  2CZ1 B;  2QG9 B;  3I55 T;  2A7Y A;  4M77 G;  4BE1 A;  4F14 A;  1NPR A;  2LTO A;  3EGD A;  1WHG A;  4GY5 A;  1BK2 A;  2XI9 A;  3L2Z A;  1SHG A;  2B86 A;  4NL2 A;  1NEB A;  4Y92 A;  1OZ3 A;  4C8Q C;  2RM4 A;  1N5Z A;  1GCP A;  3UA6 A;  1RI0 A;  2GF7 A;  1XOV A;  2DX1 A;  4PJO E;  1SSF A;  2EW3 A;  3EH2 A;  3M0T A;  2X51 A;  3PT9 A;  3G6E Q;  5CKE A;  3FLG A;  2DET A;  1QCO A;  3QWY A;  2XKO C;  1VQK A;  1SRL A;  4M75 D;  4ZGJ B;  3QDF A;  4OB0 B;  1I1J A;  2DEQ A;  2K5F A;  1M1K R;  1ZBJ A;  5GAN 2;  3RDV A;  1OUL A;  3LWH A;  1AWO A;  1WHM A;  3CMA Q;  4HXJ A;  1Y7X A;  4J83 A;  3V8L A;  2PQW A;  2DTO A;  2DRM A;  1HXD A;  3EGU A;  4J9I A;  1SSH A;  2MK5 A;  1R0C B;  4JRQ A;  2RA2 A;  3JB9 I;  2CP3 A;  4M7D D;  3V7S A;  3PMT A;  1HSQ A;  2RK2 A;  2EQK A;  1AZG B;  3EG2 A;  1AWX A;  3FDR A;  2FPE A;  2RF0 A;  3M56 A;  2MMP A;  1QVF A;  4LDW A;  3I56 A;  2MPX C;  1X6B A;  2X4Y A;  1PNJ A;  3CCS A;  4M77 B;  2P0Q A;  2CUD A;  4PJO B;  1YIT Q;  3MPU B;  5GAN g;  3OYL A;  2HBW A;  2KVQ G;  2F2W A;  2QA4 Q;  4J6X A;  4PLI A;  4PKC C;  4Y91 A;  3CCL A;  5DLO A;  3BW1 A;  4QVC A;  1VQ5 A;  3G6E A;  1WFW A;  2G3R A;  1NYF A;  3CCM T;  3EG0 A;  4FU6 A;  1M30 A;  2RI5 A;  4D8D A;  1K9M R;  2ED1 A;  1D0Z A;  4M7A C;  1VQM Q;  1K0X A;  2ENM A;  2E6N A;  2V8K A;  5LJ3 g;  1MNE A;  4OMM A;  1SEM A;  4M7D E;  5D6Y A;  4A4E A;  1VIF A;  4FYX B;  4IIO A;  3OYI A;  3CCV A;  4RCC A;  3H9N A;  2QA4 T;  1PC0 A;  2NLU A;  3LW5 E;  4YTL A;  1BB9 A;  1LOJ A;  4JZ4 A;  2JVV A;  5KE2 A;  2LT1 A;  3M0U A;  4KBM B;  3OYB A;  1YFN A;  4F7U G;  2CH4 W;  3ER0 A;  1IRE B;  1VQN A;  1J3T A;  5I21 A;  1K9M C;  3MEV A;  1X2Q A;  1CSK A;  1QWE A;  2QEX T;  5L8R E;  1XNI A;  3CPW S;  2DK3 A;  2L2P A;  2D8H A;  3PVQ A;  3GF5 A;  2GTO A;  3RES A;  3V8J A;  2YSQ A;  5KYU B;  1D1B A;  3EFO A;  5FLX E;  1O75 A;  1G3S A;  3PIP A;  4BE0 A;  1E6G A;  3FB9 A;  1FXX A;  2ZPI B;  2FB7 A;  2LCS A;  2JTE A;  5A0D A;  1LNX A;  4M77 D;  2QDL A;  3JB9 H;  2Y4X A;  1SF9 A;  3E1S A;  3EHQ A;  2VGN A;  3JCM b;  1P92 A;  2JM9 A;  2BIV A;  1IXD A;  1YCY A;  5LJ5 f;  5FRM A;  2JT4 A;  2QQB