2ED8A

Solution structure of the second fibronectin type iii domain of human netrin receptor dcc
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
106
structure length
106
Chain Sequence
b'GSSGSSGPGPVENLQAVSTSPTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPGVSTDDITVVTLSDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin receptor DCC
publication title Solution structure of the second fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 6
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ed8A01
3QIWC 5K9JH 5DRNB 5HHVL 4ODTL 5IK3A 5HHOA 1WAAF 3VXRA 1FGNL 2JJTA 1ORSB 2FJGB 3MNVB 1VGKA 2IG2H 4IIQA 5J9PA 4M1GL 3HFML 5FECB 1UM5L 5GGVH 2WBJA 1ZWIB 2B20A 5C09D 1P4LB 4WTZG 2WIIB 2ZUVA 5IVOA 3GSUB 1YJDH 1FCCA 3QXVA 2ADJB 1FZOB 3CD4A 3S4SG 1MJUH 3Q6GL 1H15B 4F33B 5HPMB 4GAGH 3PWPD 5AYUL 4UTAH 1DEEA 1MCWM 4XBEH 3GBML 3PGDB 4F8QA 4DVRH 4YXLL 2GIYA 3I50L 1QNZL 2B7DT 2XWTB 3DO7A 4MA1B 3O3DA 3V0VA 3EOBB 1RU9H 1T1XA 5AZEH 4NRYB 2IANA 5TPWL 4ZFOA 1A6PA 3M17B 4OCYH 4TQEL 2CLVB 1P7KB 5CIPB 4QHNB 1AQDB 3DLQR 4U6HB 1BGXH 2W9DL 5T3ZL 3GHEH 4QRPB 4X9BA 3ZHDA 2FYYB 4GXUM 2CKBH 3LRSB 3DMMD 2F8VA 2NY7H 4NM4L 4Q6YA 4S1DC 5HVGB 1F4XL 3GM0A 3MJ8A 4XTRD 1FL3B 3R8BB 4ODWB 2H9GB 3ZDZF 1ZLSL 2EH7H 5F9WB 1T1WA 4LDOB 3QHZL 5ISZA 3CSYB 2Z91A 2J8HA 2JB6B 5JHDA 5L88L 5FYKU 2RQ8A 3LKRB 1NMCB 4ZAKD 2GTWB 2P5WE 4Z0XB 4APQB 4JANA 5ACMA 4D0CB 5KSBB 3VD9A 5KSBF 1FL6B 5F7NC 3BD5A 5BOPA 1F13A 3SE8H 1CICD 3V52L 1RZ8B 1ZHKB 4CW1A 4ZFFA 1SYSA 1ZEAL 1HEZA 1LE5A 5HHVH 1CXLA 4OF5A 3FOMA 4HMDA 1MLBA 4ERSH 4MJ2A 1JPGA 4ZUTB 2X4TB 3NN8A 4KKLC 1DBJL 2HJKB 5F7YC 5FUZL 5DK0B 5GGTA 3MRLB 4DGIL 3HFMH 2X09A 4JKLA 3SN6N 3O4OC 3TBWA 5E6YA 3N9GH 4M7ZB 3BAEL 2X2YA 1MI5D 4IMLB 3T2OA 2VDML 1LDPH 4Y4FD 3MV7B 4N90E 1M7XA 4R26L 3MBEB 1D9KC 2DQJH 5L2KA 1ZXQA 5E03A 3B6SB 2BVTA 3VI4F 3QEQB 2N1KA 5ITFA 1LP9A 1CS6A 2YPKA 1LE9A 2DLTA 3OR6A 4HSQA 5DC4B 15C8H 5EOCJ 4R97C 5FYLE 3RUGB 5K59F 4Z95L 4E0RB 4EN3B 3GBMH 5IFAL 1ZHLA 5F9DC 2X44D 3FN3A 3L7FB 4YXLH 2DM3A 4J1UB 1MCFA 1XR9A 4EKXA 1NCWL 3OKMA 2YWYA 3O3AA 3QG7H 3O2DH 2OSLB 3WEXA 1AHWA 4KZDL 3V5KB 4NZJA 4UDTB 5TPWH 5J1SC 3PWJB 3T3PE 3BN9D 2X1QA 3OF6D 3WV0A 1ZVHA 2P8LB 4EOWL 3L7EA 1A9EB 4Y2OA 4TQEH 4OM0L 5D7JB 5KOMC 2PN5A 2C9AA 5DMKA 3SJVB 5DVLA 2KBGA 5DT1L 2DAVA 5J56B 4X6EB 3IDJA 5CBAB 4U2YA 3MOAH 4OV5B 1MCPL 3BP5A 1R5VB 2W9LA 4NGHH 5I66A 2GSGA 1CLOH 3VXSB 1FJ1B 4XBPB 2HFFB 2IALB 2LTQB 4YIQB 1BQLH 4HUWA 2VXVH 3GNML 4I3SL 5J1AA 1JZ2A 1A3QA 2Q86A 4JY6A 2VO5A 4IRSD 1QSFB 1F4HA 2V5TA 1D6EA 1BZ7A 2ENSA 1HCFX 1AGFA 5L88H 5DJ2B 1JGLH 1H9VA 1KPVA 1B0GA 1PZUB 4MDIB 3SDCC 5SX4I 1IC5L 1J8KA 1FG2A 2F9BT 3HRZB 3EJJX 4MNHB 1BD2B 3VXTB 3ESVF 3KGRA 3EYSL 4OF3A 1A5FL 2HT3D 3OBAA 5GZND 2YD5A 4J4PA 4XVUD 4LRIA 5D1XB 4JGJA 5DR5L 2EKJA 5E00B 4D94A 2M1KA 3TZVB 2WWKO 5FXCH 1QBBA 2DMBA 4KJQD 2YMXH 5FUZH 3W0WA 5CWSB 3WE6B 3P4OB 2R39A 5B4MD 1KLGA 3RVVD 4N0UA 4OLYL 4S2SB 1AD0B 3S6CA 3GM8A 3I6KB 5IMKA 4Y19E 5FDWB 4YHNB 4RA0C 4ZSOE 5FF6A 2JELH 3HAEH 3T4AB 2A9NH 4L9LA 1HKFA 1T4KA 1DDHB 3SCMA 3CDGA 4OGZA 4HS6A 2NY5C 2BC4B 1P69B 4P5MB 5C0RH 4X5WB 2X4NB 3VFRB 3QUYB 3O2WL 3TN0B 3PIQA 4U1HA 3VFSB 1NCWH 1L6ZA 3QNYA 4WI4A 2UZXB 1MVUB 2VXUL 5E2VH 3MRNB 2CJUL 2ATKB 1A64A 2GFBA 5IROA 1JF1A 3N85L 3HUJE 3BJ91 3PDOB 2Z31C 3D85D 2PETA 5DURB 1JWSA 4LCCC 3PABA 1FRGL 3GMQB 3B43A 1MCWW 3LSOB 5DQDL 3DUUB 1XF3B 1KYOK 1S7SB 5DUPH 5CEXB 2BY3A 5FYJU 4Y2DA 5I17B 4YHPA 5MEPA 1U95B 5GS2D 4ENEC 1PZ5B 3NAAL 3RNQB 1SVZA 3MV01 4U31A 5TDPA 5FO8A 2JJTC 4Q7DA 3CFJB 2IMNA 5JW4N 2DTML 1M71A 4IIQC 4KVCH 1IGYA 4GMTH 1IGIL 4KKCC 5HI5C 4JQIL 2EO1A 1MELA 5ICXB 3DTXA 1OTUD 2WBJC 1IC5H 1T20A 2Z35A 4HLZH 4M6OH 1MHHA 3HG1E 1A21A 3MFFB 1R5IA 1CFVL 5IB1B 1LO2H 5A3IC 4QY8B 1ZHNA 3GO1H 5DR5H 5I8EB 2D2OA 4PV9B 2XZCL 5DSCA 1AGDB 1S8DB 5JW3L 1DUZA 4HIXH 3UYRH 4MVBD 5FOJA 1A9BA 4DUWA 1A3LH 5KSAD 2FX7L 5HYJD 4YHZH 1JZ7A 4LIQH 1NUFA 4BFIB 4XPTH 2HJLB 4M7JH 4GBXB 5IJVA 3MUHL 1A0QL 4PREB 2F5BH 4WFHD 4KDWA 3X3GL 4XWGL 2V7NA 1YEEL 3S7GA 2IEPA 3HE6A 4AT6A 1YN6B 4MJID 5TE6L 3SO5A 5AWNL 1B4JH 3WMSA 4JZJA 5DJZA 2ITDB 4DKEL 4X4YA 5BZWA 3NCCB 1QLRA 3NZ8A 5MENE 1I7UB 1I9IL 3PGCB 4JHAL 1EFXB 4OGAC 3UPRB 3V6BR 1KOAA 1SMAA 1KJ2A 4UIMA 3CLFH 1AXSA 3BEVB 3T3PF 2DL2A 4X9FA 5CBEA 1MFDL 1V7MH 4RX4D 4RRPA 1KB5B 2Y72A 1S7TB 5JPNA 3H0TA 3MJGX 4IBLT 3HI5L 4UILH 4Z5RA 5AG9A 3WUWA 4OD1H 3HNSH 1FN4A 4ZS6C 4R90L 1YZZA 1T7YA 2QTEA 2R0ZL 5E5UB 4NO0A 4R96A 1YPZB 1X4XA 1C12A 3BHBA 4NQCE 5J6GB 5ESQB 1IARB 4YDIH 1FFRA 1ND0B 4HIIB 4LSQH 3KPRB 2B4CC 2PW2A 1WV7T 1FIGH 2ZOLB 4XPFL 1SM3L 1CDUA 2DTMH 1VERA 1MIEL 4C4KO 4O2CB 1F8TH 5EO1A 3BVNA 1BJ1H 5KN5B 4XHJC 4HC1A 2BJMH 3VCLB 4HHAB 3KPMB 2ZOKB 1MH5A 4DW2H 3IKKA 4U4BA 5F1NA 3P0VL 4I0PD 4EZMA 5L6YH 3MRPA 2IFFH 4JJ5A 4RGMC 2X7LB 3NVQA 1HH9A 3TA3A 2XZCH 4I2XE 4NN5B 1F90H 2APVA 4IJ3C 3EYOA 5E8PB 3RBSA 5AZ2H 4ZO8A 1R3LA 1FAIL 5IMOB 2Z8WC 1DQTA 2VLRA 1VFUA 4JG1H 1G6RL 3DXAD 4ZO9A 2FHCA 2BRRL 4BSVA 3MRBA 4KK5D 4OKDA 5IW6B 1AHWC 3ZT7A 4H5SA 4P2RA 1RJYA 3BPOC 3VXNB 5LCVH 4WO4B 1URLA 2XZQL 4PLNC 1Q94A 4Y19B 4HS8L 