2EDEA

Solution structure of the sixth fibronectin type iii domain of human netrin receptor dcc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
GSSGSSGPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the sixth fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Netrin receptor DCC
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edeA01
1FRGH 1CD9B 5JPNA 1G6VK 1ZXQA 3O9WD 2DQTH 4OFIA 3DRTA 1IKNC 1OAQH 3MV11 5HI5C 1QACA 1FZJB 4GXUN 4MMXC 5IJVB 5FYLH 2IBZX 2YBRA 4X6FB 3QUXC 5FAAA 4XCNA 3VRLE 2P45B 5I1EL 3ZE0F 4P46A 1MQ8A 1J8HA 3BQUB 5F70A 2AXGB 3NPZB 5IBLC 1T83A 4L3CA 4NQED 3QDGE 1A7BA 1DL7L 4WDIB 4KK9D 4MD5B 4YK4B 3CLFL 1BQLL 3CFKA 3MRKB 4RWHA 1NGQL 3NIFF 4GQPH 5SWQB 1Y18B 2E3VA 3QP3A 4NP4H 3HUJE 4P3CH 5FO8B 5GJTH 4RNRA 4BQ6A 4CL7A 1NEUA 3B9DA 1F45A 4OQTA 2NYYD 5DJ0B 5E8EA 5JPMA 4JVWA 2HRPH 3U4AA 1A21A 1BJ1H 2DLIA 2OBGA 2F58H 4J3VA 3LRGA 5IW3A 2OL3H 1EHAA 4KZEH 1OLZA 5IMOB 4QHUB 4XMLL 1U91B 4K3HA 4JHWL 3ECBA 4XRCA 2BDNH 4I4WA 5T3ZD 1WBXB 4UU9A 4KTDL 1M7IA 3P9LB 5I2IB 1RUMH 3HMXA 2G9HB 5GRUL 3D25B 1K8DA 3TBYB 1NCAH 4L4TE 1U0QA 4L3EB 4HK0A 5F1IA 3IJSB 3I6LD 3TO4C 4NNPH 5TH2B 2OI9B 1S7QA 3G6JF 2W59A 2EXWD 5I75B 2OMNA 1NGZA 1MFNA 1A8JH 1OPGL 4R4BB 4POZD 5CINL 3C60C 1M6OA 5EU6A 1URLA 1CDJA 3VXME 1HZHH 5GIRA 4M1CD 4Z0XA 1ZHNB 1DANT 3IDYC 1M05B 1NCCH 2HKHH 4LSPH 5KSBE 2DDQL 3OKLA 2MQ3A 4OT1L 3QWQB 3V5DB 5F7EL 2J4WH 5I19H 4JG0H 2FGWL 2X1OA 1FAIH 4F7CA 1CWVA 4OV5B 1KPUA 4YPGA 2ZNXA 1ZHKB 4MA3A 5F6IB 2QHRL 3U0WH 2ERJC 3TH2T 1OARH 1RJLA 4EI5B 3RP1A 5D93C 5DGQA 2EO1A 1JNLH 1U3HB 1U58B 1AXSA 3TBYA 3BQUD 4HK0B 5FDWB 2JCCB 4DQOL 3BZEA 5TH2A 4Q9BA 4LCWB 4JZOA 1VACA 1G7LB 5DMKB 2V2TA 3OAZH 5FK9A 5D5MA 1EEZA 3QNXA 3MODL 1R5WA 2XZCL 4R6UA 4QXWA 3BDBA 1HIMH 3LQAC 2J3SA 3OJVC 2P47B 4BK5A 1IFHH 2V17L 5I6XC 3CDFA 3S7GA 3MLYH 3O2VL 2IAMB 4ZO6A 5TDNB 4M5YL 1KJVA 4HUWB 1P9MC 3QNYA 1A6TB 1RIVL 3T77A 2R8SL 4UQ2B 3M45A 2GTZA 3RL1B 2EDHA 2H3NB 3EGSA 5C1MB 2B4CL 4MQSB 2F8OA 4OKVA 5BJTA 5ICYB 3WN5C 1PKQE 1AGEA 2H9GB 4DVBB 5GS1A 2GJ6D 3ZDYF 2HP4A 1OTTC 5JIKA 3QEQE 4PRAA 4FQCL 4P2RA 5FGCB 4D3CH 2DQUL 1KN4L 4RMRA 5IBTL 3LEVH 1JJUA 2R2HA 7CGTA 4Z18A 1KSRA 3QNXB 4K3EL 4NQCE 3OTTA 4MJIE 5DJXB 3T1WA 4ZD3L 2WBJA 3EW3B 1FGNH 3LDBC 3VXMA 2FB4H 3WNNA 4V2BA 3RWEA 4JFQA 1MJ7L 3IJYB 4M6OH 4LBEA 2O26U 1FV1B 4XPAH 1SBSL 3O8XC 3L3IA 4X6BA 3F58L 4OZFB 4XZUA 4LK4A 4WWKB 4KKCC 1EGJL 3MA7B 4PYGA 4KH2A 5SWSD 1R3IH 2RHEA 4WI5A 5BS0A 4M8VA 4PP1D 1AGEB 5C0GA 2Y9RT 4L9LB 5BOZG 4FFWD 2PO6A 3KG5A 5DJZA 5ANMA 2P48B 4ENED 1HI6B 3VXSE 1F3DH 4X4YA 4ZNEA 3GJFK 4P9HH 4A6YL 5FYJU 1FL5A 4PJ7A 1KIRA 5CFHA 1T80A 5I74B 3NZHH 3I3BA 1H3XA 3VGEA 2YHGA 5HHPA 3WFBL 1BQSA 5SWSA 4MXQD 3CFIC 2X6MA 2Y06H 3JWDH 5SWZA 5FECA 3JTSA 4JY5L 4TUOA 4D9QE 1GCFA 1NDGA 4LCCB 5FYJD 4R26H 4M93C 3HE7D 5C0AB 3OWEA 1JK8A 4KTDH 3BP5A 3LOWA 3KYAA 4WU5A 4HKXB 5IUSA 3ALWA 4I0PC 2V2WA 3WUWG 2LV4A 3MLTA 5E08L 4Y5YC 1FIEA 5BZWB 3ME0A 32C2B 3V5HA 5FYKH 4YDJB 3MBEA 1GSMA 1NC4B 5MHSD 1IGFH 5IVOA 2X4PB 4YDVB 4A6YH 4HXAL 1HCFX 5FF6B 4JPKH 3TEUA 3F7PC 1XF4A 4OFYD 5GSRB 4YXKH 5C0DA 4NCDA 4ZS6C 4PGBB 4UTBH 3KJ4B 4O2EA 2XA8L 3Q5OA 2Z35A 4OIBA 2A2QT 3CSBA 2I9LA 2WW8A 3MCKA 5D93B 4XC1H 4IJ3C 5CD5C 4ZS7H 4N0CC 4WU7B 4OAWB 1CD8A 2OR9H 1XF5B 3H9HB 3OXSA 4BFIB 1QP1A 1ZGLB 5EBWB 4F9LA 2XI9A 4TYUA 4ZO9A 4P2CG 3QJFB 4WFHD 4HEPG 4NSKB 2DKSA 5IQ9A 3PDGA 2QTEA 1AKJD 5HYQB 4LAJH 2FJHB 1ZS8A 1EAPB 1AKJB 3LEYL 3RNKA 1PG7X 2QV2A 4NQEA 1UB6B 3BEVB 5IMMB 5GGUB 5I6XB 3OX8B 4HWZA 4UQ3A 1QRNA 32C2A 1WFNA 3V5HB 4IIQB 4BH7A 4HKZB 2BMKA 5D7LD 5BW7C 3VFWA 3RL2B 4APQD 3QULA 1MUJA 3MROA 1YECH 1ULVA 1DP0A 4TNWK 2IPUG 4ODSH 1E6JH 4WRLA 2CR6A 3GKWH 3H7BB 1AFVL 4U6YB 1OB1A 5F6HJ 4HC1H 5FM8A 3RGVA 1A2YB 3VH8B 1BD2A 2V5MA 3T0WA 4D0CA 5JDSB 4JFDE 4KKCD 3GHEL 3DTXB 