2EDBA

Solution structure of the fourth fibronectin type iii domain of human netrin receptor dcc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
GSSGSSGPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the fourth fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Netrin receptor DCC
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edbA01
4K2UH 1ODAA 4CDHA 1TFHA 3VGHA 1NJ9B 1CLYL 3SKOB 4P5TC 5EZOH 5IMMA 3EDEA 3VFMA 2HH0L 2EO1A 1J0ZA 1J0JA 1W0WB 1OLZA 4LNRA 1AQKH 2NZ9C 4QXTA 3QDJD 3SE8L 1WBZB 3U9UA 2JLLA 3HFML 4PJHA 2CUIA 4Y19E 2XN9B 5EO9A 1GH7A 3T0VA 1J5OH 3SQBA 1C5CL 1SY6A 4JQXC 4WV1A 1NFIB 2W60B 1JYWA 1K5NB 1X4ZA 1RHHA 1SM3H 4OGXL 3OKEA 2YEZB 3S3PA 2R8SL 3OG6B 5CEZE 2VDLL 3MGTA 3QDJA 3QUZA 4P2OB 2DWEA 1LK2A 4L8BA 1JN6B 3UO1H 5GGSY 2E3VA 4J3XA 3QQ9C 5CEXB 1AJ7L 5AZ2H 1RZ8B 4BZ1L 5C09D 4G9FB 3SKNA 4N0UA 3WFCH 1RV6X 1ZANL 3VWJD 3D9AL 3C60B 2ZOLA 3TBYB 2E7HA 3F8UB 2P46B 1QSFA 4R8WH 3L3HA 1IM9D 5CMAB 3SDXA 3U7AA 1FV1B 2HVJA 2R56L 4N90D 4S2SB 2DQFB 5JMRA 5L2KE 3QULA 1F11A 1TVHB 4QXUL 2Z31A 1CZ8L 5JXAH 1FDLH 5CCKH 1UH2A 1JP5A 5CINH 1HHGA 5I18H 4BFEA 1ZSDB 2V9TA 2VITA 2P8PB 2BFVH 1UCTA 1J1PH 2BY2A 3D48R 5CUSH 1EFXA 1RZ8A 4XVSH 4OZIB 4JM2A 2VXVL 3RY6C 4R8WL 3WE6B 5CJOH 5INCB 1MOEA 2VDPL 3ME0A 5J6HB 4UTBL 4HFWA 3DETC 1KULA 5J1AA 2VLKE 1YJDL 3DYOA 4UTAL 4DW2H 4ELKA 4YHLL 3KYOB 2SEBA 1AC6A 4Y19A 5BVJA 2UZIH 4QTHA 1JNLL 4R7NB 1AD9A 1N4XL 4XP1L 5F1NA 5T3ZE 3T0EA 3GI8L 4NT6B 3WKMH 4KDTA 4P57A 1ORQB 4NYLA 5DEFB 4X98B 1K6QL 1CLOL 3MCLH 5JIIA 4XPAL 1KT2B 2FJHB 4ODTH 3GSQA 1SJHA 3DIFA 2NY2C 2FJFA 4WUUA 2LABA 1YEIH 4OT1L 1D5BA 1KELL 1JGDA 4U1JA 4HUUB 3NIDE 1SMOA 1A6WH 5MENE 3TO4C 3VRLF 4GRMA 1QFWI 4H8WL 4NKQB 2IH1A 5CWSA 4AY0A 3R4DA 1KIQB 2NZIA 4OSUH 1O0VA 3NPSC 4O2FA 4M7ZB 2O5XH 3EOBB 4XPFH 3QG6A 2WUCL 1MUJB 5FECA 2D0GA 2HT3C 1S7UA 4TULH 4CW1B 3NVQA 3RZCD 2WIMA 1G9MC 2ED8A 3MRPB 1EEYB 5I8EB 2DYPD 5GPRA 4Q6IC 1JK8B 4TSAH 4ZQKB 2BOCB 2PW2A 3ZYOA 4MJIA 4WI4A 3JUYA 4PP2B 4XHJC 4CDGC 5DO2D 3G5YB 3MLZH 1ADQL 2D4DA 3NTCL 3TH4T 1HQ4A 4QNPE 2CRYA 1S7SB 3RVUD 3T0DA 3TH2T 3S35H 1CZ8H 4HIHA 2HWZL 4HUUA 3KVQA 3EIFA 3JSSA 4TNVF 5SWSE 5HVGB 2CK0H 1ZV5A 4OKVB 4XP4L 1J05B 4R3SB 1LE5A 1Q9KA 5GGVY 1T5XB 2EDBA 5M7QA 2JF1A 3DROB 3ULVF 4LEOB 4QKXB 1C7SA 2ZCLL 5ADOH 2RQ8A 1B9ZA 4IOSD 3RVXC 3C8DA 5FB8A 4MJ5B 3S36X 1ZE3C 1R3LB 2VSCA 4AT6A 4EDXB 4PGJA 1WCQA 2CRIA 3GK8H 4HXBH 4BFBD 3P9WB 2QJDA 1YEEH 4D9LH 3KYOA 4Y2OA 1MHCB 3GI8H 5D7IA 3WKML 1C16B 4YHOL 1NC4B 4JRXB 3SDAD 3FO1B 5FGBA 4MJ5A 3OJMB 4PGZA 4PRNB 5F9WC 1CGUA 3WFDL 3MOBL 5IMKA 1I1YB 4BUHA 3OKLA 4R7DA 3QUKA 3QDME 3MLYH 1MAJA 4F2MB 1QSZA 3NA9L 5F3HB 4WI8A 1ZSDA 4NRYB 5GZNC 4AQOA 1EAPA 2C4FT 4KKLD 1E4JA 1A6UL 1T7XA 1S9VA 1MHHA 4RMRA 5C07A 3P0VL 3VD9A 1DVFD 5AWNH 1NUNB 4GW1B 5C0AD 3V5KA 4JLRA 3BZFB 1ZOXA 4PJFB 5DJDA 5CZVL 3QI9D 2ZPKL 4UU9A 3I3DA 4MSWA 1UB6B 3N9GL 3ZE2F 4POZC 4AK1A 3I85A 2VE6A 4YE4L 1IM9B 5T3ZD 3OSKA 2GJZB 1QA9A 1NKRA 4Z7WE 4ODSH 3E3QE 3N85L 4PJ5E 1MCRA 4GMSH 4QHLA 4Z0XB 1FYTE 5K9JH 1LO0L 1KPVA 1CDGA 3OJVC 4LQFH 3WFZA 2YR3A 5JR1L 1MJ7H 3QJFA 2EYRB 2VLKD 1MQKL 4F37F 1QO3A 5I8OH 4GAGH 3CSGA 1F3RB 1RJZB 1DL7H 4LSPL 3GMNA 1JGDB 1D5BB 1E6JH 4X5XB 1K85A 5CGYC 5J3HC 1NC2B 1WICA 2ZUVA 4XNYL 4A2LA 4HK0B 1XCQB 4M3JA 4OFPA 3SJVD 1EUUA 5JA9A 1LK3L 5IVNA 3L7EB 1BQHA 2VB5A 2JB6A 4ZTPL 2DLGA 1G0YR 3ZZ1A 5K59E 5C0GA 3MYJB 1YN7A 4LRIC 1LEKB 5C08D 4G7VL 3RL1A 5JW4Q 1MJ8H 3HE6B 3O8XD 1A14L 3NBNA 4M7KL 4OQ1A 1OQXA 5J1AB 35C8L 1BQHB 1P4BL 4R0LC 5TQ2H 1OTTD 2PW1B 3QPXH 1PG7X 5TE4H 1GAFL 3QDHA 3DROA 1D6EA 1OTUC 3QCUH 4TVPH 3F7PC 3U36B 1JYNA 1OTSC 4XCCH 4IBLT 5CCKL 5MP6H 4H25A 1OW0C 3I50L 15C8H 2N7AA 2PTTA 3RNQA 4KJQC 4XXDB 4R90L 4J12A 2Y23A 4KGJA 4POYA 3NIFF 5CZVH 5D4QA 3SKNB 4LSSL 3QO1A 5CP3H 1DDHB 3MOAL 1SJVA 4DWHA 1RZKH 1MCJA 1OP3H 3EO9H 5DHVB 3REWA 1FL5A 2Z35B 4Y4HA 1IE5A 5IJVA 1Q9WA 1YECH 4EDWH 3O4LD 3HI5H 4R6UA 5EA0L 2EYSB 3GSNB 1AHWA 1UB6A 2D7PA 3IJSA 2YEZA 4PBXA 3AU1B 3QG6B 1T2QL 3EHBD 2YHGA 4KMLB 3VFUB 3L1OH 5IFJA 2EE6A 4L8BB 2NY2B 4PGDA 2X41A 5E24E 4XHQA 5I8EA 1YYLL 4X4XA 2AK4E 3LQAH 2XZQH 5F1IA 4HC1L 5TDNA 5E9DA 1CXLA 3GMLB 4ZO8A 5DFVD 3SKJL 2AK1L 3MA9L 3QNYA 4KKNA 4JEGB 3WNLA 4MA8H 4MNGE 3S9DB 3MLVL 2AXJA 2BSED 5FGRA 5D6DC 5FYLD 5HDLA 1AD9B 4I5BB 3DRQB 1LE5B 4UMGA 3CD4A 1U8KB 3Q2CA 2QSCH 1WWWX 4XP4H 3UPRA 4HWEL 3BPOB 2AK4D 2I25N 4PB9H 4Z7VB 3FOLB 1ZLSL 1JNNH 3BIBX 2ZUTA 1MIMH 3JBG7 2ZCHL 2AJXL 5HGAB 1AGFA 3QHZH 4Q6IA 3M17A 1CL7L 3KYKH 3P9LA 1DFBL 2MNUA 2I5YL 4EUPH 2R2BB 4GKOA 4OFYD 4X6CF 5KG9B 1D9KD 4DN3H 5KS9F 4KAQL 1RJLA 2VL5B 2WUBH 5CEZH 3NIGE 2IALA 4CMMA 4KI5F 3TV3H 3D0LB 1R24B 1A7BA 2F53E 1CE1L 3G6DL 4PJGA 4QTIL 5ETUA 3D25B 4P5MB 4HBCL 1IC5H 3HAEH 2DQTL 3L6FB 1P53A 3WHE1 3Q6GL 2DQIL 4WO4C 4PRPE 5DJ6A 3TFKD 3VXPB 2H2PD 2OX5A 1EX0A 5TDNB 4D9QD 4Y4KC 4Q7DA 3QR2A 4EIGB 3VFVB 2X1QA 4XAKD 1A4JB 5EB9A 1KJMB 3BHBB 4P57B 1L9NA 2FDBP 2PW1A 1JGVL 1PAMA 4RFOL 2R2CA 3MV7D 1MFCL 4U2YA 1NBQA 3MACL 3WL9A 2ARJA 1IAKA 1YQ2A 5IBUB 5GS0H 1BBJA 4WV1B 1NMCC 1T03L 3RWJB 3DECA 1AQDA 3K80A 4LARL 