3X3GH 2IBZX 3D2UB 1HI6A 2BVPB 3KPLA 1YECL 1EHLH 5TF1H 4BQ6A 3H3BC 3ECBB 2JJSA 3JWDC 3ZYJA 4H0GA 4NDMB 5KS9E 5HYFA 3PQYA 4PTUA 2H8PB 4Z7WE 3TJHC 1MFEH 3E6HA 3HCVA 3QFJD 5DRWA 4CNIA 4ZFGL 5I1DA 1QBLL 1J7VR 4JN2B 3DURA 5EZOL 4WHYG 5FM5M 3MV8A 1Z3GL 4CBPA 5E5RB 1UCTA 3FRUB 2K9UA 4P5TA 2EEDA 2CIKA 4JKWA 4CADB 3HUJB 3HUJF 4G8GD 1AO7A 2EKSB 5FV2A 3VJ6A 4JG0H 3DRTB 4P5KB 3BZDA 2JIXA 3ZTJG 3VFPA 1H3WM 1IM9A 3DO3A 4ODVH 2OZ4L 1U3YA 3CZFA 3CC5B 1OT2A 5FO9B 2HH0L 3RWGB 5AYQA 4PJ8D 5D5ME 3LS4L 3D87B 4HWBA 3VA2C 4J4PC 5C0CD 4LRIC 3JUYA 1KXQE 3DPBA 1VEOA 4YHLH 1T2JA 4DCQB 4XWOC 4V1DA 4LMQI 5KAQF 3FO9B 4LAQL 5L0QC 5F7HA 1S7QA 1HYRC 5KAQG 3QQ4A 4YDVA 1MIEH 4ELKA 5FA3A 1ZANL 1XGPA 3ZDXE 4OI8A 5IGXL 1P6AB 5IBTH 3KPSE 3L3OB 1CIDA 4N8PA 3MA9L 4JHWH 4YDKL 3BZFA 5CHNB 1Q1JL 1VDGA 3G5ZB 3ARED 3RWDB 2R4SL 2CUHA 5SWZE 1RD6A 9CGTA 3G5YA 2EICA 1UWXH 2XN9D 2MCPL 4L9LC 5ACZB 3H42H 3SCMC 3NTCL 3BUTA 1KCSH 2ADIA 2EEAA 3K8MA 3C8DA 1NMAL 2BRRH 1NBYB 5CJOL 5T3XH 3UTSA 2PO6D 4FQIL 1XCQB 3FONB 5I74B 3WD5H 1S7WA 1KN4L 4BUHA 4WWKD 2VLJA 3LKOA 2Y1VA 5IROC 5T3ZE 1OWWA 1YYML 1BJMA 2H2PD 2KL6A 4Y4HA 1DVFA 4Q9BA 4X4MA 3G6DL 1ZSDA 1V3MA 2UZYB 1YEJL 2HT4C 3ILQD 3FAXA 4M02A 1S7RA 3W9EA 1IEBB 5MENB 3HE7A 4V2CB 4WIQA 3H9SA 4DZBA 3C6LB 5GSVB 4XZUA 4Y2DC 3NCFB 1BIIA 1NGPL 3QA3B 3TYFB 3EDJA 3VWJC 4F7CA 1N5AA 3U0PA 4B41A 2FLRT 1DFBH 3B8SA 3T65B 1JGDB 3T77B 1P7HL 2V17H 1NFDA 2YBRA 2FB4H 2EEBA 4DQOL 4JVPA 4LHJB 3KYKH 4HKXA 3U0TB 4NQCB 1D6VH 2X70A 3UBXB 2HH0H 2Y5EA 1NUDA 1Z9MA 2BCKA 2XWJB 3MYJA 3QIUA 3B9EA 2R56H 3FO2B 4RGNE 5IQ7H 4YO0A 1FDLL 4X9GA 3PXHA 5IBUB 1MUJA 4O51B 4NO3B 4ONGL 1OB1B 5ILTL 2NY0D 5A16A 1JK8A 5IBUG 3MLZH 5T1KB 4E42A 3DGGA 4QHUA 4G42A 1OAUL 3QT2A 4KZEH 3IGAA 4NWTL 5F8QC 5FUOL 5H2BA 1T0NB 3CVHH 5DJ8A 3IXTB 1FFPA 1TZHA 4UAOC 5I0DA 4UMGA 1A7RL 3EZ8A 4I2XB 3RY4A 4KUZH 4Y5VB 4V2BA 4ISVB 4J8RA 2NY5L 1UFUA 3S97C 1OP5K 4FTVB 4NBXB 4JZJC 3QDJA 4PGDA 2RAMA 4LVNC 4Z76A 5ID0B 1BWMA 2YN3A 1D3CA 3T3ME 3VRLE 5ETUA 1P84K 3MLVL 4WDIB 4YUEH 4LQFH 4PJ7A 3A6BL 4MCZA 4EI5A 1KN4H 3FQUA 1NSNL 1YYMH 2CKBB 1GHFH 2XKUA 1HZHL 5TQ0L 3STLB 1QFHA 4DKFH 4NYLB 5EC2A 5F7LB 3RWJB 4Z78B 3ARGB 3HNVL 3L3JB 3K2UL 5ADOH 5F7WC 1YEJH 4Z7WB 1JF6A 3BKJL 5KS9F 4Z7WF 5KVFH 2IH1B 3VXPA 1KNOB 2RCSL 2VKWA 4LF3A 5D8JH 4N8VB 1T0PB 1P1ZB 1NJ9B 2VDNL 4MJ6A 2YKLL 4HD9A 5D7IE 3G04A 4HGWB 2R0WH 4N8VG 4KXZH 3NCYP 1U3HB 5DMGC 2WM0A 1LILA 4LNRA 3LV3B 1NGPH 3ULUC 3WCYA 2PTUA 4XH2A 1MEXL 4MB3A 2HTLC 4NNPH 1UB6A 4OBSA 5E6ID 3HR5B 1SJHA 5JOFA 3WBDA 1GZPA 3EYQD 3AXLB 4AG4L 3OKNA 4ZXBA 3FHAA 4X4ZA 1B0WA 1S78C 2ORBH 2HN7A 1G0XA 2NYYC 3BYYA 4RAUA 5D5MB 1MCBA 5D5MF 1HYSC 2FZ3A 3UX9B 4HG4J 3BKYH 4P2YA 2DLIA 3RTQB 3G9VA 3K81A 4HAFA 3BQUD 1KIQB 3E8UH 3K8LA 5AUMA 4HIEB 4QEGA 4YWGL 1RIUL 3I3BA 3GSVB 3LEYH 3X12A 3MC0A 1WCBB 4H25A 3QUML 5D2LE 2W38A 4EJ1C 1A7OL 3ZDXF 3IDXL 3V4VL 1A14L 1RHFA 4MJ4A 4C57C 4NUGL 5EZLB 4HJ0D 3PHOA 3B2UD 4LL9A 2VZ3A 1UM6L 3K3QA 3NBNA 5D1ZB 5SWZB 4K55A 5BRZA 3RI5F 1WWBX 3T4YA 1E27B 4JO2H 4FQLL 3UZQA 4QRRD 1IGTB 4L3ED 3ZKXB 4OD3L 4KJWC 2NY5H 2QJDA 3WN5A 4AIZA 5K9OA 2ZUXA 1EEUA 5MERA 4OAWB 3C6SB 2JJSC 2YRZA 1T03L 5IVXA 2P49B 4GW5B 1I8KA 2I60L 2LU3A 2BXYA 3MZTA 4ZTPL 2Z93B 4I5BA 4TSCL 3PL6B 3ILPA 1CFQA 2V5RA 4JFEA 1E6OH 1N8ZB 2O26U 2ADGA 4P5TC 3A6BH 3AS0A 3KXFD 1KIPA 5BQ7A 1TPXB 3F12B 3HRPA 4F7TA 3C60A 5C7XH 2BSED 2BNRA 2VXQL 4JM2A 4JPWL 3T2NL 1AGBB 1HZHH 1TITA 3BH9A 3IF1B 3L6FA 1GGUA 3LB6C 4JQVA 2HMIC 1ZLVH 3QSKB 3LD8B 2HFTA 4BFEA 1KF9B 1N64L 2PR4H 3LMJH 1OGTB 3QWRD 4KI5C 3BKJH 4XCEA 4HF5H 4M6ML 4GRMA 4YX2L 5KVEH 2AEWA 2VDNH 1DLHA 1S7VA 2YKLH 1PJ9A 4PP2B 1FFOB 1KCVL 2B4CL 2ICWB 2V2WB 1RZGB 4LARH 4LEOB 4K8RC 5C0EA 1PX3A 4JDZA 3MCG1 4TULL 2QKIA 3GIVA 4TSBL 3V6OA 5E2WL 5DF0A 2Z92B 3LH2H 4RZCA 2Q6WB 1L7IL 2BNQA 4HFUH 5F6HJ 2NZIA 4S1SL 4AG4H 5IFJA 2J4WL 2ZSVA 4OCWH 3UC0L 1WFNA 1XGQA 4Y5YB 3L3IB 4ODHH 3IJHA 5GQBA 5EWIL 2E6QA 5I16B 4HT1L 3UPAA 4AH2B 5E8NB 1YA5A 2OK0H 4QOKA 1RIHL 5JQ6L 4WFEE 4NOFA 1EAPA 4J3WA 4L4TE 5JZ7C 1E4XH 4RGNB 2VLKB 5IB4A 1RIUH 3PWLA 1C5DB 4X6CB 2MKWA 4PJBE 4Z9KB 2R1WB 3V6ZB 1H0DA 5HSFA 4UZGA 1ZA6B 2P8PA 5IMMB 5IHZA 5F7MC 1D5BA 2IWGA 5L9DL 3VRIA 2NLJB 4GKNA 3UTPE 2EYTB 4HBCL 3LN4A 4MXWH 2FJHA 4LU5L 3AMKA 2JF1A 4OCMC 1KN2H 3HAEB 3VXMD 3ZTJH 5CD5D 4KC3B 1YY8A 1CFNB 4Y89A 4X6DE 1RK1A 2AEPH 2ZNXA 1F00I 4Y4HC 3CFCH 1DVFC 2EDTA 3L3DB 4G9DB 4ZUVA 4PLOB 2H1PH 1HHGA 1M05A 5GRJL 4CN6A 3S5LA 2I60H 1FVCB 3HE7C 2W91A 4ZTPH 3T3MF 3VRLF 4TSCH 1UG9A 4X8XA 3B9VA 2DQDL 3UJIL 3OTTA 1MHPH 2Z8RA 1KELH 3BKMH 5M7QA 1UB5A 1YDPB 5EB9A 5FB8B 2CD0A 1PQZB 2XA8H 4Y1AD 1DE4B 2JJWA 1A8JH 1I9RL 3F58L 2EIEA 3O45A 3C5JB 3BP6B 5C08A 1VB9A 4ZUSA 1KLUB 4M6MH 3MPCA 1QSED 2YD2A 4OCXH 1AY1H 5D7IB 1RUML 1E4WH 5D7IF 4YX2H 2DLEA 3ARFB 4FXLA 3VFVA 4BZ1L 2B4CH 3X14B 4WRLA 1BJ1J 3FQRA 3MCLL 1IT9L 1G0YR 5EORH 1X5XA 1XF2B 5CMAA 4Y0GA 3HR6A 1NCTA 3MUZ1 3W9DB 5GGTH 3VFOB 1XIWC 2VL4A 2APTA 2FHBA 3CUPA 4OD2A 4XVSH 1IL1A 4X80H 5DJ0B 2J4WH 4XNMA 1NDMA 4WY7L 3BT2L 4LP4A 3FQWB 5LAXB 4JFQB 4M5YH 3P77A 3TIDB 5EOQL 3VGFA 4FA8A 3S96A 5E2JA 2NQCA 3O6KH 