2EDDA

Solution structure of the fifth fibronectin type iii domain of human netrin receptor dcc
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
123
structure length
123
Chain Sequence
b'GSSGSSGFPTSVPDLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin receptor DCC
publication title Solution structure of the fifth fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 8
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eddA01
4RGOH 1VGKB 4WDIB 3TVMB 2HVKB 1L4IA 1DBKL 5JUEH 3CLFL 5FYLE 3PV6B 4CVXA 2P47B 5DK3A 3NIFE 1U8PB 2FL5B 2EDKA 3HRZB 2Z0BA 1KJ2L 2EDXA 1VADB 5FUOL 1EHXA 2O5XH 5C0FA 2E27H 3P4OA 1RZJH 3QZWA 4ODUA 5E8DH 4NZRH 2XY2A 5JPMB 1UKSA 3M8OL 5FGSA 3VFRB 1JL8A 4GG6F 4RA0C 1P4IH 5DFVC 5J0BA 2QSCL 3IDNB 1HYSD 3GSOA 4X4ZA 4BFBD 3W2DL 1VEOA 3MFFB 3KPOA 2BSSB 4MHHI 4QKXB 1BFOB 3F7RA 4JFHE 4XNUH 2OR9H 3GJFA 5M7QA 2J8UE 4FFZH 4PJXE 1QSEA 1INEH 3WL9A 4YHYB 3I2CL 2J8OA 1KTKE 1QSFB 3D69B 4HKJA 2CK2A 2DYPD 3DBXA 3GMPB 4OFKA 2EC9T 4I3GA 3TO2A 5E5RB 1MY7A 3D3VA 1OM3L 2FDBP 4GRWH 4PY8J 4H25B 4XNUL 2Z93B 5D7KD 3JXAA 1T4KA 4MJ5A 2QV2A 1F4XL 2YXFA 2VL5B 5EUOA 4OM0H 1EH9A 3IAGC 4G8GD 5D7IB 1ND0A 4J6RL 2WLYA 3ABZA 4M62L 4ISVB 2QLVB 5DGQA 1G7MA 2OR8A 4XNYH 3IKCA 3HUJE 4RRPA 1J1OL 3HC3H 2AGJL 3ARWA 3G6DL 5E2VL 2EEAA 2CLZB 1YUHA 1JNLH 5DUMH 5IJKA 5CJOH 1KEGH 1HWGB 2BY0A 3FN9A 1I7RB 3OKNB 1CF8H 5C08B 4JO4L 1XGUB 1T5WA 2MWCA 4ZFGL 4HKBA 3ARFA 5FDWA 5J9PA 1WJ3A 5MENA 3AS3A 2RQ8A 3QIBB 1NL0H 4WWKD 1URLA 2DD8L 4KJPD 4YR6A 3ARDB 2VLLB 3ARBB 2VLRD 3DRTA 5D2LA 4MLIA 3DGGA 2DOCA 4XMKL 2PW2A 1KB5B 4NQXA 1QFWH 5D7LE 4MSWB 1AD0A 4GRWF 1KGCE 1BJMA 4RFNB 3BW9B 3UJTL 3ZHLA 4FQXD 4FQHA 1G7HA 4ZUSA 1ZOXA 4JG1H 4ONHB 35C8H 2VE6B 1TZIA 2YPLB 2AI0L 2ZOLA 2VQ1A 2UV3A 5C0CD 3TNMB 3M1BA 3RZCD 1RZKL 2OSLB 1KSRA 3DOSA 3LN5B 2YEZA 1SJEB 1IL1A 4JFOB 4DGVL 1ZLVK 1YYML 5CSGA 2CO6B 3FFCD 4XVJL 1T83A 1U91A 1ZLUK 35C8L 4CRPA 4O4YH 4Z7QF 3MJ7B 3RTQB 1KJ2A 4HULB 4KROC 1NDGA 5E94A 1BM3L 3ZKXB 1EX0A 4G9FD 2GJ6E 1XIWD 3UTSB 3O6LH 4MD5B 5FIEA 4Z77A 3NZ8A 5T33L 1RIHH 2C3WA 3NGBB 4OTXL 4HGWB 4P4KD 4S2SB 2HTKC 3TIDB 5GGVH 4BFEA 4UV7H 3B9KD 1NQBA 2DJ4A 4J3SA 4IRSB 1JWMB 1CDJA 1QBML 5EOQH 4MS8C 3RIAF 1GGIL 2HWZL 3REVA 4FTVD 1EERB 4TN9A 4UQ2B 5EO0A 1CZ8H 3ES6A 4U0QB 4HUMB 1D9KB 1I3GL 2VDLL 4LP5A 3OJDB 4XAKE 3F5WA 3VXOB 2NY2C 1BJ1J 3ZT7A 4NCC2 5B8CB 2Y23A 1GZPB 3VXUB 4J3WA 3CX5J 3D2UD 2E6QA 3EDKA 2VR5A 4WIQA 5AZ2L 3NCFB 5BOPA 3FONA 3C60B 3OR7A 2H8PA 2ZG1A 4QCIA 5C3TA 1R3IH 1LVEA 5DHXB 3GSWB 3V4PH 1MJ7H 4JFDB 3PWVB 2F5AL 5D6DA 3CSYB 3QJHA 4XI5D 3HG1D 3L6FA 5JIHA 2Q7YA 4DZBB 5ETUA 3GBNL 5DHYA 4G8EA 1O0VA 3FQNA 1YN6A 4LKCB 5GGRA 3HR6A 1MEXH 5J3HC 3M17B 3DXAE 4JRYA 5IVXB 1Q94B 2C26A 2VSCA 2D2OA 4MCZA 1G9MC 4JM4L 5C0JA 4YE4H 4MCYB 3PWPB 1OSZB 3AROA 3KAAA 5I1IL 1RSFA 3DX8A 1S9XA 2XNAA 5DRXB 4OZFH 2O5YH 1MEXL 1D7FA 4F33A 3KR3H 3DJ9A 2XZQL 4HDIA 1ADQH 5F9OL 1BGXH 2ADGA 5CJ8A 4QYOB 5C6WH 1AI1H 3C5JB 2AK4E 1NDMA 4XNXH 1V8HA 5T1DH 2HT2C 4RAUB 3QUXC 5FGCB 4MQXC 4C55A 4EOWH 3IETA 4X4XB 4Q58C 4OGXL 5F3BA 4IMKC 1G9NC 4F58L 1OPGH 2O5YL 5D1QA 2UY7A 5TDNB 5JW4M 4MA1B 1QSFD 4HBQA 1S9YB 4IOIA 3VGHA 4CVZA 1FIGH 4NKOB 5FHAL 5CJQH 4HK3J 4PJ9C 3H7BB 1B0RB 2Y72A 3D39E 2GK0B 4IRJD 4LIQE 3T3ME 2Q6WB 4LRNH 4Z5RB 3X14A 4OLYL 2EDOA 2CKNA 3TV3H 4GH7B 1U8IB 3PL6C 5IM7A 4N0UA 4H8WH 3VGAC 1OAZL 3IDMB 4FQJL 2C3GA 2WINA 3D18B 1CG9A 3SKOA 1ORSB 1S7QA 3V6FB 3S7GA 1VFBA 1HYSC 1CFSA 3S3JA 1WGOA 5C08D 1DBMH 1LP9A 2P43B 1PKOA 2VOTA 4WUUA 1WZKA 5DK2A 4KZEL 2IC2A 4PYHA 3IVKB 4QRSB 1WBZA 4X0KA 1CIUA 2OZ4L 3QIBD 4ODSH 1RMFL 5EUOE 5KBNC 2H1PL 3LD8B 1MCQA 3WXVL 2EO1A 1BOYA 2R0LL 3ARDD 4Y5YA 3ZTNL 5EPMB 2IPUK 2F8VA 4G9DA 2B1AH 5IK3B 1E28B 3SJVA 1AGEB 4HMEA 4LLMA 3K4DA 3G5YA 4Q2ZB 4DGIH 3HTLX 5F3HB 4PIRF 2QKIA 3CMOL 3KPRA 1DBBH 3BPOC 4LF3A 1ZMYA 3WE6A 2WUBL 5DJZB 4I4WA 2WIMA 2YPLD 4EBQH 1F6AB 4F8TA 3DECA 3RWFA 1T7XA 1NGYB 2Y06L 1AQDB 1A1NA 2R2BB 3U83A 1FPTH 5HGGS 3L3OB 3ZHKA 1R3KB 1RIVH 4M48L 4PJBB 2XWJB 3AREA 3OGCB 1NLDL 1GIGH 4N5ED 2BNUB 3MACL 5DRNA 4YHOH 1VSCA 4OLXH 4JQIH 4U1IA 2GK2A 1NFDB 4PJ5B 3PGFH 4NSKA 5ICZB 4NHUA 2GY5A 2MCPH 1ODAA 3HCVA 3OTTA 4PRIA 1T7ZA 4X9IA 3UTSD 3OAYK 3P4NA 4WFFD 3LKSA 1B4JH 1UCBL 1L0XA 3S97C 4B50A 2AJUH 3NABL 4HS8H 4G6FB 4KJPC 1N5YL 2EYTA 5C0RL 5F1KC 1CE6B 4YBQD 1P7QB 2MTPA 2O26U 1QLRA 3HC4L 4IRSD 1WBXB 5FM5M 4FQXC 5DQJA 4NO5B 2MCPL 4YH6A 3SKNB 5HI5D 1AHWA 1KN4L 5HHMD 1MH5A 2APBA 4U1HB 1D9KD 4R4NC 2X4SA 1S7WB 1YJDC 2N1KA 2Z8VC 2W65A 3VXUD 4M93C 1TQBB 1OTSC 3QHFH 1M4KA 3BXNB 1A1MA 3S96A 5D7JA 2C1OB 4G80A 1INQA 1K4DA 1A6VH 3C60D 4XRCB 3ZO0A 1T20B 3U0PB 5I1HH 1MFCL 3QULA 5ESAB 4JFDD 3VFSA 3WUWB 2A77H 3F7VA 4P3DA 4HUVB 5INDA 1VERA 1A47A 2E9JA 4YGAB 2NY5C 5FDYA 4P23B 5D5MF 2I5YH 3QHFL 4P4KC 4RNRB 1YMHB 2A0LD 3IXAA 1D5XA 3L5XL 4MD4B 3IDUA 5FM5O 3B9KC 2CIKA 3QXUA 1NEZB 4JCMA 4OCXL 2A77L 2B2XH 5FO7A 2OZ4A 5BJTB 3PWPD 3PP4L 4XCYB 1EXUB 4M6OH 1WBYB 1MI5B 1ZT1B 3IYLW 1QFHA 4HK0A 2FBOJ 1BREA 1OW0A 4ZUVB 2Y7QB 1REIA 5F89B 1S9WA 1HE7A 4L4TD 2FNBA 3V6BR 2H26B 4D9QE 5E7FA 3G04B 4Y4FA 5FKPA 5FCUL 