A;  3OA6 A;  3HTR A;  2HL5 C;  2QTV A;  4MML A;  4XQ3 A;  4A54 A;  5GMK m;  1M90 C;  3CCE T;  2VXF A;  1R8O B;  3CC2 T;  1QKX A;  1TXQ A;  1X6G A;  3EGX B;  1WX6 A;  1BYM A;  1ZSZ C;  2CRE A;  4JJB A;  5HCK A;  1ABQ A;  2W0Z A;  1GBR A;  3OS0 A;  5DM7 R;  3CPW P;  4F7U E;  2LX9 A;  2AK5 A;  4LDY A;  3UDC A;  2LNV A;  3RR6 A;  4HT8 A;  1JEG A;  2YWW A;  5LJ5 h;  2XIC A;  4RTY A;  2RN8 A;  3CME T;  2XG8 D;  5C0M A;  3L2U A;  1IZ6 A;  2OJ2 A;  3QBY A;  1C1A A;  2EIF A;  5D6W A;  4PNO A;  1U8R A;  3HPW A;  4E7Z A;  2DTH A;  2ZPE B;  2XID A;  1Q82 C;  3OYC A;  2X4W A;  4OGC A;  2DL5 A;  4ZNX A;  2XDP A;  2ROL A;  3A8M B;  3QPH A;  4J9F A;  4EMK C;  1UTI A;  2HNI A;  3M5A A;  5GAO q;  3QO3 A;  1KJW A;  2GCX A;  3LH0 A;  3OS5 A;  4RTX A;  3NHN A;  3OBW A;  8AT1 B;  1K8A U;  4XTX A;  3EH1 A;  1I8F A;  4EPC A;  1H3Z A;  2M1H A;  3S3O A;  1KQS S;  2QAS A;  1EFN A;  4A4K A;  2DL4 A;  1M5Q 1;  3OBY A;  4C0D B;  4ANJ A;  4XU0 A;  3LGF A;  3CCE Q;  2V1Q A;  2WSE E;  2C0I A;  4N4H A;  1S72 T;  4XTV A;  4FSX A;  1YI2 T;  1AEY A;  2DL3 A;  1V76 A;  3QUI A;  2CSI A;  1TUC A;  3CCM A;  1KIK A;  3H8Z A;  2OTJ Q;  4JPB W;  4FL6 A;  2DXU A;  5GMK h;  1ACM B;  2AHJ B;  5AT1 B;  3CC7 T;  4BY6 C;  1QVG S;  3CCR T;  3CBM A;  3OYK A;  1FMK A;  3M54 A;  5GAO m;  2FO0 A;  3JCM P;  4LXC A;  1M27 C;  1G3W A;  1B3Q A;  1UJ0 A;  4HKE A;  1VQ6 T;  1KK7 A;  3GLX A;  3EHR A;  1YJ9 Q;  1M4Z A;  1D3B B;  5EC7 A;  3EGD B;  1RLP C;  4KUL A;  2CDT A;  5CQY A;  4CC7 A;  3CC4 A;  3QJ6 A;  3JCM g;  2GQI A;  3JCM c;  1KD1 U;  1ZSZ B;  2AZS A;  4GLK A;  5I2S A;  2EKO A;  1YN8 A;  2F5T X;  1VA7 A;  2KMT A;  4IKF A;  1K4U S;  1OI1 A;  2CS7 A;  4QQD A;  2D9T A;  2PVO B;  3CCL T;  2C0T A;  4KH1 B;  2J6O A;  2AKL A;  2JXB A;  3UT1 A;  3RBB B;  3CCU T;  2LQ8 A;  3OYG A;  2YRV A;  3X25 B;  4LD9 K;  1TG0 A;  4J5Y A;  1M8M A;  4HCK A;  2HDA A;  2XK0 A;  1D0X A;  3FJ5 A;  3QDR B;  3MP1 A;  1HD3 A;  2QYZ A;  3HKS A;  1SG5 A;  2BKD N;  2VAS A;  3M0Q A;  1VQ7 A;  5KYU A;  3I9Q A;  1NG2 A;  1OX8 A;  2R5A A;  4HVU A;  2L3R A;  2K5L A;  1ZHI A;  2KK4 A;  3R6N A;  3OYY A;  3JV3 A;  4C92 D;  