1F4YH 2VABA 4KKBC 1XT5A 5DQ9B 5L2JA 4NN7C 4NCDA 2WUCL 3QG6B 3RNKA 1O5DT 2VIRB 1RZJL 4DTGL 3LN5B 5TQ2H 4J3VA 2GK0A 1DQDL 5EBWB 5D2LB 5D2LF 3QXWA 4QHLA 3RWCB 4LBEB 1BOGB 5E70A 4HUUA 1H3UA 1NEZA 4Q9RL 4OB5L 5I76A 5L9DH 1KG0B 4ZUWA 3GI8L 1XF5B 2FD6L 4I8DA 4Y4KB 1PY9A 4LU5H 1Q9LA 2DQEL 1IKFL 4GKSB 4EI5C 1YC8A 4GAYA 4QXUL 1U8JA 4QHMB 4Q9QL 2ZCKH 3QIBA 4WUKH 2F53A 3JWDH 1FH5L 5DA0B 4LSTL 1CU4H 2P5ED 3FQNA 3FFCD 1VFMA 4NCC2 2P48B 1QRNB 1BIHA 4M7KH 2CLRA 4GS7B 3U0WL 4TUKH 3FRPA 4YNYB 3UJIH 32C2A 4PV8B 4MAYB 4ESKA 4P2QE 4XAKD 1L0XA 4QXTB 1RURL 1YN7A 5EUOA 4QRSA 3V4UH 3C9NB 5KSUB 3BW9B 3QCVL 1DSFH 4UU9B 1ADQL 2IAMB 3HMXA 5DJYA 3NCMA 2AGJH 3RU8L 2GITA 2L7UA 3GMOA 3H7BA 1X3DA 3LDBC 4ZXBC 5GIRB 1UWEH 2JB5L 3D69B 4YFEA 1P5UA 3IVKB 3SDYL 4QRUA 3C5ZB 1U8OB 3ARPA 1FNSH 3FHQA 3QI9A 3MGAA 2AK1L 2Y6SC 4X7TA 4O5LL 4JHBA 5FO7B 2BOBA 2XTJD 1K4CA 4BZ1H 1TQCC 4DN3H 4YPJA 3MCLH 3SOBH 2F5AL 2EDOA 4QXWA 4K3EH 5FIEA 1JNNL 3TBYB 3IDMA 1CVRA 1EX0A 3FT3A 4HK0B 3F7VA 2DIBA 3RGVD 2PTTA 1IMHC 4WEBH 1EEYB 4JZOA 4YC2B 5IP4A 2BHYA 3RVXC 3VH8G 1YYLH 3SDXB 3ULSB 3V8OA 4P4RA 3H3PH 4GKZA 4I1NB 1CXIA 4Z7UE 3CXDH 3BUYB 4L4TB 5LQBL 3QP3A 4OUUA 1I8MA 4WUUE 1DBML 2IH3B 4NJAL 1BPVA 2IF7A 4LNVA 3D25B 4NCC1 3EOYG 5HYSG 4TVPH 1WSST 5EUKB 4PJBF 1WBYB 4KAQL 1DQDH 3BX7C 3WN5C 5J11C 2FH8A 1R3IH 1ETZA 4UDUA 5EO9B 4NWUH 2GJ6A 3RZCA 5HHXL 1B3JA 3NH7L 4Q9RH 3DMMA 4OB5H 3HZVA 3OB0K 4PGBA 4K71C 4NQED 4ZUUB 5IKCB 1KBGL 4Z7VE 4QXUH 4X6DF 5CP3H 5I1JL 1RUAL 3QCTH 1QBAA 1F6AB 4CDHA 1OWRM 5C0BA 4JQVC 3MRDB 3EYUL 3WHE1 3IFNL 2VC2L 1A02N 4E41E 5C2UB 1G9NL 2X6MA 4FP8L 4E9LA 3TEUA 3U0WH 4AK1A 5GS1A 3GRWL 3DI3B 1O7SA 4NZRL 1FO0L 3L1OH 1J1XL 4YBQC 4QRPD 1RURH 2GI7A 5I1HL 3U4BL 3V6OC 1K6QH 3OB8A 1NLBL 2CIIA 4O02L 3QIWB 5HXMA 1RZFL 4RNRA 1FNEA 3QNZA 2NXZC 1SMOA 4C56B 3TO4B 2L7JA 4HC1L 4LGRB 3KYMA 5DHVA 3HB3D 1C5CH 4UV4L 3SDYH 2RGSA 4HH8A 1CLCA 1J18A 3H9ZA 2DWDB 2I07A 1BVLB 2ZPKL 4BKLB 3QULB 2X4UA 1WZ1L 2DBLH 4HUKB 1HDMB 1S9KC 1KCRL 3BGFB 4J3UA 4XP1L 4W4OA 4LRNH 3T1FA 1A6UL 2BDNL 1JYNA 3C2AL 3KS0J 3R06B 1BBJA 3L5WB 4JY5L 3CCHB 1AC6A 1A1NB 4GQPH 1N59A 5EDXA 5T5FH 2ZG1A 4NOBA 1JHKL 5T1LA 4R7DB 2AEIT 4LHUB 5CLWA 4LMQE 3TNNB 2VQ1A 1T83A 2NY4B 3DVNB 4U6XB 4ZODA 4HXAH 4UINL 4YR6A 3QH3A 1G6RB 1K2DB 2EC8A 4JFPB 4LFHG 1XF4A 3U6RA 1CLYL 4NC0B 4KAQH 1KFAL 3SGDI 3MV7D 2FL5B 4KRMB 3MBED 1MJ8L 3A67H 1BLNB 1NQBA 2GCYA 1KJ2H 5JUEH 3Q0HA 5DI8B 2H6PB 3QEQD 4N9GB 3GHBH 1MRDL 4WW2A 2ZUUA 3RQ3A 2E7HA 1PAMA 4LVHB 1KBGH 4JRYE 1NBQA 3CFBB 1X5IA 4EN3D 3UO1L 4J2XA 2D03L 3L3GB 3MLTA 3FT2B 2AABH 1ACYH 3MODH 4CMMB 2A6JA 4RIRB 4R4FL 1WEJH 3VWKA 5HHOE 1EH9A 1U92B 3K74B 3VXRE 2G2RB 1GZQA 5IT2H 5I2IB 3HZKA 4HWBL 5D7JD 2D7MA 2NX5E 3ULUH 1SBSH 3KJ6H 4IMKA 4K8RL 4P2QB 5F3HB 4NZRH 4MQXD 1SEBA 2OS7A 4JN1H 3K8KA 5DS8A 4LLVB 1Q38A 2IQAA 4FNLH 5D1QB 1WGOA 3U4BH 3FZUC 2LVCA 5C0AE 3VXSD 5L8JB 1KT2B 2OQJA 4GG8A 5CEYA 3JV4A 2Q8BH 3T0EE 1HIMH 1YNKL 3UEZA 1QFWI 3RVWD 2V6HA 3GMPA 5GS0L 1KGCD 4I4WB 3I2CL 3DRQA 1I7ZA 3MO1B 4UV4H 3QQNA 1LO4L 5DJCA 3KDMA 4ZPVB 4X99B 3CH1A 4NN6B 1GGIL 1WWWX 4PYGA 2APFA 3O4OB 4EIZC 2OI9B 4F8TA 1BAFL 5FKAA 3T8XA 2VUYA 1UH2A 2BDNH 3UXFA 1L9NA 2X89D 5GGRA 3QUZA 3S3PA 4C58B 3E3QC 2WINA 3QFDB 1A2YA 3WXWH 1UH3A 4N1HB 3PWPE 3TZVD 4KHXL 4Z7UB 4Z7UF 4I3RL 4OF8A 4WUUB 1K8DA 4Y88A 4Z8FL 2EXWC 1EPFA 3GKWH 2DWEB 4K94L 3CDFA 4XNZC 5KTEL 3QIBC 3QEUA 3EYFB 1I7RA 1QOKA 1FAKT 1B0RA 1H5BB 4OCRL 3GIZH 1ZS8A 4HDIB 1V3LA 4YGVA 3WJJA 2E7MA 1FNHA 2XYCA 4MS8D 1U8IB 3MRGB 5EIIB 1ZVYA 1EXUA 2K3TA 4FS0A 4GW1B 4X7DC 4Z7VB 3NZHL 4Z7VF 3E6FA 4F57H 2FRGP 1MFAL 3MLWH 5JW4R 2ATPA 5CP7B 1CGUA 1NGYA 3UO1H 3QUYD 4KK8C 4FN0A 4U1MA 2EYSA 4GQ9H 3TN0D 2DQIH 5GSRA 3TC9A 1A1OA 4E41B 4MWFB 3DIFA 3BIAX 3EO0A 4YDJB 5D7KD 2B1AL 5DURD 1EZVY 5SWSA 1G7JB 3TV3H 3QI9C 1NC2A 3ARQA 1F3JB 2L4OA 3D3VA 3SDCB 3MNZB 4XP4H 5BMFL 2X4QA 4UQ3A 3VGAC 2OL3A 4GT7A 3P4NA 3DX8A 3B3IA 1JRHI 4Z7OE 1XGRA 2C3XA 3GGWA 1LK2A 5IHUL 2HG5B 1IQDB 4OGYH 5KSAA 4IHOB 2X4PA 2YUXA 5L2KE 1FG9C 35C8L 4O2EB 1BHGA 4PJAE 5B8CA 1LP9E 4HIJA 5TFSL 1SEQL 3TPUB 4ONFH 1FNGB 1M7IB 1TZIA 3CFKB 5EZJA 2XRAL 3JWOC 4RGOL 3WUZA 3EHBD 2GY5A 3S34H 3HMWL 4O2FA 1QLEL 1AI1L 2MWCA 4PRNB 4PJ5A 1A7QL 3TBVA 1Y0LA 4QT5B 1QFWL 4PJ9A 2DQTH 3C5SB 4M8QA 5DD6B 3RZCC 5FV1L 3DMMC 1RJZB 1T66D 4EVNB 4GAJL 2I27N 1A6WH 1JN6A 1UXSB 4XTRC 5FGCB 4LOUC 5HHME 4M48L 3U2SB 1MY7A 1FZKA 2NY1B 4HBQA 2P8MA 3UTQB 1VHPA 3IFPB 2YD9A 4BH8B 4HUNB 4HCRH 4NKOA 2DDQL 3RJDA 1X5JA 3IXAA 4FQQB 2APXA 4P46B 1HILA 1CTOA 3TVMB 3EBAA 1C16A 1HSBA 4LSPL 1UQSA 1RULL 1NAMA 4MDJA 1OT1A 3AAZB 1KEGH 4P59L 5FYLD 4JRYB 4P23B 4ZFZA 1MOEA 1UVQA 2YEZA 2V2XB 1SQ2N 4X83A 5KSVA 2V2TA 3W2DH 2QSQA 1BQHG 1ZE3C 5GHWH 2ED8A 5IBLD 1CE1L 1EFXD 2E9IA 1F02I 4UV7L 1IM3A 1RUQL 3UP1A 2X4RA 2OJEA 1I7TA 3CVIH 5HHOB 3VXRB 4ZTOH 3DVIA 1G7PB 4JPVL 3DUSB 3B2VH 5J9PB 3C8HA 4I0PA 1FLTX 4Y4FC 5HY9B 1LO3H 2MSPA 3ZKMC 4WNQB 5IB5A 5C0AB 4J3SA 3FRPG 5GGVY 4HG4K 3S37L 5DEGA 3F7RA 3T0EB 4NIKB 1Z0MA 2A6DB 4UT9L 2E5EA 1MJJA 2QQLL 2VB5A 3HI6L 4U1SA 5ICYA 1N6UA 5FYKH 4TSAH 4FXKB 3MFGB 3KPRD 5B22A 4ALAL 2CMRH 