1AFVH 1A22B 1YEJL 5KSAA 3OJVC 5JLZA 5H35A 4NNXB 4DZ8B 1H0DB 1RU9H 1U95B 3HI6H 1VFUA 2D7NA 4FA8A 3DTXB 4LLWA 4RGND 4LLQA 3FRPG 3T3PE 4IEFB 4J1UB 2OJEB 4D0DB 5I6XB 1JZ7A 1T2JA 3AU1B 5EBMB 4K2UL 5GS0D 3SDXF 1HOCA 3VWKB 3VCLA 3IGAA 4XC1L 4Q9QH 3EOBB 4I3SH 3ZMRA 1IZKA 3S37X 2QR0A 4OCYL 5T3ZH 4OJFH 2C3XA 2W0PA 2BOCB 1QSVA 2ZCLL 3T8XA 3ZYOA 4HUNB 2IANE 1I7UA 4JPKL 3FFDB 3BP7B 1M6OB 3O41A 1WICA 1ZK9A 3GMNA 1FO0L 1JNNL 2MFNA 1DVFB 1WWCA 4K94C 4M9OA 5FO9B 5DJCB 1LDSA 1UM5H 4NNPL 1SMAA 4JO1L 1FORH 3LIZH 3B5HA 2QHRH 4LCUA 1A0QL 3UXFA 4PJDA 4OZGB 4PBWD 3OKMB 1HHGA 1KENL 3UJIL 1TVHB 1VA9A 4Y19D 1DBJH 4G6KL 3RP1A 3IJHB 1KJVB 3WN5A 4ALAL 3MXWL 4L3EA 3S34H 1FV1A 4LLVB 5DUBB 1NBYB 2Y07H 3CCHA 2DQDH 4GRMA 4N0UE 1K8DA 4O58H 5CSZA 1A3RL 4KKCC 1LO3H 2XRAL 3LIZL 4EDXA 4XVUD 1OT2A 3NAAL 4N8VG 4KQ4L 1ITBB 2UUDH 5BCAA 4U7SA 1GOFA 1X4YA 5EORL 5F1NA 2VL4A 1EVUA 1HH6B 1DBJL 4ORGA 4IRJC 3H9HB 5BVJA 1WQVT 3C5ZB 1QHPA 3DX9A 2Y07L 3DMMA 4DEPB 3IKKA 1AKJB 2CDGA 5IEHB 3SE4A 1MREH 1Z5LA 1G9ML 5D6CA 4UQ3B 2CRMA 2ARJA 1YY8A 3FTGB 2W60B 3KPMB 3PNWA 4Y4KA 4JFPA 3QDGD 4U1JB 1RZFL 2CKBL 1S7TA 4YHKH 1YC8A 1Z3GL 5JA8B 2P24A 1SYVB 5JOEA 1WVZA 4JLRB 4PJ5D 2WANA 2JTDA 3QQ4A 3BKYH 3O45A 5DMIL 3LKOA 1HXYA 1MFNA 3RUGA 1N5AA 4Z7VA 4PJEA 1CDBA 3DV4B 5KZCD 3HB3D 1IGTB 2RIKA 4NNYB 4F7PB 3WKML 4V2CB 1T2QH 4LMQE 2Q8AL 2HJKB 4HHAB 4K7PX 1P7QD 4WI6A 3RKPA 2FEEI 2PXYB 5A3ID 1G9NL 1LO2L 5L2KD 4PRNA 5BXFB 5KVGL 3HI5L 1AGDB 5F44A 2AP2A 4PB0H 1KYOK 4POZC 4PUBL 2QL1A 1Q9WB 4F2MA 2ITCB 4PRIE 3RVWD 5IGXL 4YGVA 3H7LA 4AIZA 1VGEH 1CFTA 3LEYH 4P46C 3MV9E 4POYA 1T2QL 1H5BB 2J6EH 1I3RA 1A2YB 1KPUA 2NTFA 4H1LB 2VABA 4NCDA 3WIIL 3DETD 4HBCH 4P2OA 4N5EC 4ODTL 3CFCH 1GRWA 1EAJA 5JR1L 1DUZB 5H2BB 4OUUB 4U0RC 3WEXB 3VD4A 1FO0A 4KTDH 3VW3H 4JVUA 2HFTA 3UYOD 3SQOL 3TO4B 5HHOE 1N8ZA 5L7XH 4JFQA 5I1GL 5I1EL 3W5MA 3NCEB 3GSXA 2ZUVA 5DYOB 3LEVL 1WK0A 1B4RA 5IMOB 4Y1AE 4IRSC 4APQB 5JOFB 5IW6B 1TJHL 4R97C 3WSQL 1BQHG 1WEJH 3T0ED 5DT1H 3ZDYE 1N59A 4ODXA 1Y0LB 4GQ9L 2CUMA 3WFHA 1L7TL 3O4LB 2QHLA 4QXTA 4XPHH 4PJCA 1AQKH 3HPLA 5IG7B 2BOBB 1I3VA 5CUSL 1HXMA 4N0RA 2PW1B 5HGBA 2NY4C 1X5JA 3OAZH 5ESQA 5HHPB 4QHNA 2OBGA 3P11H 3PHQB 4I0CC 2Z31B 3QI9D 3QDAA 3EW3B 1RZ8B 3VFUA 1ZSDB 3MRKB 1IBGH 3QHZH 2V2XB 3O3EB 2GTZA 1IGIH 1T89C 3MUZ1 2EXYC 3RDTB 4JM2B 1ONQB 2WIIA 1Q38A 1UXWB 4L8CB 3ARRA 3GMLB 4OFIA 3VFWA 4F9PC 1U3HB 3S88L 4R7DB 1NGXA 3CJJA 1RUAL 2XZZA 4KK5C 1MIML 2V6HA 3I9GL 1X4ZA 3VWKD 4A6YH 1YA5A 3NPSC 3ZDZF 5KTEH 1XF2A 4WUKH 1B2WL 1QA9B 4Q6IB 2R1YB 4X6CF 2CIIA 5BRZA 4BFIA 5GSVA 1LEIB 5CKAA 3U4AA 4QHMA 1Q1JL 5DEFB 4HKZA 4ZOEA 5J1AA 5CJBA 4LSVH 3FB8A 1CLZL 4MWFB 3UAJD 1PY9A 3C6SB 4NPYB 2B8OT 4AEEA 2OJZH 3QUXA 4XC3H 1MCRA 1DVFD 5HHVH 4HCRH 3VXNB 3ALWA 2XTLA 4ODWA 1T22B 2ICCA 4R4BB 5AUMA 4OM1H 2X9XA 2V9QA 3INUL 2X44D 1NC4A 1OD9A 1V3LA 1YJDL 4FS0A 2ESVD 3ROOA 1MFDH 3TBVA 2NY5H 5C2BH 2X7LA 5KN5B 2OJZL 4ZQKB 2X5PA 4RGNC 1T03L 1ORQA 1HSAB 3C6LA 1I9RL 2DLHA 5I30H 4X5XB 4XP9L 3L9RA 1LD9A 4WU7B 4LKXB 4K7FB 4FXGA 1WZ1H 5HHQB 3PL6A 4TRPL 1BEYH 1W0VB 3KWWB 4HQQH 3HI1A 4ZAKB 1NCDH 3QEUA 4MA7L 2DDQH 4HAGA 4P2RB 2M2DA 3FOLA 2E6PA 4XVTL 3SDAB 3C5SA 2H2SD 1ZA6B 1U58A 5CSBA 1JE6A 2JB6A 3LEXA 3WFCL 4NC1C 4AL8L 2JF1A 3QDJB 4QOKA 4UDUA 3U2SB 3QDMB 1BEYL 3MRDB 3TWCH 3O2DL 1NCDL 3CH1B 3H9SD 1J05A 3P40A 4OIIL 4DOHE 3QUMH 3OZ9L 1X7QA 3WFZA 2ID5A 1P9MA 4R3SA 4KJQC 2FH6A 4UT9H 5H8DA 1ZT4B 4MJID 4IMLA 4G7VH 2XACC 2FX7H 1HHKB 3MJ9L 1JGVH 1PX4A 3QFDA 3EYSL 4JDTH 4R0LB 5DS8A 3T4YA 3VXMA 1DQLH 4PGCA 1G7QA 1GL4B 5ID1A 4PLOB 2F53D 3X12A 1KPRB 5D8JH 3EGSB 1FJ1B 4GKSB 2YD3A 3NACH 2R0KH 1D3CA 2QADB 4N68A 1NUGA 2A73A 3O2WL 5D1ZC 2BNQB 3MCKA 4PJFE 1EEYA 1DSFH 1WCBB 1GCFA 2R29H 5I9QB 5I16B 1A6UL 3LMJH 3LRSA 1FFQA 3OB8A 3VGEA 4XXCC 1J88A 1IC4L 4QGTA 4R90H 5EU6A 1EUUA 3K81A 1ZXQA 3KS0H 3TBSA 3RWHA 4KRMB 3FB6A 4PV9A 2YC1A 5AZEH 1OVZA 4IDLA 5E9DA 4NN7B 5B3JF 1ACYL 5DC9B 1W0WA 1JYVA 4KAQL 2DJUA 3MBXH 1MCHA 2R29L 1U42A 2DBLH 5GJSL 3TZVC 4K94L 2WMPA 5E8EB 1NGWA 4HG4K 5AWNL 5IB2A 2VLKE 4HS3B 1A9BB 3MJGX 3P0YH 2IAMA 3TT1H 4CMHB 2P8MB 1A4KB 1OP3K 3TO4D 4KGJA 4NO0A 5GGSA 2P48B 4LEOB 2VERN 1BF2A 4NRYA 1RZGB 1CK0H 3LOWA 1QACA 2LQRA 3F7YA 2E7CA 4B7LA 4YZFE 3CVHB 5GJTL 5A3IC 3TT1L 3OXRA 1XGPA 1R3LB 1XH3B 3MLTB 2X9YA 3VG9B 1G1YA 1FL3A 5TDPA 1ES0B 3RVWC 1YN7B 5LCVH 4WTWA 2OI9B 1CK0L 1QFWI 2AVGA 1UB5B 5CBAB 5I19H 1PD6A 3MLVL 1HINL 3D0VA 1RPQA 4G6AD 5HHNA 5ADOH 2Z31D 2I25N 3ZE1E 4GAYB 5IHBA 3CVIL 3DETC 5EBWB 1KYOJ 5KS9B 3PIQB 3KJ4C 2KPNA 2DLEA 2AKRA 2IBBA 1U3HD 1FVEB 2ZJSH 4DKFL 2XWBB 3O2DA 4OZ4B 5ALBH 5FO8B 4NQDA 5DJYB 4MXVF 3T2NH 4LPTA 4DCQA 4M6NH 4QRQB 5D7IF 3K4ZA 3O3BA 4GAFB 4E0RA 4YXHH 3SKUD 3V5HB 3MJ9A 1HHJA 3WS6C 1D5ZB 3T0EC 3ULUC 4X7DC 4DW2L 5EN2B 5IR1A 4K9EC 2VITB 1A9EB 5KSUA 1CE1L 4HF5H 4U1KA 1CXIA 3SE3A 1F4WH 3NFSL 5C6TL 3KYMB 4NRXB 3LN4B 4O2EB 5JQ6L 2LAGB 2MMXA 3FT4B 3MJ6A 1JHKH 5GGSY 1CFBA 4YNYB 2P5EB 2GKIA 4S1SL 4RAHA 2DKSA 3HS0A 3DUSA 5J7CC 5HGHB 2A74A 3JV4A 3QI9C 3SO3B 3UC0H 1LO5B 4ZXBD 5C07B 1DQQA 3EYUL 3U9PH 2WBJD 3BH8B 1CICA 3MGOA 2ZSVA 4TUOB 5DJ0B 