2EDBA

Solution structure of the fourth fibronectin type iii domain of human netrin receptor dcc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
b'GSSGSSGPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin receptor DCC
molecule tags Apoptosis
source organism Homo sapiens
publication title Solution structure of the fourth fibronectin type III domain of human Netrin receptor DCC
rcsb
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edbA01
5GRZA 1FDLH 1YYMH 2XTLA 4E5XB 4GAGH 2D4DA 1HIMH 5SV4A 4X7FC 3ABZA 5EU5A 1OAKL 4KKAC 1IGIL 3QUYC 4MA7H 5EU3B 3ALWA 2CRZA 1H3TA 1I1YA 4JKPL 4KJPD 4AEEA 1JWSA 2XWTA 4UBDC 4Z9KB 3DO3A 4PBXA 1L0XA 2FJFB 1GVIA 1JFQH 4ZQKB 4XCYB 1I9RH 1PZ5B 1OARL 4CVXA 5GGUA 1FNSH 3NACH 2X70A 2ENSA 1PX3A 1DQDL 4GBXC 1F42A 2IEPA 3FN3A 2DTSA 5SWSB 5IJKA 5J0BA 2ARWA 3T8XA 2Z92B 2EE9A 2QL1A 1A1OA 2J6EA 3N1FC 3OSKA 4X0KA 5DRXA 2OK0L 4U1NA 1KC5H 5F9AC 2VLKD 3P4OA 4FFZL 1MH5A 4RGNB 2PYED 1Z9MA 1RVFL 2EO1A 1SM3H 3WKMH 3MLRH 3GBLA 4IRJC 2AGJL 2VABB 2DWDB 4AY0A 5GGQH 1QSFE 3PJSA 2QTEA 4NRYB 4LARL 3PWVB 4OSUL 4M00A 1T04B 1VENA 1I1FA 4JGJA 1SEQH 2YK1L 3HE7D 4NOFA 3L3HA 4WNQA 3M17B 2BRRH 1F2QA 3BMWA 4XXDB 1YZZA 1N0XH 1CD8A 2EDHA 1IM3B 4TVPL 1DE4A 2P42B 1L7TL 1M7XA 4MWFA 1RJZB 1XEDA 4LKXB 5EOQL 5DD0H 3MA9L 1KACB 4OLYH 4BFBD 3O6FA 3P4OB 5CP7B 1SEBB 4MQTB 4JHWH 1B2WL 2J88L 1FGNH 5FYLH 5FA3A 4FQ1L 2YMXL 3RVTD 3X11B 3FQNA 4JN1L 4BM7A 4LPUA 4C58B 4CMHB 3O45A 3NN8B 5A16A 3ULUE 5E0QA 2C3GA 3DTXB 4OF7A 2XY2A 3KJ4B 4ZSOE 2GFBA 3CFCH 2IAMA 2E9WA 1Q1JL 3P9MA 4YDVB 3H9YA 2CGRH 3W9DA 4YQXH 2ADIB 4M6AA 5FHBH 2J5LB 2XQYK 4Z7NE 3SE9H 5EZJA 2BVOA 1KPVB 3E8UH 3W11C 1EHLH 3WEXA 1B9ZA 3K8KA 1U8KA 5I0DA 4P57B 1C5DB 2DQFB 3GMOA 1JUFB 3EO0A 4LSDA 5TJWK 3SDXF 1MIMH 1BP3B 5HDQH 5FYKD 5JR1L 3O4LD 3TH3T 3LKNA 5GGVL 1HSAA 2P1YA 1U6AH 4GG8B 4Z5RB 1ZGLM 3QO1B 5LCVL 4JPKH 4WDIB 1S7WB 5A2FA 4DVBA 1MCFA 1IAIH 1KTLA 2G9HB 2VISA 3U36A 1MIML 4LHUG 4YEEA 1V7NH 1BQLL 2FD6H 2WUBL 5CD5C 2PR4L 3DIFA 4UV4L 3KPLB 1U8KB 5JW4Q 5TH2B 2CDEB 3GNML 4LHUD 4WCYL 2OX5A 4I13B 3FHQA 4PJCB 3MV8E 5EBLA 3T1WA 1NPUA 4ZYKA 5MEQB 3VFRB 1EHNA 3CXDL 5EORL 2R4SH 1EAPA 3HI6L 3K2MC 4J4PC 4QRPE 1AJ7L 2AJYL 3GBNL 4NIKB 4L8SC 3LMJL 1WIUA 2DICA 4I3RH 3TFKC 4UIMB 4MJ5B 1PLGL 2A6JA 5D6DC 4LAJH 3FQWA 4MJIA 5IOPA 1ZHLA 3MRCA 4I2XA 4X5WA 3GBMH 3RA7H 4MJ2A 3VXPA 4ZSOB 2IQ9H 5E8EB 4YFLF 3MRDB 5DWUH 1A6VL 1FPTH 1LE9A 1QPPA 3FL7A 2OTUA 4R90H 1HE7A 4LVOC 2H26B 3HUJF 2FNBA 1QYGH 2FYYB 1T22A 3B6SA 3QI9D 3UTQB 1SJEA 1C08A 3ARDB 2DQCL 4HIJA 3CPLA 4EI6B 4NZDA 3B9KD 5DVOA 4FQIH 5B3JE 2AXGB 5E5UB 3QUXC 1HK6A 4OLZH 3L3HB 2IGFL 1UH2A 4MJIB 3RWDA 3V4PL 1FIEA 1UKQA 4YBLB 1S78C 1BFOB 3TVMB 2A6DA 5IMLA 5HYJA 4OIIH 4NQDD 4JPWH 1QRNE 1JI1A 1BIIB 2AGJH 4LLWB 3Q3GA 4KV5F 1JYXA 1GC1H 1DLFL 4XNYH 2CSPA 1F3JB 3WO4C 1A5FH 4O5LH 4XBPA 5IQ9A 1IC5L 2C9AA 4JKKA 1BLNB 1E4KC 1KN4L 3QZWG 5D7JA 1X4ZA 1NSNH 2ADJB 5DD1L 5ALCL 2MMXA 3V5KA 2FJFA 1JHKH 4TUJA 3RAJH 3V5KB 3L6FB 2R4RL 1NKOA 3GI8L 1FQ9C 2OQJA 1EHAA 4XHJC 1UM5H 2B39A 4URTB 1XF2A 1M4KA 5MHSD 4L8BA 1Y18B 4E41B 1I1CA 4XCYA 1MCPH 5EWIH 2AXHA 3IDIB 3TN0C 4XBEH 5I1GL 4GRMA 1ACYL 4MNHB 4R97C 2ESVB 3CFDB 3WL9B 3LKRA 5K93A 3WNLA 2L7JA 4KMTL 4R97B 3V9FA 5IHUL 5F9JB 4WHCA 4P57A 4RFNB 2CKBL 2E27L 2EC9U 5DK2A 2DQTL 1OTSD 3PWPB 4UTBL 3H0TB 1MLCB 5AUMA 4PREB 3SGKC 4ZFOL 4LF3B 4NQDE 5KSBB 3E6FA 1JYVA 3T4YB 1R3LA 2QSQA 1E6OH 2AXJA 2F53D 4PJHA 1FIGH 1OD7A 1UQSB 2F74A 3UTOA 5JXEA 2IAMD 3BDYL 4Y2OA 5AD0A 3M8OL 4MJ6B 1RFDH 5C09B 5C0DB 4KZDL 1W0VB 4WI9A 5LXGL 5HYFA 3IETA 2AV7A 3NIDF 4UIMA 1IE5A 4X83A 2EDRA 2R8SL 2W0LA 3TYFA 2L4OA 3NCFB 4KQ4L 3BGMB 2EIBA 2HJKA 4K23L 4M3KB 4ODVH 1QLEL 2D7TL 3RUGB 4JB9L 4Y5VA 4XVSL 4LP4A 1NMBH 2VOTA 3CSPA 2A0LD 1D9KC 3ZDXE 3RIAF 3SDYH 5IBLD 1QSVA 3PWLA 3K4ZA 4P5MB 2B1AH 4PGZA 1T04A 4QRRA 4FQLL 4I0CC 2VN4A 4K8RL 5CUSL 4HPOL 4KY1H 5D4QA 5SWZD 3MZTA 4YXLH 3RTQA 3UPRB 1AJ7H 4XXDA 3C6LA 2W0PA 1IC7H 1KN2H 4LP5A 1QA9B 1X44A 3BE1H 2A0LC 2FATL 4FTVE 5H94B 2IALB 4YHNA 1HEZA 3SE4A 1R5WA 2DQUH 2X89A 3EDFA 1RZ7L 3EYSH 5F9OH 1HKLL 4PJHF 4FFZH 2YD6A 1MQKL 4NZTL 2NXYC 3FT2B 2W60A 1SM3L 4RFEA 5KW9H 5FDWA 2Y07H 3UBXB 1Q9WA 4OCXL 4WGWB 5GGQL 5CJOH 4Q9CA 1CDGA 1DJSA 2VDOL 3CSBA 3OR6B 1U8OB 3MBXH 1AR2A 2VLJE 4CDHA 3ARSA 1WC7A 1ZEAH 5F71A 1FLRL 4WFHD 5CS7A 4DN3H 1X5ZA 3U7AA 4PIRF 3GJEB 5F3HA 5FA3B 1DL7L 4X7TA 5AG8A 4OZIE 1UWGL 1Q0YH 1LO2H 1FGNL 5A16B 4XVUC 1JN6A 5DT1L 5F1NA 4OFPA 1IC4H 3MBED 1NL0L 2VDQH 2Z0BA 3DETC 3VW3L 4Q97A 1KIRB 5E24E 3C08H 3VXUE 1D5XA 1YA5A 5D96B 4HUVB 4BSWA 4YHKL 2XQBH 3LS4L 4L4VA 1JNHB 5HYJE 2CLRB 4JREB 4O2FA 1YN6B 4Y19A 1GL4B 5E56A 4HWBH 4JZJC 4NQEB 1S9KC 5HVGB 1MFDH 4JM2A 4OZ4B 3VGAB 4PR5B 4R3SB 1C5BL 3HE6C 2HRLA 3DETD 2HP4A 1F3DH 3ARBA 4LQFL 1T66D 3SGDH 4RMQA 2OMBA 1H3VA 4P2CG 5C0BB 5JIIA 1OSZA 2WBJA 1EHLL 2KZ1B 4R9HA 1LEGB 3CLEH 3MRNA 4Y1AA 3TA3C 1G9ML 1QBML 4PG9B 5L2JA 5JHDD 5JIPA 5A2LH 3RL2A 4H88H 1UFUA 2PETA 1OY3B 1MHPL 3S35H 5LGHH 4KVNH 3H2WA 3TIDB 1T1ZA 3W2DH 1G9MH 1FNLA 4OKDA 4LRNH 1V7NL 4WI7A 5IB3A 4HUXB 1YEKL 1ORQA 4IRJB 3S35L 3SDDB 