3IB4A 4ZPTA 3W9EA 1K4CA 2QADB 1DSFL 3PG2A 4KROB 3LEYH 4RGOL 4YFEA 1NMAL 1ZS8B 3L3KB 1EAPA 3I6GB 2GCYB 3G6AA 3ZSTA 1KCSH 5HHOA 3RKDD 4HKBA 4ZFFA 4GG8B 3LDBB 1FE8H 4KRLB 3WJJC 3G9VA 1P2CA 3WUZA 3BJ91 3BXNA 1JUFB 2VAAB 2Q8BH 4AMKH 1QSFB 3L3DB 1RSFA 4CVWA 2ZUQB 1GHFH 4Z95H 1C12A 3MROB 5F7LB 4UB0H 4NOBA 3VMOA 1OT2A 4NJAL 1VERA 5HGBB 4I2XA 5DTFA 1RZFL 1A7PL 4J3WA 4OZHF 3T08A 3W9DA 4MGXA 1S9KC 3FONB 3EAKA 1SY6L 4NFBA 5I1CL 4C83A 1A6AB 1CDHA 3G9AB 3TN0B 1G6RH 1KELL 4KJPC 3EYUL 4N8CH 4D0CB 3LKOA 2YRPA 3ZHDA 4LSSL 4NO0B 3AGVA 4PS4L 4HMDA 5C3LD 1CIDA 1WSST 2Y36L 5GGVL 1CFNA 4RMSA 3V8CA 4M6NH 1X7QA 2JE8A 2BRRL 1F3RB 1U8QA 4GRLB 3MRHB 4IOFD 4DW2L 4LU5H 1TZIB 4KKBD 4QGTA 4GRLD 4YHZH 1FGVL 3CD4A 1S5HB 4X7TA 1WV7T 4PJCF 4JO3L 1KCKA 1MREL 1BQHG 4UIKL 5JO5B 4O2CA 2CK0H 4P2YA 4DK3A 1IEAB 4XVUD 2PETA 4HXAH 2DQFA 1GVIA 4I2XB 1WIOA 5CSBA 1NEZA 1ONQA 4PJHF 1DN0B 2ARJB 4GUPB 3T4YB 5DHYA 2GSGB 3GMOB 1EFXD 5K9JL 2CD0A 2BK8A 2E6PA 2F9BT 2VITB 3SJVE 1JP5A 1P4BH 3DVGA 4PB0L 1RK0A 1NMBH 3O4OB 1KXTB 4H8WC 1HINL 2FBJL 2O5ZL 4W6WB 1BPVA 5GGQH 4MQ7A 4NKDA 4I48A 5HDQH 4NM8H 1WT5A 4LLYA 2E9BA 1H5BA 4IJ3B 3DUUB 3KPPA 4JGMA 3DETD 1J18A 1LDPL 3AY4A 3U4EA 4AL8L 2X4UA 4RWYH 1F2QA 3AU1B 2JLLA 2XWTA 4YEEA 3W5NA 3CFBB 5D1QA 1IARB 1U8NA 2EIZB 3V6OE 4JFEA 5EORL 4DVRH 1QFWM 4YZFF 2OSLA 3CVIL 4JREC 2YD4A 1I8IB 5ETUB 3BISA 3WIIL 4Q9QL 1KCUH 2PXYB 3WFBH 1T1XB 2X4TB 3RTQB 2ZUYA 5EO1B 4LRNH 3ARGA 3DYPA 3PHOB 2F54B 3UO1H 3OKMA 4KUCF 4N0CD 3U7WL 5CJXA 3ABZA 3O3EB 1A9EB 4WO4D 3ARSA 4LPUA 3D3VB 4HIHA 4OZ4B 1D6EB 2YZ1A 3MFGB 1WTGT 2F53D 4QRUA 5C9JA 4YGVB 4HH9A 4FQXA 2HMID 2W0LA 1IEHA 43CAA 2A9ML 3IU3B 1K4DA 1DCLA 4I5BA 3BFOA 1P7QD 4LPVA 2ZZUT 5I1JL 4RGOH 1DQJA 3V4UL 3MNWB 3D39A 4X4XA 1BGXL 4Y0GA 5CGYC 4PGDB 3PHQB 1YUHA 4QHLB 3IRZA 4Z7VB 3CFBA 5D1QB 1QSVA 4JPWL 3FN3A 4KV5F 2QADC 3GKZA 4KROC 4ETYA 3T65B 4OV6F 5A3ID 1HN1A 1NGXB 1S7WB 4LCYA 5SV4A 2QSCL 2OM5A 4NQUA 4XVTH 2PW1A 5DRXA 5ESVA 1JRHL 3P9WB 2VL4A 5EFIB 4WI3A 1Z6JT 4G8GA 1M7DA 3P73A 4NHUB 2XN9E 4P4KB 2OR8A 3U7WH 3ILQC 4QCIA 15C8H 3B9VA 5F7NC 2XKNB 4K7PY 3LMJH 4YGAB 3GB7A 3NAAL 4X98B 1DUYB 3PL6B 4UU9B 2AVGA 4Z78B 2HAZA 2YMXL 4TRPH 2N56A 5C71A 1HHKA 3QXUA 3GMPB 3IETB 3LKNB 1EMTH 4Z95L 5DJYA 3G08B 3D39B 1X4ZA 2A1WL 2A83B 3BW9B 5SWZE 2ZG2A 1ERNA 5JW5A 4AK1A 4PGDA 2QSTA 2VDNL 1EEUA 3MACL 1X5XA 3BGMA 2GIYA 3NA9L 5IFHL 1UXSB 5E2TH 4QHLA 1RQ5A 1UM4L 4LHUB 5EU6B 4OLZH 5KVGL 1MRCL 3ALXA 2H2SD 3ZTJH 3CH8A 2VL5B 1M05A 4KC3B 1HXMB 1G9MH 4HPYH 5F1OB 2MMXA 5C08A 3DXAE 4LSTH 2N7BA 5DS8B 4XNXL 4YQXH 3B3IB 3P3YA 5I8EA 1YMMD 2VZUA 3T2PA 4O4YL 4LARH 1IM9B 4XWOD 1YEJH 4EUPG 1JTTA 3BDYL 1U58A 3CXDH 4M62L 4KWUA 2APTA 4KTYA 3T3PE 2AXFA 5F7DA 5C3TA 1JZ4A 2YEZA 1BZ7A 3BKYH 1NAKH 5HYSB 2R0ZL 1CN4A 1I1AA 3AS2A 5A16A 5IHBA 2I5YL 2YZ8A 3ZE1E 2HFGH 2A83A 3BW9A 5EZLB 3WV0A 5JHDD 3K46A 1JNNH 1N64H 3HUJA 1LP9E 2N4IA 3OHXA 3X3GH 5KS9B 1LQSR 2DLFL 4Z7WE 2G5BA 3MO1B 5CCKL 1UJ3C 5DVNA 3B9KC 1ZHBB 1I3RA 1T0NA 3UJTH 4R26L 4HWNA 4MA8H 1HINH 2O5ZH 1II4E 3N06B 4AEEA 4JCLA 2D7QA 1NMCC 1IBGL 5EDXA 4X9FA 3MUJA 2HTLD 4OKVB 2F5BL 3SE9L 3D3VE 3ULUH 3EYUH 3IFNL 5ICYA 3LB6C 3BPCB 2P7TA 2X42A 3JUZA 1WUNT 1RURL 3MMEA 3VRIA 4U1SA 1B90A 3LKRA 4LF3A 4QNPE 1E4XI 5DGRA 2Y36H 1UXWA 5DO2C 4XHQA 1MWAA 4G6FD 2MTPA 4UINL 3INUH 4ELKA 1MAMH 3QFJA 1I1AB 4AG4H 2APWA 1FFOB 4PLJC 1ND0B 2NZ9D 2Q76B 1AJ7H 3HZYB 4OLVL 4ZSOA 3ULVD 5D5ME 3ULVH 1NFDA 3LKQB 4UIKH 3N1FC 1FL3B 5MENB 1QFWH 1C5DA 3G04B 2GJ6E 3KYKH 1UCBL 2MCG1 2BNRA 1PZUB 4JFQB 2IADB 2ICWA 4M1CC 2HG5A 4YR6A 1EO8H 3CVHH 1G6RB 1FFPB 3ORJA 1CGSL 4P5TB 2BVPA 2B4CC 2VC2L 4HIIA 5FO9A 1HHJB 4Z7QE 2QSQA 1QG3A 2NTFB 3LN4A 5DA4A 3IFPA 3U0WL 1OP3H 1HWHB 2AJSL 2ZUSA 5EU7E 5GGQL 4I3RH 5J06A 4PJDB 1B0RA 4KQ4L 2FX9H 3P4LA 3Q3GA 4U1IB 5JXED 3T0BA 3QJHB 2ZUTA 5KSAC 