3CU7A 3HNTL 2XZCH 4C56B 1NBZA 3G5XB 4EN3C 5C0IA 1BOGA 2JELL 3THMH 7FABL 2R56L 2ILLA 5DFTA 4KPHH 1U92B 4M7KL 1BAFL 4LMQI 5DEGB 4NBXB 5EU4B 2ERJC 7CGTA 1ZLWH 4P2RD 4YAQA 4ZOCA 2EEDA 3U48A 3TA3A 1P2CB 3SDAD 4JDZB 1YY9D 3B83A 3X11B 2V5MA 4NKDA 4ZUTB 3S4SG 3UAJC 5IMLA 1NFIA 4J3OC 2FBJL 2FSEA 3GSQB 3LZFH 1PYWB 2FX9L 3X3GL 2UYLA 4UV4L 1CU4L 4KKAC 2EC9U 1IM3A 5GIRB 3T09A 5J12B 1RD6A 2EDTA 3QIWC 1U8MB 3QQ9D 1C5DA 4JHAL 4H5SA 1ZHNA 2HJFB 5DMJB 4JZOB 3V4UH 5MI0B 1T5XA 1FZOA 4M7LH 1G6RL 4M3JA 2P46B 2ZPKL 1IAIM 4JKKA 1UA6L 1HKLL 5E08L 3TCXA 3EDDA 1F90L 3T04D 2FIKA 5CJXA 1I8KB 5KW9L 1DJSA 1A5FH 4OZIA 1R5IA 2QADD 2DLFL 3BWAA 1MFBL 5JXED 3N9GH 8FABB 1Z6JT 4NKIH 2J88L 1A7RL 2Z8WC 3OR6A 5A2JH 5LGHH 3L3GB 2FX8H 4RMSA 4N8CH 2R69H 3Q6FA 3KLAA 1F3DJ 2M26A 1UKTA 1XF3A 1JPFA 3GIVA 5I1CH 1ZGLA 1KXVC 5HVHB 1JCKA 4JG0L 1A5FL 2R4SL 4X4YB 5D7KE 4DKDC 3REWA 3U7WL 1Z9MA 4M7JH 1J7VR 4G8GE 2W9DL 5I1LB 5F88A 1K2DA 2FX8L 3I3BA 3BEWA 5IHZB 4LPCA 4KU1A 2B5IB 4KFZC 3PWLA 4Q0XL 5T3XD 5GS0H 3VFMA 5GZOD 4HWUA 4PTUA 4Z7WB 4NJ9H 3VFTB 5MP6H 1QBLL 2DQJH 3DHMA 5FECA 3CDYA 5ADPH 5IVXF 2AV1A 3F6LA 4YQXH 3MRLB 3NA9H 3MPCA 1NCTA 5IUSA 3WO3B 2C3VB 3LKRB 5EOCH 5FYKD 3SY0A 3P77A 4P46A 3MV7A 3MLUL 4GG8B 2VLRE 1QYGH 1T1YA 2HKFL 2BSRA 5DURB 5GGTA 3RNKA 1BZ9B 5FYKU 5B38A 4XAWH 1FNSL 5C09A 5JW3H 5HI4C 5I8KH 1OL0A 1IAOB 1DE4A 3W11C 5GRJL 1WZMA 5D1XB 2VXTL 5EOCL 3CFEB 2E8YA 4NOBA 1R5WA 2ED9A 5BQ7A 5A2LH 4G8IB 4KI5D 1EGJH 4Y16C 5HI3D 1TNMA 3KXFA 1QR4A 5CILH 5ACZA 1I85C 3QEHB 3WIHH 3CUPB 1QRKA 4I77H 1N0LA 3FT3A 4X7FC 4H88L 4LHUG 3GZKA 2OQJA 2FATL 3FFCE 3EBAA 4TNWF 1UWEL 2DTML 2YRLA 3S36L 1E27A 1I7ZB 3RA7L 4HH8A 1OCWL 4GG6A 5I76B 1I1FB 2W38A 4ONGL 4R2GB 1RJLB 1MRDH 2FJHA 4IDJL 5HGAB 3MCLH 5F97E 4AG4H 3RBGA 4HG4J 1M71B 4EVNB 5E5UB 2EDJA 5HY9A 3VXRA 1RK1A 5EU5A 2IGFL 2KUTA 1EO8H 3U4EB 2P5WE 4PJHB 3JV5A 5IJVA 4HLJA 5H37G 1JK8A 5KVEH 3T2PA 2OTUA 1BBDL 5KVMC 5INCA 4R8WH 1V3MA 4XVSH 5D93B 4KUCD 3RIAK 4FTVE 4RMUA 1FZMB 2DN7A 5CEYA 3GUTB 5ALCL 1KTLB 4AG4L 2P5ED 2XICA 2F58L 4PR5A 4G6AC 4JFFD 3E1F1 1FDLL 5ACMA 4HPYL 3Q1SH 5C07D 4GKZB 4N0YH 3RWCB 3GGWA 1OOAA 4YBLC 3IXTA 1JN6B 3KYNA 4S1QH 4P57A 4UB0L 3LPGA 4EZMA 4H0HB 4FOMA 4JY6B 1DL7H 2DKUA 5IVZB 4PJ8A 5EC1A 3RPIA 3KHQA 3PGCB 4LCCB 4JZNB 5DA4A 3P73A 12E8L 1BVKA 4WW1B 1U8KB 3DYPA 4G42B 1HHHB 1GZQB 1NJ9B 3RWDA 4L8SB 5BV7L 3BP5B 4DWHA 1YMME 3RWEB 4PJBF 3K2UH 2CUHA 4DGYL 4N9OB 4ZUUB 3LQAC 3U4BL 1I1CA 5C8JB 1AIFB 1NFDF 1VPOL 4RAVB 3MRHB 5I1JL 4WHTA 1OY3B 1ZA3A 4NQVA 1RULL 1PQZA 2XWTA 2OMBA 4NWTL 2A1WL 4ZXBC 3RHWK 5DF0A 4F8QA 2GQHA 1NH6A 1BIIB 2WBJC 4ZSOE 2APTA 1DFBL 4A2MA 4WCYL 5BVPL 3DUUB 4HIHA 4JAMA 3DO7B 1MRFL 4PRPB 4HWEH 1PGRB 4WI4A 4XXDA 4P5TC 1F8TL 1HI6B 2CDFB 2WLZA 3CGTA 4FFVC 1OAUL 3CU1A 5E2TH 1JGEB 3OV6A 4K71C 4Y89A 2CJUH 2IWGA 4IHOB 2FJFA 4E5XB 3IDJB 5KAQF 3AMLA 3SDAC 2K3TA 1YY9C 4OIAA 2V5RA 1UGNA 1BQSA 4HV8B 3DNKA 3VWJB 3O3DA 5F6HI 3LSOB 1I4FB 3ULUL 4ZFOL 3L3HB 4K9EL 4B0MM 3VE0B 1GH7A 1JGDA 4LSSL 1GHFH 1RUKL 5ITBH 1QR1B 4D0BA 1UJ3A 5KOVC 1K4CB 4JRXB 5D72H 3NH7L 3WHXA 2CLRA 1NLBH 1QRNB 3IB4A 5D1ZA 4P2QB 2AABH 4PJIB 4S0TD 4P9HL 5C08E 4BKLA 5KVDH 1YEIH 2HKHL 4AIOA 3H42H 1M7XA 3BISA 1GHFL 4LQFH 4TVPL 3ZYZA 5HPOA 3HMWH 1KIPB 3CLEL 3HZYB 2DQEL 5KSBE 1JZ5A 5ICYB 5JXEC 3ALPA 5DURD 2ICWA 3O2VH 1UWGL 2XFXA 3JTTB 2BP3A 4QLRA 3UBXG 3KPPB 4U6HA 4YDKL 3PQYD 1ZEAL 2XKNA 3BMWA 1G7LA 1MPAH 2X4RA 4I0PD 1UADC 2HLFD 2K9UA 3QCUH 2Z4QA 2M8XA 5HJ3A 4X80L 1TVBB 5DMYA 2V7HB 1UACL 1CFQA 3W9EA 4JFEA 1AXTL 4JKWA 5CEZD 3KPNB 5GSRA 2H3NB 3O6FA 3NMEA 2K1MA 3MYZA 3P0VH 4F7MB 1D6VL 3UPRA 4BH7B 1YQ2A 1E6JL 5TGBA 4DK6A 3C08L 1MPAL 3KPSA 1MCBA 4HLZG 3PGDA 3LRHA 2X4OB 3UDWC 5C0AA 4X6DB 4GS7C 1LE5A 1UCTA 3IFPA 4P49A 1WFNA 4RSVA 1JGUH 1JWUB 4R7NA 5FF6A 1LDPL 1YEEH 4M5ZL 4WEBL 4O2CB 4WFFE 2HJLA 1DQJA 1PG7L 4UINL 2VISB 1EMTH 3S9DB 4NC2B 5LVEA 3D9AH 4OF7A 1NCWL 1FZJA 1TZHB 2R0ZL 4RISH 5HGDA 3UJJL 3EFFB 4NT6B 4M5YH 5F7NC 2MOVA 1BHGA 4HIIA 4XGZB 4GKNA 1CTOA 3MNVA 4OZGF 5GS1C 6FABH 3T0VA 5D2NA 4BFGA 1A7QH 4HX1B 5HHME 3E0GA 3BZDA 2WAHA 2YD2A 4U4BA 3ALXA 2VDPH 4NM4H 5K9JL 5HI3C 2JJVA 4BZ1H 2NY7L 3C09B 3I3DA 4PJXB 5ID0B 4Y5XB 1RHHA 4O51A 4K3GA 4WI5A 4X7SH 1TIUA 3STLB 4OZHE 1IAKB 3TBYA 3LQZB 3WS6A 1SYSA 2BY3A 3CZFB 2CK0L 4ODHH 2V2TA 3EFDL 3LHPH 3BEVA 3KYKL 2A6DB 5CZVL 5GGVY 2V9TA 1J12A 2OLDA 3QP3A 5E7BA 3MLSL 5DR5L 1A1OA 2XTJB 5MEPB 5TQ2L 4RIRA 4CADB 4QRPE 5DJ8B 5DD3L 2CQVA 1NAMB 4QTHB 4L29A 3KPQB 3HUJB 5BZDA 2M1KA 4MNHB 4V1DE 4H1LH 2EYSA 2FECL 2A83A 1UQSA 2F5BL 1C1EL 3UZEA 3MBEA 1P84K 1FL5B 3O9WB 5IQ9A 4FQ1L 4QTIH 4LASH 4YDLB 4OD3L 4GAJL 2Q3AA 5L2JB 3X3FH 1DUYB 4X7EC 2IH3B 4Z0XB 4M7ZC 4MAYC 5DMGD 4L4TE 3VDAA 4NHCL 4FNLH 1SJVA 5TE4L 3UTTA 2R2EA 3EO9H 3STBA 5GRUL 1Y18A 4L8DA 1QNZH 2B4CH 3DO3A 2C4FT 4ZFFA 43C9A 4FQIH 5DA0B 4CU7A 1ZWIB 3VMOA 1IT9L 1YQVH 3C2AH 2D7TH 2WK2A 4NZDA 4RGNE 1SEBA 4PRPD 3BUYB 1XCTA 3MOQA 2XYCA 3OG4B 4K8RH 3GMQA 4X6EA 2IALA 2VDOL 1I9JL 3V7AE 4BK4A 5IQ7H 3QIWA 2DMCA 3L7EB 3HLAA 2O61B 4BSVB 5IKCB 1I3UA 5E8NA 3CDGA 2X4PA 3VWJD 3H3KA 5F1OB 5ILTH 3B9VA 3BESR 