5I1KL 4HC1A 3VDAA 3QRFM 4JFPA 4G9DB 4BQBA 3Q6FB 4H25A 1YY8B 1JGVL 5JXED 3QB7C 1AGEB 1EAPB 4FQ2H 5K9JH 4EUPA 2BX5A 5H2BB 5TGBB 2GK0B 4PJIB 5E2WH 5L88L 4EDXA 3HR5B 3BH8A 2GJ6D 4BKLA 3SCMC 4YHNB 3RNQA 5GZNC 1RUAL 5F6IC 3DUSB 5EZLB 4XBPB 1UG9A 1FZOA 1A9EA 4JDVA 1QHOA 4NDMB 3C5JA 1MRDL 4YDKL 5JZ7C 2FSEB 1CL7L 4TVSa 4M7JL 4OLXL 1OVZA 2V2WA 4LLQB 4RA0C 3ZHKA 2FATH 2FO4A 2VDRH 4PRAA 3AC0A 2G60L 1IQDB 2DTMH 3T04D 4K3DL 4YXKH 5C0EB 1FC2D 3NAAL 2IPTL 1AHWC 1UA6L 5H2BA 2APVA 3MCKA 3FCTA 4LCWE 3FOLA 3DYOA 3CDCA 2I9TB 3JSSA 3TCLB 3TBTB 1Y6NR 3AMLA 3QDMA 5KSVB 2FL5B 2GI7A 4OF8A 4ODTH 1MHHA 1O0VA 1HHHB 2IMNA 3L3GB 4UDTB 3RWIB 4RGNC 2NX5D 2EKSA 3DXAA 4FQQA 3DMMD 3MBXL 4Z78B 2XKNA 5E6YA 4XNYL 4QNPF 1NBZB 1X6NA 4Q9QL 2CMRL 4OLVH 5I75C 1BWWA 1XZ0A 4I18B 1Q9OB 4XPHH 3C5ZA 1RUKH 3N1QC 3DO7A 3WIHA 2DJ4A 5C7XH 3K81A 1NKRA 1G0DA 1HH6A 1KLFA 3EGSB 5BW7A 5A3IC 4HPYL 3CFEB 1U8PB 3BPOC 1VA9A 5IW1A 1B0RB 5DUMH 3SQOH 3EKCA 4G9FA 4HGKC 3TBTA 4B41A 2YOCA 4NO2A 4CMMB 3VG9C 5IGXH 3TT3H 4Y4KD 5ICYA 5B38B 4JQXA 4OI7A 3FT3A 2Y7QB 3HZVA 5FCSH 4QXTB 1AD9B 5E1HB 1HHGB 1D7FA 3LQAC 4G8FB 1YC8A 5JDSB 1J1XL 2D03L 4KROB 3MXWH 4Z5RA 1IAMA 4EUPH 1QTYT 1QSEB 2FEEL 3K0WA 2JJVA 2YWZA 5L0QC 1NUNB 4JPVH 4NO3A 2OXGA 1R24B 1FFRA 1K8IB 5ITFB 1KULA 1MCNA 2R2HB 4C55A 5FF6A 3U6RA 4KI5E 4JANA 3D18A 2H32H 3IDNB 2PTVA 2R0KH 1OTTC 2DOCA 4F7EA 1QRNB 4E0RA 1WBZA 5IR1A 3EO1B 2BNQE 3SE4C 5D8JH 5JW3L 2ARJQ 1LHZA 4HGWA 5A3ID 3SEPA 3SN6N 3X3FL 4AQOA 5FDWB 2X1OA 5HBBA 1A7OL 2HLAA 1YJDL 4OZGF 4V2BA 1AGDB 4Z7VB 1AFVH 3H7BB 4POUB 1FN4A 2XI9A 3IF1A 5E7FA 3O41B 2F58H 3OF6A 4Z7QF 1K8IA 1INEH 4HS3A 4B53A 5DI8B 3MZGB 1RMFH 2SEBB 5KG9B 1SJEB 2YSSB 1L9NA 4Z95L 5D1ZD 4V2CB 2BVEA 4AJ0A 1WWWX 2BNRD 1DQLH 3GIZL 3S4SG 3IFNH 1UH3A 3M1BA 4OB5L 4YZFF 1NC4B 3VGEA 1II4E 2OSLB 2YD9A 1UZ8A 1DANU 1F11A 2RJMA 4FRWA 4KMLB 1BFOA 5GIRA 1I7UB 4XPGH 2VXVL 5C07B 5ETUA 3LVEA 1OSZB 5CP3H 1BBJA 5D2LB 4FFVD 3QEUA 2R56L 4X4MA 4YGVA 3MRLB 4GW5B 3L9RB 4Z7OE 2IGFH 5EN2A 3L7EB 2J3SA 4KI5D 1I9JL 3RRQA 1N5AB 3MRDA 4E42B 3HG1A 43C9B 1NMAH 2X4RB 4HIEB 1B88A 3G6JF 1GC1L 3MLWL 3JWDL 4O2FB 5GJTH 1G6RH 3I2CL 12E8H 1NC2A 4G8IB 4XMKH 4MD4B 2Z35B 3ARDC 2DIJA 7CGTA 3U9PL 5F1IB 1H3UA 4JM2C 4XNXL 1NSNL 3QUKB 3NOIA 5J11C 5KAQG 1PYWB 1ZLSL 2NTFA 3RJQB 3GJFK 1G7LB 4QHKI 3GSVB 2FJHB 2K7QA 1HCVA 4QOKB 1V05A 2NMSA 5GGUB 5JHDB 1IGYB 2R2BB 1CQKA 2C3WA 3U9PH 2OJZL 3MV7E 4FXKA 2ZOLA 4EQ2A 3FO0H 3DI2B 4YHIA 1Z3GL 4RZCB 2PYEA 4OBRA 4YGAB 4BKLB 2Z4QB 4EXKA 4GXUN 3LDBC 4LPVA 3C60D 3BJLA 1R3LB 3GSUA 1KUMA 4Q2ZB 1FZOB 3GHBL 2DQTH 2Y6SC 2FO4B 4PJIF 4U6VL 4PJEB 1J8HE 1P4BH 3GSOB 1UWEL 1AQDB 1UYWH 4LNRA 1CI5A 1FVCB 3D18B 4XVTL 5DO2D 3VGHA 1CL7I 4I77L 1QLFB 1ND0A 4D9LH 5ALBH 3VFSA 4BH8A 2YPLD 3SGDI 2R29L 1FYTA 4U05A 4GUPA 2VLJB 1MY5A 4W6XB 2VIRB 1FLTX 5E8PB 2CIIB 4OFDA 1E6JH 4G7VH 1NAMB 2OXHA 3B3IB 3BPCB 3QT2A 2AK1H 2PCPA 2X9XA 1CFSB 5C0BE 4IRJA 2ITCB 3FFCD 1IT9H 5MEPB 2QEJA 5F7LB 5GS1B 3HPJB 4NHUA 3WCYA 2YD5A 4JJ5A 4C56E 3C6LC 5FCUL 3LQAH 2ZUSA 3HA0A 3RZWA 1F8TH 4NO2B 2W92A 1Z0MA 4JZNB 1JMXA 1B2WH 2JJTC 2DLFH 2A38A 4I0PD 5ESAB 4X9IA 3OKLA 1YJDH 1DVFD 4ZFOB 2EO9A 4U3XA 4D9QE 4QT5A 1T1XB 3RUGF 4RQQB 2OSLA 5AEAA 1S7SB 1FH5H 1UXWB 3FZUD 2XRAL 5D5ME 4U7MA 5HHOD 3ME0A 4WEBL 4J3WA 4FQCH 3RWFA 1JZ7A 2YUWA 3IJHA 5ICZB 2DYPA 1NBYA 4YQXL 1AO7B 1XCTB 3RGVA 1MPAH 2XN9A 4PJ8B 3IDGA 2FCBA 1WJ3A 3VRLE 1DUZA 2W9DL 3FRUA 1JIBA 4FHBD 3WDJA 3OB0K 1S9VA 4L3EE 4Y4KB 4HC1L 4JANB 1U3YA 1UA6H 5I1LB 3K8MA 2JIXD 4K3DH 1KC5L 5F1SA 4KHXL 3U6RB 4KXZH 5C9KA 4ZOBA 4WTZA 3NFNA 4JFOB 1JZ3A 2JJUA 3W0WE 5KBNC 3H8NA 2EDJA 1INQB 43CAB 1JN6B 2BY3A 3GMMA 3N1PC 2WIIA 2K3TA 5CILH 4JQXC 4XX1G 3EZ8A 2WIIB 3RY4A 3ULUC 4CAGA 4TULL 3KXFE 1WEJH 3S5LA 2I07B 1J18A 3F12B 3HKFA 3TYGH 3A6BL 1YEJL 2HT4C 4KH2A 5I8KL 5EA0L 3RU8L 1VGEL 1FC1A 1IGTB 4ZO9A 3LB6C 4KK9D 2IFFH 4Y4KA 3P0YH 4DW2H 1KB9K 3DRTB 4NNXB 3P4MB 4MAUH 4RIRA 1T1WA 3ZYIA 3HZYB 4WENB 2WLYA 2VXQL 1AD9A 2GHWB 3NA9H 1JTOA 3MRHA 3WS3B 1NCAL 3NCMA 1NMCC 2GAZB 2E9IA 4MA3B 5K9KB 2OK0H 4KTDH 4V1DA 3AREC 4ENED 2YN3A 4ZAKB 3FB7A 5DFTA 3NFPB 5FXCH 1G9NL 3PP3K 5C2BH 5D1ZB 1J8KA 4JREC 5D1ZA 5CGYC 3VWKC 1ZE3C 1KT2B 4L4TA 4Z7UE 5D1ZC 1VACB 4ZFZB 5TDNA 5KJRL 3I84A 3P0VL 1AR1C 5C07D 1EMTL 2Z35A 1RK0A 3BP6B 3TO2B 3L3IA 4UT9H 1A7RL 2B1HL 2WBJB 4PJCA 5TQ0L 3L95B 5GGVH 2N7AA 2VZ1A 2WNGA 5EBMB 4ZXBC 4MA3A 1KCSH 3W0WD 5IVOA 3TA3B 3MLPA 5JO5A 3W81A 4P49A 1INDL 1MCEA 1QO3B 3G5ZB 4QHNB 4AQ1B 3ZT5A 1I3GH 2EDDA 4U1SA 4YXLL 1AI1L 4P2RD 3PL6D 3A6CL 3P77A 4OKVB 1MJJB 3ORJA 5IVZA 5E6ZA 1ZT4A 4I9WE 1IAIM 5EIIA 1KCSL 3HCVB 4LF3A 3EO9L 3DX6A 5CGMA 3JTSA 1NEZG 1XGRA 4XP4H 2HVJA 1TNNA 2CIKA 2A77L 5IBUB 5DEGA 1Y18A 2F15A 1YY8A 2A9MH 1L6XA 3L3JA 3MJ9L 3IDUA 1JRHH 2Y9RT 3W9DB 1CFQB 4J1UB 5IEHB 2NZ9D 3HZKB 5CJQH 5INCB 2M26A 3C60B 4OF0A 2X10A 1S7XA 4Z7VF 2VZOA 1I7ZA 5C1MB 5BRZD 4P9HL 3DGGA 4WUUB 4K3EL 3CX5K 5EIIB 1OP5K 3O8XA 2CXGA 2OJEA 3QH3A 4AT6B 3IXAB 4HMEA 1Z9LA 2OI9C 1S3KH 1DBBH 1MWAA 1HHJA 4N0UE 5JDSA 1DQMH 4P5TC 1X5KA 1MVFA 3BSZH 4TUJB 3U1SL 1QPXA 2X09A 4BH7B 1H0DA 5DT1H 1Y6MR 2AV1A 