3RA7H 4JGJA 4JHBA 3QFJB 3AAZA 1YYLH 3QHZL 1REIA 2L4OA 1G1YA 4PREA 3PL6C 1VPOH 2F53E 3HZMB 4QXTA 4OJFH 4U1GB 3VI4F 4PJHA 2VDOL 1AQKH 4FN0A 3TIDA 2E6QA 3AY4C 4D9LL 4UT7H 5EOQL 1YNLL 2BNRB 3QSKB 1SEQH 3MXWL 4JN1H 1LO0L 4WU5B 3DNKA 4DFHA 2CO6B 3UC0L 2I07A 2BSSA 4HS3B 1KB9J 1ZEAL 5J7CC 3FRPG 5HY9A 1DBAH 2R69L 4Y5XC 5LGHH 3FO9B 3V52H 2AK4E 3MACH 4ZAKB 1N5AA 4MDIB 4OKDA 3VJ6A 2OK0L 2ARWA 3BKJL 5DK0A 4RQQB 3S36L 4H26B 4FMKA 3ZDXE 4HULB 4E41B 5TQ0L 2XA8H 3CPLB 3EYQC 3V4PH 2D0HA 4XX1E 1G7IB 4CBPA 4U1LB 2H2PC 1VEPA 3H42H 3BKMH 3WFEH 3O2DH 1RHHA 3O9WC 5CBAB 1FC2D 1MF2L 2MNUA 5DD1L 4BJLA 1FPTL 3MJ9A 5AG8A 1L4IA 3V0VA 2AABH 3MUHL 5EBWA 5I8CB 1AD9A 1ZMYA 2R15A 2G75A 2H26A 3VXUE 4ODBD 4X99B 4Y16B 2NXYB 4DCQA 2FH8A 1K5NA 2FJHA 1YN6A 4MAYB 1LO2L 3TJEL 3EOAB 2Q7YA 3R8BB 1F42A 1NFKA 3NCMA 4OCRL 5CWSA 5B3JF 2VDKL 3MGTA 3IFLL 3NZ8B 4MSWB 4NN5C 2CDGB 2VLKD 1QHPA 3V5KB 3RRQA 2OK0H 4XNMA 5I15H 5DI8A 3FO9A 4MQXC 3DVNB 4MDIA 3VJ6B 3O0RH 3R0NA 3ARGC 4PJ7E 3RL2A 1FBIL 5GGVY 1JNJA 3VGDA 4JRXD 3VD9A 1MFBL 4KRPD 4G6MH 5JQ6H 2ADJA 1MCJA 4G6KL 4WV1C 1A6UL 4AIOA 1VFOA 4M02A 1YMMB 3QI9C 1OB1B 3GMMB 1OAYH 1NBZA 1JGEB 5EO0B 1PQZB 3VXQB 4Z76B 4ZG1A 4HUNB 5ADPL 5JUEH 1A6WH 1JZ8A 1RURH 1CK0L 1W8OA 2DJ4A 4WGVB 5FYLL 2COQA 2EDOA 1E6OH 4XB7A 3ZHLA 1TNNA 4IRSD 4PJDF 3GSNA 5DUMH 3D2UA 4PY8I 2F8VA 2A6DA 1KTLA 3QDJA 2VR5A 1U93A 5DEFB 5MI0B 2CDGA 4X6CE 3W0WA 4X6CF 1ZSDA 4LEOB 1TQBC 12E8H 4ZODA 3VXOA 2DIJA 4TVPD 4F15B 2P8LA 1H0DA 1YJDL 3ARED 4PJDE 2HT3D 1A14L 2VLKB 2BY1A 8FABA 2NLJA 1P6FA 4B41A 3P0YH 1CG9B 3SKNB 1PLGL 5ADOH 4BELD 1KN2H 1B0WA 5MEOB 5FA3A 1SJXA 3BSZH 4F58L 5T3ZE 1UENA 4KKAD 4HG4K 5ESAB 4EVNB 1BAFH 3QUZC 4K7PX 3PWNA 1I7UB 1EJOH 1BVZA 1AHWA 4HKJA 1OQXA 4M7LL 3HRZB 4K94L 2UYLB 4N5EC 5I71B 1G0YR 3ZDZF 4BM7A 5LCVH 2QQKL 3K3QA 4S1QH 3RAJH 1D9KD 3GSNB 5KSBA 2A6DB 3GI9L 1YEFH 3GSQB 4X6DB 1INEL 3FRPA 3P4NA 3A6OA 2EDLA 2P44B 5EZOH 4X7TB 1UM6H 4MXVE 4PJEA 1S8DB 4Y19E 4PJGE 4C57C 2PCPA 3FO1B 5IMLB 1NC2A 2X5PA 3FN0H 2W65A 1U2HA 1RJZA 1J86A 1IAOB 3BVNB 3GMLB 4LLMA 5C7XL 2Y23A 1I7ZA 3LH2H 4YHIB 4ZAKC 2P8MA 4PB9H 4EN3C 2NR6C 3ARWA 3DRTB 2YSSA 4O51A 5TQ2L 4PUBH 4RBPH 5T1DL 3VE0B 1DBAL 3MV7D 3GSVA 4X6FA 2XZAH 3R8QA 1JHKH 4U6TA 5I1DB 3NVQA 2YA2A 1TJGL 5ISZB 1JGUH 3UTZB 1C5CL 1SJHA 5F71A 3NACH 3IDIA 1FZKA 1XCTA 2VSDA 2XTJE 4OCWL 3B9KA 3V0WL 4JY6A 2PYED 1AR1D 1DUZB 2DQIL 2H8PB 5EORH 3QH3A 2R4RH 2NXYC 2A6JA 1MJ8H 4NBYB 2H6PB 1RY7B 4BH8B 2JJUA 2BVEA 5T1KB 5HVHC 1OGTB 3WDIA 2IANA 4K7FA 4YFDB 2W65B 1JGVL 4M6AA 1VENA 2MCPL 3ARDC 4KJYA 1IAOA 1V7ML 3ZKMD 3MUY1 1QLRB 4I0KA 4XMLH 3UCRA 3GGWA 4HUVA 4GW4A 4OF0A 4UT6L 1FYTA 1UEMA 4G6FB 4RA3A 3O6LH 1QSZA 3AMLA 3TJHD 3RJQB 1JI2A 2J5LC 1MVFA 4HJJL 2FEDC 1DDHA 2X4SB 4MJIA 3OAYK 5D7LB 4HZAA 3D85B 4PYHA 1YEIL 4NUJB 1ORQA 2CK2A 1UACL 2EZ0D 5GRYA 1HHGA 4LCUA 4R0LC 4EEEA 4JDVB 1DQJB 4BSJA 2I24N 1NAKL 1ZAGA 2LU3A 2AKRB 4Z5RA 2EH7L 1EO5A 3WDHA 4C56E 5F7MC 3P40A 1QFOA 1T89A 4KUZH 4OF8A 4EN3D 4OM0L 3GMNA 5ACMA 2XWBA 3AS3A 5C09A 3T8XA 3X12B 2QLVB 1MNUH 1VCAA 5GISL 5T1KA 1FHGA 3SDCD 1IC5L 1KB9K 1FGNL 1OGTA 3DO7A 1DFBH 2E7BA 3I6LE 5MI0C 5EFIA 3RIAK 4AM0B 4KJYB 4J7RA 4QLRA 4M1DL 4JR9H 1AO7D 4RA0C 3PQYD 4MA3B 1KFAH 1LE9B 4S11A 4NDMB 5D5MF 3BPLC 4QWWD 4LP4A 2YA0A 5D70L 1RJLB 3WFHB 1FYTB 5E6IC 1FNHA 4U0QB 4OZHE 1DSFH 4M7JL 2HT2D 1BIIB 1D5IH 4G80A 4YBQD 2VDRH 3CZFA 4P23B 1BEYH 1U8HB 2G2RA 1DDHB 2X4SA 5FDWA 3GMPA 3IETA 4JHZA 3D85A 1DQQA 4UBDD 3E1F1 3MOAH 3KHQA 2WUCL 4KPHL 3L5JA 5C2BL 2QL1A 5TDOB 1T7YA 1TPXC 4HUKB 3VGGA 3O2WH 1MWAL 3GMNB 3RY6C 3MRCB 5DD6A 2YA1A 1DQML 4JO1H 1BD2E 1LD9A 4NKIH 2Z8SA 1CVRA 5GQBA 4PJXE 3AXLA 4HUXA 5EBMA 4UQ2A 2FNBA 1JPSH 1Z9LA 3EOBB 1ROWA 2OX5A 1G7MB 1Q9KB 1KPUB 5D72H 4DGVH 1KV3A 4PIRF 4HFWA 4QT5B 5FKPB 4ZQKB 4N8VB 3VRJA 3MLXH 4YHYC 3G5VA 