3HMXL 3SJVE 5FHBH 3QIWC 3OKDB 5D7SH 2P5EE 3TNNA 3HCVB 4RAVA 2OYPA 3U48A 2IQ9L 5IT2L 4HUKB 2Q7YA 3OF6D 3NAAH 4WTZG 4CNIB 3QH3A 4X5XA 5DD1H 4LMQI 1OAZH 4EVNB 4NKOA 1OL0A 4X4ZA 5HHMB 4NUGL 4S10A 1U3HA 1YDPB 2GIYA 4U3CA 2I5YH 2IAMC 2JJSA 4JFZL 4UDUB 1T0PB 3N85H 1RULL 5C8JB 5KVFH 4XC3H 4P46B 5C07D 4YJZL 5IFAH 5MEQA 4MNQE 2YC1B 4HKJA 2VL5A 3QO0B 3ZHLA 4ZO7A 1FO0H 4PJ9C 1FH5L 1NGZB 3HUJE 3CX5K 4A6YB 5C0JB 1RIUH 3O0RH 2E27H 3SGDI 3U4BL 3MZGB 3FAXA 1ZT4B 3SPVA 2VAAA 2F53B 1BVLB 1G9ML 1K8IA 2N4IA 1M4KA 5I2IA 1MY7A 2NY3D 3SE3A 4G6AC 4NJAH 4HUXB 4RAHA 4G42A 4F7TB 3E6HA 2X70B 1AE6H 3T77B 3HTLX 1RAMA 3LSOB 3DARA 2NXZB 3JV4B 2X4SA 1EH9A 2PXYD 3AC0A 3S5LA 1JF6A 1VFOA 4MS8C 3QUXC 4JFHD 1PLGH 3AREC 3WLWD 2HLFC 3MJ8A 3P77A 5CEYA 3G08B 4MQXD 1AGFB 4PJXF 3BUYA 4BH8A 1RZFH 1XF2A 4LNVA 1S7WB 4HG4J 3NFSL 1VGEH 4D9LL 3JWDL 1U8KA 4OFKA 5HI4C 3IF1B 1YNKH 3EFDH 1W72L 4MNGB 3PP4H 4P9HL 1T04A 4HUVB 3L3DB 2VOTA 1MIEH 1NCDL 4PLKC 3KPRB 4C4KT 4X8XA 5TF0A 3KLAB 1RZKL 5IUSA 1ZHNB 3L5WA 4ONFH 4QXTB 3QXVA 1R5IA 1UG9A 4J4PD 1JNHA 2VDML 5FFLA 1BEYL 3EZ8A 9CGTA 3FONA 1AFVH 5HDQL 4HKXA 1RZFL 1IKNC 3M07A 4KRPD 3ARVA 4U6VL 3VFRA 3E3QC 4MNQA 2EDLA 3QUKB 5DR5L 3SKMA 5HHXL 2O5YH 1CGVA 2A73A 4LMQE 5T3XL 5F6IC 3KJ6H 4Y1AD 3OKOA 4LHUA 3G9AB 2C5DC 2A9MH 4M5ZH 3WN5C 1A6UH 4GKSB 5E8DL 3RX7A 3OKNA 4XBGA 2YPVH 5IKCB 1WZKA 1HHJB 4M8QB 5F7DA 3CCHB 2DRUA 3TZVB 1U2CA 2AI0H 1MUJA 1MIML 3QUMA 5FECB 5AAWA 4IRSA 4QWWC 2HFTA 1OARL 5CSGA 4ISVB 4ODHL 1E4XI 3QUXA 5KS9E 4G7YH 3ARYA 3MYJA 4RMWA 1N64H 2IG2L 4KZEH 1X4XA 1ZT7A 5HBBA 4X5WB 1UWEL 4UZGA 1L0QA 4Q0XL 1I9JL 1A7PH 3INUH 3MXWL 4NCDA 2QL1A 5EOQH 5J12C 3VFSB 3EFDL 5GRWA 1OAYL 3V4PH 3ULVH 2WANA 2AXGB 4NQVB 1JVKA 1YY9D 2CUHA 4O2CB 1I85A 3DX6B 1DANU 1WWAX 1UZ6F 4R4BB 4CN1A 3MV9E 4JO1L 5F1KC 3RWHB 1DN0A 2DQUH 4H20H 1KN2H 3MRCA 3BYTA 1INEL 1NLDL 1XCQA 4X83A 2XKUA 5D5MF 1N3NB 5I8CA 5HYQB 2H2PC 5T1KA 1IM9A 1LDPL 1X5LA 1OAQH 4IOIA 3LHPL 2DIJA 2OJZL 3CFIC 1BX2A 2CDEA 3DO7A 1H3TA 3VGGA 4G5ZL 5BXFB 2NY7H 4D94A 3T0ED 4P3CL 4NWUL 5CJBA 3MTRA 5HYFA 3P4LA 5D1QD 5KSUA 1S7QA 3PWPD 4NCC2 15C8L 1GGTA 2VYRE 4PUBL 1F2XK 5BXFA 2PNDA 2LVEA 5GGRB 3VH8G 1NMCB 4EUPA 2XWJB 3BX7C 1DBJH 5FV1L 4AH2B 4PJFA 5IV2A 1HI6B 2IMNA 3VXTB 1WISA 4UINL 4G6FD 3VXQA 4OTXH 4YFLF 4R2GC 2A77L 5E6IC 3MRHA 2GITB 1FFPA 2VXUH 4GG6A 2RCSH 4GKNB 5GSRA 3K7UA 2DJSA 1GGBL 1T1WA 4OZIA 1ITBB 1WFOA 4ONGL 4KK9D 5HGBA 5F88B 1F00I 5EZJA 4OCYH 4NO5A 2DLTA 1L0YA 1U58A 4UV7H 5JIKA 2GAZA 3T1WA 4JO3L 1XIWD 3P4MB 4WHYH 3WS6A 2FHCA 5DS8B 4F7TA 5ICYB 2EH8H 4RGND 2A1WH 4BKLA 2YUWA 4NQCB 3U7YL 1GRWA 1T5XA 1PKQB 1UA6H 2AEWA 2Y72A 4XBEL 5D71H 4XI5C 4LQFL 4DFIA 4FRWA 3I6KA 3A6CL 2C3VA 1UENA 2IPKA 1R3LA 4JFFD 5HYJB 1Y18A 5DJ8A 4NN7C 3RDTB 4JDTH 3GFUA 3RIFK 4XCEA 3FFDB 3RZCA 2YBRA 4H26B 5CEXA 3E8UH 5F96H 4P5TB 1A4KA 1MFAH 1XF3B 1OOAA 4G9FD 2AXFA 2OBGA 1QD0A 3H9SD 4X9GA 1U3HB 1YDPA 4MS8D 2R1WB 1NCAL 1PG7H 3MROA 1X3DA 2MFNA 2B0SH 5MI0B 2OP4L 3L1OL 4YBHA 5JNYB 3SOBL 4ZUWA 1JV5A 2ICWA 4O4YH 3JVGA 2GFBA 1X4YA 1S9VB 2X5PA 5T5NF 4OLXL 5B38B 3L3IB 5A1AA 2V2XB 1GAFH 5E99H 3FQUA 2DKMA 2W1NA 4PRIA 4DTGL 1IAKB 3V5DB 2BSTA 1UEMA 2KZWA 2R29H 2D7TL 1P1ZA 3BI9X 2PXYA 4LDOB 5GGUA 5JLZB 3ARUA 4OLWH 3VDAA 3MV9B 4U4BA 4J4PC 3AMLA 1E4KC 1A22B 5IW3A 3E6FA 1S9YB 3MMEA 4OJFL 3F5WB 5EULV 4ODTL 4WTXA 2FR4B 4WU5B 1ZGLP 1EHAA 4IHOB 4PRID 5DD6B 2SEBB 4X6FA 1ORSB 3HG1D 1U91A 1DQLH 3BPNC 3K81A 4X6DB 1K4CA 2WQRA 4QRTB 4BH8B 5L88L 3NMEA 3OKYA 5J6HA 3U82B 3D69A 3GEWB 4OZ4B 1H5BC 4OUOA 4KKBD 1H3XA 4LF3B 4NKIL 5KBNC 1BD2A 3ZTJH 1U8PB 3VD3A 5F3BA 1CWVA 1PVHA 4PV8B 4ZTPH 4CJ1A 4OKVA 2BVTA 3TBSB 3RWDB 1FAIH 5I1EL 1CFSB 4GRLA 1CDJA 2FECI 5L9DL 4FFVD 3EO1B 2X4RB 2OMBA 5EG6C 4D9RD 5IHUH 4I1NB 5GRJL 4PTUA 1IAIH 4OLUH 2FX8L 5E7BA 2RGSA 4S2SA 2DL9A 2Z4QA 3CMOH 4WJ5B 3BPLB 5HGAA 4BELD 3C5ZD 1BQSA 3E1F1 4MLSA 5ISZB 1DUZB 2Y06H 3WUWB 1AO7D 3BYYA 2P5WD 4WEBL 5DRXA 1S7TB 3O41A 4URTB 1E4WL 3DSNA 3MBEB 3WIHH 2ADIB 4LCWA 5IBLD 1I9RH 4QYOB 3PWNA 4P3DA 2A6JA 5D72L 3ZSTA 1RD6A 4AM0B 4NNXA 3B2VL 1F3JA 1AHWC 4D0DB 2FHFA 3GMMB 1WZLA 4M00A 4OZGA 3GZKA 3ARFD 5HHPB 2R1YB 3DJ9A 5IMOB 1FNEA 2BNRB 1N7MH 2X4TA 1BOGB 3OG4B 1PZ5B 3QI9A 3P0VH 3G04B 1T22A 4JY4B 3MJ9A 4WHTB 4GLRI 2X4PB 1CGXA 4JY6B 1G7PA 1NL0H 4PFEA 3BGMB 2QSTA 3FO0H 2NY4C 2ZSWA 3B6SA 4X6BB 1BBJB 3PDOB 5DVNA 4PJBF 4L3CA 4OZFG 4GUPB 3EYQC 4ZPVB 3ZT7A 2JCCA 5EC2B 4KK8C 3FB7A 3ZHDA 5DMJB 5D1QC 1WT5C 1XF5A 4DAGH 5EIVA 1X7QA 2ESVB 2EEAA 3KPMA 2VABB 5T1LA 1PY9A 1E27B 1ZHKB 4WEMB 1QSEB 2AXHA 3O3EA 4S1SL 1U8MB 3QEHB 5FA4A 2GSGA 3SO3C 3RIAK 5E03A 5JA8B 2HKFL 4JQIL 2JIXB 3IAQA 1RZGB 3MUZ1 2Q3AA 4PJCF 4HX1A 2BHUA 4LPVA 3RU8L 2J6EL 1XGUB 1MCNA 4PB0L 1HQRB 4Y2DD 4QF1B 1IGTA 4YHPA 1M05A 4XMLH 1Z3GL 4DAGL 2OL3A 3PNWB 3CVIL 2FL5A 4NN5C 5T3XD 4OIAA 2LE9A 1P7KA 2G75A 2AEQH 3HFMH 2C3XA 1LO2H 1UH4A 1LD9B 3RL1B 5MEPB 1MAML 2FYYA 4Z7WF 1I1AC 3BDYH 1BGXH 5EUOF 3P9LB 4TUKL 3ZE0F 5AZEH 3QWOB 3RZCC 1N8ZB 5BW7A 4HUNB 1C5BH 1FFOB 3CSYB 5IROA 1IQWL 3D6GA 5DDHA 4LVHC 1MHPH 1EZVY 3UTSE 3GO1L 1N64L 2IG2H 3UYPA 2OP4H 5CSZA 