2DBLH 2YPLB 1F5WA 2P5WE 3H9HA 1T20A 3IFOB 5L2KE 1P7QA 3WN5B 3VW3H 2C4XA 4FFWD 1DQQB 1ZWIA 2IBZY 1WSST 1CXIA 1JF5A 4H20H 1IGJA 1Z0NA 2QSVA 2WWMD 1S7SA 3RIAK 3MOBL 5IB1A 2J8UA 4OZGB 4HS8L 2WIMA 1DQDH 4ZFOA 1JPFB 4OGYH 2I26N 5BS0B 2PO6A 3FFCB 3HAEB 2EYTA 1A2YA 5ESQB 4F9LA 4JO1H 3G6JB 1GHFL 3TPUB 5C0FA 2V7NA 1CIDA 5GS0H 3T0WA 4KHTH 2C1OB 5SX5H 4U6VH 2WK2A 3P9LA 4ZAKA 1HKFA 2HG5B 3GIVA 3LSOA 3MNVA 4NQTA 2KZWA 4PUBH 3VFMA 4H1LH 3IAQA 4XCCH 3RVXC 4XWOD 5BZWA 5GRYA 5DI8A 1PZ5A 5DD3H 3LZFL 1HKLH 4U1NB 4ZS7H 5C09A 5IMKB 4XCFH 2DBJA 3C9NA 2JCCF 5IFHH 1NGXA 1QEWA 5J7CC 4U6XB 4X7TB 2VLJA 3U2SA 4U1KA 2EECA 5FYLE 1GRWA 4KTEH 4R4FL 5ITBH 1OTTD 4KROC 2PYFA 5GRWA 4OLWH 3U36B 3QIUC 2UWEE 2P8LA 5SWQB 1FHGA 1J87A 2R1YA 2JELL 4ZNEA 1DN2A 5BO1H 1UVQA 2MKLC 3MJ6A 3JTSB 5EU6A 3RZCA 5DHVH 1CGWA 3TF7C 4MCYA 4O2EA 1MAML 3IDJA 4V1DE 1QP1A 2EKJA 3IDJB 3T0EA 2IALA 3QJFA 3RPIB 1SY6L 1CWVA 4ZUWB 4G6ML 3QJFB 2WBKA 4PJFF 3TBWB 4FA8A 4BUHA 2FB4L 5J4MA 4TPRH 4RBPH 1VFUA 4HUNB 2R39A 1F4HA 5JA8B 3L5XH 1S5IH 2PN5A 5D7KE 4XAWL 1P4LB 4CL7A 2R0WL 4DKAA 4P4KC 4WEBH 5I1JL 3V4VH 1U36A 4GKSA 4NCC1 1RZFL 2EC8A 2BHZA 3QQ9C 3MXVH 1IAII 4BK5A 2DS4A 3OV6A 3PG2A 5MEOB 1IM9D 1S5IL 1RUPH 1IEBB 1F4XL 4NYLA 1S7UA 3IJHB 4GG6E 1S9VB 1VACA 1MFBL 4ZFZA 3W82A 1RK1B 3T3ME 4PP2A 1NEZB 3EOBA 3OB8A 4X99A 4YDVA 1S9XB 1S9XA 1X4XA 4XGZB 4TNWF 2NY4D 1WCBA 1J11A 2RGSA 3KYOA 2MFNA 5LAXB 4HG4J 4Y1AD 3V6OE 4ZUSA 5JLZB 2ZNWA 2VN7A 1G7PA 2FDBP 2JJSA 1B4JL 1D5IL 1CE6A 1N0XL 4W4NA 3L7EA 4BZ2L 4TVPE 5T1KA 4KJQD 1RJYB 3L5JA 4P2QB 3VI4E 5BS0A 3VA6A 5KVGH 3NCCB 3KLDA 1T7VA 3O3EA 2BNQB 1Z5LA 1OF2A 5E5RB 4EI5C 1MF2L 5B3JF 5IMOA 1K2DA 1KJ2H 4H0HB 4O51A 4F57L 4BZ2H 1QRKA 2Y72A 1OGAE 3KPNB 2WBJD 1WFOA 4KDTA 5C08E 1UH4A 1E28A 2LQRA 1VFBB 1CTOA 4YHPB 1Q72H 1IGTA 1N8ZA 1DQTA 2V17H 3BZFB 1UB5A 1CLYL 3FB5B 5J12B 2Z93B 3FQXA 3P0YL 3QEQE 3JV4B 3SKMA 1A6ZB 3UTSA 4NQSB 3TLRA 3MO1A 4TQEH 4C57C 1HI6A 4FQHA 4XCEA 2UV3A 2MCG1 4NHCL 4NC1C 1HYSC 3BHBA 1AGBA 5EPMB 4GUPB 5FUZH 1UKTA 3QUZC 5DZNA 2P47B 3IDYC 4YJZL 1BIHA 3QEHA 3I3BA 5I76A 3S35X 2FEDC 1U2CA 2WINA 1PY9A 2X1QA 4NP4L 3GSUB 4U6XA 4Y8DC 3IDYB 4G42B 4YE4H 2YD3A 2AQ1A 2GTWA 2C7UA 5ID0B 2NY5L 1YUHB 4HULB 1LO3H 4KJQC 5JOFB 5GS3A 3BZFA 1BFVL 1KXQE 3G5YB 4PV8B 1BVZA 2DQJH 1UC6A 2VKWA 3AGVA 4F37F 1GGIH 3QDME 4WRLA 5GJSL 3W11D 2Y1VA 4W4OC 1J5OL 1JPSH 1VDGA 2YMXH 1QFWM 3BJ91 3B8SA 3MC0A 4OCWL 3U4EB 5D9SA 4LLWA 5SWSD 4JZNA 1IQWL 2GYSA 2NPLX 3KYAA 3VMOA 4NN7B 2PW2B 3UO1H 1CGVA 2YPKA 1R5WB 1OP9A 2R4SL 3HI6H 1U95A 5DDHB 1HDMB 1RZJC 3FAWA 3HAEA 2EYSA 4XBEL 5DC0A 3EDDA 3QXAA 2EIEA 4HQQH 5DTFB 1MCWM 4Y2DB 3P73B 3MV7D 3G5ZA 3EOTL 3ULVH 4WFGD 3BDXA 2BRQA 3F7VA 5IQ7L 2G2RA 4Y4FC 1FG9C 4TPRL 1JL8A 1RIVL 2NR6D 3O3UN 2AV1B 5MERB 3STZB 1OLZA 3HN3A 4WUKL 3MFFA 1ITCA 3ZKXB 2BHUA 4A2LA 1UXSA 3VXRB 5IHZA 1NMAL 32C2A 3INUL 2IADA 1CR9H 4Z76B 4QTHA 2FHFA 2WUCL 4JN2B 2XTJD 4UAOB 3SE9L 4JZOA 1NBZA 2XWBA 3QWRD 4PRHD 5LWYH 3EUUA 1DLHA 1L7IH 3VFUA 4PLKD 4L3ED 2D7QA 2EKSB 2GAZA 2VISB 1DBBL 5C0RH 2HFGH 2J1KA 4HV8A 4YXKL 4MJ6A 1TZGH 2H41A 5IFJB 1A3LL 3WNPA 2JK5B 1S3KL 3LN4A 4ZAKC 4DZ8A 5LGJB 1I9IL 3CLFH 1U8QB 1X5LA 1KLGB 2ZUYA 3FTGB 3VFTA 4PRID 1A22B 2V9RA 5DJDB 5C0IB 3DRTA 1JHKL 1JZ4A 4LSSH 5BZDB 3T2OA 2BVOB 4ZUWA 4F7CA 3NIDE 3L3DB 3WEXB 3D85B 3PV7A 4CVXB 2EDBA 3MQIA 2QQKL 1VKXB 1IEHA 1T0NB 5EBWB 3R8QA 4U1KB 3ARGB 5K9OA 1OAKH 5ERWA 3VFPA 1DANT 1Y0LA 4OLEA 5BVJA 3H9SD 4NN5B 3BPLC 3VJ6A 4DK6A 3ROLB 1U3ZA 3VRLF 3GDBA 5CEZD 3BPLB 9CGTA 2HTKD 3LKPA 3NFSH 4HIEA 1BQHB 1G9NC 3G08A 4FTVD 4NJAL 4LSVH 3IFNL 1XR8A 4MDJA 5BV7L 5H35B 4OCXH 5FYJL 3IYLW 4X4ME 2YWYA 5ANMB 1CLOL 3BEWA 5BOZG 2NXZC 3OAUL 4JO3H 4NOBA 1DBKH 1KFAH 3B43A 3VRIA 2APXA 1K3IA 2V7HA 4HS6A 1XH3B 1FFNA 3QJHA 4OZHF 3ULVF 1F11B 1WAAF 5BRZE 1OGAA 2PXYB 2XICA 4HJ0C 2H8PA 2AEWA 2L7UA 2IH1B 3T1FA 2J2ZA 2LV4A 4GRLD 4DCQB 3WNNA 1I1AA 4MVBD 3TFKD 4P4KA 3KYNB 5IK3B 4OI9A 1LO2L 1AXTH 4FQJH 1T22B 1DSFH 1OPGL 4WFHE 1JGDB 1TCRB 2A74A 3EDKA 3MV9A 2YSSA 2P8PB 1WIOA 1JMZA 3SBWC 5FYKU 3O3AB 3UTQA 4Z78A 4JO2L 2O61B 3TCXA 3VFWB 5MENE 2H26A 1QR4A 5GRJH 5JPNA 4NZJA 1ZLUK 5EOTA 1KCUH 2CJUH 1PKQB 2Q76A 1CGTA 3OKDA 4ZUUA 2FLBT 4P2QD 2IH1A 4DWHA 4G6MH 5HGAA 4GRWF 1V3JA 5DRNA 4G6KH 3NZHL 1TETL 3CFDA 2VO5A 3P4NA 1NDMB 4LBEA 5F3HB 1I8KB 1FSKB 2EH7H 1T21A 3O2WL 3NH7L 1N6UA 5E2UH 4K55A 4S0TD 2WWKO 4KRPD 2NXZD 5DMYA 1I8LA 3EYSL 4YK4B 2FSEA 1N6QL 1VEPA 4JM2F 3S4SB 1FAKT 1R3IL 5D1QB 4DEPC 4YX2H 4GG6A 3R1GH 3D2UA 5GISL 3MRKB 4KHXH 4E41A 3QRGH 1W0WB 3MLUL 5GSVA 1NCTA 3IFLH 5I9QC 3QNXA 1NGPL 4LNRB 2XT1B 1SJVA 3EJJX 3BPNC 3PABA 1D3CA 3V6FB 4ODVL 5IVXB 4YNYB 5CSZB 2D0GA 3OKKA 1HN1A 3TBSB 4Z7WB 5F44A 4RRPA 5DMKB 4CJ1A 2ESVD 3VG0L 4RGND 2PYEB 3TYGL 1EO5A 4WTXA 3BKCH 2PO6C 4YEFA 1JGVH 3ARTA 5KVEL 4NWUL 3D5OF 3FHAA 4YHYB 3LH2L 4HXAL 4XRCA 3TNMA 1KTKE 2NW2A 1CFNA 3P9MB 1ZA3A 4WJ5A 3U2SB 4OGYL 3AVEA 4PJ5A 4LSRH 3MLSH 4OZIA 2YA1A 5C0NC 6FABL 3BKCL 5DK0A 3VMNA 4DZBB 3FT4A 3HAEH 3LSOB 5KVEH 2YZ1A 2HG5A 1QLEH 3PGCA 4JCLA 2DLGA 2P43B 4BQ6A 3GRWL 3WLBA 1MIEH 3OGCA 3V7AG 5GZOD 3RNKA 1RPQA 4CKVX 