5D2LE 4BQ8A 5L7XL 5EBGA 4EZMA 3K8MA 4JAMB 2AXFB 4UILL 1PZ5A 1AXSB 4PRAB 4GQ9L 1EXUA 4GAGL 5HYSA 3D39D 4LQ1A 5CP7B 4YXKL 4EXPX 2H32B 1PJ9A 3K1KC 4YHMH 4KUCD 1K85A 3TO2A 2PR4L 1P7KA 1KYOK 4HK3N 1G7LA 4Y1AA 5DMKA 5IESL 4WO4C 1I8LA 1IGCL 1ZTXL 3U6RA 2NX5E 5IFJB 4Z0BL 3SKMA 5GS0L 5DJ8B 2NY7H 4QRRE 3BP4A 5JW4R 5ESQA 3EJYC 1OGAE 2A73B 3GIVB 4XPAL 3C5JA 5J13C 1GGCL 4LBEB 3DI2B 4YHKH 5TDNA 2EDYA 3GBNH 4JJ5A 3ARGD 3TZVB 1I8MA 4K3JL 4X6BB 1KBGL 2VQ1A 4KDTA 4MB4A 2CJUL 4CVZA 1NL0L 2ITDA 2F74B 4Q2ZA 3S5LG 1J88A 5J6GA 2R69H 3VRJB 4MNQE 1SYSB 3QIWD 3HAEG 2PO6B 2P5EA 3ARDB 1T2JA 3B2UD 5DJZB 1TZHA 4JFDD 2FX7H 4H20L 4QRSB 4WWID 2R0LH 5GJSL 3T2OA 4XWGH 3VGAC 3TBWB 1UEYA 4KTEH 3TO2B 1UH4A 1OT1A 2IH3A 1QFPA 4PJIB 5DD3H 2EYRB 4ZSOB 3MOBL 4K9EL 4TQEL 1FL3A 5MENA 5T3XE 4Y5XA 1T2XA 1C5DB 3G04A 3ZTJG 1I85C 1CIUA 4ODUB 3ARRA 5BW7A 4XI5C 3SDAD 5GHWH 3NOIA 3WSQH 1UWXK 3MZTA 3BT2L 5DD0L 5M7QA 2C3HA 4YUEH 2WANA 5E6YA 3GRWH 4HIIB 3FQWB 3FL7A 1XIWD 2W9DL 1FYTE 3QUKA 1WAAE 3AREA 3IFPB 2VNCA 3RWFA 3TH4T 1FG9C 5HHVH 1W0YT 2R0LL 5D1XD 1NCDH 3WBDA 2C3VB 3D1MC 1PKQB 3RZCA 4EXKA 4PRNA 4FFYH 1G9NC 5D2NB 2O5YH 1B3JA 2IH3B 3UTQA 3DROB 3RVWC 1R24A 5BRZD 3VWJC 2EE3A 2Y7QA 4FZ8L 1BQUA 4WWKD 1OTSD 2BNQD 5DZOA 3SE4A 3V6BR 2GHWB 1YC8A 5AYUH 5CJOH 1T1YB 2GUOB 1IC7L 3MRBB 3F7VA 4XNQB 4NCC2 2XWJB 4GW1B 1JPGB 3O11B 5HY9B 4BH7B 4XXCC 3ULUC 3WO4C 3LN5B 2O61A 5BZWA 3BWAA 1GOHA 2ZJSL 1BD2D 3S36H 3OAUH 2V6HA 3U1SL 1JGDB 1NC2D 1J0YA 4N0YL 3MBEB 3X3FL 4WY7H 1KULA 4CMHB 3V4PL 4PTTB 3TV3L 1A1OA 2VLLA 1PKQA 2B2XL 1P6AB 2W60A 4KK5C 4PJGA 4GMSL 2PW2B 4YHYB 1AGDB 1XMWA 1RHHB 4J4PD 1T04B 2Z35B 1FVDB 2ESVD 1FRGL 2I9LB 1CD1A 1VA9A 3BYTA 2FJGA 4HFUL 4HWBA 4X4MA 4Y4KC 5E99H 2GY7B 4LIQL 4C55A 3BUYA 4MJ6B 3HMXL 1UCBH 1N6QL 4NO5B 5HDLA 1IM3B 3L1OL 3ZE2E 2R0WH 2GCYA 1P4LB 3F7YA 3O9WA 5LCVL 3MGTB 4IRSB 1XH3B 4NQEB 3OR6B 3EO9L 5D1XA 5FYJE 5CJBA 3MLPA 4HAFA 2VDMH 4IIQA 1W72L 2E5EA 3DO3A 4L8DA 2AJSH 3BH9B 5GS0H 1YPZB 1RZFH 4M3JA 1MFAL 4GMTH 2P8PA 2CRMA 1IKFH 5D1ZB 4JY4B 3OPZH 1J5OL 1WFOA 5GGRB 4FABL 1MJUL 3BGFC 3PUCA 3QHZH 5ENWA 4PJIE 1OL0A 1VFUA 4LHUD 3CK0L 4J8RA 4KTEL 4ODVH 4PRHD 2IPTH 5IMKB 2PN5A 3FT2B 4KI5D 5HHNA 4JANA 2XZAL 1FH5L 2ICCA 4WENB 4ZS6D 1X7QB 3BZ4A 4J4PA 4GRLA 3L3KA 3VXRD 1KTLB 3QDJB 2JJTA 2QQLL 4EKXA 1MHHB 1U3ZA 2X9WA 4JFYB 5DEGA 3LKSB 4G9FD 2P42B 1CTNA 1BHGA 1LO3H 2A77H 5AG9A 4EBQH 4P4KD 2RB8A 2O5XL 3IDJB 1A1MB 2NLJB 4LSPL 1IAIH 3LV3B 3F8UB 3T4YA 1DN0A 4GUPA 5I1IL 5DTFB 2ZPKH 2IBBA 5GRZA 4PRBA 4JDZA 4TVPL 3QG6B 3R06A 5I1LB 3SDYH 3T2QA 1T2QH 5C07E 3KLHC 4F57H 2AJUH 3PXHA 5DJ2A 1TVHB 4AH2A 1C8PA 1A6PA 3MV8B 4Z7UB 2B20A 5I1EH 1I7UA 3HNTH 2JELL 2UYLA 2DYPA 4NKDB 4P5KA 2OL3L 1CDUA 5K33A 4P3DA 5FYLD 1NCDL 4IRJB 2Y72A 4XMKL 2YK1H 1F4HA 4FFWC 2BDNL 4WEMB 3QEQA 5HHOE 3S88H 1T21A 4QF1B 3CLEH 1OF2A 4KHXH 1X5AA 4YXHL 3EO0B 4EI6A 3N1MC 3LKSA 3ROOA 4OGXL 2ZJSH 5I0ZA 4PJEB 4LFHG 5DWUL 2YXFA 2CRZA 2GY5A 1LNUB 3B9EA 4P0DA 1DLFL 2PCPB 5HHMD 4OZFH 3ZYZA 4LRNL 3SEPA 5E8EB 4G9DB 1ADQL 4X6DF 2PXYA 1JPST 1PY4A 3I2CH 2AQ3A 2DQFB 4GRWE 5IB5A 1ACYL 4MX7B 3SDDB 5A3IC 3HE6A 1QSFE 3MV9E 4XCEA 5KVDL 1ONQB 4RMVA 2GSGA 3MRFB 3QG6A 4AQ1B 5JOPE 1ZT1A 1PDKA 1AIFA 4X4ME 3CH1A 1TTUA 1F6LL 1T89C 2A6IB 2HJKA 1F3JB 3C60B 4WFGD 2GFBA 2K9UA 3C5ZD 5L0QC 2V7HA 3QIWA 5AZEL 5CP3A 5I1DA 4L3EA 1D5IL 1MEXL 4L8SA 4I5BB 1K4DB 3HMXH 4MJ5B 5JMRA 2LTQB 1JWSA 4OLUH 1Q94B 3SDCA 4GXUM 4ERSH 1T21B 1QSEA 4XBPA 4N0UE 5L88H 1I4FA 2GJ6A 3OKYA 5DRNB 3UXFA 3I02B 5F6IC 4FZEH 3VD7A 4AEHL 1BBJB 4ODWB 4G43B 4L29A 2J1KA 4QRRB 3B2VH 3MLSL 3AS0A 1NFDE 4MXWL 4KDWA 2IANB 5DVKA 3IJHA 4MZ3A 1DQMH 4RDQF 4P99A 4OBSA 4U1HB 5FCSH 5KVDH 1H5BC 3NGBB 1KG0B 5T1LD 4XCEB 1OM3H 4YPGB 4POYA 3NPSC 5I1GH 5D96C 3CAFA 4H5SB 3GJEB 3QR2A 3VFUA 2VLJB 3DHJA 4F7TA 2NY1D 2ZOKB 3GHEH 3MV9A 