1VADB 3LKSA 4G7YL 2DN7A 2LU7A 4QRRB 2YKLL 4ZODA 3CXHK 5FCUH 4ETYA 5JUEL 1NGYB 3RTQB 2VXSL 4FP8L 2XPGB 5JHLH 4C55A 4LHUG 5D1XA 1FNLA 2NY5L 4ZSOB 5CHNB 5KW9H 1GGCH 4QO1A 4YDVA 5KSBE 3HZKA 3G6JF 4Z0BH 4B0MM 1AE6L 3GMQA 1TJIH 1H3PL 2Q20A 3FB5B 3F65A 4XPBL 3SOBH 4K9EC 2BMKB 3CC5A 1TZGH 2K1MA 5T1LB 3I02B 2XTJD 4JQIH 2HKHH 1XT5A 2IH3B 4P4KA 5LGKA 1QBLH 4CJ0A 2ADFH 5C0AE 1NANH 5CILL 3D3VE 1CGSL 2B4CH 3IJSB 2B1AH 3D2UB 3ECBB 1YYMH 3LEXA 2QKIA 2QBWA 3L7FA 4GUPA 32C2B 4PREB 4F2MA 2ZP0T 4NQDB 4LDEB 1KLGA 2HP4A 3OAZH 4YX2L 2K7QA 2DLEA 4RWHA 4PY8I 2F74B 1WBXB 4KKLC 4WHTA 3UTQB 5GZOD 3MO1B 4HH9B 1Z2KA 4DOHB 4WO4B 3JWOH 1P4LB 1DVFC 4POUB 4LRNH 3E2HB 4N0YL 4OM1L 3OR7B 2EZ0D 1C16A 2R1YA 5E8OB 3LRHA 3W39A 3QXUA 4Z78A 3DURB 4YC2C 1DQLL 3HN3A 1S7XB 3LMJH 4X7SL 1JZ4A 25C8L 5H35B 2ICWJ 4ZFZB 3TLRA 3R1GH 4NRZA 4Z7VE 5HI5C 5IHBA 1ZAGA 1J1PL 1KG0A 3QCVL 4FQXD 1ZEAH 3JWDC 3DVFA 3O41B 1WTLA 5ANME 1JFQL 5CINL 2VDPH 4PJBA 3EOYG 1JMZA 3FB8B 2LFGA 3H0TB 1W72A 1YUHB 4UV7L 3HPJA 5GIRA 1S5HB 1QPXA 4XRCA 3KNBA 2R0WH 3ZE2E 2ITCA 4Q6YA 3RWEB 5KVEH 5F97E 5I6XB 4IIQA 2UWEE 4E9LA 3MLWL 3ILPA 5DGRA 2AJYH 1CE6A 1MCWW 2ZCKL 1GZQA 2FEDC 3MCKB 1JGUL 4F58H 2VN4A 1JE6A 3O3DB 4M6OL 3GB7B 1SYVB 2EYTB 3FT3A 4KXZH 3P40A 5JXEA 5FM5O 4JDTL 4LLMA 1OVZA 4MCZB 1YZZA 5EORL 2CGRH 4HBQA 4ETQA 1PDKA 1FG2B 1DUYB 5D7LE 4APQA 3VA6A 4Y1AE 4YUEH 2J5LB 1F02I 1BF2A 4RMTA 1ZA6A 1SMAA 3BN3B 3PL6C 1MVUB 5HI3C 1CD9B 3L9RB 4Z8FH 5ISZD 4X6CA 5TDOB 1D5IL 2C1OA 4XTRC 4ZTOL 2YMXH 4WFGD 4LSQL 5CIPH 4EN3C 1T89A 4F9LA 2XKNB 1GIGH 4F7EA 3QJHA 1ZA3B 1F58H 2HT4C 1BQLH 1CFTA 3GGWB 4LCCB 3ALWA 5K9KB 4ZUTB 2A83B 2D0FA 1RJYA 4D0BA 4HMEA 4HJGB 4IS6B 1OWWA 3KS0H 3WFHB 4HK3N 1A7QL 3P0GB 4K7PY 4WI3A 1UADC 2F5AH 2R29L 4K8RH 1DLHA 5IB2A 5KTEL 1U92B 4XPGH 3QIBB 1L7TL 5E8NB 4C56D 4M43H 5C6TL 1WZMA 3RHWK 4PTTB 2B5IC 2A74A 2XG4A 1F6LL 3I6GB 2MMXA 5ADPH 4CUCA 5I17B 1AGBA 1QNZL 4BSWB 1RY7B 3MV8D 5BCAA 3DV4B 4KRMB 2WINB 2EC9U 1CICC 4G6KH 5I1CL 2Z31D 1QBAA 3QZWG 1U95A 2AV7A 4C56A 4K71B 1XF3A 3IGAA 2LAGB 5EZIH 3QP3A 1U8NA 3EOTH 1CK0H 2A6JB 1H5BB 3GBNL 1U93B 3MUGB 3NFNA 3KR3L 3HE7C 4GS7B 1NDMB 1VFAA 3O3DA 2BFVL 4HWNA 5CJQL 3DPBA 1YEDB 3FO2A 4OLZH 1GZQB 5IVXF 1E28A 4NC0B 1T1XB 5HY9B 4TUOA 2NXZC 2I26N 1S7SA 1NGWB 4Y2DB 2YSSB 5FYJL 5L2JA 2NZ9D 5GGSA 2HFEA 4EI6A 1L7IH 3S98A 1KTDB 4WI7A 5GIRB 3IFNH 4NJAL 2VLRD 3SY0B 2EDRA 4PJ8A 3VXOB 3U79A 3FO2B 5F9OH 4HWBH 4KJYA 5EU3B 3ROLA 1MH5B 43CAA 1V7NL 4L9LC 3P30L 4BFGA 2ZKHH 4PV8A 1U58B 1GGYA 1RIVL 2YN5A 2MCG1 1BD2B 3OKEB 1R3KB 4PG2A 1EFQA 2A83A 3GSRA 4MD5A 4TQEL 4ZFZA 4L4VB 2VC2L 2WQ8A 4XRCB 1WFNA 3GGWA 4R0LA 1JHLL 3HC4L 5I9QB 1U9KA 1ZT7B 1BFSA 3MODH 4XPGL 4JM2F 3VRIA 5GGQL 5E94B 2IAMB 4JRXD 3O9WA 3VWJC 2AK4A 4OM0H 2VXUL 4BSWA 1M6OA 4ZFFB 4WUKL 4PY7B 1U6AH 2V5SA 1ONQB 4I2XE 1RVFH 3GSUA 3GRWH 2P7TA 3RQ3A 1D5MB 5IVOA 3VG0L 4ETQB 3TPKA 4HJJH 4HDIB 4RFOH 2EIZA 5I76A 4W70A 1FE8H 3MRFA 4XNXH 3PABA 4M1DL 4YIQB 3F7RA 3RHWF 5I8OL 1A2YB 3L9RA 2Z91A 3ARGC 3LEYL 5FM4A 1HKLH 2VERN 2OZ4A 5GSVA 1GC1L 3SDDC 4DKAA 2Y5EA 4WFFE 2R15A 3QJHB 4XPTH 1KIPB 3QUZD 3V7AE 1HINH 2VISA 2IQ9H 3UYRL 3CSBA 3UP1A 3ZSSA 3PL6B 4K94L 2V2TB 1CLCA 1JHTB 1E28B 4P2QE 4GS7C 3HE7B 3GBMH 2IQAB 4HC1A 5C0EB 4Z18A 4ELMB 2OSLA 3AS1A 1QLRB 1AC0A 3RPIA 2X05A 5JW4R 1G9NH 3V4VL 3NOIA 4HWBL 4Y88A 4HT1H 3DX7A 2G5RA 5L2JB 3R06B 5I1KH 4P49A 3ULVL 5K9OB 4MHHG 5MERA 1WWCA 5IVZB 4FTVB 1JZ8A 5F9JA 3RVWC 5CSBA 1YMMB 2BVPB 1DBKH 1JZ6A 1NDMA 1GOFA 1JPST 3TT3H 1J1OH 1LEIB 4DN4L 4DVRL 4NBYB 3O2DH 4JAMA 4H20L 4PB9L 2FX9H 3GDBA 5AD0B 5E8NA 2FO4A 4KGLA 5EFIA 3RY6A 3TESA 2EDDA 3OF6A 4I0PD 3RA7H 4PRHE 2AJUL 2H6PB 3FRUA 3DURA 1T2QH 1C8PA 5B4MC 3NPSB 1SBBA 2FIKA 4ZUTA 4ZFGL 3OKKA 3IXTA 4C59B 3DV6B 4KVCH 3GJFA 3NCCB 4M02A 2WIIB 1J10A 1IC1A 2N56A 1EGJA 1HXYA 4JFDD 4HHAB 1WV7T 3HE6C 4Y5YC 3ESUF 2NPLX 1BFVL 3O4OB 2C3WA 4B7LA 1EDQA 4OZIE 3VD4A 1RJCA 1BJMA 1GPOH 2Y5TA 1TZHA 5CBEA 1M7DA 4KK6D 2OL3H 4RGNE 1G7QB 4ONHA 1JNJA 1ND0B 1OP3K 5C70A 3P9MB 4JJ5B 3IS1X 2JK5B 3TF7C 4NNYB 3NH7L 1XGPA 3OR6B 4WWID 5EDXA 1FFNB 4OCXH 3T4AB 1C5DB 2YUXA 3WD5L 1X5AA 2XZAH 5ITBL 5GJTL 1JTPA 1HIML 3MFGB 5I1LB 3SDAC 2BNQA 3MRBA 4NKMA 4U6VH 1EK3A 2Y1VA 3MV11 4GAFB 3QIUD 2VNCA 1WEJL 4JVPA 5ADPL 1X6LA 2C1PA 2EXWD 1UZ6E 5D7SL 5DHYB 3FKUS 2JCCB 4GMTH 4IMKA 2GUOA 5CD5C 2I27N 1KSRA 3WIFA 2G75B 4DCQB 2X10A 5J06A 3C6SA 5F7YC 3MJ9H 2VR9A 4M7JL 5AD0A 2J8HA 2NY1B 3QCUL 2F5BH 3B83A 1VADA 1ZEAL 2D03H 2X7LA 5DZLA 4C4KO 3K8KA 2J6EA 2GUOB 1JIBA 4OZFH 1IC5L 3KPLA 3QI9C 4MVBC 3FQXA 2NLJB 2ZUXA 2VXTL 3FJTA 4ODHH 1FIEA 4G7VH 1IL1A 1EO7A 1OSZA 1NC2D 1EGJH 3CDGA 4L4TA 1CXHA 3HB3D 1QBLL 4KMTH 1RIUL 3X12B 1E4KA 1F45A 3FMGL 2I60H 4LLAA 4NZRL 1KXQE 3HS0A 4X8JA 2YD6A 3UYOD 4BFIA 3S4SB 4Z78B 4W68A 4GXUN 5GS3A 4RQQA 1RZ7L 3ARFA 1UCBH 2Q8AH 4RX4D 1G7LA 3MNZA 2B7DT 4OCWH 4WDIB 2W0LA 4NNYA 5GS2D 3ARBD 1DZBA 1B0GB 1NMAL 4EVNA 4RRPG 4Z5RA 1M05B 2Q86A 5FYKE 3JWOL 3VDBA 1JGUH 2YS4A 3C2SA 5F7WC 5F1OB 1WC7A 4DFHA 3DV6A 1EHXA 4PREA 2XKSA 1QHOA 3MYZA 3S5LG 1B0GA 4FN0A 4HKXB 5TE7L 3DMMD 1A7NL 2V5YA 4MA3A 4GRLC 