1MQKH 4NZTH 4OV6F 1E4XI 5EO9A 1GZQB 1WIPA 5L8JB 1AY1L 1MFAH 4N1CA 3MYJA 3FO0L 2DDQL 1UXSB 4PJAA 5I19L 3GRWH 2WP3O 1HDMA 2ICWI 1EA9C 1RIHL 4Q7DA 5CJ8A 5E9DD 3PDOA 5I71C 3BN9C 2V7NB 5E8PA 3I75B 4FXLA 4HKBB 1JNNL 2XWJB 4JG0L 3HRZA 1FLRH 3K1DA 3MRLA 2W9DH 4GAJH 1YEDA 4FFYL 2ORBL 4WFED 4ELMA 2WANA 4HCRH 5KS9A 3MLWH 1FP5A 4NRYA 3NVQA 3VXRD 1DBMH 2V2WB 1YEIH 4AZ8A 4LK4A 4LASL 3ULUH 1X5IA 4OCWH 1W72A 4Z7OF 4Y16C 1GGIL 1WBXB 1AKJB 4NJ9H 1T03L 4PB0L 2ZWLT 1LEKA 4PRHB 5B39A 5DQ9B 4NSKA 4L3EB 2VDMH 4WO4D 1CFTB 7FABL 4PY8I 1JF1B 2BVPB 4K2UL 4OT1L 3U7YH 4ZTOH 4NQVA 3QEQB 2P8LB 5SWQA 1I3UA 4FG6D 1WZMA 4GG6B 2QHLA 3DUHA 35C8H 4JHZA 5DEFA 5LVEA 3EYFB 1OP3K 5DEFB 3VXOB 1U8HB 4U1GC 1EK3A 1FVDA 1FNEA 1C7SA 3GHBH 3UTTB 2VXQH 1XF5B 5I6XC 2AXGA 2KBGA 1NAKH 2XXMB 3GGWB 2YRPA 2BVPA 4P3DA 5GGSB 2A6DB 1XF1A 2IMMA 4YBQD 2XRAH 3CXHJ 3DTXA 5HDQL 1HOCA 4AEHL 3CCHA 4P4KB 2QADC 1ZSDA 1N5AA 3B2VH 3H7LA 1DEEA 3MGAA 1CDHA 3U0PB 4NQCA 1NEUA 4AIZA 4H8WL 3VXPB 2ZG3A 5IQ9B 4EQ3A 5KANG 4J3SA 5TE6H 4L4TD 3CAFA 4U6YB 4XPFL 4L4VB 3BO8B 3DVIA 2MHAB 4A6YA 3QCTH 1S7TB 2AXFA 4IOSD 4BZ1L 1A7NL 4X99B 5KVFH 2CLRA 1FO0H 1GIGL 1RZJH 5DXWA 2FD6L 4ONOA 4PBVC 3DXAE 3PWLB 4U6HA 1HINL 5EO9B 1N2RA 3S3PA 1UJ3C 3MRBA 4J3UA 4LAQH 5FO7B 4TSBH 3E3QE 1ZVHA 2AJZA 3LKSA 3NTCL 4LSSL 5I74C 4OZFH 1YPZB 3WS6C 3J7HA 3CC5B 4XPBH 3CFIC 2X4UB 3FOMB 2X05A 5SWZE 3WS6A 1S7RB 4M7ZC 1GZQA 4FTVA 1MAJA 5E4EB 4PYGA 2VLRE 2RFXA 3LD8B 4NWTL 4MXQD 3VH8G 3QUZA 3ZE2F 5TH2A 2DM7A 1IAKB 4EI5B 2FL5A 1FH5L 1M71B 3AAZA 3R0MA 2DM4A 3V5DA 1ZHBA 2A1WH 4OCSH 4U1MB 3KXFD 3MMEA 5EU7E 3FMGH 4IMKA 4Z18A 2FWOA 2UWEF 3LEXA 4JM2D 3O3BA 4EZMA 5D6CA 1IARB 1PGRB 1MRCH 5HHVL 1ZLVH 2DMKA 1HWGB 3QQNA 4LSUL 3BDBA 1EEUA 3SDDD 1RVFH 4ODHL 4Z7WA 1G7JB 1N64L 4HC1H 1T0MB 3F62A 1UZ6E 2IBZX 3MLZH 5T1DH 5FAAA 3V6FA 3I50H 2ZPKL 3GKWL 5AZ2H 3F7RA 4BYHA 5K9QG 3CH1B 3EJZD 3BKJL 4JFXA 3TBSA 1GJIA 4M9OA 1MCLA 3GZKA 4M62L 3ARUA 4GAJL 3ESUF 1PW3A 2NY3C 3NAAH 4PJ7A 1A5FL 3BYYA 4N9OB 4O5LL 5F9WB 3MA9H 2VDPL 1NBQA 3CUPB 4YFLI 4P5MA 5D1QA 4JN2A 3BGAA 2IAMB 2CR6A 5I30H 1OGTB 2ICCA 3ILPB 3L5XL 3WO4B 2O5ZH 2IAMC 4PS4L 3RWJB 4G9FD 4KK6C 3IU3A 3IFPA 1XCQB 3LV3B 4PG2A 4L4VE 2GQHA 3CFEA 2R0WH 1CBVL 1BJ1J 2VQTA 4S2SA 2M1KA 3OKNB 3O0RL 1DVFC 3CZFA 1YEHH 1RMFL 4LVHC 3RWEA 3LY6A 1I3GL 5HHMD 2Y5EA 4NN7C 1JRHI 2JB6B 3GIZH 3AS1A 2AKRA 4M7KL 4RQQA 2ITDA 3TYFB 1EV2E 5F97E 5FA4A 3IDXH 3ISWA 4KHTL 4C4KT 2EH7L 3O2WH 2EEDA 1RULH 1GGYA 2EYTB 4IIQC 5SX4I 1T80A 4IIQA 5T1MB 4FABH 1MCOL 2QKIA 1U92A 4QRTA 3DX9B 5SWZB 1C5BH 4M1CC 4PGCB 3EW3B 4RMRA 3FT4B 3MJ9H 1Q9KB 3GMQB 5CZXC 1CXLA 1TQCB 2EIDA 2RBLA 1JNLH 2PF6A 5DD3L 3VRJA 1KIPB 3ZHLA 3FN0L 1XIWB 3HG1E 1SJHA 2HLFD 3HZYA 4JRYE 3ARZA 5E2VH 4YHLL 1QBMH 4JO4H 1HILA 5FGBC 3H0TA 5AUMB 4J4PD 3GNMH 4WCYH 3MLYH 5F1NB 3OPZH 4CN4A 3R06B 2WUBH 4R4FH 1MHPH 2ADGA 1NQBA 1FFNB 1FYTB 1JGUL 2NY2C 4L1HA 5DJXA 1D5BA 2AJYH 3RWGA 3ROLA 5DJXB 4IJ3B 3O6ML 1V7MH 4PJIA 3JUYA 3I85A 1H5BC 1NCUA 2OJZH 2FGZA 5E08L 1ZVYA 1WITA 2P49B 5F7EL 3KPLA 2E9JA 4M1CD 2ZG2A 3QQ4B 4MNQB 5FO8B 5E6IC 5I8CA 3DV4B 1WC7B 3FQRA 2LTQB 4H20L 4JDTH 4PLJC 1VCAA 2PYEE 1G9MC 2X7LB 3C8KA 4WO4B 1AKJA 3ULVE 1YYLL 3CVIH 2LTQC 2X1PA 4QKXB 3L3DA 4H8WC 1KJMB 3MBEB 5FYJH 2R2HA 2HJFB 2HVJB 1YMMB 1J0YA 2BSSB 5KSAB 1FBIH 2Q86B 4OLUL 1AY1H 1AIFB 4Z0BH 1GHFH 3MRMA 4Q0XH 4WTWA 1J8HA 1BOGB 3O11B 4RFOH 3ARGC 3T2PA 1TNMA 4NN5C 5KSBF 2APBA 1CLZH 3UBXI 3FT2A 5LKNA 3DOSA 1MJ8H 2NXYB 3B9KA 4NZUH 3T08A 5DD6A 4WI2A 5DJ0B 1OF2B 4PJBE 5GGTA 4FZ8H 4PBWD 2IPTH 3AY4A 4LPWA 4WI4A 2V9TA 3D39A 5J3HC 3S37X 3OKYA 5I1IH 2HJLB 2DQDL 2BP3A 1G7IA 5K59F 4QNPE 1KJ2A 1F6AA 1NC4D 1YPZA 4PGJA 4IS6A 3IFPB 2JB6A 4GRWH 2Z91A 3BW9A 3WFHA 4JRXA 3CDFA 5HXMA 4QRPA 1CICB 5IEKB 2DQDH 1CU4H 3HMWH 5FKAA 4QHMA 3UJTH 2AQ2A 4KKLD 4ISVA 3PGDA 3VWJD 3GSRB 3BN3B 1AO7E 1RZIB 4OTXL 1I8LC 4GOSA 4QO1A 4X8XA 1MCIA 2HJLA 5T1LB 4IRJD 3REVA 3GJEA 2EXYD 4NO0B 3OQ3B 1CDBA 5I8EB 4WWKD 1ITBB 5IM7A 3I6LD 4LQFH 1UKSA 4KKCD 1ZKAA 3OGOE 4HJJH 4QWWC 1JGLH 2GJ6B 5I1HH 3KPOB 4P48A 2P46B 3GUTB 4DAGL 2ZKHL 4ZO6A 1OAQH 3BH8B 5T3ZE 1TZHA 3JV5A 1MRFL 1BJ8A 5LGHL 1UACL 4RZCA 4PJEF 2H3NA 5FO8A 3UZEA 3MJ7B 5EBGA 4LLYA 3HE6D 2ZUVA 4GBXB 1MRFH 3QNXB 2IWGA 2WMPA 4I3GA 4JQVC 4PJDE 2WP3T 3IDGB 4UINH 3TESA 4MA1C 4FQPA 1J88A 2HN7B 4WW2A 3VFMB 4U1HB 3TBYB 2DRUA 1TPXC 4IEFB 3FB5A 1VSCA 4N5UA 4K8RH 5CUSH 3UTSD 2EYRA 1OWRM 4M43H 5DFVD 4A6YH 1P7HL 1Q94B 2P5EB 4UINL 4CVZB 4IBLT 2PO6B 3T0BA 1LDPH 4Y16B 1LO5B 1L9MA 5KTEL 3I75A 1BZQK 3B9VA 5IV2B 5I1EL 5ETUB 3KAAA 4L1DA 3CFKB 3G5VB 5HHNB 4M8QB 2A6IA 4U1JA 4WNQB 2N4IA 3RGVB 2XIDA 3DJ9A 1JV5A 4OGAC 4WUKH 3VCLA 4I0PA 4PGCA 3MREA 3PJSB 3MV01 1YNTB 2YUXA 4OD3H 4YWGL 1I85C 5HHMB 4X6BB 2W0FA 3TWCL 4Z7WE 3U83A 4RFOL 1KCRH 4ONHA 4Y16A 5E9DE 3V0WH 2XXCB 1MHHB 2JJWA 1IC5H 5D1XD 1S5HA 2ITDB 4YIQA 4N1EA 3MLRL 3GEWB 4LCCA 4D9RE 1DUYB 4J3TA 1AGFA 5B3NA 4PJ7E 3V8CA 2YEZA 5FEBA 3X12A 5CBEB 2IFFL 3STBA 2X1XR 1UWGH 1BVLA 4L8CA 1M7DA 1ES0B 3KLAA 2Y36H 3FZUC 2BSRB 5C0EA 4XVJL 1ADQH 1AO7D 1MI5E 1XIWD 1UGNA 2DQEL 2FEEI 5GPRA 2HRPH 4JY4A 3X17A 2NY7H 