3WVD B;  1I81 A;  2PU9 B;  1YHQ A;  1G8X A;  1LJO A;  2O31 A;  1NLO C;  1D09 B;  4J9G A;  3QII A;  4ESR A;  1AWJ A;  1X2K A;  2KDS A;  5CIU A;  1V29 B;  3JCM d;  4MMK A;  2E12 A;  3WVE B;  2A0F B;  3QXE B;  4AG2 C;  1NLP C;  1OU9 A;  4XU2 A;  5CKD A;  2QAZ A;  1VQ8 T;  1GL5 A;  4FW1 A;  3FIF A;  1N27 A;  2CZ0 B;  5IH2 A;  3JAM E;  2YRD A;  2M9U A;  3H0F A;  2E5K A;  1MV3 A;  2SRC A;  1AZE A;  1PD1 A;  1WJS A;  1MMD A;  5KYX A;  4JS5 A;  2DXB A;  2CH4 A;  5GAN 8;  2XDB A;  4N0A A;  2EYZ A;  4C5E A;  1Q81 U;  2JS0 A;  2WAC A;  2XU8 A;  2L3S A;  3V8K A;  2DPP B;  2KEA A;  2Z0W A;  4RCB A;  5GAO p;  3CCQ T;  3MEA A;  2J6F A;  2HL3 A;  4PJO A;  1UDL A;  3BDL A;  3P8H A;  1RLQ C;  2EYQ A;  3A5Z B;  2F69 A;  3C12 A;  2YUO A;  3CMA T;  2FVU A;  2JTM A;  3GOX A;  1QP2 A;  2O2O A;  3EG9 B;  4M7A G;  4FM4 B;  2LMJ A;  1AOJ A;  3ZFJ A;  3ZEH A;  1YHQ Q;  3VS5 A;  1NYG A;  2R58 A;  3I5R A;  3NPF A;  1ZUY A;  3OS1 A;  2QEX Q;  2J05 A;  2JJ9 A;  3LYI A;  3CCR Q;  3CCS Q;  3ULR B;  1KQ2 A;  3CC7 Q;  3CC4 T;  2E4H A;  2VGM A;  2M0Y A;  2K79 A;  1QKW A;  1W2B S;  4JLI A;  4JRK A;  2K57 A;  4FYV B;  1K8A R;  1FX7 A;  2KRO A;  1TH7 A;  2HKN A;  3MHX A;  2SEM A;  4JRI A; 
#chains in the Genus database with same CATH homology
 3LH5 A;  1AZG B;  3EG2 A;  1UG1 A;  1AWX A;  3VS1 A;  2FPE A;  2RF0 A;  3UAT A;  1SHF A;  5FWC A;  4J9H A;  2OAW A;  3TVT A;  3EG3 A;  1X6B A;  1I0C A;  1PNJ A;  3PVL A;  4RTT A;  4JZ3 A;  2CUD A;  2X3W D;  2HBW A;  4Z88 A;  2F2W A;  1WIE A;  1CKA A;  1TUD A;  1K0S A;  2CT4 A;  5GJV B;  1T3S A;  5FWB A;  3REB B;  3TSW A;  2XMF A;  1WLP B;  2RNA A;  2F2X A;  2NUZ A;  1WFW A;  3M0S A;  3H41 A;  1NYF A;  1RI9 A;  3EG0 A;  1ABO A;  1M30 A;  4D8D A;  1ZX6 A;  2ED1 A;  2ABL A;  2JMA A;  2W10 A;  1AWW A;  1UUE A;  5IHI A;  1K0X A;  1JXM A;  1AVZ C;  2ENM A;  1QLY A;  2EVR A;  3GBQ A;  4Z8A A;  1GCQ A;  1JXO A;  4OMM A;  1OPK A;  1SEM A;  2JW4 A;  2LNH B;  2YT6 A;  4IIO A;  2MIO A;  1W70 A;  2IIM A;  4EIK A;  2LQW A;  2EPD A;  4RTV A;  2LJ1 A;  2LQN A;  1QCF A;  4CC3 A;  2HEQ A;  1BB9 A;  4JZ4 A;  2DVJ A;  3M0U A;  2KRS A;  1A0N B;  1MUZ A;  2K9G A;  2KXC A;  3PE0 A;  3REA B;  3CQT A;  5IHN A;  2CH4 W;  1J3T A;  4A63 B;  5IXB A;  1X2Q A;  1CSK A;  1G2B A;  1QWE A;  2DF6 A;  2EKH A;  2JM8 A;  2L2P A;  2D8H A;  3PVQ A;  1Z9Z A;  2FRY A;  2GTO A;  4AFZ C;  1FYN A;  4J9D A;  1YCS B;  2AKK A;  2YSQ A;  1WA7 A;  2EGC A;  1E6G A;  2LCS A;  2JTE A;  2LJ3 A;  2A28 A;  2QDL A;  2K3B A;  3SHW A;  1S1N A;  3EHQ A;  2ED0 A;  2JM9 A;  2KT8 A;  3KFV A;  2CT3 A;  2JT4 A;  2A37 A;  2DYB A;  1SRM A;  1Y57 A;  1IO6 A;  2A36 A;  2I0N A;  1GFC A;  2EYX A;  2KNB B;  2D8J A;  1QKX A;  2O9S A;  1X6G A;  4M4Z A;  1WX6 A;  1UEC A;  3I5S A;  1GBQ A;  2KRN A;  1G83 A;  4X1V A;  2EQI A;  2CRE A;  1BBZ A;  4JJB A;  5HCK A;  1U06 A;  1ABQ A;  2W0Z A;  1K1Z A;  1GBR A;  1H92 A;  2DL7 A;  2M51 A;  2AK5 A;  2V1R A;  1UFF A;  2BTT A;  2PNI A;  1VYU A;  2OI3 A;  1H3H A;  2DE0 X;  1PKT A;  1JEG A;  2YDL A;  2DM1 A;  1W1F A;  4RTY A;  2DL8 A;  2RN8 A;  3THK A;  1HJD A;  2EBP A;  2OJ2 A;  1UHF A;  4R0K A;  3VS0 A;  1GCQ C;  3IQL A;  4RTZ A;  3I35 A;  1QWF A;  2O88 A;  1OV3 A;  1JO8 A;  2DL5 A;  4ZNX A;  2ROL A;  4QT7 A;  2FPD A;  4J9F A;  1UTI A;  1KJW A;  2LX7 A;  4OMO A;  4RTX A;  3NHN A;  1X69 A;  3VS4 A;  3VS7 A;  1PHT A;  4OMN A;  3H0H A;  2DBM A;  1SPK A;  1K76 A;  3A98 A;  2HSP A;  2DMO A;  1X27 A;  4JJD A;  4J9C A;  1EFN A;  2DL4 A;  1E6H A;  2J6K A;  2DNU A;  1T0J A;  1ZUK A;  2CSQ A;  2BZ8 A;  2V1Q A;  4JJC A;  4OMP A;  2C0I A;  5ECA A;  1KFZ A;  4AG1 C;  4AFU C;  2PZ1 A;  2ROT A;  2DIL A;  1AEY A;  1PRM C;  2MCN A;  1GRI A;  2DL3 A;  2RQT A;  4IIM A;  2CSI A;  1I07 A;  4Z89 A;  1TUC A;  1KIK A;  2FRW A;  4RTU A;  1YWO A;  2GNC A;  4JPB W;  4AFQ C;  4CC4 B;  1H8K A;  2KR3 A;  1BU1 A;  2RQR A;  2L3Q A;  2LJ0 A;  1FMK A;  2PTK A;  2FO0 A;  3M0R A;  3ZL7 C;  3UF4 A;  1WXU A;  1M27 C;  3NGP A;  1OPL A;  1UGV A;  1B3Q A;  1UJ0 A;  2GGR A;  2L3P A;  2EYY A;  4AFS C;  2YUN A;  2P4R A;  2MOX A;  3EHR A;  4K11 A;  1ARK A;  5EC7 A;  1RLP C;  2CDT A;  4CC7 A;  3VRZ A;  4D8K A;  3EG1 A;  1UHC A;  5I11 A;  4HVV A;  3UA7 A;  2GQI A;  4RUG A;  1JU5 C;  2AZS A;  1YP5 A;  1YN8 A;  1VA7 A;  1K4U S;  3M0P A;  