5TF0A 5E8EB 5HGDA 1DEEB 1SEQH 3HC3L 1T83C 4RGOH 1K4DA 3QUMB 3DGCR 1JF5A 1XGYH 2OR9H 3QBTB 3DO7B 1JRHL 3V0VB 3HMWH 1FP5A 1U8QA 1QLEH 2VERN 4KTDH 1AI1H 2IANB 4KJYA 5LXGH 4XX1E 4KI1A 1FBIL 1NANI 1YEGH 1XFPA 3HI1A 3PWPB 1HCVA 2FSEA 4MNGE 4OLZH 2IFGA 3WJLA 2AV1A 3WHXB 4KRLB 3SE3A 8FABA 2Q76B 1KC5H 3WFCH 1H8SA 4JFOA 3QHFL 4G8GA 2VYRE 1NLDL 3NCEB 2VSDA 1L9MA 1IGCL 4U1JA 2KUTA 2CDFA 4UTBH 3NFPA 5GGSA 4Z7QE 3ZYOA 1RIVH 3KHOA 4WO4D 5KBNC 3VWKC 4LSPH 1VESA 3D2UD 4OV6F 1RULH 4XP5H 2Z91B 1BZ9B 1CGSH 4IMKC 5GGUB 3LKQB 4HUXA 4O58H 1OD7A 5GZNC 2HT3C 4KRPB 3GMRA 2UZIH 2ZWLT 3I84A 1X7QA 5LBSL 1ZT1A 4LGSB 5I8KL 4M9OA 3MR9B 3ULVD 2CLZA 1RUQH 3MCKB 2MFNA 1HEZB 1BM3L 3G6JA 4PJGE 4KJQC 4R0LC 2R0KL 3IJYA 3VFTA 3FOMB 5DVNA 5F8RC 5E08L 1BFVL 4JPVH 4N1CA 4WV1A 5DEFA 5DVMA 1U41A 2CGRL 3GSQB 1OGAE 4ZAKB 1C08A 2YD1A 3DV4B 3GJEA 4LCIL 3HLAA 4JFDA 4YHOL 5LGJA 5I8CA 1VCAA 2B5IC 3FAWA 4P9HL 4Z7OF 3IU3A 1T04B 1IGML 4UOW1 2ZCHH 3Q3GA 4WU7A 3B9KA 3BH8A 2VH5L 3EW3B 3QUZC 2IBBA 4N5UA 4UT9H 2VDLL 5L2KB 3GSXB 4XC3H 2QQLH 5KJRH 2RFXB 3HI6H 4CJ1A 5J57B 4PJAB 4U0RC 1HQ4B 1LP9B 3MLRL 4PJAF 5JO5B 1LP9F 2VR4A 5F71A 1LE9B 3FKUS 2PO6A 3OR6B 1LWRA 3HPLA 3MLUL 4MD0B 4L9DA 5HYJE 1ZHLB 4X8JA 1R3HA 1CFTB 3CZJA 3OKMB 4OQTA 4WFHE 4CN1A 4L8CA 4HAGA 1NUNB 2ZUYA 4WW1A 4AEIL 1CD8A 4LLDA 2EIDA 1RZKL 2H3NA 2YWZA 3WJJC 4FFZH 1FBIH 1VFBB 4MJIE 1DBAH 1N4XL 1VFAA 2YPLA 2EYRA 4TNVK 4HEPG 4M1CD 3IDJB 5KVGH 4JDTL 5HHMB 2DYPA 3TCLA 3MLPA 3FOLB 1Y6KR 3EFDL 2A2QT 5E1HB 5J13C 4OM1L 5E2TL 5F7DA 1IQWL 2HVKA 3T0WA 3W39A 1B2WL 2DL9A 5FGSA 5ERWA 5IM7A 4JY6B 2Y36H 1RK0A 3QPXL 4PLJD 3OV6A 2WIMA 1BZ7B 4AY0A 1AGFB 2W0PA 2Z4QB 3BOVA 1KPVB 4KKAC 5HI4C 4XPBL 4JRWA 3ABZA 5ICZA 4MQ7B 1I4FA 2I26N 4FABL 2J3SA 1U3JA 2DQGH 3C6LD 2V5MA 5IQ9A 1OSPL 4U1GC 4MVBC 4RFOL 1GOFA 1I3RA 5E9DA 4ELMA 5KSAC 1U2HA 2BFVL 1X5HA 3ZSSA 4YK4C 1OQOA 2ZJSH 1BFVH 5L0QB 4RMQA 4Y5XB 1WC7A 5B8CC 1MAMH 2CGRH 2VDOL 3OHXB 4FQCL 3ZHKA 2PXYA 4PJCE 4OQ1A 1UEMA 3FO0H 5FYJH 4J3TA 4TRPL 3P0YL 5CFHA 2YK1H 4G43A 5I18L 1FE8H 3MLXH 2F58H 4YHOH 5DRXA 2AI0L 2OLDA 1D5IH 4N0UB 2E3VA 2YUWA 4NQCD 1EVTC 4DGVL 4GFTB 5HHNB 3FJTA 1DR9A 12E8H 1T7XA 3LZFL 3SHSA 5FF6B 1KULA 1T4KB 4JFZL 1I9JL 3SCMB 3VFNA 2XWBB 3CDGB 1RHHA 5EA0H 3P73A 5FM8A 3DXAE 4UT7H 2MNUA 2A77H 2H2SD 5A2KH 4P48A 1BVKA 1CGXA 4DN4H 5ENWA 5T1KD 3IU4L 1YEKH 1MNUL 1JNLH 4KK6D 5C8JA 2EZ0D 2R69L 1RUPL 2GFBB 1JF1B 3K4AA 3NGBB 4XVJL 4JLRA 3ROOB 1N5YL 4K3DL 1AO7E 2LU4A 3B5GA 3DX9A 5J3HD 1JWSB 2YC1B 5ESVB 3BEWB 4MNGB 4P0DA 2BRQA 4TUJA 4RFNB 3O0RL 2GW5A 1KTLA 2CRMA 4FTVD 4QRQB 1CZ8L 2F74A 3ARBA 4XCFH 4XB7A 5FEBA 4M1DL 4YHPB 5E1AB 5MEPB 4N5EC 1DBKL 4U7KA 1MCHA 5CUSH 3D85B 4HPOL 4Z7QF 4PJXA 3WIHA 4HZAA 1NANH 5H35A 4EI6B 5TDPB 2YD3A 4ORZC 4FQ2L 2RR3A 2R15A 1VPOL 4BSJA 4HW6A 4V1DE 1AXTH 1CGVA 3ARGD 2I9LA 4I0PC 4XPBH 3RWEA 1J88A 4UT6H 3DTXB 5L8KB 4YE4L 1GVIA 4NRXA 1T20B 2AERT 4BZ2H 2Z35B 4FABH 3GMMA 5B39A 1ZA3A 1MHHB 5D9SB 3G08A 1I3GL 1R5IB 5C0CE 1TJHH 3KPTA 4PJGB 3KPNA 3QJHB 4PJGF 1MHEB 4YBLC 1U3HD 5F1IA 2A1WL 1ZHNB 2P43B 2YHGA 4LCUB 2BFVH 1F3DH 1OGAB 3FB8A 4CUCA 3JWOL 5B38B 5KZCB 3KLHD 4KK5C 3R1GL 4JY4A 3P9WB 2VDOH 4J6RH 1MCOL 2BSRB 4GRLA 1QLFA 1UWXK 5INDB 3F7PC 3BRDA 3L5XH 3LEXA 3EGSA 4M93C 1BFOA 5K9QG 3GJFB 5CINL 1RJLA 4L3EA 2V7NB 1HHIA 43CAB 2XZZA 4GLRI 2XPGB 5FA4A 4M43H 5GXBB 5A2FA 5EZIH 1OTTD 3HE6B 4NKMA 2NW2B 5KVMC 2XN9E 3GFUA 3RTQD 4RAVB 1UCBL 1ULVA 3Q1SL 2AJZB 2ERJC 4NJ9L 1A4KA 3WJLC 3UJTH 5HYJB 3F7YA 2BXZA 3KJ4C 4X4ME 4LLWA 5DJZB 6FABH 3BPNC 3SE3C 3IDGA 3SQOH 1QLRB 3NZ8B 1SYVA 3KXFA 3MUY1 3TWCH 3OKEA 4PB0L 2D7PA 4PRHE 3MRFA 4ODUB 4UIMB 4DK6A 1AXSB 5C71A 4XNYL 4YH6A 5GGQH 5MEQB 3I75A 4UUJB 2CRYA 5CBEB 2R69H 3QWRA 4XVJH 1N5YH 5D1ZD 5SWZD 4S1RH 2FGWL 1G1CA 1YMHA 1FYHB 1MRCL 1XCTA 2ID5A 4Z5RB 4WEMB 4XI5D 2HKHH 1BX2A 4PJ8C 1CQYA 4NNXA 1YY9D 1F4WL 3HMXH 5ANMA 2EDKA 3WFDH 4IDJL 3OAUH 4RMWA 4NO0B 1A22B 3RDTD 4R96B 1PKOA 1BBDH 3BHBB 2DLFL 2AV7A 4CU8A 4GAFB 1DBKH 4E5XA 1S5HA 3G5VA 1FO0B 3HZMA 1A7PL 3MGOB 4PY8J 1IILE 5T3ZD 2A9ML 3U7YH 4WV1C 2HKFH 2NY3C 2VXSL 5EO1B 4BFBD 4NNYB 4YXHL 4LKXA 4NHUA 3AREC 4HKBA 1ZT7A 5MHSE 1ED3A 1MH5B 4I48B 5CGYD 5JORA 5FHBL 3OR7A 4KQ4H 1I3GH 3MRPB 4KHTH 4BQ9A 1J05B 3U36A 1J0YA 3BKCH 4KK9D 3B9KC 2H26A 5D96C 2YXMA 5FUCC 1HH9B 3MBXH 3TA3B 5KVDL 3EYOB 5HD8D 2HLAA 3JWOH 2PO6C 5EFIA 4PJCF 4EQ2A 2VLRB 4XRCA 1K8IA 3MRCA 2V7HB 2B0SL 4BSVB 1JHLL 1JUFA 2DQUH 1EO8H 1R5WB 3EAKA 5CINH 4BA8A 4P2RB 4OI9A 4MNQA 4H0IA 1Q94B 1MCKA 1G7LB 3ILQC 4NSKA 5J6HA 5BZDA 1HI6B 1MPAH 4ORGA 4L5FH 3KPLB 3BDYH 5JXAH 2VLKD 3U30C 5EU4B 4YBHA 3JTSA 4XCNB 1ZGLB 4PTUB 3KLSA 1Z5LA 1A1MB 3BZ4A 3E6HB 1YMMA 2NXYD 4WI8A 2HAZA 5I1DB 3KVQA 1FORL 3AROA 3DURB 4OZFA 4HULB 1NCBL 1LVEA 3HZYB 4Y1AA 5EN2B 4BSWA 4L8BA 3LRHA 4LPXA 1AQKL 2CIKB 5DYOB 3WFBL 1QP1A 4CN4A 3KWWB 1U8KA 3T09A 2VLLA 3TH4T 1AO7B 3VJ6B 1XGTA 3MXWH 5DTFA 5D72L 1UEYA 2BMKA 2VDPH 4CJ0A 1MRCH 4M4RA 4QNPE 2BNUA 4R3SA 5EU6D 2JIXB 4RBPH 4D9LH 1SVCP 4DGYL 2WZPD 2Z9TA 4UOW0 3CZFB 1A6AB 2QQNH 1DN0B 4JKPL 1JZ6A 4R4BA 1QVOA 5DHVH 2VXTL 1JNJA 4AIOA 1ZTXL 1MFBL 2FATL 3WNPA 4BQ8A 4V1DB 1LEGA 2BVYA 2OJZH 1E28A 3CK0L 2WLYA 3BP4A 3L9RA 4YDVB 5F88B 1ZT4A 3SGJC 4PJDA 4BQBA 1N6QH 5CJQL 4BYHA 2EO9A 4AMKL 4XPHL 5FHBH 3EJYD 3JV6A 4OTXL 2A6IA 5C0CB 3BZFB 1LO5A 5DD0L 4P3DA 4LCWA 1ZK9A 5IWLA 3KPPA 5I75C 5BRZE 3SKJL 5IB3B 3G5YB 1NFIA 1UYWL 2YD4A 2VE6B 2R1XA 3NCJH 5DEZA 3X13A 1MCQA 4R4ND 4R8WH 4XVTL 5E7FA 5C07A 2ADIB 1GGCL 3WLWD 5CZXD 4PD4J 4XP9L 2OM5A 1M6OA 2D9QB 5A43C 1TZGH 4X5XA 4K3JH 5F3BA 1S7WB 4ETQB 1MIML 5H94A 2W60A 1Y6MR 2VLJB 4PGEB 5BO1H 2P5EA 5LKNA 2OTWA 2J5LC 4QRRE 2P45B 1DVFB 3TIEA 4NKIL 1ZSDB 1YEFH 1KJ3L 3W9EB 1LMKA 1F58H 2COQA 3QYCA 1RV6X 5DD1H 3O3EA 3HE7B 3TNMB 4DZBB 4U1KB 1ZLVK 2WP3T 4TTDD 4PRHB 4KRNA 5JMRA 3MRQA 3OX8A 4H26A 3QRGL 4XZUB 4WWKB 5IF0B 2PCPA 3ARTA 3WFBH 1TVHB 3OZ9H 5CEZL 3R8QA 5AAMA 1N5AB 3KYOA 5KW9L 4JM4H 4KTEL 1LGVA 2OCFD 4YHML 4HWUA 5A1AA 3QXAA 2J2ZA 5EOCL 2BNQE 3TYGH 1CL7I 3D0LA 3N1GC 1NFDB 2YBRB 3IDNA 3DVFA 1S9XB 2EIZA 4HKXB 1IAKA 4WU5B 3BQUC 1TJIH 3KR3H 4U6YA 2X70B 1QRND 4RISL 1IAOA 4QOKE 2HYMA 3A6OA 2XFXA 1P4BH 1HXYA 2AXJA 5HDQH 4XAWL 2VXTH 4MAYD 3RGVA 3QIUB 1A6TB 5DC0A 1BWWA 4YO0B 2HP4A 1KPRB 4I77H 1WAAA 3GK8L 2IAMD 2FO4B 1ORSA 3GUTB 4C55A 5FK9A 1KCLA 3MNVA 4GRLC 1WBZA 4OZGE 1A7NL 2DQCL 1MQKL 1EA9C 2P44B 4PRBB 3FO1A 3PUCA 1GGBL 2AXGB 2WV3A 3DGGB 3LHPH 4WTZA 4YAQA 4YHKL 4C4KT 1JGVH 1ZWIA 3C5ZD 4OBRA 5JOEA 1P4LA 1T3FB 3IGAB 4BUGA 5H2BB 3O8XA 3QZWG 4NN7B 3T2QA 5DJ8B 4QTHA 2ICCA 2NY2B 1FFPB 1TZHB 1HSAB 3GSUA 1M4KA 1QEWA 2VQTA 3TJEH 1UWGH 4LEXL 4J8RB 2D7TL 3V79C 2AJUL 5I1AA 4HWNA 5F7EH 3QDJB 4PGDB 4KMTL 1HHHA 1H15A 4F33A 5E4EC 2UYLA 4XVTH 2NY0B 5E2UL 2GJJA 3TM6A 4KMQA 1HKLH 1WIUA 3PGDA 3KLAB 5ETUB 3CX5K 3QWQB 3VXME 3VFUB 2J1KA 4PJ7B 4MCZB 1VENA 4P99A 5LGKA 2GSIB 3FQUB 1NAML 1T21A 3X3FL 3ZZ1A 2ZCLH 4X5LA 3M17A 1P9MA 5EC2B 4ZS7L 4MYWB 5CIPA 3MACL 4QHNA 4RMTA 2DTSA 4GRWE 3WNMA 5CCKH 1FLRL 3PV6B 3VXPB 1R24B 1H3TA 4MJ6B 4L4VE 3UTPD 1RFDH 1UADC 5E94A 3MRMB 1YQ2A 1BREA 2VZUA 4LNRB 4H1LB 2VUOA 4OJFH 2CQVA 4NKDA 3LEVL 5TDNB 5CEZH 2FJFA 4QCIA 2YN5A 1FL3A 4ODWA 5I1KL 3LIZL 1UB6B 4KTEH 4KVNH 4OLXH 1GZPB 1DANU 1RMFH 3NIFE 5GRWA 4QNPF 1MWAL 1NCCL 3J8F7 1PG7W 1D5ZB 3LDBB 4ZXBB 5F6IB 3CSYA 3O4LD 5LGHH 2JB6A 5KANI 2OL3H 5CGTA 3SDDD 2HN7B 4APQA 4RAUB 4XCYB 2NPLX 4RISH 4S0TD 3A6CL 4YPGA 4U6VL 2FNBA 1T2QH 3WDJA 4XAWH 1RSFA 1RZ8A 4K7FB 5AUMB 1JYVA 1J5OH 3VXOA 5FOBB 2W92A 3X12B 1JIBA 4YFDB 1CL7L 4PR5A 2N7AA 4CVUA 1Z6JT 5I1EL 1IFHH 3QIWD 4ZUTA 1HXMA 2X4TA 4C56D 3TO4D 5DVKA 1A7NH 2DQCH 5DK0A 3B5TA 3MRLA 5CJ5A 4AL8L 2OTUA 5I73B 2EDJA 3PHOB 2EH8H 2ESVA 4JO1H 3MREA 4M3KB 1MRFH 4JAMA 1C7SA 1DQJA 3QDHA 3LS5L 4OSUL 3NPSC 5BRZB 4IMLA 5CSZB 3T4YB 4PB9H 3MV7A 3B4NA 5DGRA 4LEXH 5M94B 3PGFL 3RIAK 2AJUH 4AIZB 2F53E 5HVHB 3B6SA 5J11B 5MERB 1JGUH 1F97A 1U36A 2FBJH 1CK0L 4YHYB 1UZ8B 2F19H 1BEYH 4KMTH 1GXEA 3MJ7A 5GZOD 2EDHA 4I5BB 4F58H 4F3FB 2WSKA 1CFQB 4K71B 4OF7A 1GAFL 1CLZL 3MRRB 4J1UA 4JFEB 3I85A 2CUMA 2RB8A 1FVEA 5I1IL 3FTGB 5F72S 1KIPB 5BQ7B 4LHUD 5DQJA 4F7TB 1S5IL 3C60B 1L7TL 2BNRB 4JM2B 4JM2F 1VFOA 2NY4D 3IFOA 3BPCB 3BH9B 3L6FB 4P3CH 4UDTA 4UIKH 4XC1L 4JJHA 1EAJA 1A9EA 1FYTA 2IGFL 4JVUA 3F65A 3SJVA 1FLRH 1Z0NA 3S35X 5I6XC 1QYGL 4GRMB 4X6EA 5CAYB 1KXTB 3RWHA 1MJ7L 3MOQA 3ARSA 1R5VA 1S7VB 2X1PA 4JR9L 2HA1A 1T0MA 1AIFA 1NMBH 2HFFA 2IALA 5C0EB 4JDZB 3HC4L 4NO5A 5CKGA 2QKIB 3GIVB 4PJHE 1J1OL 4S1DD 3GSNH 4EUPG 1ACZA 2BNQB 3RHWK 1Q9KB 5HHQB 1NCCH 1QSFA 3U83A 5IFJB 1NFKA 2ZSVB 4H20H 1E6JH 1XGQB 5DJ2A 4G6KH 3RX7A 1F3DJ 4ZQKB 1OAXH 3BJLA 3O9WB 5K93A 4MDIA 4JRXA 3S35H 4QOKB 2XTJE 3LKNA 3HRZA 1BD2A 3J7HA 3VXTA 3U9PL 5IWLC 2KKQA 5D1XA 1PG7L 1TETH 5LWYL 2VOTA 3ZE2E 1GPOL 2GJZB 5E00A 2FH6A 2AAVA 1H0DB 2P8PB 4WGVB 4OZGB 3VG9C 5IHZB 4OZGF 1JWUB 4OQTL 3VRIB 4GKNB 2EDRA 1X44A 3LN4B 1G7MA 2XQYG 5JOPE 4OKVA 3RA7L 4KKLD 3P4OA 4WCYL 1YY8B 3LS5H 4OSUH 2SEBA 4IRJA 1RK1B 3I6KA 4Y16A 2IPTL 5IFHH 1CDJA 1FC1A 2VTFA 4ZUVB 4JFHE 3T4AA 4AEHH 1KEML 4ONOA 4U33A 1HHKB 4KDTA 4EBQH 3S5LB 1DDHA 1NCDL 3K0WA 5EO0A 4TTGA 3VXMB 4X5WA 1U6AH 4NQEE 5HYQA 5BVPH 1DP0A 3ALPA 4HQQL 1CLZH 1AGEA 3TN0A 3V4PH 4GW4B 3VFSA 4OCSL 2HWZH 1DLFH 2R2BA 1MVUA 4WUUD 2IBGA 3MRNA 2C5DC 5DZNA 1KTDB 3VW3H 4GRWB 3O41A 4ZDHB 2IGFH 4GRWF 3O45B 2QEJA 3SKOB 1D9KA 3ES6A 4FMKA 1NCUA 4ZUSB 4GXUN 5JXED 3GMQA 3CVHA 4DK3A 2EE9A 4L4VB 1XF3A 1JV5A 1KIRA 3NACH 1Q72L 5CEXA 4QRPE 4U3HA 3OKOB 1W0YT 5D6CB 4JPIA 3RGVC 2FWOB 4G6FB 4K7PL 5MI0C 1NEUA 3CXHJ 3NIFF 1QSZA 4OD2B 3WL9A 3CFJA 1OL0A 5DO2D 2R0LL 4XNMB 1AE6L 1G9EA 1CF8H 2P5WA 3F5WB 2XQBH 4E41D 4LSRH 3P77B 5ICXA 3S96B 3BE1H 2ZUQC 3OGOE 2VABB 4X7SH 5L2JB 3MFFA 5HI3C 2AJVL 3RNKB 4GOSA 3SDCD 5JW5A 4QY8A 1B9ZA 1MHCB 4I0CC 3DHMA 4PV9A 4GXVL 1XGUB 4AENA 5K9JL 1U0QA 3WKMH 2X1WL 5IESH 2EDWA 4HUUB 1NEZB 3HC0A 1R3KB 3UAJC 2C3WA 4JFFE 3MROB 4TUOA 2IG2L 4L4JA 4WI5A 2AVGA 4GBXA 4S1QH 3TPKA 4ZNCD 2J8OA 3IFLH 5GGVL 3VFMA 4MA1C 4GAYB 4PREA 4WCYH 3MXVL 4XGZA 2F53B 1P9MC 1QBMH 1YJDL 2QR0B 3FQNB 2OR7A 3QAZB 1KEMH 4UB0H 3LOWA 5CD3B 1MJUL 3VI4E 1KUMA 4OFPA 4GAGL 5K33A 4IOIB 4UTAL 5F9OH 3VG0H 4DEPC 1AC0A 1I7UA 4XBEL 1DL7H 3WIHL 3UPRA 3GI9L 1OF2B 4DVRL 3RUGE 5I30H 3O6MH 