3FRUA 5B4MD 3EO9H 5GRVL 1D6EA 3MC0A 2MPAL 3MLXL 1NMAH 4JKPL 1HHKB 4QRUB 3P9LA 2AJYL 4HH9B 1EUUA 3IU3A 1JWSB 3BZFA 3DPBA 4J3SA 4N1EA 1YNKL 4Y1AD 1NLDL 2EDTA 2AEQH 1AD0A 4PJFB 3W11D 25C8H 5T5NG 1LDPH 4AL8H 1V7NL 3O3AB 1C16B 2QQLH 3QYCA 2CGRL 2V7NB 1XGRA 3JUYA 3IDGA 4MD0B 4XNUL 3BAEH 3SQOH 4EDWL 4K3GA 4ODTL 4YE4H 2R8SH 4JGUA 5L9DL 2A9NL 3QIUA 1AGFA 1NGXA 1S7WA 1I1YB 5IKCB 5E00A 3OKLB 4WI9A 1W0VA 5CZVH 3V5DA 2IFGA 3KXFA 1AC6A 2Q7NA 2H3NA 3EGSB 4OZGA 4I0CC 1JNHA 1SY6H 3SDCC 1N3NB 4ZUVA 4R4FH 3UTTD 5C6WH 3MRQA 4HS8L 1QYGL 3RX7A 3OKKA 4Q97A 3D0VB 1CVSC 1T03H 5SX5H 3IDMA 5KSVA 2ZCLH 4PD4K 1DUYA 3PL6A 5IJKC 3C2AL 4WI6A 5C2UB 1NLDH 2YRLA 3PWPB 4YWGH 4S0SD 1IQDA 3BZEB 2EDDA 2YK1L 1RD6A 1AGBB 1MFCL 4Y4HC 1IL1A 1UXSA 4LEXH 4LHUA 2D7TH 1T1ZB 4IRJC 4OFPA 1S3KH 3ZT7A 3UBXB 2ICEA 1UZ8A 3IDUA 5KZCB 3ZE1F 3QNYB 1R3KA 2CIIA 1IGJB 1R3IL 2DL9A 1QQDB 4XNYL 3ROLA 1EHXA 1Q9KA 1Q0XH 2K7PA 1T03L 2A38A 3B3IA 3VFRB 2CKBA 4U3HA 5IVZA 2P49B 4I77H 3CLEL 5ANMB 3WXVH 4JFHD 4DVBA 1NH6A 1DEDA 1CL7H 1F4YL 3KYOB 3SKJL 1KOAA 5CIPH 4K8RL 4LCCC 1AQDB 1WCBA 4ISVB 4CW1B 2NY4B 4XGZA 4JKKA 4TSCH 3IAQA 4N5UA 2ORBL 4OQTH 3LPGA 1FNFA 4JB9H 1NCWL 2AJVL 4TUOB 2LVEA 1MHPL 4XP4H 4Q9QH 5DJXA 3VFPA 1NDGB 4LCCA 5KVGH 4J3TA 3VXMB 1BFVH 1UJTA 2HYMA 5DRZB 4NKOB 1G9ML 5F44A 3RVVD 3BP7B 1FORL 1RULH 1F4AA 4X6EB 4LASH 2IBGA 2VQ1B 5EIIA 3KJ4C 5FO9B 1E28B 2VLJE 5BVJB 1P7QA 4ZUUB 2E9IA 2D0GA 1WZLA 2X4PA 4YDVA 2WBJC 3BPCA 4FQQB 5C0GB 1WK0A 4IDLA 3M1BA 4P48A 4KVCH 4RFNB 2VB5A 2J12B 4OD1H 1U8IA 1VFBB 1AQDA 1QBML 5DRWA 3AAZB 3QBTB 2WUCH 1GIGL 3BIKA 3QEQD 4WEUD 3RWHA 5J57B 4PV9A 1FFOA 4XPTL 5HGAA 5GS2H 4OAWA 1GPOH 2WSKA 3TFKC 3CSGA 3N1GC 4XP6H 2CGRH 2NY3B 2P5WE 1JF1A 3KPQB 1A7NH 1T83C 5GHWL 1IVLA 2KZ1B 1J11A 1FZMA 4BKLA 2JJTC 5D7KE 1A4JA 2Z9TA 4GBXD 2HT4C 2A0LD 4U1NA 2WQ8A 1GOFA 1ZVYA 5GGVH 1M71A 3JVGC 5GZNC 3D6GA 2V2WB 1QRNB 3FO0L 3RVWD 5ABDE 1QLEH 4Y2DC 5B39A 2WNGA 5D72L 4DGVL 2IMMA 5IF0B 4EDXB 3BO8A 1BBDL 1JZ7A 3C9NA 3NABH 4LKXB 1DVFA 4PJDA 1Q9LB 5EA0H 5FXCH 1NGWB 1NFIB 4QTIL 2VTFA 4YC2B 2AEIT 3DARA 3QJHA 4AG4L 1PLGH 3BIKB 5HI5D 3WD5H 5F9JA 4RRPG 2FHCA 5IB1B 3QUXB 5GGSY 1G7HA 4NGHL 3CMOL 4WU7A 3TLRA 4PTUA 3MV8E 4NRXB 3O6FB 4ORGB 4RRPA 1DEEA 3STZB 5BQ7A 2RR3A 4HC1A 1IZKA 4MAYA 1CGVA 5HYQA 5MENE 3I6GA 4QRRD 1ED3B 1UT9A 5AWNH 2IGFH 1GL4B 5LVEA 3G6AB 1S5IH 4NRYA 3SDAA 5HHOB 1AKJA 3RNKB 5I15L 2B7DT 3CVHL 2JCCF 2BSSB 3GSOA 4KZEL 3O6MH 2CJUH 4UQ3B 2VH5L 3A67L 3QDGB 1FVCB 5D7JA 5EWIL 1K8IA 5F7WC 4P2OD 3TV3H 5DDHB 4QXUH 4LOUD 2R1XB 2J8HA 5DK0B 5ILTL 1I9EA 3PWUB 4P9HC 1GGUA 2NTSP 4HSQA 4XPBL 5HGBA 3D48R 25C8L 4MZ2A 1U8MA 5T3ZH 1KC5H 1MRFL 4FQXC 1D7FA 4CU8A 3KLHD 3HC3L 4PBWD 1M1SA 5IB1A 1CR9H 3EZJB 2CSPA 1I9RH 1GOGA 1Q1JL 1AY1H 3JV6B 5CJ5A 2APFA 1CFTA 2CK0L 5IB4A 1NSNL 3QT2A 5EO0A 4O02H 5DJAB 4S1SH 2A9NH 4NRXA 4LCIL 4QO1A 2VDOH 4TOYH 4NO0A 3WFDL 4WFGE 4Z7QF 1KJMA 4P3WA 1CFNB 1K4CB 2J4WL 4DW2H 3MUZ1 4PJBA 2BOCA 1FG2A 2RFXA 3EDDA 3SDAB 1RUAH 1F4XH 4CGTA 2VDLL 4HKBB 1ZSDB 3EYOB 4XNMB 5I30H 3E6FA 2P1YA 5BV7B 1Q72H 1NCWH 2EE6A 4O2CB 1JUFA 3QQNA 5C0ND 4XP5H 5DVMA 3RGVD 3H3KA 1J9CT 3O4OC 5GS0D 1EEYA 3EYSL 1U6AL 3ARBA 1WBYB 5F7EH 3KYMA 4JFPA 1U8MB 2EDKA 3I2CL 5F1NB 2E27L 1AY1L 1OD9A 3LQAL 4F9PA 1VSCA 1AXTL 5DHXB 4RFNC 4M7LH 3GMRA 1YNTB 4U49A 4MDJA 4YAQA 1HYRC 5HDQL 5HDBE 3VXQA 4RGMB 4XCFL 3CFJA 3O2VH 4I48B 1F13A 4LLYB 4FQIH 4MCZA 5ITFA 1RUAL 2ZKHH 3OZ9H 3J8F7 2NY3C 4PLKC 3UPCA 2H45A 1WISA 4LVHC 2K3TA 3NA9H 5I1AA 1FIGH 4NNPL 1IC4L 1NUFA 1ORSA 4MJ2A 3RVVC 1DBJH 4KMLB 1H0DB 5TE6L 5C7XH 1L9NA 1JRHI 5HYEA 1F5WA 4KKNA 1EEYB 1P4IH 5BCAA 5K59E 1HHHB 1WBYA 1HEZA 1VPOL 2Z93A 5GS1C 3QRGH 1RZ8B 4FNLL 1AGCA 4TUKL 3QHFH 3DX9B 4PRBB 1T4KB 3H9ZA 4H1LG 4POZC 2ATKB 1HXYA 2APVA 3MRDB 4ZTPH 1HWGB 5JIIA 5JW4Q 7FABL 5KOVC 4XAWH 1YY9C 2H32H 