2YPKB 1JTPA 4OGZA 5D9SA 4NN6B 4RX4D 1HN1A 2Z91B 4LEXL 4NC1E 5DQ9B 2XA8H 4WI3A 1VKXB 3WJLC 5ISZA 2RCSL 1AO7A 2GJ6B 3QXWA 3DV6A 3ZDXF 4JRXD 4YXLH 4LHUD 3BIKA 1QRND 3G5VA 4P2QD 5JPNA 1IQDB 5K93A 4F15C 3QFJA 4NYLA 3MRJB 2Q8BH 1OGAB 4C4KT 5HYIA 1KULA 1KFAH 2WWMC 4Y19E 5DFWH 1MCOH 2VQUA 1YNLH 4PD4K 4PGEB 3MLPA 1YYLL 5GGUB 5DJAB 5EIVA 4XMPL 1G7IA 3MA9H 3LQAH 1K8IB 4PREA 4NO2B 3DRQA 5IB5B 3U0TB 2O5ZL 1U8LA 3IFNL 4M9PA 1RJYA 2NMSA 3NCCB 4HWBL 3KDMB 4U6VH 1IM9A 2OS7A 5EC2A 2X9WA 5IOPA 4WO4C 4IIQC 1KFAL 4LU5H 2AJXH 1JI1A 1YNLL 5FAAA 3RL1B 5K33A 1E4XH 4IOFC 4KKBD 1ZKAA 4WTXA 2JKXA 2YBRB 3GSNB 2J4WL 4JM2F 5IT2L 1F2QA 3WLWC 5I71B 3H2WA 4PRBA 1C5CH 1GSMA 3KPLB 4GSDH 1OARL 4YUEH 4EUPB 2LVEA 1X5LA 4PJBE 1B6UA 4GLRI 4PRAB 4F7CA 2B5IC 1UXSB 3QDGE 2I07B 3DSFH 3HRPA 4JY5H 2W92A 3EYQD 1L7IH 4YEEA 5CMAB 5I2IA 3V6ZB 1I75A 4PJ5E 2ZG3A 1HILA 3DXAB 1A7BA 3MRRA 5IESL 2OL3B 4F80A 3NN8B 1G7JB 2A9NH 2RJMA 4MLSA 5FYLD 4XNZB 1C5CL 4XHQA 4YUEL 5IMKB 4R96B 4LARH 3H3PH 3O8XC 1KIUA 4TULL 1BFSA 4Y16A 5T5FH 4XPGH 5I73C 3PWNA 4ZPTA 2UUDK 5AYQA 4AMKL 2NX5A 1I85A 1QZ1A 3R06A 1YPZA 5E00A 5E95B 4XPBH 5L2KE 2YPVH 4X8JA 4S0SD 2VC2L 2ZNWA 3R1GL 3DVNB 4JQVC 5FOBB 3FRPA 4I0PC 2EDFA 2A9NL 4OD2A 3RU8H 2HLFC 3P30L 5HYSB 4UIMA 3OBAA 3MRNA 4Z76B 2AK4B 1JZ3A 1T1WB 3B4NA 4GT7A 3EJZD 3ARQA 2NY3B 3FAWA 4JJ5B 1NMCB 3ZL4L 4JN1L 2XY1A 4XWGL 3FRUA 3CMGA 3SDYL 2HFGL 2YZ8A 3FZUD 3P4OB 5E1HB 5I17A 3QZWB 2RR3A 1QP1A 3QG7L 3RU8L 1WAAF 3SCMB 3GSRB 1QSZA 4UIKH 3D39B 3GNML 2PYFA 3UZQA 3KPOB 2WWKT 5F7FA 3SDDC 1IKFL 1S78D 5GHWL 5KJRL 3V4VL 4NQUA 1JZ4A 4XH2A 2XTJD 1HWHB 3T08A 3NIGF 3MZTA 3SGEH 5E70A 1QSEB 2VB5A 4GW5B 1P1ZB 3BKML 1S9VB 3HC0A 2A6IA 1FNAA 4QT5B 3WL9B 3B8YA 4OF8A 1UVQB 4PG9A 3DBXB 2Q76B 1ZLVH 1WFTA 3T0EE 3ULUE 3MLXH 3TO2B 4DKAA 2H32A 5LAXB 3O9WD 3CH8A 3V0WH 1ZLUH 2NZ9D 5T3XH 4X4MA 3I50H 2OP4H 4MJ5B 4P5MA 3OKEA 4LSRL 4YHMH 4PV8B 4KQ3H 5EUOB 5I1DB 4CBPA 5K9OA 4HWBA 5L8LB 3DURA 3WFBH 1F13A 4N8VA 4HT1H 4ZYKA 4MMXC 3RAJL 3UCRA 2DQCH 4M8QB 5E8PB 1G7MB 3IKCB 2NPLX 5HDBE 5FYKH 3S5LB 1XMWA 4D9LL 3N1FC 5DHVB 3TN0A 4LLYA 3CVHH 3ULSB 2EH8L 5FCSH 2QTEA 1KBGL 1RUPH 1DQDH 4OV5B 5F7EH 3QO0A 3HZMB 5F6IC 5ERWB 1G84A 3ARFB 5J9PB 5JORB 4HT1L 1CGXA 1ZV5A 4KHTH 3CSGA 3HPJA 4Y4HA 4M4PA 1KCKA 4YR6B 5FYKL 1NCBH 5D2LB 4KKLD 4OF3A 1JFQL 3FT2A 3H0TB 5HYJE 2PW2B 1A7NL 2R0WL 1EK3A 1AD0B 3NCJH 5C0GA 1JZ6A 2FZ3A 1AGFA 2DL9A 4FFWD 1XF4B 4FQHB 2FJGB 3IDXH 1ZHLB 1G7HB 2G9HB 3NOIA 4ZUSB 1HSBA 5FYJH 3Q5YA 2ORBH 2YA2A 2GJ6D 4P5TA 5HHXL 5JW5B 2HVJB 1HQRB 2ZOLB 1T6WA 2VQ1B 1UZ8B 3WJJA 4WW2B 1TCRB 5TQ0H 3V2AR 4M43H 3VXPB 1IL1B 3P4MA 1DLFH 1OGAD 3BQUC 3N1MC 1P84J 2ESVE 2XG5A 5BMFH 4NN5C 2CMRH 2F74A 5BS0A 1BBJB 1U91B 3FQRA 4XP1L 1NFKA 2AS5M 3TBTA 2X1XR 4OFYA 1B0GA 4HIJA 5CKGA 3GBML 1AO7E 3WNNA 1U93A 3GMOB 1SJHA 4Z77B 4XAKD 3QB7C 4W68A 5K59E 5DQDL 4KI5F 5JIKA 3FAXA 4DN4H 1C7SA 3IAPA 2R2HB 4Y5VC 3MLRH 3FO2A 3VWJC 2OK0H 5KS9F 1WFOA 3TYGL 1QEWA 2IPTH 4KTYA 3BHBA 4ZTOH 3REVB 4WV1A 2OX5A 1PZUB 5LGJB 4WGVB 1MF2L 1W8NA 2GHWB 3MREA 4PRDA 4K55A 3V5DA 3ES6B 2XQBL 4BSJA 3HE7C 2CGRH 1YNKH 3H9SE 3EHBD 4PGBA 1EBPA 2BVTA 2GTWA 3F5WB 2J6EA 2ADIB 4M61A 1BQHA 3C2SA 4KDWA 1YEHH 4Q97A 1IILE 4MJIE 2DQUH 5EBGA 3RWJA 3DXAD 3KGRA 2XXCB 3FJTA 5GGQH 2ZOKA 2IPTL 4KVNH 3RI5K 1GAFH 2ED8A 3FONB 1FAIH 1N0XL 3OR7B 2H8PB 5TE6L 4QCIB 3N85L 1H3WM 3GEWB 2F53E 4GAGH 2BVUA 2MPAH 4AEHH 1U8QA 1T80A 2VQTA 3K1KC 4OLVH 4KUCF 1LGVA 4PFEA 4EI5C 3QBTB 3QJHB 4F57L 5A16B 3BRGC 2Q7YB 4MD0A 2QQLL 4PJGF 3T1FA 5E03A 5DZLA 2EDBA 1AGBA 1CL7L 3FQNB 1AXSA 1AR2A 1BMGA 1PDKA 3GIZL 3BOVA 1I7TB 3W39A 1BJ8A 4JPWH 4LSPH 1AGCA 4G5ZL 4PD4J 4UILL 5D7SL 4HJ0D 4JRYB 4EEEA 1KLUB 4KKBC 3SN6N 3TT3H 2YR3A 1C5BH 3K1DA 3QA3A 4X6CA 5FHBL 4MCZB 2V2WA 5C0JB 4NUGH 3DPBA 5BO1H 2NY3D 5F6HJ 1KELL 3A0OA 3DVFA 3HNSL 4RGMC 5I75C 1GXEA 3VD7A 1FBIH 5FV2A 4DQOH 3D85A 1YPZE 2NXYC 4YIQB 4YWGH 4LSPL 2FR4B 3MLZH 3JWNC 3TT3L 2VDMH 3D39D 1I1AC 4OLZL 3RQ3A 3CXDL 1MJ8L 4MHHG 5BO1L 2IQ9L 4WWKA 4DAGH 1EJOH 2IANB 1UWXH 2W07A 1NDMB 1RUMH 1T0NB 3QH3A 1IGJA 1PLGL 4XCCH 4MNQA 1QSED 5F3BB 4ETQA 5E24E 1EZVY 4KK6D 1PG7X 1S7XB 3EYVA 5D1QB 1JWSA 4NWUL 5DK0A 4YXKH 4AJ0A 4ORZC 2VUYA 2QQNL 4CVZB 1S5HA 2R1WA 1UM4H 1A3LL 2HAZA 2I27N 3NCYP 3V52L 3D3VD 1MVUA 1N6QH 4UTBH 1QKZH 4XP5L 4XCFL 1A7OH 4JDVB 2COQA 5MERB 1DQML 2IPUG 2GFBB 3GKWL 1H3XA 1CFNA 4HJGB 2CLVA 2EZ0D 3HMXL 4LVOB 3C09C 1LO4L 2JLLA 4FFYL 4YX2H 5IM7B 3MLWH 2AJYH 4N0UB 4D9RD 1WISA 3FZUC 3R0MA 1ZHKB 2WINB 3QXAA 1OAYL 1S7QB 4LCIL 1VFBB 3VFGH 2VWEC 3RKDD 1D5BB 4AENA 1JRHH 4A2LA 1XIWA 1YEFH 1LP9B 4JFXB 2PO6A 3ARFD 2DQHL 3QUYA 1KCUL 4Z7OF 5DK2B 5MEND 1Q9OA 4JKMA 1WBZB 3OXSA 5C70A 3MGTA 3MO1A 4PRHE 5E1AA 1R3HA 3ARSA 4MAYA 3ZKQD 4NZUH 2YKLH 2FLRT 3RWIB 4G9DB 5CEZH 3AGVA 1U8NA 1VFAA 1H8NA 1KN2L 2G60H 2W0LA 4O9HH 3UPCA 1DTUA 2NR6C 4G8FA 4PLJD 4Z7WF 1KJ3L 1Q0YH 2V17L 1UEYA 3GHBL 2NZ9C 3KPRB 1E4JA 4JHWH 2ZUQB 1VCAA 4LF3B 3MQIA 3CK0H 4W4OC 4R4FH 3NZHH 4M6ML 5D71H 5B39B 1WSST 5CP3H 3KHOA 1FH5L 2XN9A 3ZKNC 4D94A 2AERT 3PWUB 1IGYA 3GBLA 4Y2DA 2BVEA 3AREB 3ARPA 4QXGL 4GMTL 1TMCB 4TSCL 