3GHEH 3HI5L 3JWDC 3SDAD 3OTTA 1U3HB 2XZQL 4MSWA 2XG4A 3WFBH 2O5XH 3MRJB 5EBLB 2YC1A 3VD3A 3VI4F 2G5BA 3UO1L 5B8CC 4S1SL 5J1TC 1CLYH 1QSFB 1FL5B 2YXFA 3D85A 3FN9A 3GUTA 4DK3A 5DJAB 2WLZA 5ISZA 5TE4H 5LBSL 3BWAA 4LIQE 4P46B 5C2BL 4QRSB 3WJJA 3EO0B 3UZQA 1P69B 5HHOA 4ZDHA 5HVHC 4XWOC 1RY7B 1ZHKA 4R2GD 4YO0A 3TA3A 4FABL 1WBYA 2YUZA 5KANI 3UAJC 4LEOA 2VL5B 3JVGC 4PRIA 5IFJA 2GIYA 2LFGA 2ERJB 3GMPB 3HAEG 5I1DB 1RFDL 5FHBL 3P77B 3QNYB 2BDNL 4KDTC 2BNRB 2P24B 4U1LA 2I5YL 1IAOA 1YJDC 4EUPG 4XVTH 4Y5XA 3ZKSD 3LEVH 5CSGA 1HQ4B 2NTFB 1PY4A 4D9LL 4DZ8B 1OP5H 5DLML 3D3VA 1MCJA 1NCNA 2MCPH 3QIBC 2EICA 2VITA 1NANI 2VQUA 4LFHG 5J3HD 4JFFB 4XNUH 1RJYA 2IG2H 4BQ8A 4N0UA 3QDJA 1S7RA 2C26A 2NXYD 5DD0L 4K9EL 3VXUB 2HFGL 5CMAA 4U0RC 2F19H 5DK3A 4TRPH 1ZHNB 4QY8A 1WISA 4NFDA 5L8KB 4QHUB 1JV5B 5DJCA 1EEYB 1AC0A 1BZ9A 1R5IB 1NCBL 2DWEA 4YDIL 2XFXA 3RUGE 5J9PB 1NC4A 2OTWB 2YD1A 1WWBX 4HZLA 4OF5A 1CICD 1BBJB 2EEBA 3C8KB 3QQ3A 3P11H 1CYGA 5FHAL 1VERA 4TOYH 3WN5A 2X4QB 5C92A 3S37H 2VC2H 2BOBB 4JPWL 1HZHL 3PXJA 2GJZA 2NY1C 3O41A 2Q86A 4OZFG 4GRWB 3HC4H 3ZKQD 4IM8A 2B2XH 4ODUB 4RWHA 4UQ2A 1EZVX 2ZPKH 1BOGA 5E94B 3FO2B 2PW1B 1A4JB 3IB4A 5IT2H 3IJSA 1ZT1B 2B5IB 5C0CE 4PREA 2QQQA 4WWKB 3UBXG 1INQA 43CAA 4LU5H 3LS5L 2VZTA 5HGDA 3BZ4A 2H2PC 5C6TH 1K8DB 2AEQL 2NLJB 5AAWA 4NKIL 1AQDA 1T66C 2X9WA 4UV4H 5J6HB 3P4NB 3ZTJG 3K1KC 4DKDC 2VNCA 1PFCA 2JK5A 3LN4B 4L8BB 3UPCA 1TZIB 5E94A 1DLFH 4JY6A 5DQJA 4UQ2B 5F70A 2Z31A 4JAMB 4FXGB 3RI5K 2Y5TB 4HFWA 1JBJA 3RWFB 3ULSA 5F9WC 4YDLB 4LLDB 4N8VB 2ZOLB 3LPGA 4JHBA 1A47A 1T5XA 1K4CA 1Z5LB 1DZBA 4LKCB 4ONGL 1AGCA 3BISA 4AL8L 3WHXB 2HH0L 4NPYA 3GRWA 4XXCA 4XMLH 2A6IB 4U1JB 4MDIA 1CDCA 1URLA 1YEDB 4NFBA 1H3XA 4XXCC 4X6BA 1OOAA 4K3GA 1CDIA 3RHWK 4AEHH 1KIPA 1H5BB 4P3WA 2CGRL 2DDQH 4S1DD 4AL8H 1DVFB 2PO6D 2W1NA 5HI5D 4Y16D 1UYWL 1YMME 4XB7A 3WBDA 1EBPA 2Z8VC 5DJYB 4D9QD 4HCRA 4P2QE 4PJAB 4PTUA 3JV0A 4ZOEA 2J4WL 3BEWB 4PJCE 1FL6A 3B3IA 2VITB 1J5OH 2V7HB 3RL1A 2HLFC 2JCCE 3RDTA 2ITCA 5DK0B 2I5YH 5HD8C 1Y0LB 1C5CH 2XKUA 5DD5H 5BVJB 4YHOL 3AS0A 3GJFA 3QSKB 2R0ZH 5IFHL 1IEAA 5E6IA 1B4RA 4KKNA 4AENB 5A40E 3VFSB 4BH8B 5D8JL 1KELH 3RZCC 5JW3H 4PRBA 5JPMA 4E41E 3E2HB 3G04A 5H37H 5IESL 2IG2L 2XA8L 3NCEB 3MUJA 2YPKB 1LO4L 5I1JH 1AQKH 1YMHA 4JRYB 4XTRC 4A6YL 4K9EH 2V5TA 4J7RA 3CXDH 4HUWB 5KSUB 5JW4N 2ZCHL 2EH8L 4ODWA 1OL0A 4L9LC 4R96B 1QSFA 4NZRL 4HXAH 4ZDHB 1UZ6F 4OZFA 1A7BA 5IBLC 4OZFB 1NGXB 4Y4FA 1PJ9A 2PTUA 4G6FD 3P9WB 6FABH 5IB5B 3NH7H 4IJ3C 2VLKA 4HF5L 3QISA 4X7DC 1FGVL 3T0ED 4G43B 1U3HD 2G60H 5I1EH 1FORH 2R56H 3F12A 3UBXA 3MODH 5KVDH 4HKZA 1I3VA 4X4XA 2IANB 4YPGB 2FH8A 5C8JA 1A3RL 1K8DA 1K5NB 3X13B 3KJ6H 4PJ5E 1CGSL 2BJML 5EZJB 3FAXA 2I27N 5DHVA 4S11A 3I6GB 4PJ8C 3DSFL 5FK9A 1XGTB 4HAFA 3NCYP 4HD9A 4NUGH 4NQCE 3TEUA 4ACPA 1NC2D 1B0GA 1LWRA 1I7RB 2ZJSH 1ERNA 4M6OL 2IJ0C 3BP4A 4MNGB 5D7LE 2DLTA 2I60H 1SVCP 1YYML 3MO1B 1FJ1B 1BIIA 3CFBA 2QJDA 3GMLA 2IPUK 3DECA 4XMPH 3HHRB 4X7CC 3BD4A 4AMKL 4PRDA 2BNQA 3BXNB 4I48A 4NNPH 3DX8A 4U6YA 5JQHC 3HG1D 5GZND 3CGTA 3MNWA 5FGSA 2W07A 1GIGH 1C7TA 3BSZL 1SY6A 2R23A 3KLHC 4JN1H 5D7LD 4XVJH 4ESKA 3VFVB 2GJ6E 3BKMH 1KG0B 3OG6B 1MAKA 3TPUA 2B4CH 4ELME 1AGCB 3HB3D 1WCBB 5C0JA 3MV8B 2HYMA 5C0JB 5C3LD 2C1PA 7FABH 4OQTL 4ZMAT 4Y1AB 3TA3D 1G7PB 1ZSDB 5GRVK 4EVNA 2N7BA 3WKML 2UUDH 1OQXA 5JMOC 5C0BA 3S88H 3ARFA 4UILL 3D1MC 4GMSL 3S98A 4FMFA 4NKDA 4ZUTB 3DX8B 4H88L 1PBYA 3O8XB 3QG6B 1LD9A 5T5FH 1QFUH 5F89B 5I15H 4Q6YA 5JR1H 2P7TA 4KVNL 5T3XE 1RUMH 3O2DH 2AJSL 1BZ7B 5HVWA 1HQ4A 1YUHA 3CMOL 5CEYA 1IL1B 1ZXQA 1UACH 3QUXA 4KQ3L 5D70L 1H8SA 2IFGA 4FFYH 1RJCA 5GS0C 2YPLA 1CD9B 1T1YA 3ROOA 1YEKH 3S7GA 3UJJH 5SWSA 5KVMC 4RAVB 2P5WB 3CLEL 3SJVE 3TO4C 1NGZB 3P0VH 1FZMB 4WUUE 2HN7A 1ZEAL 3TO4A 3O81A 3TO4B 2J6EL 5D70H 4NQSA 3BOVA 1A7PL 5DFVC 5F7DA 4KU1A 1V3LA 3S3SA 2GJZB 4FQHB 4ORGB 3VI3E 1LD9B 3JTTA 1DL7H 2WBWB 4PYHA 4JDVB 1S7XB 1KTLB 4N8PA 2VLKB 2JKXA 1A4JA 2ATPB 3A6CH 4QF1A 3JZ7A 4K23H 4L3EA 3X3GH 4G7YH 3MRPB 4P59L 4UNVA 1NCWL 5F88B 3PQYB 3QDGB 3B5TA 4TN9A 3FONA 4PJFA 1TJIH 1EEZA 4XC1L 2AQ3A 4PJXA 3WIFB 5CKAA 5J6GB 1QA9A 3H3BC 3EOAB 1MPAL 5JO5B 2X1WL 1KPVA 1NGYA 3UJIH 1D5MA 1SYSB 1CLZL 5E00A 5EIQA 1HEZB 2A6KB 1FNGA 1UT9A 4NT6A 2X41A 4ZUVB 2XZAH 4Z76A 3OAUH 3D0LA 4P9HC 5DJ6A 4YIQB 3OAZK 4ZFGH 3BXNA 5C0GA 3U30C 4I18C 3RDTD 1QACA 1OAZH 1XZ0B 4I18A 5C0CA 2F5BL 5HDOA 1RUQL 2BJMH 3OXSA 4LSPL 3FQNB 3L5IA 5KW9L 4N0CC 1ZS8B 3GO1H 2DF3A 2XKNB 5JZ7D 1G7HB 2XOTA 4XP1L 4NUGL 2CDFB 3OKNA 1KJ3L 3F8UB 5JQ6H 3QIUD 1J10A 4HLJA 3TV3H 1TVDA 3IU3B 4LSQH 1U42A 4Y19D 4BH7A 3GJFH 1ETZB 1U8IB 2LAAA 2CD0A 1HYRC 1RJLA 4PV9B 3RVVC 4CN1A 5IROA 3KLSA 3BH9A 3IAGC 4LSTL 3C6SA 1DQQA 3RU8H 1BQUA 2HJFA 5FGBA 3QH3B 1L0YA 4K07A 3QIBB 4U31A 2ZUTA 4F15C 4JFEE 2D0HA 3MJGX 4NPYB 4X7EC 1ZHKB 5FUOH 2Y5TA 3PL6A 5B4MD 2E7BA 4LPCA 1X7QA 3NZ8B 3CD4A 1E0OB 4LVOB 3EYFA 3V6BR 1J05B 4Y89A 3EJYC 4TSCL 2X6MA 2Q8AL 1T4KA 1XGQA 2DLEA 3HC3L 1U3HC 3BESR 3WYRA 2E6QA 1JGEB 5L2KD 3G04B 4M7LT 4JE4B 3Q5TA 4LHUB 1OLLA 2C7UB 5ID0A 2GW5A 4OLUH 3QUXB 3ZZ1A 3CFJA 5ITFA 3H9SA 3VH8A 