5F9OL 3CFJB 4OD3H 3NCCB 5DMIL 3D18A 3Q1SL 1UWEL 4XCNB 5C0BA 4LDEB 4HIJB 3BD5A 3S88L 1SJHB 3S35H 3WO3B 3QEQB 2DQIH 4KPHH 2BY2A 3O6FC 4PJ9A 5GZOD 4M43H 1LEKB 5KSBB 2FYYB 5IEKA 3GSQA 2D7OA 5BXFA 3T65A 3UP1A 2DQHH 2H6PA 3MJ7A 3WKMH 1WTLA 3CMOH 4NQVA 4ODSL 3UMTA 3ZKND 2FB4L 4U6HB 2XTLA 4BFBD 5SWZD 1G1CA 1HHHA 2GKIA 1WZ1H 4XCYB 1QR4A 2D7NA 2E9JA 1AFVH 2ICES 3H9SB 4PJ5A 5IB5B 2X7LB 1QLRA 5GSVB 2QQNH 5E2TL 5F8RC 1U3JA 4LLMB 2FIRT 3GGWB 4XP6L 4HUVB 1I7TB 1AC0A 3RI5F 2XKNA 5DVLA 1BM3L 4PR5B 3L6FA 2JCCE 3NTCL 4GKNB 5BVPH 4D9QD 3MRDA 3ECBB 4XRCB 2D03L 3SCMC 4HIHB 4OZ4A 3VE0A 1WBXA 3V2AR 1JE6A 3T0EB 3TP4A 5CZKA 4CJ1A 2E8YA 1YEHL 5C9JB 1ZA3A 5I2IA 2A6KB 3QEHA 2G9HA 4FQXB 3D25A 3U9UB 3DYOA 5B38B 1O7VA 3SN6N 3VCLB 3IJSA 4UINH 3M8OL 1HHGB 3MBED 4PJ8C 4JM2B 3LS4L 4HIXL 5L8KB 1LP9A 3HI5L 1YEJL 3FQTB 1HKLL 3RIAF 3BGMB 3QCVH 1XGPB 1YEFL 3FCTA 4N90D 5E2UL 2R39A 2WQRA 5A2IH 2YKLH 1KJ2L 3PHQA 4XAKD 4OZIA 1F4WH 2NY1B 4U31A 5GIRB 3MJ7B 4DVRL 4X6DE 3SGDH 4DN4H 3DUHA 3SDAC 1CFVL 3V6ZB 3RY5A 1JNNL 2JIXD 3U83A 4XX1G 1KCUL 4J6RH 5I9QB 1X5ZA 5F97E 1ZLVH 1NUGA 3KAAA 4Y19B 2M26A 1M7DB 2JJVA 4BA8A 2BERA 3O3BA 4UV4L 5I8EB 1HCVA 2J8UF 4M7JH 4PR5A 5FGCE 1CGWA 3QIBC 1JWUB 4KJWD 3A6CL 1KGCD 5EOCJ 2Q1EA 1JZ5A 4LVNC 1I75A 2A6KA 3MCLL 4K8RC 1DQQB 2Z91A 4OSUH 4R96A 1NC4D 5KVMC 4MJIB 2B5IC 3BZFB 3ULUL 1N64L 1ZHLB 2VDPL 4LCUB 5ISZD 4OZIF 1U8JA 1EEZB 2IQ9H 5K9QG 5I8OH 4JVPA 1B6DA 4GSDH 4G9FA 3NIDE 5DURB 2Q87A 1MAML 3MRLB 4LDLB 5C0AD 1KLGA 1FZOA 3SKUD 4NQDA 3VXRA 4G3YH 3HZVB 3TYGH 4BUGA 5J6HA 1G7QA 4IIQC 4BUHA 3QDMB 4MA1B 2Y06L 3JWDL 3QAZC 4UMGA 5ICZB 3VWKC 3I3DA 3EOBA 3FFDA 2YPLE 1QRNE 4YO0A 2VUOA 4YUEL 4CN1A 2XN9A 1MFEL 3K74B 3D0VA 5BJTB 1IM9A 4LKCA 1KJ2A 5J4MA 5CJQH 1FSKC 1KPVB 3IDMB 5KSVB 2H9GA 4GBXC 2YPVH 5GS1B 2BHYA 2CRIA 5E95B 4DKEH 3EO1B 2XZQH 4F37K 4Q9CA 1AJ7L 2VXSL 1MEXH 1VDGA 5TQ0H 1CDYA 1ZHLA 5FYKL 1ND0A 1ZLWH 3LS5H 3HZYA 2C1PA 4C58B 3E6HA 4N0RA 1U8JB 4Z0BH 4AENB 5IOPA 3C6LB 1KCRH 4I0PA 5EUOF 1IL1B 1GGCH 3TBVB 2AS5M 4DOHB 4ZUWA 2KDGA 3DUSB 5IGXH 3UTTE 1T5WB 1YYLL 1NGPH 4A6YA 1H15A 1J0IA 1I3RB 1J0JA 1LD9B 4LIQE 4M5YH 4NC2B 1ZLSL 4PY8J 4NJAH 4P4RA 1G6RA 5DHVB 3TC9A 2Z0BA 5D7SL 1OAKL 2BVPB 3KLAA 4F57L 5KSAB 2VAJA 3WNPA 1RFDL 1RUML 2XN9B 3VFRA 1FE8L 5C0CA 1SEQL 4PJ7F 1WVZA 5LQBH 3T0EE 5JW3L 4U1GC 3ZE2F 1TZHB 4V1DE 4NIKB 5I1JH 3FQXB 4KDVA 1UXWB 4JPVL 4LDOB 3B83A 3LHPL 1MWAB 5DQDH 4M61B 5J1TC 4ELKB 2EIEA 2BHZA 3KYNB 4WIQA 1EXUB 3TN0C 5B3JE 3V52L 4OQTL 4HIXH 5HHPB 2FDBP 2OXHA 3SDXA 1F11B 1NBYA 4AEIH 5SWZB 3OKDB 5FECB 1YECL 4XXCA 4Y5XB 4L5FH 3VFPB 5IFJA 4JM2C 3T0DA 3VFGL 4HMEA 3VXPA 1FNEA 3D3VD 3MYJB 3ZYIA 3BP4B 3RUGF 3B43A 2IADA 1RVFL 1OAKH 2DQGH 1CGTA 1U41A 2HG5B 1DQLH 4P4RB 2Z31A 4CVUA 1U8OB 2I9TA 1A4KA 3TNMA 4F7PB 3MLTB 1BFSA 4ZAKA 3PV6A 1KYOJ 4Q2ZB 3ZL4L 5JA8B 4NWUL 4N8PA 4ZOEA 5A40E 1PD6A 3MLVH 2X1PA 3TVMD 1LO4L 5TF1L 4UILH 2Z31C 3DBXB 5HVGB 1XF4B 4RDQG 4R4ND 1GIGH 4M61A 2GITB 4Y16C 4M43L 1YN7A 4U2ZA 2EECA 1QD0A 3S3JA 3RWHB 4P5MA 1NLBH 3GBLA 1Z3GH 4ZNEE 4PP2A 1EJ6A 2D7MA 2WBKA 3VG0H 4OUOA 4PJIA 2R56L 3QWRD 2PYFB 1BJMA 3HUJF 5A1AA 2CQVA 3SJVB 5CJOL 3SE3C 1PG7L 3I85A 4GXVL 1VADA 2H26B 5E03A 5KS9E 3VXPB 4Z7WB 3NH7H 1KIQB 1KGCE 1NKOA 4K94H 3U7YH 1MRDL 5DYOA 4NOFA 1RI8A 1MCSA 4KGLA 5I18H 3FO0H 4QXGH 1MPAH 2J8UB 4PJHE 3WS3B 3CFEB 2FR4A 1U8OA 2I9TB 5ID0B 5D71L 5FUOH 4JRYA 1I1CA 3U30C 3V5KA 1V3MA 5E94A 3BWAB 4Y8AA 5DI8B 4OCYH 5IROC 4WV1B 4F2MB 4XPFH 1H3PL 5GGSA 1GAFL 5M94B 1QVOA 3KJ6L 1IAMA 1N5AB 1MLBA 1T6VN 4MA1C 4R90L 4XP1H 5JOPD 1QFWI 4HWBH 2FHBA 2V9RA 4XP5L 2LQRA 2YD6A 2YC1A 2OLDA 4E41A 4YHZL 2W60B 4NQDD 3ARYA 3K80A 4OZFG 1YY9D 1YN7B 1CFSB 4N90E 1FVDA 3LRSA 2VJXA 2HFFB 1EFQA 4R2GD 5CBAA 1A14H 3UTQB 4NKIL 1PVHA 1RZJL 3TYFB 1EDQA 5JHDB 1MHCB 4XP4L 2HFEB 4Q0XL 1YPZF 5JDSA 4LP5A 