1MCIA 2BFVL 5DRNB 4U1IB 2EIBA 5DJ6A 3HG1A 4NSKB 5LWYH 4R4FL 4Z7NE 1DR9A 3HCVB 4PRIB 1BQLH 4E42A 2FGZA 2HYMA 2VIRA 4WDIA 1VGKA 3MV9B 3TVMA 3BH9B 1CR9H 2HVKA 1FP5A 4I48A 2RHEA 5HD8D 3PV6A 3CXHK 4W4NA 1U8PA 1UJTA 2FL5A 1NMAL 3BZFA 3HRZA 3RVXC 1VADA 1X5IA 1P7KB 4FFWC 2ATKA 2JK5B 1HCFX 1RK0A 3LS4L 4QXWA 2MQ0A 4FZ8L 5HVWA 1OB1A 1QLEH 4LSUL 3VFRA 4ERSH 1CR9L 5HHOB 1CXFA 3N50A 4ZTPL 1MIEH 1ITCA 2X4SB 3J8F7 2BSSA 1ZANL 2UWEE 3LQMA 1QVOB 1F00I 4DUVA 4WO4A 4N1EA 2IMMA 4HXAL 3F62A 4IIQA 4Y1AB 4ZS6D 4G80B 4LNRB 3DYMA 2B0SL 1K4DB 3EKCA 2ARJQ 3O6KH 4PJHF 3A6BH 1TPXB 1WWBX 3HMXA 4LVHC 2V5SA 5JHDA 5T5NF 1J9CT 1U0QA 3F7VB 3D69A 5INDB 5CGMA 3GMPA 2D03L 4HIXL 1RJZB 3GRWH 1ZLWK 4NKMA 5E6IB 3EO1B 4D9QD 1A8JH 4BK5A 1LK2B 4XBEH 1C12B 3IXAB 3WO4C 4OLEA 2VL5A 5E5MB 4JRYD 2Y6SD 2CIKB 5B3NA 2VO5A 5D7IA 1MELA 1XZ0B 3E6HA 5FO7B 4ISVA 3BE1L 3CFIC 1J1XH 1OAKL 1FFPB 2IADB 2AEIT 1F3JA 4MJ6A 5GQBA 1I9EA 4HKXA 3O8XA 1I7RA 3F12B 3OB0H 3OKNA 1S9WB 4IRZL 4XBEL 5A2IH 4EIGB 2JCCE 4JREB 4YC2C 4X8XA 4GRLA 4Y4FB 5FKPB 2YUZA 3IRPX 5KSAB 5H35B 3SE8L 2HH0L 5T1LB 4HC1A 1SBSH 2IAND 3ARDA 1CBVH 4KMTH 2VLLA 3ARBA 1XCQB 2VZUA 3Q0HA 4LLQB 1ZHBB 1BD2A 4IS6A 4YDIH 1KB5A 5FYKE 4MSWA 2Z35B 1DEEB 5D1QD 3DIFA 3BGFC 2YRPA 4XMLL 3IGAB 2N7BA 1MRCH 3QWOA 4XPFH 1VENA 2NY6D 4ONHA 4HXBH 4WHCA 2MKWA 2VE6A 2QR0B 1F97A 2DM7A 5TPWL 3PE9A 1FGNH 1CBVL 1LQSR 4CL7A 3V79C 4JFZH 2VDKL 3TNMA 4OKVA 2D4DA 2VH5H 4XCNA 3QUZC 2H2PD 5DWUH 3TLRA 5ITFA 4JFOA 5F71A 5C9JB 3SDDA 4OI7A 1OAXL 5E99H 3O41B 4MNQE 4DUWA 3MFGB 2PNDA 1QFUL 2OCFD 4FABH 2DIBA 3QEQE 4YJZL 2BX5A 3MJ7A 1TJIL 3RTQA 1INDH 1FFOB 5J11C 2W9EH 4LCUB 4LFHG 3MMEB 4WUUD 4W81A 3ZKMD 4HGWA 4S2SA 4KV5F 2Y36H 3GMRB 4OQTH 1KTDB 3WN5B 5GXBB 2XIDA 3MUY1 4G6JH 1K8DB 2HRPH 3X17A 4DTGL 4DOHB 4EDXB 3VRLE 5BOZG 3S8WA 3UTZA 4EDWL 4UQ2A 1SQ2N 5CD5C 2FHFA 1CLYH 3EUUA 2R1XA 5I66A 2WP3O 2I9TB 3OJDA 3KPRD 5EOTB 4FQCH 3VXOA 5BVJB 2UZXB 5B8CA 1K3ZA 1HH9A 1GZPA 4FQQB 2AEPH 4I0KA 3CNKA 2P5EE 4L4JA 5GZND 5D6CB 1GC1H 2ARJB 2IH1A 4JFFE 1E4WL 5FYLH 3PNWB 3E6FB 5D4QA 4KRLB 4JFPB 3ARED 4MNGA 3KS0J 1F58L 3GSWA 4PJFB 3PWVA 5DLMH 2P24B 5I0ZA 5A2KH 4PJAA 1L0YA 4PRID 5DD5L 2X2YA 4LKCA 1NMBL 4Z7VB 4EQ3A 3HR5B 4FRWA 3MNZB 2HMIC 3QG6B 1A4JB 3NVQA 1V05A 4MCYA 2VTFA 1OSZA 1NBVL 3PWPA 4GXVH 1NCUA 4YHIB 4PRNB 4HSQA 1BZQK 3QPXH 3BQUA 2DI9A 4LRIA 2VLKB 4KY1H 4X6DF 2F8XC 5AYUL 1QLFA 3ARYA 1PSKH 1ZGLM 2YOCA 1N26A 2GAZB 1T1XB 4YGVB 2D0HA 4KROB 1CFTB 4GO6B 1I3RB 4QYOA 3NIFF 5IFHL 3QQ3A 5LXGL 4Z8FH 4Q74A 3C5JA 4MXWL 1UC6A 5J57B 1IQWH 2HT4D 2X1WL 4RAUA 1U8JB 4KRPD 1AY1L 3ILQD 1BQUA 4D2NA 4X4XA 1Q8MA 1T83C 1N7ML 2BVYA 1NAMH 3W82A 1NGPH 4RFEB 4DFIA 1RFDL 1FO0B 4ZPVB 4ZNCD 4NKOA 3BT2L 3P2TA 3VRIA 1RUQH 1E0OB 3RVUC 4JFQB 3H7BA 4KK9C 2GK0A 3HE7A 4HH9A 4MQTB 4PJXF 2NY2B 2YS4A 1CWVA 2LU7A 4HIEA 1DBAL 4UI2A 5L88L 1NGPL 4XB7A 4I9WE 3MRCB 4J4PC 3F65A 3QNYB 4S1RH 5JO5B 4GFTB 1FLRL 3P9LB 3IDMA 1RUQL 3WFHB 1ORSA 3G6JE 1U9KA 3B2VL 3V6FA 3CAFA 3OGOE 3GO1H 4JN2A 1A21A 1BWWA 5C0DB 5IBLD 1JMZA 1UYWL 1HXMB 5HGBB 1HZHL 5SWZA 1UM6L 3CXHJ 1GPOL 1EGJA 2X4UA 4Y4FD 4QHNB 3Q48A 3JZ7A 3RVTC 5KSAD 3VD9A 3IVKA 5DD6A 1IAIL 4P3CL 4ZS6C 4N5UA 3HUJF 1MJUH 2GTZB 1G7PA 1IC5L 3P4LA 3X13A 2WIIB 5D6DC 1E28A 1KOAA 1AGEA 1NGXB 4TPRL 1RZIB 1JJUA 1P4BH 5F3HA 1H8OA 2CKBB 3BPNB 3IFOA 5HVGB 3BPLC 5JMRA 2VRAA 3PQYE 4OB5L 1X5YA 4BFIB 5BRZB 1MAMH 2VZ1A 1F6AA 4QHMB 3BPCB 3HFMH 5GISL 4RWYH 1NGYA 4HKZB 3JTSA 5J1AB 1I1AA 4X5LA 1AQDA 3VXTB 2R2BA 3L3OA 1R3KA 2DQGH 3G9AB 2FD6L 4JQXA 1IC7H 2XWJA 1OWRM 3QUXB 5CINH 1A6WL 4LBEA 4X9FA 2BNUA 1GGBH 1W8OA 5LQBH 4L4VA 4ODWB 3KLDA 1E4XI 1MWAL 4WTZA 2ZCKH 1NFDA 1OSPH 1KC5H 1MAML 5DVLA 1UFUA 3HAEG 3CIQA 4JGUA 4JKLA 4KHXL 3ROOB 1JF1B 4PJ9B 3LS5L 2DQGL 3MROB 1ORQB 2GSGB 2WQRA 2ZUSA 1TQCC 1CE6A 1P7QA 1N64H 1GOGA 3L9RB 4EXPX 4TOYH 3OKLA 5D1QC 5C92A 1WBXA 4TUKH 4FXGB 2APWA 3GSNH 4O5LL 4NO5A 3BAEL 3PL6B 4J12A 3FKUS 2NY6C 4OSUL 4V2BA 2HTLD 3HNVH 3SKNA 3HI1B 2QSTA 3QEUB 4CU8A 4EUPH 4U1HA 1S5IH 3IJSB 3K7UA 1N6UA 2AXGA 4O00A 3C5SB 5BZWA 5E4EC 1HNGA 1S7WA 1OF2B 4X9GA 3T2OA 1QFPA 2IQAA 2JB6B 2H2PC 3LEXB 3DMMD 1G1CA 3BXNA 4ETYA 1O7SA 4RFOH 1CXEA 2JIXA 4QOKB 3QR2A 4UDUB 2OL3H 3AY4C 2C1OA 5L9DH 1MOEA 4QXUL 5B21A 4XRCA 2YUWA 3U7YH 4Y4KD 2DQTH 1J05B 1S8DB 4NUJB 5ESAA 5GRXG 4HWNA 2FWOA 3TYFB 1E6OH 4IMLB 2DYPB 3GI9H 4CAGA 4P23A 4RNRA 1FG2A 1YMHA 3T4YB 4MD4A 4DVRH 5ID1B 1CGSH 2BK8A 1A02N 3BPOB 1CLOL 2CR6A 5IMMB 1MQKL 4Y5YC 3X12B 2C4FU 2NW2A 1MFEL 4D3CH 1F6FB 1NEZA 3WXWH 4G8GB 3BKCH 2APVA 5J1SC 2XPGA 4MNGE 4J23A 4G43B 1UG9A 1AR1C 1TETH 1EXUA 3FQWB 1WBYA 1MI5A 3MCKB 1EEYB 3L5IA 2D31B 2VLKD 2FHBA 5CGYC 4DN3H 3GHEL 5F89A 5EOCJ 2WBKA 4LL9A 1X5GA 2EH7L 1OT1A 5DJXB 3SGEI 4UTAL 1SEQH 5EU6B 3IFLL 2H26A 1EHLL 1QFWM 4XWOC 3UMTA 4KROD 1SM3L 3RWHB 2JE8A 3G04A 4R26L 4PV9B 2YC1B 4JEGB 3NCYS 8CGTA 3GK8H 2VXUH 4DZ8A 4LIQH 1AJ7L 5GZNC 3UBXA 4BSWA 3LPFA 2YD7A 1XGYH 1A6AA 5SX4I 3GJFH 1IE5A 2OJEA 4D0DA 4P2OD 5EBMA 5DUPL 3Q5OA 5F9DC 4ZMAT 1RI8A 4WNQB 4QF1A 1M05B 4CDHA 4FQXB 3F6IA 3EOBA 2CRIA 2BHUA 2EEBA 1TENA 5GGSB 1MWAA 5F8RC 4GMSL 3LV3B 4OD1H 