5HJ3A 4YQXH 3FB7B 3W2DH 2AJXH 1EV2E 3ULVE 4JKPL 4JZNA 5I16B 4L3AA 1Q38A 3KPRA 1BP3B 4OZHF 4XVTH 3KJ4C 3T0EE 3RKDC 3NIFE 1JFQH 1DQDL 4KAQH 2PYED 5D7JD 1MNUH 3FHQA 2VKWA 1JUFA 1YMMD 2M2DA 3FQUB 1HXYB 2WAHA 5FKAB 1YEJH 5EU5B 3VWKD 4N9GB 4YE4H 2V6HA 1IKNA 1N59A 1NPUA 3A67H 5K9OA 2D7OA 5E6IB 5D9SB 3QDGE 4TTDC 2IMMA 5B38G 2DQIH 4CGTA 3U2SB 4XWGH 5ESAA 2BSRA 2CKBB 3K2UL 5JHDE 4E0RA 3OAZK 4LVHB 3S97C 4PRIB 1MH5A 1XGPB 4Z95H 5IFHL 3C9NB 2P49B 4D3CH 2F58L 5KN5A 2B2XL 2VKXA 1OD7A 5SWSD 3RNKA 3ZL4H 4NNXB 2V5RA 1SVCP 4NP4H 3SDXE 1IAIL 2VXSH 3ZKXC 4IRZL 2Q8BH 4OQTL 3QDGD 2CDFA 3FQTB 4HEME 4YAQB 4WFGE 1RK1A 4L3EB 3X3GL 1CK0L 3TJEH 3TBSA 2ED9A 3ARQA 3DV4A 1CD0A 2H26B 1EEQA 1MI5A 2K9UA 4L4TD 5T5FL 4NQUA 1AGBB 1TJIL 3MNWA 3VRJA 3C5ZA 1U0QA 5IEHA 4WUUD 1MIEL 2EH7L 4G8GE 4WIQA 3VXSD 2W65A 2BDNH 3THML 1BECA 4HS8H 1QFHA 1PYWA 5DUPL 3LQAC 5F6HI 5SV4A 1QKZH 2GAZB 3QPXL 1GL4B 3STLB 3GMOB 3WKNA 5C6TH 2QADB 2AABL 3OB8A 3TO2A 1B6UA 5CGTA 3LN5A 1TQCC 1FHGA 3HCVA 4PIRF 1U8HB 2C4FU 3VCLA 3O3BB 4BK4A 4JY6A 4PGCB 3WDJA 2YPLB 4F15B 3O2DA 4OSUL 2XKNA 2X40A 3MLXL 4KVNL 4G80A 5IM7B 5FYKD 2Z92B 4EUPB 2HMIC 4DTGH 1MFCH 2ATKB 5GGQH 3BJ91 5I8KH 1TTFA 3VXRD 1B88A 2V2XA 5T3XE 5EFIB 5LWYH 1A0QL 2Z35A 4Y4HB 2VLJD 4Y4KA 3U7WL 3PGFH 4R96B 1DUYA 5CJXA 4MXVF 5IWLA 3QXWA 1Y6KR 3TWCH 2YXMA 1F13A 3CDYA 3HAEB 4UT6H 3S35L 2EXYD 1T83A 4PLNC 4GQ9H 4NQCE 1YC8A 2VXVH 3HLAB 4RA0C 1WCBB 4XNQB 3T4YB 5JW5A 1KTDA 4OQTH 4KROD 1T2XA 5JDSB 4Y4KD 1UB5B 4GAJH 3QPQC 5FO7B 4JFZH 3X14B 5GS1C 2DM3A 5F6HJ 1NAMA 3CUPB 1B4JH 3ORJA 3OMZA 1JF1B 5L88H 1Z5LB 4ZFOA 1MFDL 1MQ8A 1DQML 4KRNA 3BKYL 2IEPA 5SWZA 5JR1H 2A0LC 2OI9B 3UJTH 1EO8H 1PW3A 2RJMA 1YY8B 3BPCA 5JUEH 4GLRH 4GSDL 3X14A 4LPCA 1N5YL 1T66D 1DEDA 4N0CD 2FX7H 1LO3L 3FMGH 3ZLQC 3V6FA 3ARRA 4HV8B 1Z0MA 3QIWD 5D9SA 1TNMA 4OT1H 5HYSA 1XFPA 5DSCA 3O9WC 4PY7A 1D5ZB 4G8EA 5BVPL 3KWWB 1LK3H 4KI5E 3K4ZA 1Q9OA 4WEBH 4ACPA 1HEZA 4PGBA 1OP5H 5GGRA 1U3ZA 1RFDL 2JTDA 1P4LA 1DQMH 3DGGB 3SDCB 4O51A 4PTTA 1R6VA 4PJEF 4JM2C 3MXVL 5A3ID 4YDLC 1KJ2H 4P59L 1CGSH 1HH6A 1AO7E 3T2QA 5IM7A 4GMSL 4QLRA 3BP5B 4MD0A 3N06B 4LHUD 4DKEL 1RUKL 4Q9RL 2V7HB 5HYSB 1OARH 1JZ2A 3ULUC 3BH9B 2HFEB 4MJIB 5AUMB 5DWUH 5KVDL 5FUCC 3OB0H 2HWZH 4L5FL 1CLZH 3QUMH 3JV6A 5E7FA 1KLFA 1VDGA 2DS4A 1KENL 1MQKH 4YDVB 5GHWL 1OAKL 2NY4D 1JZ7A 3EFFA 5FYLE 3UXFA 3C5SB 4R7DB 4GW5A 5D7JC 2NMSA 4AG4L 1HHHA 1NEUA 1D3CA 4U1NA 2MJWA 1KXVC 1QFOA 1U95B 4QRQB 5J56B 5KS9B 3OBAA 3AXLA 4XPFL 1Z9SA 3L3OB 3HPLB 3FFCE 1X44A 4JO1H 3JWNC 1P9MC 4OF5A 2W9EH 3HZKB 3BMVA 4KQ4H 3ET9F 3GJEA 3SCMD 1WFUA 1QSFD 5DQ9A 4DUXA 2WP3O 1T3FB 1JRHL 3SDXF 4FNLL 4XP5L 4G43B 4LAQL 4PJEA 2DQEH 3RU8H 3DX9B 1WGOA 4M6AA 4XB8A 5C7XH 1KPUA 2ICES 1DLHB 1T80A 1UXWA 1UXSB 1Q1JL 3U0WH 5HVWA 4Z7QE 4HH8A 5EU7C 2G60L 4R2GB 3VJ6A 4WCYH 4K7FA 3PWUA 4I18C 5J9PB 2Y6SC 3BH8A 3QHFH 1I1AD 4PP2A 4B7IA 2YPLD 4XH2B 3SKMB 4H1LB 4ODUA 5IB2B 1ZT4A 4Y16C 5AEAA 4BUGA 5HYJD 4P59H 1N6QL 2C1OB 1D5IH 2J5LC 1FDLL 3RKPA 3I3BA 2VDOL 1JI1A 4G5ZH 1BZ9A 4WNQB 4XBGB 4FXLA 2E7BA 4XCNB 5T5FH 3TYFB 4FQLL 3RTQC 2NR6D 3PNWA 1TVHA 4LCCA 4JZJC 3E0GA 4IRSB 4PV9B 4G8IB 3CH1B 1YQVL 4NC1C 2CIIA 1BBDL 3QUML 2YXFA 4KPHH 4MNGA 3AY4C 3N9GH 4XHJD 2WLZA 4RNRB 3WEXA 5IHZB 8FABB 4UTBH 1ZGLB 1BVKB 5CHNA 5EO1A 3HA0A 1KCSH 2IGFH 3WXWH 3K1DA 4L8SA 3MRJB 4X80H 2BHZA 3SN6N 3PQYB 1XR8B 4XPBH 4DOHE 5EPMB 1IAII 5BV7C 4NKIH 4RAUA 1AH1A 1MJ8L 1CLOH 3MCLL 2CD0A 4FQ1L 3LKSB 3HC3H 5FUCE 2AXGA 1T2JA 4HGWB 4XMKL 3KLAA 4P2QD 2XICA 3MRNB 3EGSB 4YWGL 2YD1A 4MWFA 4A2MA 2VIRA 1J8HB 2H45A 4QXWA 5CBAA 2UZXB 2YUVA 3D39A 3ZDXF 4JFOB 3H9SB 3BPLC 2GCYB 1Q1JH 2FYYB 3U0WL 2ARJB 4F7MB 4NQVA 1IEBA 1OF2B 5GZOC 5LGJB 4P23B 4J3WA 3OTTA 4ONOA 4G42B 4JPWL 2I9TA 3BWUC 1RZ7H 3I3EA 5HHME 5EOCL 2E9JA 2VDLH 4XGZA 4B41A 3HZMB 3D39D 3NACL 4UV4L 5DJ0A 3TZVA 5C0FB 4NUJB 2HJLB 1OM3L 1BWWA 2QKIB 2W9DH 3MV8B 2XZCL 2ZKHL 4QOKE 1N0XL 4LFHD 5C3LD 2FD6L 3ZDZE 1EAJA 3TBVA 4KZEL 5DLMH 2Z93B 2R23B 2JIXA 4LHUB 1IAOB 1WC7B 4ZOEA 5HPMB 1CFNA 3UTSB 4QOKB 3O9WD 5DUBA 3QEUB 1CFQB 2ZG1A 2NY2D 4P2OA 4ZXBB 3T1FB 2OK0H 2O61A 1IRAY 4AEIH 5C0BE 4N1CA 1U91B 3OR6A 1FVEA 3LS4H 3ARDA 3VD5A 1F2QA 3PV7A 1C1EL 3O11A 4XAWH 2JIXD 2CJUL 4ZPTA 3TA3B 4RQQB 3UTTE 3N50A 2F54E 2NX5E 5BRZA 4CNIA 3E6FB 2DKSA 3VXUA 4ZO9A 3SO5A 2HT3D 2R1XB 5HDBF 4ESKA 4LPWA 1AQDB 1C5CH 4OD1H 4PJ8C 5IMMB 1FNGB 1U3HD 2OTUB 1A6TB 3FQXB 5FYKH 2HTKD 5HHQB 1BD2D 5DMIL 4OCSL 5DK0B 3CMGA 3U46B 4NDMA 5IFJB 2W91A 3ILQD 3OPZH 3O8XC 2BVQA 3MNVB 1QSEE 4M6NL 5HGGS 5IW1A 3PQYE 4OV5A 1R3IL 4PJHF 5DRXB 3QRGH 4UAOC 3VXPA 1RJLB 3PQYD 3LOWA 4EI5B 2DWDB 1FC2D 2J7LA 1NSNH 4KK5C 4P48A 4HSQA 1HK6A 4I8DA 3RY4A 3DVIA 2BNQB 4OFIA 3HI6L 1CFNB 3AMKA 1WZ1L 4XCEB 4C56E 1G0XA 5T1KD 5EWIH 1TDQA 4MD4B 5DD5H 1FNEB 5ID1A 1BZ7B 4J23A 4LIQL 1OB1B 3VMPA 5HHNB 2GSIB 3RWIA 2EDTA 1IGFL 2I60L 2R1WA 3MREB 1IM3A 2RCSL 4H0IA 3F62A 3KXFD 1F4WH 3OGCB 5GGVH 3D0LA 1Q0XH 4KTDL 4WGWB 3VE0B 5CP7B 4KY1H 5IB4A 3C8KB 2C3GA 4FQJL 3HRZB 5JOPE 2GY5A 4IRJD 2Y5TB 1WT5A 1AY1L 2ITDA 3KYNA 1V3JA 3T2OA 2IPKB 3BAEH 5LGHH 4R97C 4P4RA 2P44B 