2WLZA 2C1OA 3DTXA 4ZPTB 3W9EB 4B7LA 5IGXL 1DBKH 4X7SL 3RPIA 5FGBA 1IM3A 3LPWA 1MI5E 4OF3A 4OLWL 3C6LC 3FB8A 4RFEA 5DD0H 2NMSA 4JO4L 2VXTL 2D9QB 5DEFA 3OR6A 5IQ7H 2XWJA 3NACL 3X14A 3O11A 3BEWA 4WV1A 4F2MA 4U6XA 5GGSB 1D9KC 4GAJH 4TPRH 3SDDD 1MLBB 5D9SA 2HVKB 3PWUA 3HG1B 2VDPH 1C12B 2BJML 3B8YA 5CHNA 5HGDB 3GFUA 5D1ZA 1P5VA 3FOMB 1CLZL 5GGRA 4AT6B 1QO3A 1X5KA 2J6EH 4L4JA 4J8RB 4HCRL 2DOCA 1IGYA 3FONA 3GBMH 3GMMA 1A6AA 1JGEA 1MIEL 3PWNB 4NZRH 3TYFA 4ZNCD 3TN0A 5JHDA 2MJWA 2JB5H 4I18B 4Z76A 2PUQT 4PJAF 2C1OB 5F9OH 4X9GA 2VXUH 1Z2KA 3MLRL 4K23H 2EKSA 2XQBL 4L9DA 1KCSL 1MCWM 1V3JA 3F7YB 3OXRB 3V6OA 5TE4L 3P4NB 5FGRA 3SHSA 1I8KA 2R23B 1TQCC 1F6FB 1A64A 1WWBX 3LIZL 1MCIA 4JDTL 5IIEA 35C8H 2UZXB 3BEWB 4WUUD 1KACB 5D6DA 2DRUA 2YD1A 4KQ4H 3I9GH 4O2FB 3T0XA 4IOIA 2DQHL 3D87B 2QSVA 1X6NA 4I0PD 2HVKA 1GHFL 3DURA 4NZTL 1XT5A 2DQUH 3MRGA 5J56B 2KQNA 4FQ2L 2ARJQ 2VZ1A 3PP4L 1S7VB 4XNXH 4YHIA 4NWTH 3IXTA 3NFSH 1MCOH 2MQCA 1DANU 3DXAB 1ZT4A 4TQEH 5J11C 1KF9B 5L6YH 3QPQC 5D7IB 1CLYH 1JHKL 3GMRB 3DVGB 1BM3H 5ESAA 4OLXL 1RK0B 5E4IA 3P30L 3PGCB 4UBDC 1U3YA 2YBRB 1H8SA 2DYPB 5HI4C 2VLRE 3MLRH 2YR3A 2AJYH 4P3DB 2CXKA 4OCWH 1OAUL 5IW1A 1QLFB 2I5YH 4IMKC 2V9TA 1B0GA 1FYHB 3B9KB 4HUUB 4RSVA 3QQ9C 3QCTL 1GGTA 4JZJC 3WEXA 2BXYA 3MNZB 2DD8L 5I1AB 2PYEB 5CUSL 3U2SB 5FO8A 1ADQH 5C0IA 4S10A 2W9EH 3MZGB 3O2DA 4R3SA 3O8XD 5H37G 3BDXA 1UVQB 4G9DA 5JR1L 3QDME 5CP3H 2VQTA 4LHQB 4GMTL 3T3MF 3U30B 4FQLL 3WE6B 1SMOA 1U2CA 4P2QB 3GMQA 1OW0C 1S7VA 2CLVB 1RZKC 3VG9B 4R0LB 3DXAA 1UYWH 2FEEI 1ITBB 1ZT4B 3D0LA 2WZPD 4WUUA 4R7DA 4OBRA 2ATKA 1P4BL 3TPUB 3JV4B 4Y5VA 4XCCH 2A6IA 4I4WB 2CKBL 1CT8A 3RUGE 4MCYA 4MAUH 4Z7UA 1D5BB 2BY0A 1C1EH 1WC7B 1MH5A 4OIIL 4WW2C 2V9QA 2E9WA 4KHTH 3F65A 3SBWC 4P9MH 5ISZA 2BC4A 1JV5B 5IW1B 1JF6A 4HUUA 2ESVB 4O9HL 1SJVA 2FYYA 5IEKB 1I4FB 1BQLH 3I02A 5EUOA 4Z7VA 1FYTD 3BX7C 3QUML 5I30L 5JDJA 3MOAL 4Z7NE 3IJHB 1VFMA 4XHJC 1OP5K 4YLQT 4RMQA 5J3HD 2F8XC 4N0FB 4FFVD 4IMKA 4NUGL 3GMQB 4P4KA 5FYKD 2EH8L 4LPXA 4QRTA 1KELH 1PSKH 4MB5A 4HFUH 2YXMA 3ARFC 4DKFH 2BZDA 4F7TB 3L6FB 1Q0XL 1CK0H 3MRFA 5TQ2H 4M6OL 3DVIA 3UTSE 1ZT1B 5EBLB 3L5HA 4Y4HA 4G80B 4G7VL 2HJKB 3C60A 4X9HA 3CZFB 4P23A 1U8HA 2HLAA 4PFEA 2YPVL 1YNKH 1WC7A 1OWWA 3GUTB 3ARBD 4MYWB 1AI1L 4JM2A 4BZ1H 4FQIL 3LKNA 4W4OC 1GGIL 3MBXH 5DVOA 5FM5O 5KTEL 2ICWI 3G08A 5HYIA 5FK9B 4C4KT 1QUNA 1S9XA 3O3AA 1VKXB 1XGPA 3FCTB 4HHAA 3O8XA 3D5OF 3KJ6H 2V7NA 3S4SG 4HJ0C 3FZUD 4P2RD 3LVEA 5CGMA 3IKCB 1JGLH 3MRCA 3EKCA 4KK5D 1NANH 3DYMA 2P24B 4QKXB 5IVXE 3QIWC 4WCYL 4HW6A 1W8NA 4HUXB 4PGZA 1CGXA 3HPJB 5B21A 1AE6H 1A6TA 2GW5A 1TQCB 2IQAB 4K23L 3BWUC 3PP3K 3ULUD 2UUDH 3BH8A 1G9EA 2RAMA 4FQ1L 5D7IE 4ZQKA 3EDKA 4ONOA 5CEZL 4LSRL 2ZOKA 3MV9B 4NZJA 4Y4FA 1TMCB 5LQBL 1RMFH 1A6VL 3CCHA 5BMFH 3L5WA 1AI1H 3F7RA 3LAFA 1QOKA 4KY1L 3VMPA 2Z91B 3R0MA 2VR9A 3LEXA 3V79C 4PJ9D 4DGIL 5A16B 4NNXB 4OCRH 4L1DA 2R2HB 2I60L 2DQEH 2ZOLB 3VFSB 3G5YA 4P59L 4UIMA 3U6RB 3ULVE 2PYEE 2OYPA 4UAOB 1C16A 5GS0C 4L4VB 5L8LB 4MD0A 5CS7A 5ESQB 1MNUL 4NN6B 4X8XA 2OQJA 4XWGL 1QFUH 4NN5B 3NFPB 3HZVA 1T0NB 4NZUH 5J6HB 4XVSL 3IJYA 3QDMA 1EFXB 3B9KD 5IB3B 4JFFD 3DIFA 3BESR 3FFDB 3KXFB 5T1DH 3DGCR 1ZE3C 5DK3A 4OZFA 4XZUB 2LAGB 1CF8H 1MIEH 1GH7A 4LARL 5IVZB 3L7EA 1SYSA 3MV8D 5TDPB 3RY6A 3NTCH 4QT5A 5FKPA 3U79A 4YHPA 4N8VA 4O58L 3TZVD 4C59B 2BY3A 3QUXD 1BOGB 1HI6A 1CLCA 2G60L 3L5WB 1FN4B 3WXWH 1WCBB 1C1EL 3QI9B 2J88H 3FHAA 4PJ7B 4URTB 5IBTH 3TBWA 3IAPA 2BRRH 4JPWH 5D7LE 4JB9L 4KJQC 2EYRA 3ARQA 1PEWA 1J1XH 3U36A 2R2CA 1BOYA 3QQ3A 4Y4FC 4HLJA 5JHDE 1EVUA 4D8PB 1CGYA 5F88B 1OP3K 4YDKL 5FGSA 3DUSA 1V5JA 4PRIE 5DJ8A 4LCWE 4A6YB 3QPXL 1Z9SA 4S1RH 5CJ8A 5ALCL 4UT9L 2ICEB 4NHCH 1B4JH 3IF1A 4F15C 2CIIB 1P7QB 4ZUUA 3BSZL 3LKPB 4F58H 3S6CA 5HSFA 5EU5A 2NTFA 3L7EB 4ZO7A 3T1FA 1ACZA 