2CLVB 5ESVB 3S34L 2BY2A 3CDYA 4X6EA 2M8XA 1CK0H 2YN5A 3LKSB 1EFXB 3IDNA 5A2JH 1H8OA 2CO7B 4HBCH 1IM9B 5HVHB 3ARGD 2CDGB 1EMTH 4GMTH 5E8OA 4BZYA 4HX1B 5C71A 3EYUH 1J9CT 1G7QA 1R24A 2OZ4H 1FVEB 4U33A 2P4AB 3C5SA 1ZGLB 1MVUA 2VDPH 4LGRB 25C8L 5MI0B 1CG9B 1NC2B 1TJHL 2H9GA 4OUUB 3QI9B 3ARDD 3O6LL 3WHE1 3L3IB 4FG6C 5GIRB 4DGYL 5ANME 2FB4H 4O02H 3AXLA 3QUYD 2OL3L 5EO1A 3T4AB 4HWEH 2OYPA 1SY6H 5EBMA 1JGUH 3NPZB 1V3MA 4X9HA 2BNQD 3ETBF 2YZ8A 1IZJA 2N56A 2OTUB 1J12A 2PXYA 5B22A 4V1DD 3LN5B 3NBNA 4BQCA 4QY8B 3S37L 4DCQA 4MNGE 5D7LB 1CXKA 1RK1A 1CZ8H 1UB6A 2V2TB 4M8VA 4OD2A 1MFBH 5C0GB 4DUWA 1L4IA 4U49A 2R1WB 4PJEE 4W6WB 4KZDH 4KPHL 5K9QI 1H3GA 4HDIB 5DJZA 4JFQB 2UY7A 5F8QC 5TE6L 1FG2A 3S36H 5ID1B 3QXTA 5C86A 4ZNCD 2FX9H 2OMNA 2NLJA 1MCBA 4NNYB 5E8NA 1K85A 4S2SB 2X70B 4E41D 1DQML 5IEHA 1CFVL 5FOBB 5FUCC 5I8OH 1WUNT 3OJVC 1AP2B 3MPCA 4AK1A 2PW1A 1TTFA 4HLZH 4NBZB 2A73B 2CXKA 4F2MA 2EE6A 3NTCH 3C6SB 4R26L 1Z3GH 3OR6A 1X7QB 1JHTB 1DFBH 2ATPA 2UVFA 4XP9L 2AW2A 5HGBB 3TN0D 3JV6A 5DMGD 1PYWA 3MRFA 3TV3L 3MRFB 3RX8A 5EWIL 1RU9H 5AYQA 5T1LA 4F57H 5TE4L 5D7IA 3OJ2C 1BEYL 1W0WA 5GSVB 2FX8L 1T0PB 1RIHH 1LDSA 5I1CL 4AENA 4D0DB 3FOMA 4G6JL 4YH6A 1OTUC 5B38A 3RVUC 3CX5J 3QO0A 3REWA 2C3XA 4J3OC 1T6WA 3ZSTA 3MJ9A 1E6OL 2ZUQC 4TTDD 1GCFA 5L7XH 5C0CB 5DJ6B 3RL1B 3TBVA 1FIGL 4O9HH 3HC3H 4U7SA 3TH4T 3T0AA 4L9LB 5H8DA 3QUZB 4KI5F 1NFDA 4OD3L 1AO7A 4NP4H 2D03H 5JOPE 2G2RB 4WJ5B 4PRHE 1OSPH 4FQIL 4LDLB 3QFJD 1OHQA 1DN0B 1KLUB 3V8OA 3SE3A 5MERA 2Z8WC 3QHFL 4JM4H 3PGCB 4C56D 4DAGH 4P99A 1G6VK 1D9KD 4XC3L 3FB6A 3RWHB 4WY7L 1HINH 5B21A 4P3DB 2GITB 1DE4B 5GGSA 3RKPA 4NBYB 5T1KD 2VABA 1JZ6A 2R0KL 3FCTB 3MRGA 3LPWA 1YNKH 1HOCB 3U7WH 3C5ZC 4DUVA 1KPUA 3VMPA 1WTLA 1MH5B 3PUCA 4JHWL 4H5SA 3X3FH 3UTPD 1TMCB 5FECB 4M61A 3SDAA 4AIZB 4HUVA 1BQHA 3O6LH 4M6ML 4KV5E 3X3GL 2VL5A 4PRIB 2VXSH 4UB0L 4PJFE 4Y19B 4WI8A 1CN4A 4LDOB 3FQRB 2YS4A 2XPGB 5IIEB 2DN7A 4UMGA 1TJIL 5IMMA 3DI3B 4WO4A 4M43L 1IBGH 1AC6A 3D85D 5CEZE 1VFOA 5DRZB 3B2VL 3ZTJH 1K6QH 2VDNH 3MRKA 4FQXA 3CU1A 1IGCL 1DQLL 1LDPL 5E2UL 1JPGA 3GI9H 3IGAB 4ZFGL 1GSMA 4HUMB 3H9SB 1NJ9A 3VH8B 4H5SB 3ZKXC 2DM2A 1BVLB 2X4OA 1J0ZA 1RSFA 2ZJSL 3V0AC 3ZE0F 5JIKA 4Z7NF 2IPKB 3SDCA 4PPTA 3UCRA 4X6DA 3QEQA 3BX7C 4M1DH 4G8FA 3NIFE 3SO3B 4ZG1A 2O61A 1M7DB 4HFUH 2DQHH 3VGGA 4M1GH 4TYUA 3C2AH 2HFFA 5L9DH 3VXQB 5C0IA 3VI3F 4NQED 2MTPA 2Q6WB 1PKQA 2Q76B 3DURB 3QDJE 3UTTD 5DJ2A 4GAGL 5I8EA 5BJTA 5E2WL 3PXHA 4S1RH 3WIHH 3VG0H 3VFNB 5J1AB 3KPMA 4HH9B 4MCZB 2HTLD 4RBPK 5F21B 1CDUA 1U8IA 2X4NA 5D96C 5KZCD 4P23A 5A1AA 5D93C 5C0AB 3ARFC 4PJ9B 1IGIH 1HHHA 4MJ4A 3ZTNL 5HHQA 2J12B 2W65B 1MI5B 5E9DA 5EOCJ 4IMLB 4X6FA 4LSTH 4Z0XB 1MRDH 4ZSOA 4XVSH 4BELD 1B6DA 5AWNL 5IHLB 3WFEH 1HXYB 3MRIB 1W2KT 5CINL 4TUOA 3MRCB 4I2XB 4OF3A 4FZEL 4MDJB 3EAKA 3O4OC 2XZQH 1ZGLA 5IB4A 4J8RB 1F00I 2ZCKL 5E8EA 4GLRI 2XFXB 2Y23A 2WWKT 3QUYB 5F7YC 4UV7L 1B0RA 3ZYZA 1QFUL 5EU4B 3LB6D 4KK9C 5KJRH 2IBGA 4ZXBB 1TIUA 5FKPB 3V52H 1LO0L 3KPMB 1E4WL 4HH9A 1F3RB 3IS0X 3ARGA 2VE6B 1XCQA 3CH8A 3LV3A 4JRWA 5EUOF 4V1DB 4YR6B 1ND0B 1MQ8A 3H9SE 4ODSL 4IDJL 1U91B 2YPVL 4UV7H 4KRPB 4X6FB 2IF7A 2NXZB 5TDOA 2BOCA 4K3JL 3CH1A 4KKLC 1FYTE 4KRPC 1NGYB 1NCDL 4WDIA 5D1QD 2GK0A 2J6EH 1A7PH 3QAZB 1YNLH 2NW2B 1OPGH 1A9EB 4EBQH 2H3NB 3MRPA 1F4YH 3RNQB 1AXTL 4FQJL 3QXVA 4AIXA 3MJ8A 4YDJA 3C5JB 5K9JL 4DN3L 4L8CB 2BZDA 3O3BB 1KGCE 5BVPH 1NGZA 5DSCA 3MGTB 1QHPA 3QPXL 3SCMB 1JHLL 4MNHA 2XA3A 3PABB 4P5KB 5FM5M 1JPTH 1IFHH 3WJLA 4G6KL 5JDJA 1YQ2A 4LVNC 3IU4H 1S8DA 3V6OC 1WK0A 1GZPB 5EO0B 3BVNA 1KTRL 4HJGB 4M7JH 5MENB 3G6JE 2OI9B 2QR0B 3LN5A 5E8DL 3O9WB 5JPNB 3B9EA 5TFSL 2YD7A 3FB8A 4WEMB 2W38A 4P5TB 2XACC 3FO2A 1HXMB 1ZS8A 5DQDL 5DZLA 3O9WC 4NM4H 1RZIA 2E7LC 3KHOA 8FABB 4KAQL 1CR9L 5FGCE 3QRGL 1OB1B 1HHKB 2ATKA 1R3IH 2OCFD 3D87B 3LAFA 1RJZA 3SPVA 1R5VB 4G9FB 4PJGA 5EU7C 1JF6A 1BD2B 3VFOA 2AXFB 3BWUC 4FZ8L 1S7QA 4MCZA 3OKEB 3EGSA 5LG1A 1S7QB 3W5MA 4XHJD 1FRGH 3ELAT 1OGAD 3GM0A 3KS0H 5DZOA 5BJTB 4Z0XA 3IRZA 2YA2A 3ULSB 2DI8A 3LQMA 3N9GL 1A2YB 3QUZD 2OL3B 1T5XB 5T1MA 3CLFL 5I8OL 1FCGA 2C3VB 5IB1B 5JOEA 4GLRH 2HMIC 1HCFX 5SWZA 4RISH 1PG7X 3QFJB 2VDKL 5D7KD 1LE9B 1HHKA 2ATKB 4LGSB 1MCDA 3ZKMC 2E8ZA 1YN6A 3LKPB 4K9EC 4NKIH 1FVDB 4HX1A 5IFAL 1JTPA 4WI3A 1LQSR 3P3YA 2XA8H 4CW1B 2VUOA 1AQKL 1EH9A 5MEPA 5CZXD 4GRMB 1MY7A 1N6VA 3VRIB 3BP7A 2CLVA 5ADOL 3RY5A 3DYMA 1EFXA 2CUMA 2R9HD 3BE1L 4NSKB 3W39B 4X8JA 4L8DB 2XNAA 2H32A 4KGJA 1JF1A 5E6ID 4R4BB 1MSPA 1FYTD 5CEZL 4PD4K 5IB5A 3BIKB 4M4RA 4J2XA 4PRPE 3V6ZA 1I1AC 1KFAL 3IVKB 5HDBF 4L3CA 4G80A 4Y5VC 5ICXA 5KSBE 3ES6A 4X4XB 2ZUUA 4BQ9A 3VGDA 4KJYA 2IH3B 1OAUH 4G6AD 1YMHB 3JXAA 1BHGA 4PP1C 3RIFF 4DOHE 1JI2A 2P8MB 3RVXD 4X8JB 4XC3H 3IDMB 4Y4HD 4P4KD 1TJGL 2XWJA 5KSAD 4GAYB 1KN4H 3SKUD 4POZD 4X98B 1N0LA 4WTZG 2IC2A 4L4VD 4QHNA 4PGDA 5FKAB 1MJUH 4G8GA 1RHHA 1QLRA 1RIVH 3D39D 4D0BA 4NGHL 4MXWH 4U1MA 4ZTPH 3WKNA 5A2KH 2DD8H 4MGXA 4EI6A 2DLIA 1CXHA 3KPRE 4U3HA 4NYLB 1G7IB 3K2UL 3DMMA 1DP0A 5DUPH 1P84J 4DGVL 1D6VH 1UQSA 3B4NA 4KMTH 3TGXA 5F3BA 3DNKA 4XMLL 4B0MM 3TM6A 3EOBB 