4OCSH 5EUOB 4NP4H 4QRTB 2FIRT 3BEVA 5CJBA 1ZVSA 2NY1D 5DJYB 1TJGH 1RU9L 3LVEA 3CLEH 5F9WC 5AZEL 3HB3C 2GITB 2DI9A 1S7TA 3GMOB 1XH3A 2AP2A 4OCYL 1JNHA 1JMZA 1J87A 1BGXL 2CDEB 1U8NB 2BY0A 2OXHA 3OPZH 4G5ZH 4QRUB 4APQC 2R4RH 1PY4A 4IRZH 3OWEA 1FPTH 3QI9B 2A73B 4WHTB 3VMPA 1TTFA 4LSDA 2VN7A 4X7TB 1NGWA 2BOBB 1K4CB 2NY7L 4L3AA 1A6ZB 1ONQB 3NA4A 4PJHB 5ESQA 4PJHF 1T7ZA 1ND0A 3D39E 4HIIA 2DICA 4K7PH 1JVKA 4DKAA 3IDMB 3T2PA 2DD8H 3FT3B 3UZVB 1MAJA 3OXSA 3F7VB 1SHMA 2EH7L 2PTTB 4ENED 3GMNB 5TDOA 1LO0H 5ESAA 2Z31A 1EK3A 1KGCE 4RDQF 4LCCA 3ALXA 5HHOD 2VJXA 2MKLC 4O2CA 3VXRD 4RDQG 2N7BA 4GKZB 2XTJB 4H8WC 4IEFB 5KN5A 4W70A 3RAJH 4HH9A 2QSCH 3KPMA 2ZOKA 4K9EC 4OUUB 4M7ZC 4FZEH 1DANT 5E99H 2C26A 3ZE2F 4PRAB 2WBJD 2X7LA 3SE8L 5C0AD 1C7TA 25C8H 4N0RA 4GXVH 4MLIA 1ETZB 4UDUB 5E8PA 5A3ID 2GJ6B 3T0ED 3RZCB 5IMOA 4N0CD 1KSRA 3DI2B 3HZVB 3H2WA 4ERSL 4HIHB 3S37X 2XY1A 4MB4A 4FFVD 4G9FA 1NL0H 1A47A 2EIBA 4LQ1A 1MF2L 1G7IB 2HFGH 3MXVH 4NPYA 4XMKH 4WO4A 1IAMA 2J6EA 1G9MC 4JGUA 3N9GL 4Y19A 3REWA 2Y5TA 1LDPL 4ZSOA 3SDAB 4WFFE 2BVPA 3PV7A 2DQJL 3S3JA 2IAND 3REVA 2X4OA 4M62H 2AKRB 4MQXC 1TLKA 2X1XR 1U58B 4NQEB 4NDMA 5BS0E 2XI9A 4G7YH 15C8L 2D9CA 2OXGA 5GS1B 4JN2A 5SWSE 4JFXB 3WIHH 2R2HA 3GI9H 1NCAH 3FRUA 1PX4A 2LTQC 4NM8L 3QG7L 4CADA 3HUJA 3O2DL 4UBDC 3RVWC 1U93A 2CIIB 4OGAD 3VA6A 1SY6H 4RNRB 1FNEB 4R2GC 4ZNEE 3SEPA 1CDGA 1QZ1A 1GH7A 2HFEB 4KH2A 3KYMB 3UJJH 1Q0YL 2BK8A 5D7KE 5HYEA 1V3KA 4A2LA 4ODSL 4D8PA 4OZIE 3MOAL 2I07B 3U82B 4NGHL 2VWEE 2X4UB 4MD4B 2AJXH 1CLOL 3KYAA 3MV11 5D1XC 4KRPD 1J8HE 3T1FB 3N1QC 4DCQA 1BQLL 3TZVC 2VXVL 4PJ5E 4JGMA 5F6HI 3VGBA 1T89C 3DVGA 2YR3A 3FO9A 1BBJB 1N59B 4H0HB 2BOCA 1OAQH 2FLBT 2I5YH 5HTSA 5T1LB 1Q0XL 3T08A 1JGLL 3HG1A 2VQ1B 3OKDB 5A40E 3FCTB 5CHNA 3VGGA 1XR8B 4IRJC 3G5ZA 4XHJD 2X05A 3RWDA 4Y16C 4MS8C 3U6RB 4LP5A 3D18A 3NABH 3S36X 1P53A 1RI8A 3ET9F 2EE2A 3BIKB 5DD5H 5DWUH 4KDTC 5DFWH 1FVDA 4JFFB 5L2KD 4HUMB 2GCYB 4EUPH 4J3XA 4MA3A 2G5RA 1CD9B 3THMH 5IW1B 1EV2E 4NC2B 3QUYC 3MNWA 3MA7A 1NBYA 4WW2B 3TN0C 2YMXL 4WW2F 1XCQA 2MMXA 3RL2B 4K3HA 1MF2H 1IC7H 4YEFA 4KY1H 4FQHB 4L3CB 4IDLA 3MLTB 4M4PA 4ODXB 3QDGE 4QGYA 3RL1A 2A6JB 4QXGH 1OARH 4XB8A 1N6VA 3KPQA 3TFKD 1WBXA 5H37G 2JELL 2A9NL 2DIAA 1IEBA 3HZKB 3QB7C 5MENA 4L29B 5IJKA 3C6LA 2UV3A 3RUGF 5HJ3B 5GSVA 5C0RL 1SEBB 3C09C 3QPQC 5E4IA 5DS8B 1BF2A 5HHMD 1JTPA 4NUJA 3TJHD 2IQAB 4P2OB 4NM8H 5AEAA 3TYFA 2EDLA 3K46A 5J0BA 1I3UA 1G7HA 1NGQH 2ZG3A 2DLHA 5E2VL 5CEYB 1V5JA 3JV4B 5J4MA 3F8UB 1OOAA 1FZMB 4MXVE 4XMLH 5DD3H 2FIKB 1K3IA 3GMPB 1JGDA 5F9JB 3T77A 1I1YB 1OY3B 1I7ZB 1Q0YH 3EHBC 3K1DA 3KDMB 2IPKB 4ODSH 1FGVH 3SKUD 1W0WA 2VRAA 2Z8VC 3U0TA 4NQCA 1RZIA 1UACH 4MAUH 3O11B 5BVJA 3QWOB 5DUPL 5I1LB 3D39B 3K7UA 5C6WH 1YNTA 5IEKA 2XWJA 5FKAB 3T8XB 3WS3B 4B5EA 1YPZE 2ZP0T 4ZO6A 1YEIH 3FN9A 3QUZB 1DEDA 4OT1H 4J4PD 4AEEA 2W59A 1OVZA 3OAZK 1S3KL 3KPRE 2HT2C 4O51A 4NO3A 4XWOD 1S9WB 4PUBH 4KVCL 1Q0XH 3FB6A 3NFSH 1YEHH 4GMTL 2QQKH 1K8DB 4GBXC 5T1KA 4PD4K 4CU7A 1N0LA 4Z0BH 5DHYA 5I1GH 2NTSP 4N68A 5D71H 2DQFA 4TNWK 4UNUA 3CDCA 4M6OL 1PEWA 1T0NA 2W9EL 4JCMA 1I7RB 4I2XA 1LO2L 2X4SB 1B0RB 1CIUA 4ISVA 4YDLB 1ZS8B 3BISA 1BFSA 3FMGH 3GO1L 4YGVB 4OZFH 2XKNA 2DQHL 1M7DA 1NPUA 4GSDH 4HIXL 3UYRL 1AR1C 1A3LL 1MCNA 1EXUB 5IBLC 4CAGA 3VXUA 4YHZL 3SCMD 2J88H 2F54A 3E6FB 4LIQL 4WDIA 1ZV5A 4XPTL 2W1NA 2CK0H 2DMKA 4M7JL 5J13B 1RQ5A 2EDYA 3CPLA 1IGJB 2F5BL 3G5XB 2D0GA 3FFDA 3FQXB 3M1BA 1W72H 5MEOA 5KS9A 4ZD3H 5BS0B 4Z7WA 3EO0B 3BSZH 5JTWA 2IH1A 1B4JL 4FFYL 3CMOH 5SWSB 1T1ZB 4N8VA 1P1ZA 4BK5A 4FZ8H 3D3VB 4PLKD 1DQML 5CJXA 4PPTA 5JMOC 3FB5A 4JFDE 4P4KB 3LV3A 3P4NB 1XGRB 3ULVE 5BJTA 3CLFL 3GGWB 3SO3B 1LK2B 4U1GB 5DJ6B 1V7ML 3BFOA 3AXLA 5CP3A 5TE4H 2O61A 4UILL 5DMIH 4OD1L 4OZIB 3HNSL 4OZIF 3VD4A 1AD9B 4P57B 5D70H 3V5DB 4HMEA 3TO2B 5D5MA 1KJVA 2PW1A 2R23A 1BQSA 1J8HB 3PG2A 5HPOA 4MZ2A 4L8SA 3RTQA 4PJ5B 1JZ5A 4YDIL 3O6FA 4HIEA 1Y0LB 4NN5C 3D6GA 4LSQL 3VWJA 3EO1B 4PJ9B 1WCBA 3ZE1E 2DM4A 2N4IA 1S3KH 1FIGL 3DX7A 4CRPA 3CSGA 1OGAD 3KPSA 2L0DA 5KZCD 1F8TL 2HVJB 1AKJA 3IDYB 2P8MB 2BJML 5KG9B 2AJSH 4DW2L 4HUVB 4XMPL 4WO4C 2I9TB 5I0ZA 5SWZA 4BZYA 2W9EH 4M61B 5C92A 3IXAB 1E27A 5L6YL 2IFFL 3CAFA 1MY5A 1HILB 1C16B 1HSBB 4OAWA 1UQSB 1F90L 2DQHH 3DETC 2KZWA 4B50A 1NAMB 3JTTB 5EPMA 3HE6D 5AZ2L 5GRXG 1H3GA 2Z93A 3PL6A 2C1OB 5MP6H 4JG1L 4ZFZB 2C3VB 1UVQB 1BZQK 1DQQB 5ALBH 2V2TB 3F12A 3QDGB 4F9PA 2KH2B 1IM3B 5LCVL 2X4RB 1EBPA 2OJEB 3OJDA 1I7TB 1JJUA 1UA6H 5E9DE 1HN1A 3KHQA 3PWVA 3IAQA 1EHLL 5TF1L 3LQAC 4FFYH 3SGEH 4LKCA 1MFEL 1MWAB 2FEDD 4GH7B 1DQMH 4PP2A 2R29H 1TVDA 3NFNA 1RZGA 4U1LA 1G84A 2H41A 4NO0D 2FCBA 5EBLB 5DMGD 2Z92A 4X7CC 4MXVF 3EYVA 4K2UH 4PS4H 1MJJB 1LEIA 4JG0L 4U1SB 2G9HA 3OKKA 2CO7B 1QKZL 1J1PL 3A0OA 4MHHG 4Y5YA 5EU7E 3E0GA 1UKTA 4LLUB 5ABDE 5I16A 4ODVL 3EDEA 2B1HH 1JWMA 4AH2A 1K4DB 4NQDE 1CR9L 1N7MH 4M93B 1S78D 1U8QB 5JR1H 4OLVL 3LQZA 1YPZF 1RUKH 3AS1A 1CXFA 4KJYB 4LASH 2X41A 4F15C 4YHLL 1A6VL 3HI1B 3EDDA 5I8OH 1HNFA 2FSEB 3V7AE 3TA3D 4U1IB 2AV1B 3KJ4B 4D0BA 2EYTA 4LVOB 1UZ6E 1TCRA 2VLRD 3V95A 5IBTL 4XMPH 5CIPH 4JHWL 5BW7A 