4Y16B 3H9SA 5CFHA 4XCFL 2KH2B 4EXPX 1S9KC 4JFDA 1XGRA 4UB0L 3D3VA 4FFZL 5D8JL 3VXNA 4N5ED 4LCWD 3MXWH 2CIKB 5DFWH 4WEUD 4LOUD 1VHPA 3TO4A 5FM5M 4OZGB 4K3JL 1CVSC 4OGYH 1EBPA 2KUTA 4L8CA 4J6RL 2HJFB 1OGTB 1T03H 1E6OL 2MHAA 4FFVC 1QRNA 2A2QT 2BC4B 5F9OL 2HRPL 3TGXA 1FFPB 1A02N 3FFCB 5LBSH 2DB8A 2GJZA 1TCMA 2XTJE 4L29B 5JDJA 2E6PA 1RU9H 4JHWL 3VW3H 1OP9A 2VC2H 4IMKC 5E99L 2PR4H 4TNWK 5I1HL 3KS0J 2EDXA 3HMXA 3KPRD 5EU6B 2HFFB 5EC1B 4J3UA 1HXMB 2P24A 2Q7NA 1K8DA 1E4XH 1GPOL 3NCJL 4QXUH 1O7SA 4LCIH 5DJ2A 5HSFA 4K3DL 5E2WL 4ALAH 5BRZB 4QYOA 4ZOCA 1P5VA 1S7RA 4G9DB 2OTWB 5FEBA 3H9YA 1A6ZA 4JCLA 3SE9H 3PHOA 2WWKT 3GSNA 2WK2A 5D96C 5FYJD 3NFPA 1HKLL 3MLWH 1DBAL 1A9BA 3L3GA 4FTVD 3KLSA 3SDDB 5GJTH 2FGWL 1I1CA 3ZL4L 2FGZA 1MSPA 3KNBB 4PRAA 3FO1A 5LWYL 1MHHB 1UKQA 4XC3L 1B3JA 1IC4H 1CFSA 4GRLB 4HS3A 4XT1C 1YEDA 1IGYB 1GC1H 1I7UA 5F7UA 1MHEB 4XCFH 4NO0A 2BNQD 1XCTA 3N1MC 2ZOKB 3ZDXE 2EKSB 2VZOA 3F5WA 3V6BR 1IEHA 1IGJA 2X9YA 4P2CG 5EN2A 3QNXB 4F8QA 3X13B 2PO6B 5IG7B 5DS8A 1LP9F 1EEZA 4GG6B 3NZ8A 5F9WB 3GJEB 3QUMB 3V5DA 3I6LD 3Q3GA 1MHCA 3GMLA 4MA1C 4OUUB 4QXGH 4MAYD 1C12A 5CKGA 4YC2B 5HYJE 4LLDA 5CEZL 5E56A 5MHSE 4D0CA 1T1ZB 4DN3L 4PRAB 5KVGH 2WV3A 5ICYA 4JHAH 2D3VA 4X5LA 3G6JE 1AR1C 3W9DA 3IU3B 1RI8A 1H15B 4PJDF 3RVVC 3EFFB 5C2UB 1NCCL 1IMHC 4O5LL 3CFJB 1F8TL 1EEYA 3CIQA 5I19H 5DC9B 2HTLD 5EUOB 1ZTXL 4XNZB 3W11C 4LLQA 1Q9WB 5HHOE 4JFQB 1JJUA 3H9ZA 3WNPA 1NLBH 1SYSB 1EPFA 3W9DB 2R2EB 4RX4A 2A73B 2BMKA 4UQ3B 3GJFK 4FQXB 4N1HB 5KVMC 1FZMA 3HZYB 5ESVB 1XIWA 4B5EA 2DTSA 4PP1D 2ERJB 1YEKL 5EU7E 5D1QB 1IFHL 3UDWA 4MDJB 2VJXA 4LPYA 3HI5L 3CNKA 3QXDA 4HMCA 4JFFB 3ZE0E 1X5JA 3V8OA 1G9EA 2DYPA 2PXYC 5GS0D 4U05A 2EICA 1CCZA 4GH7B 1EXUA 4GG8A 2X4QB 2FEEI 1FGVL 3MJGX 4UAOB 3RGVB 4UI2A 1T1YB 1MCPH 5IESH 5FHBL 3KG5A 1L9MA 1I7UB 4V2CB 3M1BA 3IETB 4OUUA 2FEEL 4FQ1H 4C57C 4P3WA 1MWAB 3IDIA 1QQDB 4N5UA 5JPMA 1W0YT 4JRWA 3VFWB 4YXKH 2P5ED 4F15C 4WW1A 2PO6A 3BWAB 4NT6A 1H3WM 3SDDA 4PLJC 3AFLA 3QUYC 4U1MB 3SGKA 4OZFA 1QR4A 1XGTA 1CXEA 1IAMA 3CFKB 4S1RH 1WEJH 4EDXA 4M6OH 4J2XA 5EZLB 2DYPB 3S4SG 3L7EA 1F4WL 1HH9A 1KTLA 4L3EE 5CD5D 1G7JB 3IJYB 5LAXA 5DJ2B 2OCFD 3CLEH 3NACH 5BRZE 2X1WL 5DVKA 3SDXB 3H3BC 3QDMA 1TNNA 2CDEB 2ENSA 3A6OA 3CFCL 5J7CC 4LSQH 5C0BA 2FIRT 3TBTA 3GSOA 4FQCL 5E1AB 3IDJA 3G5YA 1JNHB 1LQSR 3DWTA 5DLML 1FJ1B 4PRIE 4P46A 1CDBA 2NTSP 4JO4H 2A38A 4M1DH 2DQUL 1YEHL 1EGJL 5K93A 4HW6A 1A3QA 3SE4C 4M7LT 3PJSB 3L3DA 3RUGE 5ID0B 3MGOA 1ED3A 1FBIH 3S37H 3DO7B 2DI8A 2DKUA 3GBLA 3ZT5A 4OZGE 4QTIH 5E2TH 3FCTB 1HILA 4LSRH 1KIQA 4LCIL 3TIDA 4PJIE 3PGFL 3EYVB 4N0FB 3MRCB 1SYSA 2X4PA 1S5HA 2DQDL 3TC9A 3VFVA 4LEXH 3MJ7B 3ZT6A 3IETA 5FAAA 1CGTA 1Z9OA 5LCVH 2MTPA 1NJ9A 4O9HL 5B3JE 1A7QH 3LVEA 2VO5A 5GJSL 5FYKL 4X9FA 3SGKC 3W0WB 5IEKA 4JRXA 3TT3L 1XCTB 2ZUUA 5CSZB 1R3IH 3MBEA 1RSFA 3RKDD 1UKTA 1LDSA 1EO5A 4ELKB 4JR9L 3QUXD 5E8DH 3HMWL 2HLFD 2Z9TA 2OZ4L 3CSYA 2HKFH 4HH9A 5E2VL 1HQ4B 3HC3L 4NC2B 2BNRD 2KL6A 3A6BH 4GRWF 1S5IL 4PG9B 5E08L 1JN6A 3R0MA 4YK4B 4YGVB 5D2LF 5DD5L 5TH2B 2B1HH 4GXVL 4EI5A 4WRLA 2DI9A 1C08B 1WZ1H 1I8MB 3MLZL 1JZ5A 4RBPK 1CU4L 3ZYZA 5HHOD 5K9QG 2X70A 4WHDA 4J3VA 4M48L 4E0RB 4CN4A 5DJ0B 2Z31B 3MNVA 1LO2L 5DQJB 1Q0XL 4PG9A 1NFIA 2F19H 1BFOB 1IGTB 4YHPB 4AYFA 2DDQH 3S96A 4XCYB 4GRMB 4MJ6A 1U2HA 3SPVB 3B43A 4X0KB 3GMQB 4LU5H 4R97B 5EOCH 4ZUSB 2KPNA 1BF8A 5F7KC 3B3IB 3QH3B 2Q3ZA 2NYYC 4Y5XC 2FNBA 3BXNA 1ZT1B 3BDXA 4WV1C 2PCPB 4Q2ZA 5IVXE 5IB3B 1K8DB 3GM8A 1J88A 5ALBL 3FT2B 2C9AA 1NAKH 3W11D 2ZOKA 1VFUA 4NN6C 3AAZB 4YWGH 3QIUB 1YEGL 1M71A 3DXAE 3T77A 5F1IB 1V7MH 1A6PA 3MLTB 1KIRA 1KT2A 2FJHA 3K0WA 2ORBL 3MRQA 2QHRL 4HS8L 3U1SL 4XI5D 3IDMB 5J89A 4PJEE 5ELIA 4CVXA 4YDIH 1RK0B 3WO4B 5ACZB 4N0RA 3WBDA 5ENWB 2BXZA 1XH3B 3MV01 1NCUA 1T7ZA 2CXKA 2ERJC 2ZPKH 3V7MA 1CD1A 3SQOL 4YDKH 5E5UB 3EJJX 1FNAA 4KZDH 1P7QB 2Z8RA 2VL4A 2NY6C 2XI9A 5IMLB 4LKCB 1MAMH 4K8RC 4I9WD 4A6YL 2RAMA 1CE1H 3U36A 4FQIH 1YEIL 4EBQH 5DHVA 1YYML 3O6FD 4N68A 3QEUA 1N0XH 1ES0A 4FMKA 1J11A 4PY8J 2GW5A 4DEPB 3CDGB 2AS5M 2DD8L 1IM3B 4JN2A 3QCTH 3VH8A 4HXAL 3SDCC 2FZ3A 4HCRA 5ISZA 2D31B 4N8VA 3TBYA 5AYUL 2W0KA 3KPPB 1P6AB 3KPLB 1G7IA 4PGEB 3MRRB 1K3ZA 5A2FA 4PRPB 1D6EB 1J86A 4DW2L 1ZHKA 3IVKB 4PLJD 1J8HE 2BZDA 4TRPH 3U0TA 3V5HA 1DL7L 3A67L 4OGYL 4JO3H 4W4OC 3HE6A 4P2RA 1W2KT 4GBXD 2ZNWA 4FA8A 4JG0H 3B9EA 5DJYA 4I9WE 1MY5A 3D39B 1T7VA 1OPGH 3ARGD 5FV2A 1PSKH 5HGDB 1WBZA 3U9UB 3IDMA 4Q0XH 1OQOA 4JPKH 4OLVH 2J4WL 1GXEA 3W82A 2D9QB 1N5AB 3WLBA 1TTUA 4NN6B 3KPSB 3B9AA 2VUYA 4QOKD 1AIFB 4Y7MA 2FB4H 1EUTA 5EBLA 3DUUA 4JG0L 2KZ1B 3V5HB 4ELME 4EUPG 3VXUB 5BVPH 4PJHB 1U42A 2R0LH 1GYAA 3EYOB 2R2EA 4JO4L 2AEQL 3MRGA 2NY4B 3GSWB 5DZNA 1AP2B 2Y9RT 5C0RL 2X2YA 1I1AA 5EZLA 3O2VH 2BCKB 4L1DA 3VFTB 1I8MA 1AI1L 2MQCA 4G6ML 4RFEA 4Z7UA 5EBMA 3VH8B 5FYKU 3WFBH 4GKZA 3QQ3B 3LD8C 3EO9L 4JANB 1DEEB 3OJDB 3LEVL 1NBZB 3MR9A 3RPKA 3OHXB 2W92A 5GXBB 1SEBB 2P1YA 2Y36L 4JZJA 4LKXB 4ZPTB 4ZD3L 1T1ZA 5IBLC 1WQVT 1HDMB 5FK9A 4XNUL 3P4NA 3BW9B 2VZSA 5DJCB 5HDOA 2L7UA 3NN8A 5LCVL 4WW2B 4OFDA 3PGDA 3CU1A 5IQ7L 