2VXSH 4XP6L 4TQEH 5E8OB 3RVVD 3BIAX 5LJYH 5I8OL 3R0NA 2NY2D 4QHUB 3F7YB 5EZOL 3FFDA 4QHLB 3LB6D 1M6OA 1PJ9A 3MNWB 4C83A 4MZ3A 1FE8L 1FYTE 3VG0H 3OXRB 5FO9A 2VXVL 3FFCB 5HPMB 5DJCA 1AHWC 1FL3B 1IFHL 3TJEH 3IU4H 4TQEL 5DHVH 1EVTC 3T3MF 4P4RB 2VZ3A 2ZUXA 4OZGA 4L5FH 2MHAA 1JHLH 1P53A 1TVHA 3SHSA 1IKNA 5HHNB 4AM0B 4PJIE 1FRGH 3IJHA 1KJVA 4MXQC 4KRPC 5D7JC 3LKNA 1SY6L 2DS4A 5DUBA 3B9KB 1IEBB 2P5WB 3IU4L 1FN4B 3VMNA 2AKRB 3QCTH 1FVCA 3WD5L 2VN7A 5EUKA 1HIML 1X6LA 4X98B 4FTVB 4L5FL 3O11B 5EUOF 2X09A 5SWZE 4DCQB 3TH2T 3O3BB 3C5ZA 4MDJA 2QSVA 5BRZD 4IJ3B 1A6TB 2G5BB 2E7BA 1AKJA 5IEHA 4Q9BA 2JJSA 4AQOA 1VEMA 4UQ3A 1TZGH 4BH8B 1SHMA 2W60A 3JWDC 5IR1B 4PJ7A 5J13C 2HT2D 4U1JA 4ZODA 1CTNA 2J2ZA 3QUXD 1OW0C 5CBEB 1VB9A 1DBKH 1WWWX 1NCAL 1T7VA 2KQMA 3CLFH 2ITDB 2BXZA 5ANME 1LK3L 3U1SL 3QNZB 4JREC 4LGPB 4F37K 3S37L 1KJ2H 2ENYA 3HZKB 3QCVL 5FUOH 4CMMA 5FUZL 2GW5A 3I6LE 3HS0B 1T7YA 2A74B 5D2LF 1D6EA 1NGQL 1YMMB 1TZGL 3DV4A 1I8MB 1DQQB 3M8OH 1IGTA 4NNYA 4JGMA 2QSCH 4F7PA 2ZSVB 3RWGA 1T21A 1ZS8A 3SE9L 3W2DH 1DZBA 2HJKA 4LSQL 4X6FB 2PXYA 3QUZA 3CFKB 3ETBF 1CGWA 5C71A 1CL7I 1A14L 1AGDA 1R0AL 3PL6D 4JO2H 3TCLB 2R8SL 3QRGH 1YEDA 1Q9WA 3E8UL 2ITCA 2I60H 5F9JA 1N4XL 3QAZC 4WW2F 3I2CH 4X83A 3RIFK 4WHYG 4F7TB 3LKPB 4NDMA 4ZSOB 3S35L 4H1LA 1JUFB 5IMLB 1OM3H 2FSEB 3RPKA 4QOKD 4K3HA 4JO2L 1HK6A 1F4XH 1MLCA 3QRGL 5DD0L 4UNVA 1IM3B 4JFYB 4AEIL 2I60L 3WFDL 1ZHNB 5FGRA 5I15L 5KOMC 3VXQB 2IFFL 3WEXA 4J6RH 5A40E 3C8DA 4TVSa 4M62H 4E9LA 1J1OH 2AGJH 2F54E 2VWEE 1EEQA 3G6DH 5E2VH 4ZD3L 4OQ1A 4ENED 1QBBA 2F9BT 3VXMD 4IRJB 4KRNA 4JO4H 3I6GB 3WN5C 2YZ1A 1JPST 1U8OB 1WT5A 4OGYL 4ZFGH 4CUCA 2XTJE 4APQA 5JOFA 1FGVL 2D7QA 3WBDA 1VACB 3W9DA 1RY7B 3BWAB 2BC4B 1SY6A 2HTLC 5SX5K 2DD8H 1Y0LA 2RFXB 1F02I 3OR6B 4WJ5A 4KH2A 3O4LA 4MA3B 5AAMA 4XMKH 2X4TA 1Z0NA 3Q6FB 3KLAB 4FQ2L 2G75B 3SGJA 1C8PA 1XF3B 5EU6D 2PW1A 1TVDA 4XHJC 3GIVB 5IB4B 3RNQB 1OLLA 3UJTH 1JP5A 4ZOBA 3DMMC 1JF6A 3PHQA 3SE4C 5E9DD 5HXMA 5EZJB 1XT5A 1RZ8A 3MRKA 4S10A 4K7PL 2QEJA 3O3EA 4Y4KC 5KSBB 2AI0H 2FEDD 2EXWD 3RDTA 4JM2A 4N0CD 2F8OA 1ONQA 4C54A 4OLUL 1RZKH 4N9GB 1FQ9C 5LGKA 1C08B 4R7DA 3TH3T 3JVGA 6CGTA 2Y5TA 3O3AB 4K23L 2IAMD 4DGVH 4KTEL 1YNTA 1YYMH 4ZO6A 2Q7NA 3KNBB 3BSZL 4XVJH 4NGHL 2G2RB 3JWOC 3G08A 4Q6IA 1AE6L 1NCCL 2R1YA 3U6RA 2KDGA 5IW1B 4BM7A 1EEZB 3T3PF 4HEPG 1MFAL 1BM3H 4R4ND 4JCLA 1JRHI 2OTWB 3O4OC 4P46B 5IBTL 5HTSA 4MWFA 3BYTA 3C6SA 5T33H 2BSRB 1OQOA 4OTXH 3RNKB 5B38B 1OTSD 2N56A 3NFPA 2YD1A 2Q87A 4R4BA 4UT6L 2XQYG 1R5VA 4GXUN 1QBMH 5SWSE 5DJ2A 4U0RB 1GGIH 2HWZH 3O6ML 1X5KA 3SGDH 1R5WB 2GEEA 3MRMA 3DARA 5BQ7B 3KXFB 1TXKA 1I3GH 2VDLH 4ZQKA 3BJLA 1IGML 4P2OC 5C9KA 3ZE0E 1OGAE 4X5XA 4LVNC 4WU7A 3FT3B 2P5WD 4LKXA 2DQIL 5T1KA 1J0HA 3G6AA 1X5AA 4R97B 5HHQA 4J4PA 5AZ2H 2JJTA 1W0VA 3KWWA 3KLHD 1MCWM 5B22A 1CDGA 1E27B 2BRRL 4ZAKA 1T3FA 5HHMB 1WAAA 4P2RA 4NQDD 1BLNA 1ZT7B 3SDCA 4ZNEA 4U6XB 3RVVC 1ZA6A 4KDTA 2F5AH 2FJHB 4ELMA 1G6RB 3S6CA 4H20L 2PYEA 2NY4B 5CZXC 1ZLSL 3LB6C 3GBNH 4MVBD 1TCMA 2EDHA 4P0DA 1D5IL 3QDJA 4OZHB 5EU5B 3QDMA 4CNIB 15C8L 3CH1A 2IPKB 2OTUB 5CS7A 1RIUH 5H94B 4YFEA 2PTTB 4JM4H 5FV1L 5CEYB 5I1AA 2X4NB 1XAUA 1N2RB 5I1IH 5FB8B 3SKMB 3I75A 3NPSB 4XNQB 4R0LA 4NQTA 4PR5B 4NO3A 1YMMD 4QRPB 5EZIH 5C6PB 2BMKB 5C0BA 3ZSSA 1EO5A 1CICD 2XZQH 4HGMA 1SVZA 3LKQB 3EGSA 4V1DB 1RIUL 3U9UA 1FJ1A 3KYNB 5F9OH 1FNHA 4P57B 1UT9A 3GJEA 1PW3A 2BNQA 1WCBA 1OAQL 2AEWA 2A9MH 2ARWA 5I16A 1UZ6E 3BPNC 1C7TA 3P73B 4OGXH 5ICXA 3LAFA 4NZJA 4L4TB 4F58H 2VZTA 5EZIL 3CFBB 5DVOA 2N4IA 1DP0A 3RHWF 2HN7A 3T0DA 2LTQC 3DI3B 2BJML 2CXGA 5FA3B 5FHAH 4ZDHB 3JV0A 3AC0A 4YEFA 4JJHA 2A9ML 4RGNB 3VFPB 2FYYB 3TESA 4WHTB 4ONFL 2J1KA 4OLYH 4KKCD 2P8MA 1A4KA 4WI2A 4CKVX 1YEKL 3U36A 1OAZH 4FQJH 3OKKA 1HEZB 5E6ZA 1FL6B 1MCFA 2QQKL 4XPAL 4OZFG 2VDQL 5IROC 4M1GL 3C6LC 4ESKA 1JBJA 2MQCA 4HIHB 1MHPL 2SEBB 4KZEH 3BDYL 5KG9B 4XXDB 2OZ4H 1QSEE 3OWEA 4LGRB 1RMFH 4MX7B 3AY4A 2H1PH 3WXVH 2R0LH 4HUWB 2FJFB 4NZTL 1W2KT 3ZTNH 3DLQR 1KIRB 5HVFB 5IHUL 4OF6A 3PXJA 1NPUA 3D3VE 3RX8A 5CBAA 4U1NB 1GOHA 5GGRY 4Y19B 4CN4A 1CLCA 4GAYA 3CMOH 1EDQA 3ZDYF 1C16B 3FQUB 5EBWA 2GITB 4KVCL 3JWDL 2WUBH 3LH2L 1JGDB 1CDCA 3OKOA 4K7PY 5LKNA 2JB5L 4D9RE 1P9MC 4D0BB 1P7HL 1UJ3B 3B2UC 2X89A 2Y06H 4FZEL 1MUJA 3WHXB 1K6QL 2CLRB 4Y88A 4M48H 5D1ZB 1WIOA 3TEUA 1KF9B 1PEZA 1NLDH 5DJYA 4ENEC 5L0QC 1UWXK 1EIBA 1NBQA 3MACH 4POZD 43CAA 1W72L 5MENE 3V5HA 3PDOB 4P46D 3VDBA 4G3YL 3MV7D 5KVFL 2EYRB 4FP8L 4LK4A 1CCZA 2EO9A 3BKJL 5D2LE 5EN2A 5HYEA 1UCBH 1N6VA 2ICWB 3NABH 2XFXB 3UYRL 1A9EA 1J1PL 5CCKL 2C7UB 3EDJA 4HS6A 5C09D 1BZ7A 3QDGB 5CHNB 1N5YH 5C0RH 3TZVB 4NRXA 5MEOA 4DKEL 3I6KB 4O2EA 3HC4H 2X4RB 3FT4A 4PJGA 3HZVA 2Z4QB 5HJ3B 3DROA 3MLYL 4X7TA 1CFQB 5HGHA 3W9EB 1GGYA 1KN4H 2ADJB 5C07A 4XNMB 3KXFD 3ROLB 3BH8A 5IBUG 5KZCB 3BYYA 3O6FB 2B20A 2FEDC 5BV7B 2EXWC 5DJ0A 4N0CC 3U82B 1PKQA 4C56A 2MSPA 5TGBB 3G5XA 5LG1A 5L2KB 3NIDE 1N3NB 2IAMC 1U92A 2BNRA 1BWMA 3BI9X 5EU4A 4R7NB 3IJYA 3VXSA 2QSQA 5FF6B 1MFCH 5DC4B 1JPTL 1P2CA 3X11A 1JYNA 5C3LD 1DQJB 4FMKA 3MODL 3EJJX 4KUZL 2NY4D 4I5BA 4AYFA 