3JUZA 4PY7B 3NFPB 4I18A 1X5FA 4P2RD 5GGSB 3UYPA 1ZHBA 3W5NA 4A6YA 2DJSA 1HINH 5IB2B 3WFEL 3H42L 5IJKC 4KJWD 3AC0A 5F44A 3C6LC 4HUXB 4FTVE 1KCSL 2VDRH 4TOYH 3GMRB 3N0PB 5T3XL 3I3EA 1X7QB 4QKXB 1ZT1B 2PYEA 4HWEH 1JPTH 3WD5L 2GT9A 4KXZI 2CLZB 1DE4A 3G6JB 3G6JF 5C0JA 3QUKA 1EHAA 4R6UA 3IJYB 3VFTB 4G6JH 1HOCB 1AO7D 2JCCE 4JCLA 5DEFB 1O7VA 4WV1B 2V5SA 1I85A 3BP6A 4OZHA 1GL4B 1KLUA 2NY3B 3IAPA 3TH2T 5AD0A 2HMID 3LPGA 1MSPA 3VXQB 3BD3A 1IJ9A 3MLYH 3ARFA 5FCUH 4JFDB 2JIXD 1UXWB 3C08H 4PBVC 4X4XB 4BH7B 3ULVF 4HV8A 1IBGH 3Q3GB 5J89A 2I24N 3BH8B 4G6MH 1WIOA 4K8RD 4H8WH 4PRIE 1DFBL 4K9EH 1QKZH 3K80A 1J1PH 1KTKE 3HPLB 4V1DD 2FBOJ 4AZ8A 1SJEA 2V17L 2YUZA 2FB4L 3FQWA 4X8JB 2WUBH 3F62A 4NFCA 1G7QB 1MREH 1INQB 5H37H 3W82A 3KYKL 1I8IA 1CR9H 3OJ2C 4BQCA 1YQVH 1D6VL 5J3HC 3CSBA 4L8CB 4OLVH 4G80B 3QXDA 5GS0D 4LLDB 3T0BA 2VIRA 1K9TA 2CPCA 4K07A 3ZE1F 2R56L 5EBWA 1A6VH 3BD4A 5D2LA 2Q3AA 5IQ7L 2YPLB 5JZ7D 2EYRB 2EECA 5D7LE 3HNTH 1CFSB 1LHZA 5T1DH 5C0GB 1WFUA 2DYPB 4U05A 3NA9L 5GISH 4Y4KA 4LLQA 1G9MH 3VDAA 3BMWA 3P0GB 3MLZL 4GKSA 5ANME 5DJAA 3UTSD 2JJUA 4QHMA 5F7DB 3HTLX 1A3RH 3W39B 5ITBH 4KZEL 4KGLA 3CVHL 5ERWB 4BELD 3RKPA 2VLJD 4KUZL 3QHTC 1RK0B 1I75A 4D0DB 2BZDA 2LAGB 3WFEH 4Y4HD 4GUPB 4Q2ZA 3ZT5A 1PW3A 1DVFD 1T1YA 3OG4B 3PJSA 1OLLA 3AS3A 1KYOJ 1LD9A 5ICZB 5TE7H 4YNYA 5CJXC 1XZ0A 4PV8A 5I9QB 1U3HC 4GO6B 1T22A 3HE7D 4QXTA 4YUEL 4LQFL 2FR4B 5JIKA 5IQ9B 4PRHD 4TPRH 3RP1A 5F7UA 2IAMA 5E9DB 1N0XH 4ODBD 5DMYA 1GHFL 4Q6IB 5T5NF 4OIIH 3CXHK 4DKFL 5T5NG 1PKQE 4HCRA 5GIRA 2AS5M 5ADOL 3IDUA 1S9VB 5CILH 5ADPH 4KROC 1AP2B 2PXYB 4MQTB 1T6VN 5IEHA 1J0ZA 5KVFL 1U8OA 3AY4A 4UOJA 2R2EB 5D8JL 3ZE0E 2VZTA 1U9KA 4H88H 3QEHB 3GSOA 2I25N 2R0WL 4L8SC 3RTQC 3O6FC 4MNQE 4F2MB 4NNPL 1F45A 1E4XI 4HK0A 2DKUA 4CU6A 3QIUD 3VH8A 3ME0A 1H3PL 2V5YA 4P9MH 2VL5A 3K2MC 3G6AA 4PJFE 4NQDB 1YMME 5GJTH 3PWUB 2ORBL 3ZTNH 4DFHA 4L4TA 5HYSA 5MHSD 4PRDA 5D1ZC 4W81A 1P6FA 3D25A 5FYKD 5C8JB 3OL2A 3BKYL 3ZKXC 4PJBA 3UBXG 2C7UB 1WBYA 2J5LB 4KKBD 3DX9B 3P4MB 3E8UL 1FNLA 1NGZA 2NY2D 2VLKE 2ZKHH 5EO9A 3V0WH 4LCYB 3LEYL 1XIWA 1J0KA 4X6CE 3SGKC 1INDL 1KTLB 3PL6C 1UZ6F 3NA9H 2F74B 3ARBB 3FB7B 3QDJD 5IKCA 2XY2A 1TPXC 4X6DA 1EEZA 1DZBA 2A6KB 4F9PC 4RBPK 5CZKA 3MV9E 3M8OH 4HKZB 4OLWH 3QJFA 1F6AA 1VADA 3KS0H 4PG9A 1EBAA 1KENH 3MRDA 2NNAB 4JO2L 3LD8C 3TESA 4PRPE 3QO1B 2VZVA 5EU6E 1CDYA 3HKFA 5CS7A 3DUHA 3ELAT 3QQ9C 3RWEB 4KK9C 3QCUH 4NRXB 4B7LA 4Q0XH 5B39B 1UJ3A 5E8OA 3FQTB 1E6OL 4L8DB 5I19H 1U2CA 2GTZA 3KPNB 5HD8C 3IS1X 5F1IB 5HHPA 3OMZA 5C7XL 4HLJA 4X6BA 2JCCB 2B2XH 2JCCF 3TO4A 4LPTA 3FB8B 4M6NH 5CGMA 2Y7QA 4JY4B 2PR4L 1IC4H 4Y5YC 3LMJL 1JPFA 4HF5L 5C07E 4Z6AT 4ZXBD 4D9RE 5HDBE 5HGHB 2DWDA 5KVEL 1BVLA 3EGSB 1BFOB 3NPZB 3MOBL 3LPWA 3SPVB 1HDMA 4RGNC 5DUMH 4JFYB 5AAWA 1TMCB 1HHIB 5IV2B 4LARL 4G8FA 3E2HC 2CUIA 5FA4B 2M2DA 4PRIB 4CVZA 4N0FB 4NKMB 3DYOA 3LH2L 1NKRA 3CCHA 4HFUL 1UC6A 1H3PH 2CH8A 2OYPA 1A1NA 4G3YL 4M5ZH 2ZUSA 3WIIH 4LLWB 5HVWA 3SE9H 3IDGB 2LABA 4OCWL 1SYVB 5DJXA 4LHUA 4ODHL 2PYFA 2QADC 2Q8AL 4NC1E 5C1MB 1TQBC 3DVNA 4U6XA 3RVXD 3LN9A 2OK0L 2P7TA 3QDAA 1G6RA 5BW7C 5FYLH 4JFPA 3KYNA 1MLCA 4I18C 2WANA 1E4XL 3ZL4H 5BRZD 5LVEA 6CGTA 5D7LB 4LIQE 1YMHB 1F42A 1XCTB 4GKOA 2X9YA 2ARJA 4FQXB 4BM7A 2O5XL 1BLNA 2O5ZH 2MHAA 1WJ3A 1BX2B 1KB9J 1INDH 3WSQL 2H6PA 5FCSH 4Z77A 5DK2B 4N9GA 5ANMB 3WXVH 5GRYA 4MXWL 4NRZA 4ZFOL 1KB5H 1KN2L 1RZ7H 4Z7NF 5BOZG 1JTOA 4E5XB 4JO3H 4JFED 1X5AA 1S7XA 4QF1B 2Q7YB 3V0AC 4CMMA 1CE6B 3C60D 2AEPL 3JXAA 2BNRD 4JM2D 3CFCL 1OSZB 2WWMC 1I85C 4MX7A 2NTFA 1T5XA 4JO4L 3BGMA 4HXBH 1U92A 3AB0C 2H1PL 3ARFC 2VITB 4LKXB 3RDTB 5T33H 1CCZA 3O3BB 4P2QA 1ED3B 5JORB 2XNAB 4FFWC 1QRNE 3RPIB 5F93C 1MHPL 4LLVA 1KELL 3BKML 1GIGH 3N1FC 1OAYH 1DUYB 5D1QA 5LG1A 3OSKA 2XA8L 4NHCH 1KT2A 1L4IA 4PJIE 3WLWC 1PKQB 1JPSH 5CZXC 3PP4L 2HLAB 5D2NE 1U8LB 5EFIB 4WI3A 4I4WA 1U8PA 3MO1A 2BNQD 3P30H 1AJ7H 4S11A 3DROB 3ZE0F 1I1FA 4LSVH 1JUFB 4OCXL 1AY1L 2LE9A 4X99A 1E4WL 4ZPVA 5C0FA 3MOBH 3O9WD 4FQJH 4MNQB 3NPSB 4QOKD 3ARZA 5EORL 5J6HB 5BZDB 2R9HC 4KJPC 4ORGB 5JDJA 5GGTL 4TTDC 3JTSB 4XVSL 5DC9B 4G3YH 1CD1B 4PJFB 4X80L 4PJFF 3BZ4B 1YMMB 3RY6A 4Y4KC 4Z7UA 2J6EH 1W0VA 4WUUA 4IS6B 3RWIA 2CDGB 4M5YL 2Q8AH 4BSWB 2XA3A 2XIDA 3SE4A 4WI9A 5I1CH 3SDXE 2W0FB 4WFGD 2DWEA 3O6KL 1F4YL 1JZ4A 1WUNT 1U8KB 1EZVX 2VLLB 3GBNH 3IS0X 3EYFA 4WHYH 1XGTB 5DTFB 1F2QA 1H5BA 1S9YA 2BMKB 2BSTB 5JXEA 2VAAA 4OLEA 5TQ2L 4G6AD 2ADFH 4X6CF 2BNUB 4R3SB 1YEDB 2NXYB 2O5XH 3GKZA 1IGFL 4GS7C 3WSQH 2VDQH 1G6VK 1WZLA 5EIIA 4LLYB 4Z7VA 3BO8A 4EDXB 3QO0A 2QHRH 1BFTA 4PG2A 1MFCL 3MV9B 5GRUH 2J8UE 2UVEA 3EOTH 3CDYA 1J0JA 4R4BB 3DX6B 1QVOB 3O81A 2IAMC 2AK4A 3HAEG 3EZJB 5D93B 4PRPB 2ZCKL 3V5HA 5JPMB 3LQAH 4WUKL 3JWDL 4HFWB 3BZEA 1BMGA 1OCWH 5EU6B 3AU1A 2Q1EA 4E41A 4JO4H 4MXQC 3L9RB 4MWFA 1CU4L 3MRKA 3O4LE 4YDJA 1ZT4B 3TBTA 5IR1A 1A7BA 3AY4C 4PJDB 3I9GH 1G7JA 1S7UB 4M7KL 4TUKL 1FSKB 3H9HA 4L4VD 3UTZB 1LO5B 3VDCA 2ESVE 3NCBB 4P3DB 1NGXB 1Q9OA 3V4UL 1OAKH 3KPPB 1DSFL 4NZTH 4FG6C 1NFIB 1IQDA 4M7LH 1LEKA 1F11B 2AGJL 3PP4H 4G6FD 2R1XB 3FZUD 1X4ZA 3G9AB 2VLME 4C56E 5C07B 1JFQH 