3IU3A 3PIQB 2EE9A 3V4PL 1QLEH 2CMRL 3SGJC 4OFVA 4Y19D 2D0HA 2UWEA 4DZBA 5I74B 1I9JH 1Y18B 2CK2A 3JTTA 1QLFA 3MZTA 1J0YA 3ZHKA 1OY3B 2EKSA 5J12B 1Q0YH 1VESA 3SKJH 4ODBD 5HDBE 1NC2A 4BQ8A 4PJ9A 2XQBL 2ZZUT 4MDIB 4NZDA 1S7VA 3CZFA 1KBGL 4APQD 3CXDL 2VXQH 1I4FA 1S9XA 1AGDB 1G0DA 1KLUB 4I77H 1INDH 1EZVX 4DGVH 1MCBA 3SE3C 4DGIL 3P3YA 4LU5L 1J87A 4EQ2A 1CN4A 1CT8B 2H3NB 3RPIB 5DJXB 3ISWA 2PUQT 2IFFH 4ZXBC 4F3FA 2YK1L 2ARJQ 4EI5C 2ZUYA 1T1WB 1W8OA 3RWFA 5IB5A 3A6CH 43C9A 3BT2L 4NFBA 1H15A 5C0DB 4U1NB 4XC1L 1HNGA 2YZ8A 4U1HA 3BP4A 2X4UB 2BP3A 3OJDA 1H8OA 3O2VL 2LQRA 5JDSA 4XB7A 2VE6B 2DBLH 2XZZA 3GMNB 4R4FH 4LCUB 4X9BA 1MFAL 5C92A 1EJOH 4KTEH 2EDHA 4LVNC 4H25B 3D5OF 3HAEA 1V3LA 4WHCA 5DK2A 4UQ3A 1EHNA 2B0SL 3QB7C 1MWAH 3CFCH 1I1RA 1T6WA 3U6RA 1HH9B 1BJ8A 4XCNA 3BT2H 3UMTA 3KHQA 5F1NB 3G9VA 1FYTB 4UQ2A 4JFXA 2H9GA 4PJ5B 3T0BA 5L7XL 4P2OD 3GKWH 4K23L 4ZUVB 3KPSA 4PD4K 4RMSA 1OCWL 2WIIA 5T3ZH 4RFNC 1SJHB 4EOWH 1T0NB 1H3GA 2XNAA 4Z7UF 5D71L 3O8XB 1EEZB 5HYIA 2JELL 4DVBB 3UJTL 3SDCA 3P77B 1OGTA 4DQOH 1RUML 2L7JA 2Z0BA 3UX9B 1DQDH 5D1ZA 4PS4L 3B5HA 4UIMA 4OI7A 3SBWA 3SE8H 2WBWB 4OM1H 1XMWA 1DVFA 3KPTA 1D9KC 4Z7OE 1S8DB 4ERSH 1KCUH 4K9EL 5IP4A 1QRKA 3T3PE 5C0NC 3N1GC 1FL6B 3LIZL 5I73C 1FPTL 4HUXA 1S9XB 4Z0XA 4JY5L 1KB9K 3OXSA 3SDCD 3UBXI 4PJBE 1UB5A 5FO7A 5EC1A 2H26A 1KCKA 1IGYA 1XIWB 5E6ZA 3WO3B 1EERB 5LQBL 5GISH 2XTJC 5INDA 3IRZA 3S36L 2MCPL 1A6ZB 1S7UB 5L9DH 2F58H 3HMWH 4XC1H 3QWRA 5KSBF 3RNKB 5CD3B 2F5BL 2B1HL 3IKCA 3PXJA 1HXMA 2P24B 4YZFF 3TBTB 1UACH 5IMLA 4M8QA 1QKZL 5F7DB 3ZE1E 5FHAH 5I18L 4NSKB 3RWIB 3X3FH 4ORZC 3TO4B 1KB5L 4MSWB 3EBAA 5DJXA 5KOMC 3VXRB 3KYKL 1QEWB 1LNUB 1QACA 2YA1A 2EC8A 4Q9CA 2X09A 4K7PX 1DCLA 3C5SA 2YPLE 1AGDA 3FQWB 2CLZB 4WCYL 4GQ9L 3VXUE 2P45B 3TPUB 3LAFA 1ZMYA 5I1CH 2IANA 4IOFC 5DUPH 1AXIB 1IAIM 1Q72H 4Y16A 5GRZA 4YHNA 4RISH 4AT6B 1K5NA 3VXSA 5L6YL 1YNTA 2AABH 4Y4FA 4WW1B 3REVA 4G8GB 2OQJA 3UTZB 4LSTL 4NM8H 3TNMB 4J1UA 4WW2A 3AS0A 3ETBF 4KUCF 3RGVC 3MREA 2GKIA 4PJCB 4ZUSA 1U8IA 3UTOA 3DUSA 2D31A 5M95B 5ALBH 4NQDE 1UEYA 3T3MF 4MQ7B 4LSUH 3MC0A 3BKJH 4P5MA 3GMRB 4KDWA 3WO4C 1KN4H 3MJ8B 1ES0B 4L9LA 4NHUA 4KC3B 1RHFA 3NCYP 4YXLH 4RMQA 5D96B 5I1JH 2IALB 4Y0GA 3O11B 1HCVA 4KJYB 4QT5A 3CH8A 1W0VB 2O5YL 4WWKB 1VGKB 3L5IA 4FZ8H 1DQQB 1BZ7A 2ZOLB 4HV8A 5JHDB 4BFIB 1NFDE 1AGEA 4JG1L 4V2BA 5KSBB 2KBGA 5GGSB 3LH2L 4G6FB 5L0QC 4GAJL 2WZPD 3EYFB 1FV1A 2HVJB 4HIJA 2Y4SA 2VDQL 4LLWA 2YD5A 2HT4D 3C9NA 1JTOA 1U8JA 5DMYA 1U6AL 2E7CA 3MGTB 3O4LB 5F89B 3I50H 1JGLL 1NUFA 1YEHH 3MV7B 4G9FA 4P9MH 4QRRE 1ERNA 4RIRB 4BK5A 4MZ3A 5ESAB 5I1AA 5F8RC 3BDBA 5F7MC 3W0WA 3WDIA 1MLCB 1H8SA 4J3SA 3T0EB 1G7MB 1TCRB 1LEGB 3BXNB 4U3XA 1IBGL 3FQNA 2WBJB 4U0QB 2J2ZA 3MOQA 3DXAB 4CBPA 1QSVA 1I7ZA 4YFDB 1F3DH 3DIFB 4TTGA 1MRDL 5LVEA 4D8PB 3KYMB 1CDHA 1NBYB 4U3HA 4PRPA 4L8SB 4TYUA 3Q5OA 5D8JH 1HILB 4KJWD 4BQ9A 1OGAD 2OTUA 3IFPB 3LEXB 4LEXL 4M8VA 3V8CA 4P2RB 2YD7A 2DQHL 3VXNB 2G5BB 4QCIA 2A0LD 4AEIL 4C54A 2CLRB 4N5EC 2XN9A 2FX8H 1SY6L 4X4YB 5HI5D 4UT7H 1A6VL 5E8EB 5L8JB 5DT1L 2I9TB 2OI9C 1EFXB 1WIUA 4O2EA 5E1AA 5KAQF 5GRVL 1DQJA 4LP5A 1NAML 2VH5L 2XN9E 4I3RH 2Z8VC 4J4PA 1CTOA 4UUJA 3VRLE 4M1GL 4NM4H 5IWLC 2B4CL 3AS3A 1TQBC 3KYNB 3MV8A 5HXMA 4PUBH 1B4RA 1TXKA 4FZ8L 3WFEL 1FFQA 4ZAKB 4XH2A 3PHQB 4DK3A 2DQHH 3LPGA 4XZUA 4HBCH 1IAOA 2H2SC 4N8VG 1A0QH 4LKCA 5TDPA 5KTEH 1E4XL 3NCJH 2DIAA 5CGYD 5J3HD 4JFOA 2CDGB 5BZWB 1J8HD 3PE9A 3O2DL 4LGRB 4YR6A 4KHTH 4NRXB 2NW3A 5J11B 3BKMH 1IBGH 3QUZB 4YZFE 2MHAB 2C7UA 2I9LB 3W0WE 1I3GH 1IEBB 1OF2A 1RMFH 3VMNA 1I7ZB 2C3HA 4BZ2H 3U4EA 2VR4A 3BQUA 5D6CB 3WL9B 4EN3D 4L4VD 1RUQL 5MENA 1IKFL 1CDUA 3DNKA 5E70A 2JJWA 4YHKH 4CADA 1S9WA 5IIEA 3PP4L 3RAJL 1G7QA 1OAUH 1N26A 5I1AB 1F90L 5DJZA 4WFHE 1JGVH 4U7SA 4JKPH 2NXYB 2XWBA 4WW2F 3K1KC 1CQKA 4AEHH 4PJFF 1BVKA 1XGUA 1MELA 5DURD 5C0CE 1L7IL 1IZJA 1K9TA 1TVBA 5DFTA 3UTPE 4UOW0 1MFNA 2O61B 5DZOA 1VEMA 5TH2A 1XR8A 5L0QB 3P30H 4XCCL 3H3PH 4X4YA 2HYMA 5JOPD 2M1KA 3DXAD 5E6ID 1IGIH 5C07B 2Z91B 5FOBA 1JPFB 3BJLA 2ENYA 3P4OA 4IMLB 2DOCA 1YPZA 2EYSA 1BIIA 1CICD 5GRXG 4HEPG 4M5ZL 3LHPH 4LSSH 1FL3B 1OB1A 4TULL 5I76B 3EHBC 2J88L 2X4OA 1RVFL 4XGZB 2A6IA 2HTLC 3X12A 4PRHB 1FJ1A 1DDHA 1HYRC 3WFDH 4KDVA 4Q6IB 5FGSA 3KYMA 1JWUB 4OM0L 1PG7W 2GJ6E 3V2AR 4YBQD 3RWCB 6FABH 3IYLW 2VXTH 4KRPB 3C5JB 2BNRA 4Z7QF 1H3UA 2GQHA 1SEQL 3G5ZA 2WM0A 2E8ZA 1P2CA 5SWSA 1F4XL 1YMME 4L3ED 3WDHA 2H1PH 2QQNL 2R0ZL 4KUZL 3BRGC 3IJYA 4LDLB 5IEKB 3C6SB 4KJPD 2J8UF 4L4TB 3EYVA 4N0FA 4K7FB 2OK0L 3RTQD 3MRNA 4YHIA 1N2RB 3U46A 2GTZA 2A9NH 2VZUA 3BSZH 3MLVH 5E5MA 4ZDHB 3CVHB 3P73A 1RIHH 3KDMB 4PGBB 2WWMD 3AB0C 4M43L 4HIIB 1NEZB 4NO0B 5FKPA 3MA9H 2AK1H 2YN3A 4LPTA 2D7QA 4G43A 3WSQL 3L5JA 2K7PA 4P2QB 5KS9A 4QRQA 4EJ1C 1A3LH 1KIPA 1GOHA 5J0BA 3QWOA 4HKBB 3CGTA 3O6ML 3IDIB 5JPMB 1NGWA 4Y2DA 5BQ7B 1T20B 4MNQD 5DQDL 1U3JA 4NWUH 3E2HC 1K3IA 4XNYH 1RJZA 4K7PH 3QZWA 4OCWL 4HWBA 4NSKA 4ZFOB 3ZTNL 4WWKD 3TVMC 2LTQB 3DSFL 4NHUB 4E41A 3MLUH 2QHLA 3HNVH 2IFGA 1S78C 4X9HA 5CJQH 4HKZB 3FO9B 3K8LA 3IDJB 3QRFM 5FGCB 2FWOB 1BZ9B 