2A83B 3PWPE 2F5AH 4LEXL 6CGTA 1IBGL 3GSNL 4R3SA 4XAWH 5GSRB 2B20A 4U0QB 4HWNA 4ERSH 3P4MA 1GAFH 4X98A 1R0AL 3E6HA 3VE0B 1VB9A 1YN7B 4KFZC 5DUPL 2ZG1A 3ALXA 1KXTB 2F9BT 3EHBD 2MCPL 5LQBL 3FB7B 5F9JA 2AK4A 3U0WH 2VERN 2HJKB 4XMKL 3KXFB 4RFNC 3CCHB 1FE8L 2ZSVA 3KPPA 1S7TA 3M8OH 4JM2B 2CK2A 1GAFL 5CCKL 1GOGA 1HH9B 4XNXH 1JHTA 3SJVA 5DRWB 4UBDD 4H8WH 5E2TL 2GTWB 5KVFL 2NY3D 2ZUQB 4R26H 1A21A 4F37K 2Y06L 1P2CA 2D7TH 5GXBB 4GBXA 1F90L 1H0DB 1KIQB 5IF0B 2ESVA 5DUBB 4K7PH 2VLLA 3GBNH 3EJZC 1X5FA 1DBJL 2Y6SD 1JPST 4Z77A 2H6PA 1KEGH 2Z92A 3LOWA 2OTPA 3LDBB 3GMRB 3BMVA 4OM1H 2VLRD 3QWQB 1MHEB 3P30H 4RRPG 2NYYC 1FFQA 1MHEA 3G6DL 3MR9A 4DJMA 4RX4D 3KPOA 5SX4H 3KLHD 2BSTA 1S5HB 1QYGL 2D0FA 4WHYH 1T2XA 2BVQB 4RFEB 4J6RH 5CEYB 4YHPA 2AAVA 2DMCA 2FWOB 4OFKA 4JEGB 2FJGA 3QEHB 5DUBA 5CBEA 3X12B 2ZZUT 3LD8C 3O3DB 3G6DH 2VAJA 4I1NB 4RGMB 5IVZB 2VLLB 4HIJB 1G6RB 3CJJA 1YNTA 3WFCH 3OMZA 3LRSB 2H6PB 2OR9L 3KS0J 1ZT7B 1QFWL 3L3KB 1CXEA 4WHDA 1JNNH 5HI3C 3DV6A 4IRSB 5DJYA 3U82B 3WMSA 2K1MA 1EX0A 4PGBB 4XP5L 4H1LG 3RVUD 3HRPA 4ZS7L 2X4SA 4KZEH 3QXWA 2E6PA 2C4FU 3I50L 4QTHB 1RHFA 2GTZB 3DBXA 4M5YL 4X5XB 3JWOH 3MRGB 3C5ZD 4HXBH 3QR2A 3QUMA 4JRXB 3T77A 5D5MB 3QUMB 1KIRA 4LARH 5C6WH 1KCRL 4XNZC 1KJ3H 2G75B 1N7MH 3M17A 4JFDE 3VXSB 4HWEL 2F8XC 2BMKA 2VAAB 3UJJL 1TVBA 3STZA 1JNHA 1KJ2L 4PJ8D 2E7LA 5IG7B 3T3PF 4M48H 3U7YL 5DHVB 2BFVL 5M95B 1IFHL 2CUHA 1M6OA 5IHUH 3VXSE 1RZKH 3BFOA 35C8L 1CU4L 2CO6B 2EDOA 2UZIL 3SQOL 5DVLA 3CUPA 3FOLB 4JVWA 3O11A 5CZKA 4E0RB 4K7PY 2BDNH 2EDTA 1GZPA 3U4BH 3AREB 4YFDB 3FQWB 4J23A 3VD9A 1FAIH 2YKLH 3VXTB 3FFCE 4WHTA 1JVKA 3QYCA 1HZHH 2NY6C 4Y4KC 5D93B 4MNQD 5E8DH 5E99H 1NGPH 1TVHA 2XY1A 3O2VL 1P4IH 5EU6D 3P40A 3RZCD 5LGJA 3VWKB 3QNYA 3OB0H 4MHHI 4H1LB 2EDWA 4CBPA 5I0ZA 1T4KB 2MNUA 1S7WA 2OBGA 4RIRB 5CIPB 4PLJD 2GSIA 5IJVA 3DVNA 4N90E 1YMMD 4ODXB 3MYZA 1XR9B 1MCSA 2EIZA 5BV7B 4WI5A 4F33B 3DIFB 1D6EA 1N3NB 2QSCH 3MV11 2CKNA 1FL5A 4QRSA 2JB5L 1KTDB 1KIQA 4ODBD 5IF0A 1KCKA 3AREA 3QIBA 3V95A 2YHGA 3C09B 3QO1A 2LU7A 4GS7B 4P46D 5DC4B 5DHXB 1P9MA 3QP3A 4ZOCA 4XPTL 5I8KH 4HSQA 1F4AA 3GO1L 1A6AB 3CK0L 4OCYH 2KH2B 5CBAA 4PP1D 2FR4B 3MA7A 43C9A 1A1NB 3KWWB 1VPOL 3SO3C 4XNUL 5IB4B 1EEYA 3BT2H 3TJEL 2VUYA 4LSQL 1V5JA 2VDKH 3GSNA 3ZHDA 4JFDB 1AXIB 4NJAH 3RVVD 1RZGA 5FUCE 2I24N 2EC9T 4Y4HB 1IEAB 3MLXH 2K9UA 5FM4A 4JGMA 4F8QA 4ZPVA 2AP2A 4WWID 1UZ8B 5EU6E 3MRBB 3KPQB 4CGTA 2V6HA 1KJ2B 5CJXA 1ADQA 1J1PL 3DX7A 2W65A 3QIWD 3L9RA 4GW5A 3ARFB 3NACL 1K9TA 5J6GA 5KTEH 2X4UA 3MRQA 3QG7L 1U0QA 5IK3A 2I9TA 3SBWA 1WWCA 5E00B 1J8HB 2QQNH 4R6UA 5T5NF 3VXUD 3T1FB 4JAMA 1C08B 3ARDA 4NO0D 4LVNB 4P2RB 1ZLWK 4GKZA 3GB7B 4JFEA 4L29B 3QG7H 1LK3L 5KSBA 2W9EL 3IXAA 1D5ZA 3N50A 2JE8A 3THML 5TE7H 4JO2H 4WW1A 2BSSA 5KSAA 1C12A 4K71C 2NY1D 4ZPVB 4ZD3H 1Q9LB 1AIFA 3QDHA 3TH2T 2H8PB 2AS5M 4XAKE 3ECBB 3QI9A 1OD9A 4K71B 1QFHA 5BO1L 2CKBA 4Y7MA 1IC4L 4QWWD 1FSKC 3TIEB 2WSKA 2NY0B 1XGTA 5ISZD 3EDEA 5TF1H 3R4DA 3DGCR 3Q1SH 3NZHH 2X42A 5D2NB 3JTTB 1NCCH 1I7ZB 1T6VN 5DQJB 1P53A 4F9PC 1ZT1A 4UNTA 3C60A 3O0RH 8CGTA 1CLCA 1YQVL 4GRLC 1Q0XL 3SO5A 3V5HB 1QBAA 4M6NH 5INCA 2O26U 1NFIA 4GG6F 3QAZC 4HPYH 1IJ9A 1CE1H 5HGDB 4HIHB 1EJ6A 5DUML 3O3DA 2EDEA 4GBXD 3HS0B 1VGEH 1QR1A 3IJYB 4DKEL 1CGYA 1Y6KR 5D7JB 1BEYH 3SKNA 3KPRA 3NIFF 5I1CH 1OCWL 2NX5E 3OKMB 3TZVB 1FZKB 3GI9L 1XR9A 5D7JC 4J1UA 3UTSB 3MXWL 1I8KA 4PFEA 3CMOH 1AE6L 4FXKB 4RA3A 1A3RH 3TVMA 1E4XL 2P5ED 2IQAB 4HT1L 1H15A 3C8DA 4ZUTA 1G9EA 3HNTH 3O4LE 1GPOH 2Z4QA 3BH9B 3VG9B 4N5ED 4ZO7A 2XZZA 3WE6B 4YFEA 1YN7A 5KSUA 5FA4B 3GSWB 3C2AL 3OL2A 4JZOB 3FQUA 4LDEB 1Q9OA 3DRQB 2CLZB 4MYWB 1UCBL 4QRRD 2AK4B 2I60L 1MLBA 3MLYL 5BS0D 5ILTH 3MROB 3G9AB 2F54D 4ETQA 5AYUL 5IESH 5ABDE 4X4ZA 5HHNA 2YD2A 4WW2C 3PF2A 3SDYL 1EZVY 1R5VA 3T2NH 1JWMB 3ZLQC 1T7ZA 4M03A 3WNOA 1VEOA 2JB5H 2AJUH 4F7PB 4LPYA 3EYVA 1KEGL 5M7QA 3L95A 2HT4D 4QEGA 5F7EH 1KGCD 4NWTH 2R0ZL 2AABL 1G0XA 4GW4A 4JRXD 3TBYA 4FZEH 1P1ZA 1KNOA 1IM3A 1OARH 2DQUL 4JB9H 3DBXB 3ZDYE 3MROA 3LQZA 5J8OA 3KJ6L 3RQ3A 2QQKH 4EIGB 1YYLH 3CVIL 5IVXE 2QSTA 4OM0H 3IVKA 4QF1B 1X6LA 4MCYB 4O2EB 4HPOH 5HD8D 2X2YA 4XB8A 1IAOB 1QBBA 5AD0B 5IBUG 1K5NA 4ODXA 4LLUA 1FNEB 4HKXB 4L3AA 4Y88A 1QSFD 4G6JH 3S6CA 1MJ8L 4NZUL 1X5HA 5FYKE 5I1AB 3DVNB 5F96H 5MP6L 4TTGA 3ZSSA 3DURA 5HYSG 4LCCC 3F58H 3HNVL 3UEZA 3NCBB 2OM5A 1RI8A 2Z31D 1UCTA 4X6DE 1SMAA 4L8DA 2P44B 2R0LL 2QHRL 1ONQB 5EOCH 4DFHA 1NJ9B 3BWAB 2R1YB 2VXUH 2X4OB 4UI2A 1T7XA 2PNDA 4GKOA 4O58H 4G6FB 5D2NA 4HMCA 1DUZB 3VXME 3QEGL 1A1MB 3ES6B 3U4AA 3RHWF 4NQVB 2IBBA 1BLNA 2V17L 5EFIA 1WLHA 1EJOH 1FNFA 4WIQA 2VZSA 5I1LA 1XCTA 3ARBD 1I75A 3ULUD 3T0DA 2IAND 3N06B 2P7TB 4XWGH 1YEGL 1JK8B 4GSDL 2DKMA 4HDIA 3PWJA 3WFZA 5F1IA 4C4KO 1NBVL 4HUXA 4UUJB 3R8BB 3BD5A 1N59A 1K4DA 5IMMB 5TQ2L 5FB8A 2NY4B 2Q8AH 4Z6AT 1UM5L 1DUYA 1EPFA 1F58L 3ZDXF 3BW9B 1RULL 5ICYB 5EB9A 2ZNXA 4K2UH 5I17A 2NY4C 4IRZL 4PB9L 3DUUB 5B8CB 1UXWA 4UT6L 1JPFA 1A7QH 3EFFB 1KOAA 1P4BL 5LBSH 2VZVA 3ZDYF 1WFNA 2BCKB 2ED8A 1RIUL 2F8OA 2MHAA 1ORSA 5ALBL 5E99L 1BFVH 5L7XL 2V2XA 3VDCA 3FN0H 5JMRA 3EYQC 3GMNA 