3TPUA 5HDBF 3PNWB 1UWEL 1M7IA 3CFKA 1M6OB 1FNSL 2G75A 3INUH 4WJ5B 3D0VB 4GMSH 5F3BB 2QBWA 4M3JA 1FCGA 4DN3L 3U4AA 1KLFA 3SOBL 4Y8AA 1CDIA 1EJOH 4K3EL 4QT5A 5DD6A 3C5SA 4W68A 2EDNA 1RJZA 2FX8H 4WEBL 1CTNA 1E0OB 3O3EB 3SKMB 1NC4B 4U1NB 1UXSA 1D7FA 2VR9A 1YYLL 3MRQB 1T2XA 3H3PL 3UTQA 4PP1D 3CXDL 4XPAH 1PFCA 4K23L 1BJ8A 5C0DB 3MZGB 4P46A 4TVPL 3T0XA 4Z18A 3TVMA 3Q5TA 5T3XE 2IQ9L 2YSSB 3QXAB 1R3IL 2F53D 3D0LB 1OAZH 3QDME 2HTKC 3AAZA 4NWUL 5C86A 1FFNB 1WWCA 1IGFH 4AM0A 2ICEA 1Y18B 2DKSA 4FQ1L 2EIZB 4JRYA 2X5PA 1BQHA 1UJ3C 4P23A 4U6YB 1MFCH 2V2XA 2Q87A 3B9DA 1H8OA 1IAOB 1P5VA 4K3GA 1HXYB 3EKCA 1EHXA 3OJVC 4ONHB 3QCTL 2Q7NA 1NUGA 5C0IB 5MI0B 1P4IH 3TO4C 3BWAB 1F2XK 4I9WE 4KK8D 1I9EA 1G7PA 3BPLB 3DUSA 5FK9B 2NX5A 1WBZB 4TNVF 3FO1B 3P11H 1EUUA 5HY9A 1ES0A 5E7BA 4YAQB 2ZUQB 1ZLUH 1I1AA 3L1OL 4WTWA 4WNQA 5C0AA 3BGFC 4DZ8A 3QI9D 3O8XB 2D7QA 4QTHB 1YUHB 4PJIB 4PJIF 5GGRY 1QEWB 3S4SB 3T0EA 4U3CA 1K6QL 5GZOC 3OKLA 2A6DA 5D2NB 4YEEA 5I1AB 4FXKA 5AG8A 3UMTA 1I1RA 1HHHB 3F6IA 2UYLB 2EC9U 3V8CA 5E8EA 2GUOA 1C5CL 2CRIA 5EC1B 1LDSA 5C6PB 5B3NA 5C09A 2NY4C 2NY6B 5I71B 3QUMA 1P7QB 1KJMB 1WZMA 4POZC 2PUQT 3UTTE 1J9CT 4D9QE 5T1MA 2DBLL 4DUVA 1T21B 3LAFA 4GJTB 4LRNL 1OM3H 1QA9B 1NBVH 3PWPA 4MA7H 1RAMA 2BVEA 3WHXA 4DWHA 2FX9H 5DFVD 5T5FL 2GJ6D 2Q76A 4JHZA 3RZCD 4LVHC 1KXVC 3SDXF 4DEPB 1V7NH 5E94B 3AUVA 2E8YA 5GJSH 5JOPD 1F6FB 4HPYH 4NKDB 2FJFB 3RVTC 4HXAL 4LOUD 4K23H 4QCIB 4EDWH 5CJ8A 3EO9H 2IQ9H 3MRJB 5C0BD 4MD5A 1ITBB 3FN0L 4G8EA 4JFHD 3SDAD 1BZ9A 5GRZA 3A67L 5GGUA 3CFDA 2MPAH 3LKQA 4FQ1H 3QNXA 1KJ2L 5JUEL 5F9AC 4PJEA 2J8UB 2J8UF 1AFVH 3PF2A 4YXKH 3GHBL 4YPGB 5BCAA 2AQ2A 4HJGA 5D1QC 3IB4A 1HQRA 2P24B 5GS3A 3MR9A 1T5WB 4PY8I 2QSVA 3MCKA 2CR3A 4P3WA 1FNFA 3VXOB 4ODTH 3MRHB 2AABL 1ACYL 3MODL 4PR5B 3O4LB 1FGNH 3ARDB 3SDDB 3ALWA 1L0QA 1WEJL 1HXMB 3GSQA 4ZAKA 5EBGA 3GSRB 4RAHA 3DV4A 3PHQA 5IT2L 4M1GH 5JIHA 1MCCA 1UM5H 4NN6C 2OTUB 1SBSL 3ULUL 3KJ6L 1X6LA 2ESVB 3MREB 4JAMB 4XNQA 2OI9C 1CICA 1DQJB 1QFUL 1WQVT 1J0IA 4JN1L 3M45A 1T04A 1QR1B 3W11D 4FNLL 2CXKA 1JI2A 4F37K 3S8WA 3ZKMD 5CSGA 3GSXA 5BXFB 3QUXB 3NIDE 2RFXA 2Q8BL 4PJAA 5IG7B 1HIML 2YPVL 1HQ4A 3Q6GH 1GOHA 5ELIA 5C6TL 5JO5A 2JK5A 3MJ7B 5AYUH 3RY6C 4MD0A 1CD0A 3WKNA 2HLFC 3IYLW 2DF3A 4OZ4B 3SE4C 3Q2CA 1FVEB 1CFTA 1MI5A 3I50H 5T1LD 1CWVA 1QNZH 4Y4FA 5DQJB 4A6YL 2IADA 1F4AA 1HHJB 3IFOB 1VACA 1H5BC 5JXEC 1FYTB 1VFBA 1REIA 1FZJB 3IDIB 5C3TA 2W9DH 3H6JA 3EDFA 5K9KA 1U8MA 5T3ZH 2W0LA 2AW2A 3QR2A 3WXWL 3RWHB 3UCRA 4OFVA 4JFFD 3FOLA 1ZMYA 4PG2C 4NM4H 1F4XH 1T0MB 3BXNA 3LPFA 1AIFB 5FGCE 4LHUG 5DDHA 3OF6A 4NO5B 2GHWB 3GKWL 5DO2C 2ZZUT 2XACC 4HKJB 3QQ3B 5JNYA 1ZLSH 2JKXA 3QHZH 3QDMB 4R2GB 3GIZL 3RIFK 3FN0H 5FHAL 1P2CB 2Z4QA 5EBMA 3RWFB 2IPUG 4X7FC 2UY7A 4QHKJ 3VWKD 2W07A 4MQ7A 4JRXB 5B3JE 5DRZA 1U8HB 3MMEA 3LKNB 1N2RB 4F57L 1T6WA 3X11B 1ZLWK 3MLWL 2EXYC 3V52H 4G8IA 4KPHL 5SV3A 5TH2B 1JTTA 3STZB 1ZEAH 4GQ9L 2DQIL 4P2OD 4IRSA 3OGCA 4Y5XA 4YFLI 3OHXA 1DBJH 3OJMB 4DGIH 1N3NA 1NDGB 1QQDA 1G7MB 3CJJA 3TV3L 5SWQB 2WAHA 4OKVB 3EOAA 5JDSA 4G9FE 3DBXB 1QFUH 5ACLA 3BAEH 4XP4L 2VDMH 2SEBB 3OXRA 4WHDA 4IRJB 4KDVA 3AFLA 4R26H 4Y16B 4YHIA 5HHNA 4LSUL 3D39D 4Y7MA 3U1SL 3IKCA 2YS4A 3JV0A 5EU5B 1TVBA 4OGYL 5FKPB 4DKDC 4RFEA 2YPVH 4R0LA 2LVEA 5C6TH 3QUZD 2XWBA 5EO0B 4Z95H 5IFAH 4QWWC 3DV6A 5HYQB 4ONFL 5HGAA 2NY1C 1AGEB 3LRGA 3UTTB 2R2BB 4JKMA 4KZDH 2BVOA 3ZLQC 4A6YH 3NIGE 4X0KB 1XF1A 3S34L 2E9JA 3HN3A 4P46C 5GGSY 5ID1A 3TVMC 3ROOA 1B6DA 2Q20A 4EOWH 3O41B 2YC1A 5ESVA 3BEWA 4OM0H 1CGTA 2IANE 4MNGA 1D9KB 3ES6B 2DQTL 4RQQA 5DT1H 3CVHB 5EOTA 2UUDH 1E4KA 1MCPH 4P23C 4QRQA 1HE7A 4HK3N 2O5YL 1A6WL 1JV5B 4LHQB 1KIRB 4QYOB 4R97B 3C09B 1PSKL 2ICES 1XAUA 5E1AA 4JPIB 1E4JA 4HCRL 3D85A 5HGBB 3GNMH 2A74A 4I3SH 4EI6A 2KZ1B 4M8VA 4CVXA 1TXKA 3P40A 3WL9B 1PVHA 4WFFD 4JKKA 1K85A 3GB7B 1ADQA 4X9HA 3RVUC 2P5WB 5FHAH 5ISZE 5CEZD 5F7FA 1KEGL 1WFOA 5BS0D 3WFHA 5JHDE 4Q74A 1I1AC 3CFEA 2AJ3A 3BWUC 3IJSA 5C9JA 5SWSD 4MJ5B 5D9SA 1I8LA 3LKSB 5HI4D 1NC2D 4JDVA 4KKAD 3MGTB 5F1KC 4DAGL 3D3VD 3EYSH 3W2DL 1A5FH 5JW5B 1VEMA 4PJGA 3T0EC 4KPHH 3QJHA 1MHEA 5GHWL 1U3ZA 4N0CC 2NMSA 1FV1A 5C70A 4P4KD 2LV4A 4AENB 3I6LD 2Q3ZA 4ZOEA 4LCUA 2IJ0C 1OGAA 3CVIL 2KPNA 4FFVC 5B38A 4ZTOL 3HC0B 4TUOB 2BSRA 1EFQA 5D4QA 5INDA 2H32A 3B2VL 1GRWA 4LSSL 1LO3L 4HWZA 3VFMB 3GJFA 5F96L 2PTVA 4LPWA 2JTDA 4XGZB 4OLYH 4U7MA 43CAA 1PGRB 2C1PB 2XPGA 1YNLL 3NIDF 4LSUH 1J8HD 1A4JB 1U42A 3MRIB 3U1SH 2NW2A 3S3SA 2WP3O 4PJ5D 4XCCL 2E8ZA 4RAVA 2AJZA 5HYJA 5FYKL 4TSAL 4PJ9D 1DTUA 2CMRL 1L6XA 3DSNA 1CXKA 3O2WH 4ODUA 1XGYL 2OR9L 2VXUH 1ZVSB 4Q9CA 5MEQA 2CJUH 3IETB 4UUJA 4KTDL 2EC9T 3N85H 4MJIA 4O9HL 2QL1A 5LXGL 3ZHLA 1XH3B 4NQTA 1YEGL 1JNHB 2XQYK 3C8KA 3Q48A 1FRGH 5HDLA 3ARXA 1CT8B 5DQDH 2B8OT 3WYRA 2QV2A 4OLZL 5DXWA 4X6FA 4C54A 1PDKA 2O5YH 4KRPC 5IIEA 1NGWB 1Z9SA 1KC5L 3WFCL 1PSKH 4RMVA 3HPJA 3VRJA 2EDXA 1MCEA 2CSPA 3FT4A 4RX4A 3MUJA 3NAAH 3R4DA 5M95B 3D1MC 2BSSA 3GRWA 4F7MB 1FO0A 3MGOA 1K3ZA 3OXSB 3QDGD 4UTBL 4N5ED 4PGJA 5TDOB 1RIVL 5ESAB 2Z31B 4K7PY 4ZAKC 2Y06L 5INCA 4LCCB 4XP5L 1IGIH 4JQIH 4NNYA 5B3JF