2APXA 5DRWA 5LBSL 2PYEB 1Q9LA 5TFSH 1T4KA 1NSNL 5B3JF 5HD8D 1TPXB 4MB5A 35C8H 3QIUC 4WUUB 5EUOE 2OR7A 4XMPL 4OCSH 5MEOA 4BZ1H 2AJZB 2VDOH 3BWAA 2F5AL 4K8RL 3O6FB 1GZPA 4BSVA 4YPJA 2DAVA 2BY0A 3V6FB 2X1PA 3G6JB 5FF6B 4NWTL 1QRNB 2BC4A 3X13A 1CICA 3D85B 3CFKA 4QTHB 4FXGB 4TQEH 1JPSH 3VXUD 12E8H 5ANMA 1NMBH 1JGEA 2DQCH 3QAZB 4H1LA 4ODUB 3R0NA 3QISA 2BRRL 1NAMB 2DM4A 3N1FC 1G7HB 2V7NB 2ADJB 4M7ZC 5DUMH 2YWYA 1R3KA 1AQKL 3KXFA 3UJJL 5SWZE 3I6LE 4WU7A 3RVWD 2P47B 1FZKA 4L3EA 4YHOH 2Y7QB 2QADC 4PJ7B 5F44A 2RR3A 1MFDH 3NABH 4HIXH 2CGRL 3T2NH 3DX9A 5CIPB 3CUPA 4M1CD 4S11A 3GKWL 3L95B 4QHMB 1BIHA 3K74B 3PWNB 1WIOA 5E4EC 4OZGF 1UFUA 1QA9B 1RIVH 5FA3A 1CXIA 1MF2H 1AXSA 2FJGA 2J8UA 2MQ0A 4MX7B 4PJ9D 5HVFB 1HYSD 1T1XA 5B4MD 1MCHA 3UZVB 3T65B 4AENB 3CFJA 2AKRA 2FH8A 1ZANH 2W0FB 3GSVB 5E2JA 3LKQA 4KKCD 3Q0HA 2VN7A 4RGMC 3RAJH 4ZFOL 2NTFB 4BKLB 3QEQA 4Q58C 3HPJB 1U41A 5E2VH 3HLAA 1Q72L 3T4YA 4FG6C 2PKDA 3IDXH 4FXKB 4GO6B 4JY5H 2XA8L 1MCDA 4G8FA 4YDLB 4PJXA 5EU6E 4F3FB 3RX8A 3GMOA 4BZ2L 1QFUH 2V2TA 3FRUB 3VXME 1O5DT 3EOBA 4NQEE 5E95B 1F58L 2HRPH 4P2RD 3BIKB 4UT9L 4OLWL 2B39A 3D87B 4DVRH 4F33B 4JZNB 5DC0A 3CFEA 1FZJB 1I9RL 3FB6A 3VFMB 5HI4D 5D93C 3M8OL 1MVUA 5JMOC 4L4VA 2Y07L 5JORA 2F74A 4LPXA 5IK3A 4U7KA 3LS4L 3C08L 5I30H 2CK0L 3FRPA 1MCFA 4Q74A 4TUJA 1UWXH 1EVUA 4AL8L 1MJ7L 3TA3A 4R3SA 3GB7A 1RUMH 3VXSE 3LB6D 3QQ4A 5JZ7D 1NUDA 5AG9A 5L2KA 1Q9LB 5LJYH 2PYEA 1I7RA 3P0YH 1SJEB 3MRMA 5GRUH 5T1KB 2WMPA 2XXMB 4YBLC 5J6GB 3LKRA 3WFBL 3VWKA 3UJIL 1DQTA 4X8JB 3VA2C 1MVFA 2JJSC 4JM2B 5CZXD 2IPUG 4QRPD 3R8QA 2EYTA 1A2YA 2ORBH 3U1SH 4MMXC 3WIHL 5SWZB 3ARDD 4IEFB 3DX6A 3BP7B 4Z7NF 3QHFL 4LRIA 4Z77B 1T20A 1A14H 3WHXB 3RWEA 1NGPH 5BS0B 4MAYA 5TGBB 1F3DJ 4U1SA 4X6DF 5CIPA 4C56B 3HHRB 1X5KA 2NY6D 5HHVH 3SKUD 1MLBB 1NUGA 2BNQE 5E9DD 4TOYL 4M62H 1AJ7H 1BMGA 2HA1A 4A6YH 3TVMA 2NLJA 1V3MA 4WU7B 4HWUA 4OD3L 2MOVA 1TETH 3KLDA 4JQXA 4CKVX 1KG0B 3D9AH 1KACB 2NNAA 3KPNB 2BJMH 1A7PL 3GM0A 1IT9H 3PWJA 1U92A 3LN4B 2MSPA 2HT2D 4RISL 2F15A 3BOVA 1HSAB 2QQLH 2Y07H 4DZ8A 4R7NA 3QEQE 3BW9A 5D2LB 5DRZA 1WBYB 5FGCE 1S78D 1MRFH 1YPZB 5DGQA 3D2UA 1ACZA 1HE7A 5D7KE 4KI5D 3I2CH 3MGAA 3D3VB 3OB0K 4GBXC 2O26U 2Q8BL 5ICZA 5C6PB 2AQ2A 4MB3A 3PDDA 2Q86B 1YY8A 3BPCB 2BDNL 4MNQB 3THMH 5EO1B 1OSZB 3WD5H 4GW4B 3KPPA 2DDQL 2J12B 4S1SH 3UTTB 1T0MB 4Z7VF 1Y0LB 1VFAB 4B53A 2IH3A 2J6EH 4HIEB 4P4KB 5ABDE 3MLRH 5I66A 5FUOH 1S9WB 3DUUB 3NA4A 2F54A 2NX5A 2E5EA 3RY5A 5C0BD 4YDJA 4V1DB 3IRPX 4RCAA 3IF1A 1P7QA 3O81A 4U7MA 3OXRB 2GSIA 1I8IA 3BD5A 5CILH 2QSCL 3SJVB 2OM5A 3EJYD 3S7GA 1PJ9A 4PJDB 4LAJH 4F7CB 3MV8E 2D03L 5ACZA 2QR0A 5I8KL 1IEAA 3KPQB 2VZ1A 5E2UH 3BVNA 4KK9C 4LP4A 4OTXL 3U7WH 4XNUH 1KOAA 4HQQH 2ATKA 1FNGA 3TO4D 3LRSA 1PEZA 1MCPL 1KC5L 4LCYB 4JM2D 5MERB 1XIWC 3WJJC 2Z8SA 2I9LA 4H8WH 3O3AB 4RGNC 1L4IA 5DA4A 1FRGL 3H7BB 2FX9L 4HPOL 2OL3B 3ALXA 4X5WA 2L0DA 5I16A 4DUVA 1B4JL 5T1LD 2QQLL 1TLKA 3X3FL 3C5JA 3HRPA 4RNRA 3WEXB 1BREA 1IC4L 1KNOB 4PP1C 3KGRA 2OLDA 1G6RH 1J8HA 2X9WA 4NC1E 3C87A 3T1FA 2Z4QB 4ZXBA 4Z76B 3BP6A 2XWBB 4P0DA 3WNMA 4XBEH 1A7NH 3EYUL 4K3EL 5JIHA 3P11L 5DQJA 5ACLA 3S6CA 3KYAA 1FL3A 3IFOB 1FFNA 2ESVE 2HFGL 5EC2A 1UWGH 3S34H 4YDIL 1C08A 1JHTA 1BEYH 2EE3A 3HZVA 4LFHG 4LBEB 3RVXD 1Z3GH 3HS0B 3ULVD 2LU3A 1NCAH 3C8HA 4KJQD 5KVFL 1ACYH 1JPGA 4EI5D 3V95A 5A2IH 4JHAL 3D0VA 2O5ZL 4PRBB 2DQDH 2NNAB 4X6DA 2R23A 3UZQA 3OQ3B 1M6OB 4ZFFA 3HNVL 4I3GA 1UQSA 4PR5A 2WNGA 1QYGL 1NLDH 4NO2B 5D5MB 4F9PA 4WVRA 5F9JB 4Y8AA 1G7MA 1UJ3C 3B5TA 2ZSWB 3B6SB 3FT2A 3UJIH 1MFEH 4N8CL 4NQED 4MWFB 3UTTD 1A1OA 2E9BA 3BD3A 5DJAA 4WUKH 5GZND 5GGRY 4WI6A 3V79C 4OLYL 2GCYA 2P43B 3HAEG 1HZHL 4HQQL 4JDZB 3WUWA 3OR7A 4XVSL 1JPSL 4Y16D 1G6RB 3BZDA 1DLFL 1GSMA 4P2OC 5E1HB 5C3TA 2HN7B 3O3AA 4M4PA 3DVNB 1V3KA 2G9HB 4KKBC 5HHOA 4DCQA 3NCYS 4XPHL 5I66B 1Y6NR 5L8LB 2VQUA 4RDQF 3GMPB 2APBA 2CLRA 4EZMA 2CRZA 3C60C 2BOBA 2NR6C 3O4LA 1VENA 4YDJB 5EU3A 3ROLB 43CAB 3BAEL 5LGHL 4P23C 1P4IH 1KPUB 4XVUD 1JF1A 1MCQA 3L3KB 2AXFB 3FN3A 3SE9L 3JXAA 3MUGA 4K94H 3ROOB 3O6KH 1RPQA 4N90E 5BW7C 2C26A 4YK4C 3D69B 4OZ4A 5DMGD 1TZHB 1KEML 4Y5YB 4PJAB 4OCNC 3IFLL 5E08H 4U2ZA 3V6ZA 1SJEA 2VDRL 1C5DA 3FFCD 1OAXH 3G5XB 2D9CA 3MRDA 3MRMB 4JN1L 4YGAB 4EN3A 4X6DE 1FQ9C 4PJCA 4QRPA 4V1DA 5SWZD 3RIAF 4IRSD 1XF1A 3ZKNC 4FZEL 1DFBH 1PKQA 2AV1B 1HH6B 4PYHA 1ZLVK 2HT2C 4Z7WA 3GJFB 1D6VL 2GHWB 2OQJB 2VABA 1TJHH 1TQCB 1H9VA 5GSVB 2AVGA 5EUKA 3RX5A 1MEXL 3P4MA 2VLRA 1P1ZB 5GGUB 4QRRA 2XA8H 1A3LL 3B9VA 3U30C 3UC0L 4HULB 3MRFB 3DUHA 1X5YA 3E8UL 3JV6B 4JFEE 1D5ZA 4G8EB 5DD0L 1YJDC 2MPAH 1P84J 3WNNA 4P99A 3BH8B 4IIQC 1T22B 3B2UC 4J8RA 4NPYA 1KYOJ 1L7TH 3SDDD 1RFDH 3KJ6L 4Y4FC 1QFPA 5JLZA 2B5IB 3QHTC 4PJDA 6FABL 2WBJA 4KK8D 1OT1A 1LD9A 4FTVA 4PJXB 1AO7A 4S1QL 1FZOA 4TSBL 3TPUA 1XF4A 3AXLB 1Z5LA 3VFGL 5C71A 4TRPL 3BEWA 2AI0L 5DF0A 5FA3B 5I19L 2GY7B 3F58H 3DX8A 1BLNB 3WHXA 5B3NA 4GW5B 2Q76A 3RJQB 4ZUWB 1EO8L 2ZJSH 4TUOB 1WSST 3DYMA 4NWTH 2OL3L 3STZA 2NY1D 3OGOE 2J3SA 1OAZL 3TCXA 1FE8L 4OCLC 5CZKA 1CF8L 5IT2H 5A2LH 4H26A 4FQIL 4LHQB 5IBTH 1DJSA 3EKCA 