3QWOA 3WUWB 1CFSA 1PSKH 1JPSL 2CPCA 4A2MA 3BQUD 1U6AL 1KV3A 2Q8BL 4NKQB 5TPWH 1B4JH 1D5IH 3QIWB 3KGRA 5FB8B 3ARFD 4KVCH 3TJHC 4XP6L 3MV8D 3WFDH 4FN0A 2GUOA 5EIVA 5C70A 3SCMA 4YXHH 4UIKL 5D9SB 1J8HD 5IR1B 1DBJH 1J0JA 3RY6C 5D72L 4K8RD 4MMXC 5TPWL 4AEFA 1BQSA 3B5GA 1XAUA 5GRXG 4XP6H 5BRZA 3T3PE 1RZ8A 3HC0B 4LLVA 4N8CH 3RI5F 3LQAL 3KPSA 4PJ7B 3TNMB 3KVQA 3O8XD 3RVWC 3F5WA 5J12C 1NFIB 3RIFK 1NLDH 4JCMA 4AEIH 2VH5L 2NW3A 1RZJL 4Y4FB 1EO8L 4LLUB 3VGFA 1PQZA 2AEPL 3S96B 4PRPD 2FZ3B 4N8CL 3RPIA 3OZ9H 3HCVA 2IQ9L 2N1KA 4XNZB 4U2ZA 1A6VH 1FPTL 2ICWJ 1AGBB 4JVUA 1PKQE 4AEIL 5HYSA 4OAWA 1I85A 4JFXB 1MFCL 2FECI 3TO4D 2C3HA 1MEXL 1ETZA 2IADB 1JRHL 3WJLC 1OT2A 5L6YH 5F93C 1MCKA 3HC4L 3HR6A 4JFZL 5GS0D 1B90A 2V5RA 1NDMA 1ZOXA 4HIXL 4LBEB 5HHME 1E4JA 3S4SA 4HKBA 4P2OA 5HSFA 3V4PH 4YAQA 5D1XA 2NW3B 3I02B 4P2OC 3TZVD 4PY7B 5EUOB 3G5XB 5ACZB 4UDUB 4NQXB 3DX9A 3H42L 3RGHA 1F97A 3PQYD 3QDGD 1XF4B 3NN8A 5DHYA 4LSUH 4PJBF 1EDQA 3EYUL 2NCMA 3MRRA 4KDWA 4TVPH 5IW1B 1X4YA 3ULUF 2NY6B 4NCDA 3MNVB 1FRGL 3SDXA 2AJXL 3VXRA 1QUNA 5IHZB 5C6TL 1BQHG 1CXFA 4FQXC 3DO7B 3BGFB 3EYVB 2EXWD 4IRSC 2A6KA 4NRZB 4R7DA 2Q20A 5BXFB 1P5VA 5FUOL 3BGFC 5DJ2B 3ZE1F 1GOFA 3CZFB 4PB0H 2FX8H 4APQC 1MFNA 5CP7A 2F54A 4APQA 2R4RH 2HA1A 4GKSB 4HKJB 3MV9B 4XPBL 3ZDZF 4GQPH 1R3JB 3SDCC 1ZA3B 1EVTC 1NGWB 3E6FB 4OI8A 3PWVA 1F2XK 1EAJA 3GMNB 4DKEH 2XKSA 1PEWA 4CU6A 5D7IB 5ESQA 5HHXL 1ORSB 1F4WH 4Q9BA 5ICXB 5C0AE 3FO9A 1SBBA 3SKNB 1MVUB 5CZVL 2IQAA 1ULVA 1XF3A 2DJSA 1CG9A 4JG1L 3L7FB 1OTUD 2ZCLH 3SPVB 1OW0A 3HMXA 4XNMB 4LCUA 3MUY1 1M7IA 1WQVT 4RSVA 1GPOL 1E4WH 5EDXA 2ED9A 3F7PC 4LIQL 2FX9L 3G9VA 4HT1H 4WFFE 5FYJD 2FGWH 1EUUA 4AYFA 2E7CA 4WUUA 1IKFH 3PP4L 2CK0H 3BAEH 4OQ1A 3IS1X 1BQLH 4F7MA 1BF2A 5TQ0H 1QRNA 5E8OB 1N5YH 3V2AR 4GFTB 3KYKH 3D25B 2J7LA 4HGMA 1EFQA 3SE3C 2D9CA 2Q8BH 1F3JA 2FHBA 5ERWB 3VFPB 1CK0L 4FS0A 3SGJA 2KQNA 4HKZB 5FF6B 2VR9A 3SGJC 2QQLL 3NIGF 1J05A 4D3CH 2R1WA 4LHJB 4X9BA 1TJGH 3UC0H 1FO0L 3RWDB 1JGEA 3MJ8B 2J8UE 5HYQB 1CGUA 3N9GH 5KS9E 2DL9A 1I9EA 1R3KA 1LNUA 3O6KH 3AS2A 2DQGL 1NUGA 2X4QA 3PHSA 4M3JA 2MQ0A 1PG7W 5JLZA 1KYOK 4WU5B 1EFXD 2W60B 3DLQR 5FDYA 4I5BB 5ACMA 4ODUA 1JZ8A 1NCWH 1MFAL 4L8SA 2DAVA 4TUKH 2P8PA 5SX5K 2PUQT 5CJ5A 3GSQA 2WV3A 2E6JA 2K7PA 3AU1A 3X14A 5D2NC 1ZT4B 1NFDF 4MQXC 1MFEH 1T89A 1WV7T 4OM0L 4PRIE 3LIZL 4Y4HA 4H26A 3QIUA 1H9VA 4OSUH 5J89A 1I1FB 3KPNA 4Y4HC 1RZ7H 5E70A 5F9OL 4MX7A 4BSWB 1L0QA 1FV1A 3UJIL 1WTGT 3C2SA 1T7YA 3KPQA 1QD0A 3NABH 1NEZA 5CD5D 1OM3L 5I73B 3MRRB 3UTPE 1OSPL 4X4YA 3EBAA 3CFBB 3D3VE 5IEKA 4MNQE 2WUCH 2VLMD 2BVUA 4R4NC 1NUDA 2V5MA 3TNNA 4UOW0 4UOJA 1A1MA 2Z91B 5A2IH 2QHRH 3S9DB 4LSRL 1OM3H 3OPZL 3C60C 2ESVE 2DBLL 4OF6A 2MQCA 1NAMA 2Q3ZA 5GRJL 3WE6A 5D2LF 5JXEC 1RV6X 2OJEB 1CFNB 4LLMB 4XBGB 2UWEB 4MAUL 2RR3A 3U7WL 5AWNH 1A4KB 3SE8L 1MCCA 2IPUG 3HMXL 4Q2ZA 3MGTA 1OWWA 2EDLA 2KDGA 2AJVH 2HH0H 3ARVA 4F7CB 4OQTH 5DQ9A 2OZ4A 2NY0C 4DVRL 4KTDL 4GJTB 3RP1A 4NQEE 1EXUB 5DMKA 5JNYB 2WQRA 1FZJB 1QNZH 5IMKA 3O2VH 5ADOH 1AE6H 4YNYA 3TN0A 5FOBA 5I66A 2ZKHH 1FBIL 2ILLA 4PJDB 2LABA 4GO6B 2BY1A 1RZ8B 4PTTB 5DRWA 1EGJL 4ODSH 3W5NA 4Y4FD 3VFUB 4BSVB 3AROA 4LLMA 4XBGA 5I9QB 2GT9B 3IJYA 3KXFA 1N26A 3JV6B 1ED3A 4PLNC 3T3MF 2CRIA 4EI5A 1A7RH 2B1HH 4M61B 4MQ7A 3HPLB 3IKKA 4YLQT 2JJTA 2VAAA 1FZMA 3BP6A 3TO2A 3ZYJA 4NRXB 3QUYA 3FRUB 1T1YB 2ICWA 1EIBA 5DD5L 3ROOB 2BVYA 3BGMA 4FP8L 4G5ZL 1YPZF 3AUVA 5C3TA 1X9QA 4UU9A 4PTUB 2GK2A 3R06A 3IETB 1OT1A 2X4SB 1QFWI 4YHLH 5E2VL 3JUZA 5I1KH 5F6IB 1I4FA 4LHQB 4QCIB 1L7TH 1MLBB 3RGVC 4LCCB 5E2TH 1KENH 3KG5A 3QFJA 4B50A 2B0SL 4XH2B 2EYSB 4NZRH 4FQCL 3MCG1 4BFGA 3LEYH 3VXSA 3QIUB 4Y5YC 2AEPH 4Y2DA 3L1OL 1I1AD 3CIQA 3DVGA 2YRZA 1OAXL 1KCUL 2CJUL 4QLRA 5D7LA 4RGOL 1HIML 3CSYA 4DKFL 1XGYL 4Q9RH 3P2TA 3PDGA 5KG9A 3G5YA 3OBAA 4PV8A 3VXQA 5JTWA 1WF5A 4OFVA 5F7MC 1CL7H 4DTGH 3CFJB 5I71B 4OCLC 3MBEA 4X6DF 4G3YH 5CJBA 2LE9A 4CVUA 1AKJD 3VXMB 2XG5A 3TT1L 3HZKA 3OX8B 4OLZL 3QIBD 1W72H 2Y07L 1KF9B 1BJ1H 3CFKA 1KJVB 2QR0A 4BFIB 3PQYA 3QDGA 1GGBH 4XZUB 5EUKA 3LS5H 4G42A 5JW4M 1TCMA 5EO0A 3CMGA 4Q0XL 1P4IL 4OQTA 5DMJB 1K6QL 4MD5B 5I2IA 4PJDF 4NFCA 4OFIA 5JHDE 4X80L 3HNSL 4MD0B 3C5SB 5DEZA 4U7KA 5IIEA 4EOWL 4XMPL 1C16B 5LJYH 2P5EE 5GGVY 3UTTA 4LNVA 3X13A 4PRAB 4OZHE 1VEMA 4OGAD 3B2UC 2MJWA 4HHAB 4XVUD 3ZTNH 1E28B 5FYKH 1T0MA 4PLOB 5EZOH 4DN4L 2ADFL 1UB5B 1UJ3B 4AM0B 1NL0H 1EXUA 1U8QA 1KTDA 5HYEA 4ZTOL 5GZOC 1YPZE 1OQOA 2MPAL 3O4LB 5JXAL 1C5DA 2DQFA 1ACYH 1R3HB 1UEYA 3M07A 1NCAH 3KR3H 2A1WL 4OCSL 5FYKL 1J86A 1HSAB 3VXNA 5C9JA 1A9BA 1ZMYA 4QXGL 1A6UL 1U3HA 5I6XB 3N85H 1MRCL 3FO9B 4P4RB 4UTBH 2FBJH 1QVOA 1TENA 4JFHE 4L4TB 1HH9A 3SJVB 1GYAA 3REVB 1EHXA 2A9NL 3KYOB 2BFVH 3QCUL 4NO5A 1FO0B 4PV9A 3WFBL 4ODHH 1U8PA 5ADPL 2G5RA 4KKBD 3LKOA 4JG1H 5EU4A 3S5LG 1XMWA 2UZIH 5FKPA 2VJXA 4ZO8A 2HTLC 3MYJB 2A6JB 3E6HB 4KUCF 3VE0A 5AG9A 2KPNA 4U6HB 4N0FA 3DX7B 1RK0B 2FGWL 4KRNA 5LXGH 4MWFB 3CC5A 2APFA 3VXUA 4DGIH 4PJ9D 4MAYA 1BM3L 1MI5D 3CU7A 4TUOB 1AXSB 5I30L 5F9DC 4UIKH 4KQ4H 2Y4SA 1IKNC 5D2LA 3WXWL 5H37G 4HK3J 1NLBL 2VZUA 3BD3A 4GMTL 2MQ3