1LO0L 1KPVB 4J3XA 2E8ZA 3IU3A 4O02L 3VXRD 3GSQA 1XGQA 1FZJB 1FVDB 1PYWA 2ZSWB 4JZJC 3L5XH 1MHHB 3WFEH 3R4DA 4HIIB 1II4E 1EBAA 1RURL 4BZ2H 2EXYD 1U8MA 3KJ4B 2HJFA 1S9KC 25C8L 1UH2A 3F58L 4OCXH 4HJJL 3ULVC 4U1MB 3PP4H 5HYFA 4KK5D 2MCG1 4ZNEE 5HDQL 2PKDA 2NLJB 3SKJL 3MXVL 2PYEE 3D87B 4XBPB 4QRPD 1RHHB 3WFEL 1MLBA 1U3ZA 4GUPB 5I0DA 4BZ2L 4V1DD 5FCUH 1YEJH 3TBYB 4WFGE 1BFTA 1ROWA 4G7YL 3T0EB 3KLHC 3FN0L 8FABA 4ZFOB 3ESUF 1K9TA 3L3GA 2Y9RT 2V2TB 3GI8L 1WTGT 4ODVL 1F4YL 3ZE2E 4K2UH 3JWOL 1DDHA 3T0BA 1TJGH 3PHOB 3CC5A 4IJ3C 4BA8A 4RIRB 4GBXC 4MVBC 4XC1H 5C0BE 4CVUA 4UOW1 4L29B 3ECBA 4JRYE 3QI9B 5BZDB 4OCYH 5DD1L 2EYSB 3TFKC 4Z7UA 1W72A 1AC6A 4PJFF 5I1LA 2A83B 4HEME 2PR4H 1V7NL 3SE3C 2ZCLH 3PABB 2GCYA 1ZTXL 5IQ9B 1T04A 4JPKH 4EN3B 1TJGL 3MV01 5GRVK 1FO0H 1JNNH 4P59L 3GM0A 3K46A 1MCJA 4LOUC 4TTDC 2WW8A 3ARXA 3MA7A 5E2UH 3MRLA 4NNPH 2ERJB 4JO1H 1Y6MR 1Y18B 2ZKHL 1BX2A 2CXKA 3LKRA 5HYJB 1CICC 2PR4L 4MJ4A 1A0QH 4ZFFB 3AS0A 3IT8D 4PTTB 1J0YA 2ICES 3L7FA 2VZOA 1KENH 3V7MA 1LEKA 3UJIH 2D4FA 2X6MA 1XCTB 4G6KH 1HCVA 1X6NA 4YFDB 3GMQB 1NAKL 4ALAH 4X6EB 3MXWH 3Q3GB 5E2UL 4MAUL 3B5TA 3QIWB 3L1OL 1A3RH 5D1XA 2XRAH 4KJQD 4MB4A 3TA3C 3CFEA 3NAAH 3CDGB 3BDBA 4KQ4H 4YZFF 2YMXL 4G8IA 2X4PB 1Q9KB 5EORH 1F6LL 3OHXA 2ESVB 2VUOA 1LHZA 1EEUA 2J5LC 2AAVA 4G6ML 3WHE1 5D9SB 3QEHA 4MJ2A 3S35X 5A43C 1XGTA 3OB0K 4QRTA 4U6YA 1AO7B 4YHNA 3DV6B 4GW1A 3D48R 4BQCA 5I8CA 1G9MH 1I7ZA 5CP3A 5IW3A 5D1ZD 3JSSA 3WIFB 5I76A 5JPNB 1I1FA 4WU5B 1RZFH 3BP6B 2CKBH 3MRPB 3QFJB 3ZE1F 1RJLA 4QRUA 3DSNA 1LP9E 5JW4Q 1CDHA 1Z3GH 1MHEB 4WUUE 1DEDA 5HGAA 3WDIA 3T2QA 5CJXC 4EVNA 3UO1L 5DMIH 2FO1A 5CP7A 4MYWB 1J0ZA 3D25B 1CD0A 3N0PB 3U4EA 4PJHA 5MEQB 2VDRH 3H9SB 3WKMH 2XA3A 3TZVD 3PJSB 2FGWL 3SJVE 2Q8AH 1IM9B 4NQSA 4U33A 5EC2B 2YA0A 2HP4A 1FZMA 5IOPB 4WGWB 3GUTA 1G9NH 2NXZD 4R9HA 1LO2H 4MJIB 1KTLA 3SOBL 5KVGH 4WFEE 3HI5H 1FFRA 4OCWL 3KPRE 4JVWA 4OAWB 4QHKI 1CI5A 2R23A 4JANB 5K9QG 1R24B 4JFED 2Q86A 4PUBH 3TPKA 3MUGA 4U1LB 5IGXH 1HNFA 1D5MA 3O6FD 2F53B 2VDRL 4PRBB 1JN6A 3MOAL 4F7CB 1Q9LA 3KPSD 1K5NB 4JY6A 1J11A 3OKYA 5IVZA 5JHLH 4PPTA 4FHBD 2E7MA 4LCCA 3WIIH 5I2IB 2AJVL 5F96L 1H15B 5JXAL 3ILPB 2NZIA 1FNLA 4ODTH 4WW1A 1U8KA 1HHHA 1GZQA 5JR1H 3C9NA 3BP5A 4TSAL 3BVNB 1HQ4B 3SQOH 3BRDA 1ERNA 4Y16B 5I1GH 2P8LB 5I1EH 1PKQE 5JHLL 3MYJA 4ZPTB 1RZ7L 2NX5B 3GRWA 3R06B 4RAVA 1YPZB 3VH8G 4KXZH 4I1NB 3LEVH 3Q6GL 1FFNB 4X8JB 3WLBB 2BNRE 1TJHH 3FO0L 4OD2B 2DM4A 3GSVB 3WSQH 4UIMB 3VXSE 2R4RL 3E2HC 3QPQD 4GQ9H 2A6JA 1L7TH 4UAOC 4TSBL 4NM8L 3PF2A 2XZAL 5CUSH 5IWLA 2GT9A 3DUUA 4UT7L 3K8MA 2VYRE 5I8EB 5F7HA 4J8RB 1UEMA 1HI6A 4Y7MA 4JPIA 3FB7B 3ULUD 1JGEA 4IHOA 2GIYA 3QNXA 2PYFB 1T1ZB 1YDPB 3QUKB 3IDIA 4LLUA 3S88H 1LE9B 4I2XA 1RUAH 1MIMH 1CGYA 3I9GH 5TFSL 3V6OC 2F19L 2A6IB 4K3EL 1I4FA 1B2WH 5CAYB 2H9GA 2LE9A 4PG9B 3VE0A 5DJDA 4TVPD 3MBED 1Q1JH 4YBLB 1QD0A 1CT8A 1Z9SA 1RQ5A 2H32B 1K4CA 2VXQL 1CLZH 4EN3D 2NY1D 5EWIL 1QRNA 4YO0A 4P2QA 4MMZC 2ADFL 3OKEB 1QO3A 3FOMB 1KNOA 5K9OB 4PRHB 4N8VB 5TF1L 3TGXA 4ZYKB 1UH3A 1EFXA 2W0FA 5HYJD 1RZJC 3T65B 1B9ZA 3INUH 4P3WA 5GS2D 1H3PL 1KIPA 4Z7UE 1YJDH 2YK1L 3TN0B 4LLYB 1CGVA 1KEMH 3AAZA 4PJ8C 3SPVB 1QQDA 2ATPA 3KPPA 2DIJA 3QO0B 4MB3A 1T03H 4NP4L 4KKAD 1U41A 4M1DL 4OLWL 1I9RH 1KCSL 4XP9H 3QIWD 4OQTA 3FMGL 3HPJB 4LAQL 2HLAA 4JY4B 1U6AL 4IM8A 4TRPH 2E7LA 2V7HA 3HE6A 2EIZA 4MA7H 4ZXBB 1FZKB 3KPNA 3C8KB 1KEML 2H3NA 2WBJB 5C0GB 4XVTH 4OCRL 4F7MA 2FZ3B 1AGFB 5IROA 4KKNA 1HSBB 3KYOA 5ISZD 1FNGA 3WFCH 2HFEA 4XP4L 1AO7D 2FO4A 2V7NA 4P5TB 4AL8H 4MA8L 4X6DA 4EXKA 2EDEA 2LV4A 3ULVL 1J86A 3FQTB 2BVPA 2DB8A 1JGLL 3O2DH 4K71B 4OIIH 3OZ9H 5TE7L 1MJJA 3QFJD 4JB9L 4E41A 4O2CA 4PJDE 3OQ3B 1ZVSA 5CWSB 2B7DT 3OJ2C 4GLRH 2VISA 2VKXA 5BS0B 3F8UB 3FQRB 2Y1VA 1IGFL 3G9VA 3MJ9H 4L3EE 3EYSH 2VDNH 3TBTB 3U30C 1TZHA 3QO1A 1AD9A 2CR3A 4JHZA 4HIJB 3EFFA 5JW4N 4NT6A 1MNUL 2FLBT 1JIBA 2RB8A 5SWQA 1T0PB 1IM9D 2HG5B 5F93C 3O2WH 2UWEB 3FO2B 3MTRA 1FNEA 3RI5F 3RGVC 2J8UA 1A6UH 4UUJB 3WS3B 4PJXA 2VDNL 4Y5XA 1IC4H 3LRGA 3BHBB 2R9HD 4B5EA 4ZS7L 1S3KL 4JR9L 3BMVA 3V5DB 1UB6A 5J8OA 1UJ3C 3M07A 3LQZA 1A6ZB 1ACYH 4HFWB 4RDQF 4PGBB 3CZFA 3DHJA 4KAQH 3MV11 2ZG2A 4N0FA 4LSTL 4RMRA 1WCQA 2C4XA 1BQHB 4MQ7A 2A6DA 5GJSH 5HI4D 2AJ3B 4K94H 2P42B 2L0DA 5CLWA 3AM8A 5AWNH 3W11D 2UZIL 4OCSL 3RUGE 2AEQL 2KQNA 4Z7VE 5DJ8A 4PJEE 1KLGA 3Q2CA 3KPQA 2BVQB 3VFNA 3HUJA 3KJ6L 4MNHA 1U8QB 4Y16D 2PN5A 2NX5D 2YXMA 3DX7B 1F3RB 3T1FB 2AJSL 2JCCB 1FL5A 3I02A 3QIUC 4HPOH 4YPGB 1AGBB 1AXSB 4DK3A 5GJTH 4K3DL 4F9LA 2NXZC 1DUYA 2IH3A 4Z0XA 4QGYA 5JNYB 1XF5A 4GS7B 1TITA 3QA3B 5IFAL 2V2WB 3BGAA 5FFLA 3O6FC 5D7LA 5BV7C 3FQXA 1LEGB 3NTCL 3DI2B 4KMQA 1YEGL 4ZG1A 4HPOL 1HYRC 3MLVH 1HINH 3D85B 3MOBL 4LLDB 3L5WB 1X5HA 3CVIH 4JZJA 3DGCR 4OKDA 3JBG7 2CPCA 1Y6NR 1S7VA 4WEMB 5GS1B 3O0RL 2O61A 5IKCA 1DQTA 4QNPE 4DKFH 1TTGA 4LPWA 4MNQB 3V5KB 1AP2B 3VJ6A 2YPKA 4N90D 3HAEA 3EYVB 2YD4A 1DN0B 1JWSB 3QEQB 1BVLA 1CFVL 3CFJB 5DQ9A 1S5HB 1VKXA 5D2NC 2OMNA 1MVUB 1T0MB 4DW2H 4PJCE 3QPQC 5EA0L 1J18A 1CE1H 1IQDA 4PRHD 1CFNB 3NFSH 5C6TH 3WNMA 3MRJA 4HMDA 4I2XE 2IG2L 5FGBC 