1S7TA 2V7HA 3BKJL 3P0YL 2HVKA 1I7RB 2NY0B 1W8NA 1CI5A 3LY6A 4YHNB 1FN4B 1LGVA 1JCKA 4FFYH 5TPWH 2WP3T 4LGSB 5C0GB 4WJ5A 3O0RL 2DMKA 3I75A 3QDAA 2E7LA 2W07A 1CR9H 3A6BL 3IGAB 4UDTB 3O45B 3NCBB 1KGCE 2OZ4H 3FN9A 4ZNEE 1E0OB 1FNHA 2MKLC 2NY3C 5J13C 3L3JA 5D70H 3WXVH 1A9EA 3CFBB 1LDPH 1QVOA 3H6JA 1WTGT 3UROR 5C2BL 3VFNA 4ENED 1JGLH 1IVLA 3I9GL 1LVEA 4UQ2B 4UINH 5D1XC 4J6RH 1CBVH 2VLJE 1MLBA 1DTUA 2R4RL 2VDQH 2GK0A 3HG1B 4Y5XA 3HNSL 3QIBA 3VXRE 1DBKL 4H88L 2D7TH 2NXYC 2XNAB 1QZ1A 1KEGH 2DQCL 1U3YA 2VWEE 2AJSL 1OCWH 5F7EL 2P42B 3CCHA 1Q9OB 4Z6AT 2ZWLT 1BIIB 1FIGH 4NGHL 1PLGL 2R9HD 1FNFA 2A6KB 5E94A 4AIZB 2H9GB 4UIKH 2QQKL 3NZHH 4EN3B 2OS7A 1UH3A 2RFXA 1CFVH 3GI9H 2YRLA 4OB5L 4KWUA 3GUTB 3GSRB 1UJ3B 3VFUA 3V4UH 1VFMA 1U8HA 2VDKH 4ODSL 1DBML 2N7BA 3RRQA 2IBBA 1P84K 1NBVH 4LLMB 1A8JH 5DK2B 1TVBB 2VZ3A 3PF2A 4PJBB 2EXWC 5J11C 3OAYK 1Q94B 1R3JA 3WN5A 1TVDA 1BFVH 2WSKA 2J8UE 2DQGH 2QQKH 2I07A 5E6YA 3EOAB 2ITCB 2VDMH 1FPTH 1T04B 4HUVA 3J7HA 5IBTL 1OW0A 4BQCA 1TZIB 1ZHLA 1V05A 4JGJA 5FO9A 5ICXB 2GJ6D 3CZFB 1CR9L 1UVQA 2DICA 1CE6B 5I1DA 4JVUA 1P2CB 1C7TA 4RGOH 1P5UA 3WHE0 4YIQA 4OCRH 1KUMA 5DDHB 5BJTB 3MOBH 3LZFH 5K9QI 1J1OL 3VFSA 2XZAL 4I77L 5IG7A 5I1IL 4B50A 2PYFB 2GK0B 5HYJA 3HB3C 4QWWD 1QR1B 2AJZA 5CP3A 1ZVSA 2QV2A 4M03A 5B22A 4MA3B 4LCCC 1TJGH 2E6JA 1Z9MA 4ZO6A 4HG4K 4ZNEA 5KVGL 4OCRL 3O2WH 3KPOA 5GGTL 2YA2A 4GAYB 3FL7A 1AR2A 4OZHE 1LHZA 3X17A 1C5BL 3K3QA 1CDIA 1DEEA 5HVHC 2LAAA 1U8QB 3S3SA 4MA1B 1U3HC 2QLVB 5MEPA 2FEDD 3X3GH 2F8VA 3IS0X 4U6TA 2W0PA 3OKNB 4X4MA 1AKJD 1X5IA 3UTQA 5DTFA 1NCBH 3EZJB 4FZEH 5KANI 4OIBA 3FO9A 1S7QB 3O6FA 3T09A 2OTPA 4UDUA 1TJGL 3VXMA 2JKXA 4HKBA 2BRQA 2XYCA 3KPRE 4Q97A 4QRSA 5EU6A 1DBMH 4YUEL 1JZ3A 2HAZA 1WUNT 4HX1B 3K4DA 1TPXC 1ZLUH 7FABH 2ZCHH 2BSSA 5B8CA 4HT1L 3MLYL 2P4AB 3L5WB 4J3TA 4JFYA 1QSEA 2VDNH 2GTZB 1CTNA 4TSCH 1EAPB 3NFSH 3FB8A 4F7CA 4S1RL 3WIFB 4LCWE 3DMMA 4Y19B 1II4E 5DRZB 3CDFA 3T2PA 2H3NA 1P4BH 4QNPF 4U6YB 5F88A 5TQ2L 1DANT 3NIDF 5ACMA 1KCUL 4K9EH 4XWOC 1I9IL 1QSED 3MRLB 1NCDH 4M61B 3EW3B 3HR5A 5JXED 4JZJB 4QHKI 2HN7A 1GZPB 4FNLH 4XP5H 4IRJC 4M7LH 5K9JL 1F4YL 1W72B 1YUHA 3H0TA 5I2IB 3UTSD 4PRHA 3Q6GH 4KRPC 1NGXB 4C83A 4KQ3H 3RDTD 1PX3A 5B8CB 1JL8A 1UQSB 1YMMA 2BVPA 4PR5B 3T4AA 1NGZA 4ZDHA 1UM5H 3MFFB 1CGWA 1ZWIB 4ZD3H 3DOSA 1OD9A 1JF5A 5CP7A 4BSVB 4MAYB 5TGBA 4XPHH 2CKBH 4LVNB 5EA0H 2ADIA 4RGMB 1VGKA 1HSBA 1LP9A 1T4KB 4YH6A 5JHDD 3MA7B 1KCSL 4WO4A 3OHXA 5KW9L 3WYRA 3IDNB 3HNTH 1KCVL 2MQ3A 5D2NA 5C9JB 1A1MA 2P5EB 4O02H 4P2QA 2AAVA 4E41B 4NCC1 4ENEC 1V8HA 3G04A 2Q87A 1PY4A 1HHJA 1U8IB 2JB5L 3CXDH 1NDGB 5D70L 3O6KL 1AY1H 1G7LB 4IDLA 2ZUQC 4YO0A 5GS0C 3W9EB 3MRGB 4L3CB 3GMPA 3VI4E 2EIZB 3TT1L 4LF3A 2IH1B 2AJYL 5CWSB 1M7DB 3D39E 1X5FA 3L5XH 4DUWA 4OLYH 4OI9A 1IKFH 1WIPA 2OMNA 1GC1C 4FFZH 3RBSA 2OR8A 2X9XA 1MEXH 5DHYA 4C83B 2UWEF 3FQNB 3HI6H 5ITFA 3QHZL 1B90A 4JN2B 2EDJA 4GJTB 4ODVL 4IDJL 2F54D 2NX5D 4ZS6D 1VB9A 5GRVK 2ICWB 2K3TA 5F70A 3S5LB 3BO8A 5IMOA 4BM7A 4U1IA 3BRDA 2O5ZH 3OXRA 2XFXB 4MXVE 5FGBC 4ZOAA 5D1ZC 5B38A 3EO0B 4MXQC 1RURL 5DYOB 3BDYL 1FL5B 1QYGH 2XG5A 1CFQA 5INCA 4O2EB 4Z7UE 1IEAB 3VFGH 3WJLA 4RBPH 3CX2A 1KIRB 4XX1E 4QHKJ 4TVPE 4CMHC 1IGCH 1DQJB 2OXGA 2V17L 3V7AG 4NUJA 1VKXB 3TWCL 3UYRH 2WW8A 1G6RL 5EOTA 3F12B 2G2RA 4XPAH 1UM6L 3NABL 4HIXL 1DVFB 4D9QE 3BKCL 3FT4B 2FO1A 3ULSA 2WINA 3GIZL 2MPAL 4O58L 4PRPD 3VFNB 3TZVC 3I2CL 4OGAD 4NKDB 2EDNA 2G60H 1QPPA 3EOTL 1KJVA 4GKNA 5GSRB 3S36H 4DEPC 5BS0D 5J4MA 1RZKC 4YR6B 2NY3B 3BFOA 1KGCD 5E8PA 2FSEA 4N0YH 4UILL 2UYLB 3JWOC 3I75B 5JNYA 4YHML 1EHLH 2CLVA 1A6AB 4NKOB 5T33L 5F21B 1D5XA 1YN6B 3FN0H 2E8YA 3LMJL 3LKNA 1MRFL 4QHNB 1AI1H 4AIOA 1OTTC 5BS0A 5K9KA 4QHLB 5ILTH 2HLAB 1T3FA 4LCWB 3VGDA 2QSVA 2YSSA 2A6DB 3B9KC 2Y36H 2GJJA 1WAAE 3BP7A 4GOSA 4OF7A 2AKRB 1RQ5A 2FZ3B 1YQVH 3MOAH 5I1DB 4QT5B 3EYQD 3ARBB 4PJGB 4U1KB 1UZ8A 2ZUWA 4I0KA 4KY1L 1WWBX 4MD5B 3ZE1F 4U1SB 1NFKA 3V4UL 1JV5B 4KPHL 5KSUB 5F6IB 1SY6H 2APVA 5I30L 4MB4A 1B0RB 4FABL 4U1GC 1FNSH 4HAGA 5I74C 3BEWB 4JM4H 4Y1AA 2CO7B 4RDQG 4XX1G 1JGEB 4MNHB 5CUSL 5JXEC 1T0MA 2BK8A 4YNYA 2R2HA 4AQ1B 5FYLL 3Q48A 5ETUB 3AM8A 2Q7YB 5GHWH 5IJKC 4G3YH 3ES6A 1KENH 4UOW1 4PRNA 3RWGA 5DRNB 5JPNA 4XMKH 1RUPH 5J6GA 2XT1B 3DUSB 3FOMA 4DGIH 3VXSB 3CPLA 4O9HH 3WIIL 4K3JH 3OZ9L 3MUHL 3DHJA 1J0HA 3JTSA 4MLIA 4JFED 3OAUL 4L8SC 4WY7L 1TZGL 3D85A 1UJTA 4L9LB 2FH6A 1KC5H 1VEOA 4PJIB 4BYHA 5I75C 4ZAKD 4JPWH 4ZMAT 2UZIL 3O6LL 3IDGB 4FS0A 4L4JA 1MI5E 2H41A 4D8PA 5C08A 3MLXH 3X11A 3WNKA 4AEFA 4TOYH 3ARWA 3TA3D 4CVWA 4Z7WB 4GRWB 3MCG1 5E8OA 4IHOA 3K2MC 1A1NB 2D7NA 5ECJE 4E5XA 3D85D 4OD2B 1TETL 1FZMB 3FQWA 2FBJL 3UTZA 4DK6A 4WFFD 1MLCA 3H42L 4JFPA 1T21A 3VGBA 3BIKA 1F4HA 4EKXA 4NQEB 3C5ZC 2Y06L 4M6ML 4Z9KB 4X6EB 3MV7A 5DD3H 4LLQB 5D72H 1FN4A 3VFTA 1CQYA 3L3IA 1MCEA 2FJGB 2J8UB 4U1MA 2Q8AL 5IR1A 4RRPA 1OAKH 3EYOA 3GMRA 3I84A 4FQQB 4PTUB 3L95A 3DYPA 4KI5C 3V52H 1DSFH 4LASH 3D1MC 5D7LB 2Q6WB 3GKZA 4WWKA 2X4NA 4JRXE 4X6CB 5TDOA 5TQ0H 3LPFA 3FO0L 4GRLD 1EVTC 2ICWI 4I3SL 1A47A 1K6QH 5KZCB 4QHUA 4U1LA 1N6VA 3T0XA