1UE9 A;  1W6X A;  1KSW A;  2KT1 A;  3QWX X;  3C0C A;  3VS2 A;  1WXB A;  4LE9 A;  4CC2 A;  2D1X A;  4LN2 A;  4F16 A;  2C0T A;  2J6O A;  1CKB A;  4GLM A;  4RTW A;  2AKL A;  2C0O A;  2K6D A;  4OML A;  2JXB A;  3VS3 A;  3U23 A;  2CUB A;  3RBB B;  1OEB A;  2A08 A;  4FSS A;  1PKS A;  2H8H A;  2O9V A;  1TG0 A;  1ZLM A;  1M8M A;  4HCK A;  2HDA A;  2LZ6 B;  2J06 A;  5IHK A;  1X43 A;  3FJ5 A;  3VS6 A;  2L0A A;  1HD3 A;  1ZUU A;  2ECZ A;  3SEM A;  3H0I A;  2D0N A;  2AZV A;  1LCK A;  1MV0 B;  1V1C A;  2RQW A;  2KXD A;  2VKN A;  3M0Q A;  1WDX A;  4HVW A;  2NWM A;  3I9Q A;  1NG2 A;  1K9A A;  4HVU A;  2YUQ A;  2DJQ A;  2VWF A;  2DA9 A;  2BZY A;  2K7A A;  3RNJ A;  1VYT A;  3R6N A;  1M3B A;  5I22 A;  3JV3 A;  2GTJ A;  4KRT A;  2HCK A;  2KE9 A;  2KRM A;  2O31 A;  1NLO C;  4E6R A;  4J9G A;  4ESR A;  1AWJ A;  1M3C A;  1AD5 A;  1PWT A;  1X2K A;  2LP5 A;  4WCI A;  4AG2 C;  1NLP C;  2GBQ A;  1RUW A;  1NM7 A;  1GL5 A;  2X3X D;  2RPN A;  5IH2 A;  3H0F A;  2E5K A;  1U5S A;  1Z9Q A;  3O5Z A;  2J7I A;  1MV3 A;  2JMC A;  3TSZ A;  1NEG A;  4F17 A;  2SRC A;  1AZE A;  2BZX A;  4LUD A;  2CH4 A;  2FG0 A;  2JS2 A;  2F2V A;  2EYZ A;  4F14 A;  4DEX A;  2DLP A;  2JS0 A;  4GBQ A;  1BK2 A;  2RMO A;  1M3A A;  1SHG A;  2B86 A;  2RQV A;  2L3S A;  1NEB A;  2FPF A;  4Y92 A;  1WI7 A;  2KEA A;  1YNZ A;  2FEI A;  1N5Z A;  1GCP A;  3UA6 A;  2J6F A;  1UDL A;  2RQU A;  1XOV A;  2DX1 A;  1RLQ C;  2EW3 A;  2YUO A;  5GJW B;  1WXT A;  3M0T A;  1E7O A;  2KYB A;  1OOT A;  1ZSG A;  1T3L A;  2DBK A;  2O2O A;  1GFD A;  4DEY A;  2K2M A;  1VYV A;  1T0H A;  4LNP A;  1YWP A;  1UJY A;  2LMJ A;  3QWY A;  1AOJ A;  1SRL A;  4J9B A;  2EGE A;  5L23 A;  3VS5 A;  2EGA A;  1NYG A;  3I5R A;  1JQQ A;  3NPF A;  4LUE A;  1B07 A;  1ZUY A;  2KYM A;  2G6F X;  2KGT A;  1I1J A;  4OMQ A;  2KBT A;  1Y0M A;  2J05 A;  1ZBJ A;  4ORZ A;  3VRY A;  1AWO A;  4HXJ A;  3ULR B;  1WYX A;  5IXF A;  2DRM A;  2DRK A;  3EGU A;  4J9E A;  5FW9 A;  2M0Y A;  1SSH A;  2K79 A;  4J9I A;  3NMZ C;  1PRL C;  1QKW A;  1U3O A;  2ESW A;  2VVK A;  2KRO A;  2YUP A;  2SEM A;  2EYW A;  1HSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...