5JQ6H 1QHOA 1KT2B 3GJFK 4S1SH 4GBXA 1JNHA 5EU3A 5GGUA 3UTQB 3VI3E 4PG2A 3SGDI 3TN0D 3EYUH 4NO2A 5GGTH 2NQCA 5IB5A 3U0TA 3CPLB 3KDMA 3HNTH 3FHQA 5MHSD 3OXSB 3ET9F 3MGTB 4WWID 2JELH 3S3PA 7FABH 2R56H 4Y4HD 1EPFA 2FB4L 4Z18A 4M7ZB 4MAYB 2Z92B 4M7KH 4P9HC 1BAFH 3D6GA 5KSBF 4JFFB 2YBRA 5BRZE 5TDOA 3L3JA 4PB9L 3GSUA 5GGTL 1KCVL 1EAPA 3BN9D 1PG7W 3MBEC 3D0LB 1WZLA 3A67L 4G8FB 1CD1B 1UXSA 2NY1C 2I07A 5KANG 2FBJH 4P5TD 4PBVC 2XT1B 1KJMB 4FFVD 3X3GH 2FX9H 4UV4H 5CMAA 1CU4H 3V6ZA 4J2XA 1AXIB 4YDJA 2DWEA 3DXAA 1IGCL 1KCRL 3MV8A 4JHAH 3NN8A 3MCG1 1G7JA 4H8WC 2VKWA 3WUZA 4ZOAA 1VEPA 4GKOA 1IGYB 3NFNB 5DI8B 1G6RH 4JO3H 4R96A 2ZPKH 5BS0D 1UA6H 5E2WH 1HKLH 1EUTA 4J3VA 3RY4A 5E08H 5A1AA 4Q9RL 1F90H 1K85A 5L6YL 3FB5A 5KW9H 3DVGB 2VLJA 4KK8C 5FOBA 5IB3A 2EE6A 2VIRB 5HYSA 3QJFA 2DLFH 1MFBH 1P5UA 5FK9B 4JO3L 4I48B 2AK4A 4Z76A 1T1WA 1A7RH 2J88H 4E41E 5E4IA 4JPVL 1KG0A 5E2WL 4UBDD 4F15B 3BZFB 4JJ5A 4KWUA 5C0EB 2WBWB 3OAUH 2ATKB 1RK0B 4JG0H 4QOKE 2R4SH 1OB1B 1X5ZA 1NSNL 2E6JA 4RGOL 3U7WH 3SCMA 1L6XA 1P69B 3GSRA 4FQLH 4L9LC 4RMVA 2W9DH 4XX1E 3D39A 5JUEL 3TPUA 3FO1B 4GOSA 5DMKA 3LDBC 1MCWW 2OYPA 5HDOA 2O5XL 4Q0XH 4WO4B 3OAUL 4IIQB 2E27L 2D7MA 3OKDB 4OZHF 4CW1A 1RZJL 3VXME 5E8DL 4NZRL 4GW5A 3UP1A 1P1ZA 4Q6YA 1S9VA 1QBLH 4QT5A 4AIXA 4FXKB 2X4QA 5JHDB 3KPTA 1P4IL 1KTRL 1UVQA 4FQLL 2I9LA 3G6JB 2QBWA 2EECA 2Q76A 2V9RA 4I18C 4PS4H 5CEXB 1SBBA 4NKMB 2HA1A 5LAXA 2OM5A 3MLUH 2HKFH 2OR9L 4FFZL 3VI4E 4D8PA 5F7DA 5I1DA 4PV8A 1FNSH 2R39A 2DKMA 5EU6E 1INEL 4X6BB 3TM6A 5IVNA 4O2FA 4YFLF 3ZLQC 2HFFB 3DX6A 2C3HA 3VFOA 3E6HB 4M3KB 3BFOA 4Q7DA 4X7CC 5GRJH 2R9HC 3PWJB 4M8QA 5E8PA 5E9DE 2VXTH 3NCMA 4PS4L 4TUJA 2DI8A 3S5LA 1QPXA 1F3JB 4LAJH 4MJ6B 2VAJA 5DHVA 4HKXB 1SJXA 3O8XB 3ULSA 3D85D 4F7EB 4RZCB 5ENWA 3SBWA 5I73B 4U7MA 3RZWA 4OV5A 4DUXA 3HZMA 4OM0L 5ERWA 4HUXB 4GRLB 3B6SB 5JORA 3PQYB 2ZWLT 1LILA 5EO1B 3ZSTA 4H88H 1GJIA 1ETZA 3EYFA 2FATH 4I0PB 4XNYL 1VESA 1UWEH 3GMMB 3HC3L 2IBZX 2QJDA 3ARUA 4YK4C 2DTMH 2EICA 2EKSB 3S36H 5DUML 1OGTA 1JNLL 3SO5A 3H0TA 4MNQD 5CJOL 1BD2B 4IS6B 3RA7H 3V7AG 1KEGL 1OCWH 3BDXA 2ICEA 1CF8L 4PGJA 4YHLH 4ONGH 2Q1EA 3DIFB 3H9YA 3QEQD 4IDJH 1XF4A 3QWOB 2FJGA 1ZHLA 2G9HA 4L8BB 1G9EA 4KJWC 1X9QA 4OT1H 5IB1B 1NL0L 5JW5A 2HVJA 1EA9C 4HWZB 3WDHA 2IGFH 1HQRA 1UZ8A 4OKVB 3L5HA 4WFHE 3AXLA 4WW2A 4XCNB 1TCRA 1QFWL 1B3JA 4HZLB 1BBDH 4QHKJ 4CVWA 3VXPA 2DWDA 3ULVE 5ITFB 1OLZA 4YHLL 2NNAA 3SDDB 2KL6A 4NQEA 5ALCH 3BIBX 5F70A 1BBJA 3V6OA 4JG1L 2F58H 4OT1L 1FDLH 4HPYH 4LCYA 1HDMA 3S4SB 3EYOA 3GMOA 1FG9C 2PO6D 3QUYD 4FQPA 4UB0H 1CQKA 2R2HA 4NQDE 2NW3B 4MAYD 4O4YL 1J8KA 1MCLA 2DL2A 3GFUA 12E8H 5D70H 1F5WA 3MRGA 3UTZB 5LGJA 3O6LL 3TNNA 5BV7H 1RIHL 4DGYH 2XXMB 4Z78B 3H8NA 1XR8A 2R1XB 3P9MA 5I66B 1JV5B 5I18H 2H6PB 3U4BH 2ADIA 4LPXA 4NQCA 1HH9B 5GGVL 4UV7L 1VPOH 1BIHA 2GUOB 5F6IB 1CIDA 3RL2B 2YUVA 5I74C 5I1JH 1DLHB 5D70L 5EOQL 5JMOC 2XN9D 1RULH 2IH1B 3MRFA 4WTZG 4Y2DD 1CZ8L 4MNGB 5J06A 4NWTH 3MUJA 2A1WH 3TN0C 3MR9B 5I18L 4PJAB 2DBJA 2Q3ZA 5A16A 5E56A 1DFBH 4QRRA 5BVPH 4WCYH 2X05A 2HRLA 1H8SA 1KV3A 5GS3A 1I7TA 5D96B 1MRFH 1PX3A 3TVMD 3I3EA 5TH2A 4Y4HC 1F8TH 5IP4A 1OAUH 4RCAA 1R3IL 1KLUA 3TH4T 3MV8E 4X5WB 5EBLA 4U1GC 4QO1A 3V4PL 1MJ7L 1H9VA 2NY0C 3DVIA 1GGTA 3BN9C 3ZTJG 2CUIA 3BQUB 3IDYC 1HHIB 2WWMD 5DGRA 4NN5B 1QUNA 2NYYD 4YHPA 1XR9A 1QLFB 4YIQA 3M45A 2FR4A 5KAQG 2IMNA 3EO0B 2VLJE 4XB8A 3ULUH 5F7UA 3WJJC 4K9EH 3BP4A 1T66C 3QQ3B 1RUKH 1KLFA 4LSSH 3BO8B 4YE4L 2IANA 1I8IB 5DSCB 4KJYA 1T0NA 4WO4D 5GRZA 3NH7H 4Y5VB 3BZ4B 3WUWG 1OTUC 4I9WD 3E3QC 1FYTB 4N1CA 3RGVA 4P9HH 1S7XA 3QWRD 4GW4B 4IOFD 2AJZA 1KB9K 1P5VA 2CO7B 5JHDD 3LN9A 3KR3L 3V0VA 2PCPB 5DDHA 4OZIE 1FSKC 2DM3A 1ADQL 3WLWD 1BGXL 2VMFA 2HKHH 3CDCA 5F21B 3VRIB 1AI1L 3BWUC 4TVPH 4WI9A 3CLEH 3HE7B 2DQEH 4XNXL 4HH9B 5T1DL 4LHUB 4EOWL 4JDVA 5JIIA 1NEZG 5MERA 1UWGH 2GFBA 4HJGA 4HIEB 4UBDC 1OPGL 4YDKH 1ZEAH 5ACLA 1F11B 1ED3A 1FC1A 4M8VA 1Z2KA 4WV1C 1FIGL 5HYQB 5CJQL 3ULUF 1ZHKA 3MZGB 4JGJA 4X80H 4PLKD 1UACH 5GS2H 1FC2D 4U1SB 1WTLA 2D7OA 3O8XD 1AXTH 2Y25A 1D5BA 3L3KA 4JN2B 2VN4A 4MZ2A 4EI5B 4LRNL 4JFXA 5SWZB 3IS0X 4GRLD 3K2MC 1NANI 2X4UB 1D6VH 3QIUA 1E6JH 2F15A 2H41A 3B3IB 3TV3L 3L95A 4L3AA 3C08H 5DD6B 5EO9B 4H8WL 2LVCA 5HDBF 4YLQT 3ARBD 1G7PB 2BVOA 4U7KA 4UU9A 5FM8A 1BD2D 3RWIA 3X13B 3ARGA 1LDPH 4M5ZH 4WEBH 3MV7E 1DBML 4K3JH 5ANMB 1PG7H 4UINH 1OD7A 4RGMB 5I75B 1JPGB 32C2B 1NUFA 3A6CH 4XCEB 3IFOB 4ODSL 3S3SA 5C09E 1L0QA 2NXYB 4AT6A 1NCWH 2R0ZH 3BGMA 5B39A 3UJJH 3W0WA 4ZFZB 3JTSB 1P4LB 1I1AB 1WC7A 4UDTB 4U49A 4OCNC 2B1AL 1I8LA 3V0AC 3SDDD 4K3JL 1Z9OA 3PWUA 1E4KC 3KXFE 4DGIL 2FH8A 3QXDB 4LBEB 3A6CL 3JUZA 4L4VB 5K9JH 1DBBL 2NY7H 3RTQD 5FM4A 4MDIA 5EZLA 4EBQL 1JHTB 2ENSA 4ZUWB 3L3IA 5ELIA 5EU7C 1GYAA 1FPTL 2KKQA 3MV9A 3BH9A 4WWKC 3NBNA 4M1CD 1RIVL 4GG6E 3ARZA 5F7MC 3N1PC 1I1YB 2CK0H 1NGZB 3HKFA 4PGDB 1GIGL 3EFDH 4YHOL 4OLXL 2WNGA 4NQEE 3KYKH 4JQIL 3OKLB 5CZVH 2B39A 1SVCP 3PGFL 2UVEA 3V6OE 3MLSH 1P7KA 5FGBA 2JK5A 5DR5H 4R6UA 3VXRE 5TQ2H 1B4JL 5K59F 5DD3H 4OZFA 2AJUL 2C1PB 4HS8L 5HHOA 3QXTA 2AXGB 2F54B 1WUNT 5BZWB 1ADQA 2IEP