4K71C 5J6GB 3VWJB 1IC7H 4ZUSB 3GSNL 1A3RH 4D0BA 3QDMD 1U8IB 3TBSA 3KYOA 4MA7L 4GT7A 2P43B 3KYNA 3OJDB 2E8ZA 1EHLL 4RIRA 4ISVA 1DL7H 4QHNB 4APQA 3DROA 5J9PA 3NCEB 1JWMA 3ESVF 2FEDD 4RAHA 4JY5H 3DX7B 4RCAA 1R3HB 3B6SB 3P0GB 4LEXL 4LMQI 1FZMB 4BKLB 1FNEB 2ADFL 5HYSG 4OM1L 3KPSD 4U1NB 5I1CH 1UZ6E 2NXZD 3LZFH 4XBEH 2DBLH 2EXYD 2W0PA 4HBCH 1JTPA 5CSGA 1FCCA 2AGJH 4M62H 3MLZL 1VFAB 4FQ1H 1TCMA 1YEHH 4HT1L 4EOWL 5E8DL 1LO3L 4DK6A 4M6ML 1A3LL 4DUVA 3HI1B 4F9PC 3QO0A 1A1OB 1DVFB 3MRMA 1MUJB 5E2JA 1E4WL 1LHZA 4Y4KB 1ZKAA 3WNLA 3VXSD 4FXGB 3TT1L 1NFIA 4PJGB 1NUNB 2CIKB 1EUTA 1Z3GL 5AAWA 2YWZA 1CQYA 2D4DA 3QI9D 4DGIH 4APQB 4TSAH 4PB9L 5JW4M 4AIZA 2RCSH 4JN2A 5L9DH 5H37H 4PJ9C 3P0YL 5TJWK 1MJ8L 3SJVA 3VH8A 4YDIL 3MXVH 2NY4D 3BD4A 4Z7WA 3DWTA 5D7JC 1CL7I 1TDQA 2UZIL 1CBVH 1ED3A 2EH8H 1OGAB 1JYXA 1T1YA 3UDWA 2ITCB 1ZLVK 2GUOA 3MRBA 4UAOC 4YBHA 2EC8A 3BHBB 4KKLD 4XNQA 2WM0A 5ID0A 1CXFA 4GW1A 1T5XB 3HS0B 4MSWA 5HVHB 4M4RA 4LPYA 1JCKA 2N7AA 4JRWA 5CBEA 3S3SA 1K8IB 5CKGA 3MRIA 5C0AE 1P2CB 3BH9A 2R1XA 3BXNB 1FC1A 3BO8B 1T22A 4WUUE 1JGVH 5I17B 5AUMB 2CIKA 5B3NA 4P3CL 2VOTA 4BSVB 6FABL 2EH7H 1ES0A 1FAKT 2PW2A 2IFFH 5MERB 4DTGH 2HFFA 3U4BL 2BHUA 2V2XB 5C70A 1MCCA 1UKTA 1FPTH 3VGFA 1NBZB 4UT6H 4HC1L 4PJ8A 2FIKB 5E8NB 5DHVH 3O6FA 4ORGA 4E9LA 4Q6YA 3WFCH 4HK3J 5BQ7B 1KPRB 4UUJB 4EQ3A 2P5WB 1NL0H 3IU4H 4OLUL 1OW0A 3QQ4B 1H9VA 3T4AA 2JK5B 1QFHA 2XNAA 3X14B 4YBLB 4H88L 5HHQB 3W0WB 1CGUA 4WFFE 5DJ6B 1S7SB 4HQQH 3E0GA 2WINB 3N9GL 1FNSH 3RGVC 5C0NC 2Y4SA 4BFGA 1BBDH 2QR0A 5HJ3A 2VKXA 2WWMC 5FHBH 1MELA 1DBBL 3LQAH 1ZANL 2XXMB 3FOMA 2CUHA 4HPOH 3ZYJA 3SKNA 3GSRB 1V3LA 1QO3B 1MIML 5DHYB 1A6UH 5FA3B 5DUPH 1IGYB 2AEWA 4OFYA 5BO1L 1YNTA 3PE9A 1IMHC 5IB4B 5I8KL 4OUUA 1AHWB 2XTJB 2XN9D 3MREB 1HH9B 1KPRA 5HHNB 3OG4B 1WITA 1ZGLP 3SE8H 2GAZA 3BZDA 4BQCA 2WV3A 4LU5L 1MCRA 1GC1H 2KZWA 3B8SA 3ILPA 3DMMC 4EI6B 3REWA 4JQIL 2P46B 1MAJA 4G6JH 3VGBA 4EOWH 3HC4H 1P4IL 2UY7A 1D5ZA 2ZWLT 2V5TA 3QQ9D 3IDJA 1I8IA 2VABA 5ETUA 4RFOH 2I26N 4G6AC 5DC0A 4NJ9L 2X4TA 3GMLA 4YDLB 4LLWB 5EO1A 3PHOA 2VR4A 4JFPB 5DUPL 4AEIL 3ULVC 3CU7A 4TVSa 1YEEL 3TESA 4JQXA 1S9YA 2DBLL 3CH1B 4CN6A 3WLWC 1F3JA 2BNRD 1ZA6B 1TVHA 2V7HB 3NCYS 1G7JA 4FMFA 3W2DL 4OUUB 4N5ED 3TNNA 43CAB 4APQC 4HIJA 1T3FB 5IB2B 3TM6A 5L8JB 1LEGB 1Q94A 4LLUB 3LB6D 4HGKC 4PJ9B 5L88L 1B0GB 1QSEB 1F4XL 1UM5L 1J10A 1KTDB 1J8KA 3EFFA 1CDGA 1EBAA 1L0QA 2OL3B 3IXAB 4KGJA 4HZLB 4OCLC 4NQEE 4QOKB 4XP9H 4FQCH 5D96B 3EO0A 4L29B 1L7IH 3FO2B 5TF1H 1TFHA 3GIZH 4LPTA 3O41A 4R97B 3DX6B 4R3SB 2D7TL 3PV7A 1PYWA 2PW1B 5DRXB 5ESVB 2ZUUA 3FOLA 4MJ4A 5HGGS 2X7LA 4X80H 3HI6L 1HEZB 5DFVD 4G8GB 1EERB 1I7TA 3HFML 3HE6B 5GZND 4H5SA 1AGCB 2Z92A 1PX4A 1S7TB 3VFUB 2H41A 3J7HA 4FQJH 1CICB 4CJ0A 1PG7H 4J12A 4LSSH 4H0IA 1CFQA 2A0LC 3AUVA 1BFTA 1AQKL 1B2WL 5CZXC 4WI2A 2WAHA 1Z9MA 1ZA6A 2CMRH 4MCYB 5C07A 1G7JB 2VZTA 1HSBA 3BN9D 4KHTL 4NZDA 3QEHB 1Y0LB 1AP2A 3U9UA 1MH5B 1EGJH 3OSKA 3Q5TA 3TBTA 3D18B 5CMAB 4DKEL 3SE9H 1NKRA 5C0BB 5DJYB 3UC0H 43C9A 1T66C 3K2MC 5KW9L 3FQTA 4WI8A 5TE7H 2MKLC 4XNUH 5KSAD 1XF2A 3SDCB 4OLEA 1XGRB 4XBPB 3TPKA 1LEKA 3OKOB 4QOKA 4JFZH 1J0HA 1BBJA 5C09B 3T8XB 1FNSL 1R5IA 3I50L 5FIEA 5TGBA 4XVTL 3DO7B 3EDJA 1FVEA 2AJ3B 1HXMA 3HE7C 3V6ZA 1W0VB 3NCBB 3RWGA 2MCPH 4N0FA 4YBLC 4R7NB 2Z4QA 4IDJL 3V4VL 1PSKL 4U1HA 4NO0D 1MFCH 1N3NA 4ZUVB 2RCSL 4JFXA 1NSNH 2WLYA 3GNMH 3DVFA 1DZBA 3FB6A 1NMBL 2Z92B 5D7SH 1UB5A 4MLIA 3K1DA 1CF8L 3WFHA 2AV1A 4ZFGH 3O6KH 5JIHA 4Y4HB 5C07B 1BIIA 3N9GH 5D2NC 1KBGH 4I9WD 3VXSA 5J0BA 2YEZB 5E7BA 3KPMB 1UACH 2XICA 5B38A 1N0LA 1ZT7B 5GGRY 1P9MA 3VI4E 4CMMB 4WTXA 1AD0B 2AP2A 2L0DA 3MODH 4HHAB 4PJFA 2PF6A 4F7EB 4U3XA 3T09A 4LLVB 1X5YA 2OS7A 2AXHA 4N0YH 4IHOB 2P24A 4CADA 5DD6B 3BRGC 2F58L 3L7FA 1A7NL 1ZHBA 1IC5H 4IDJH 3V4VH 4LNRB 1AGFB 1TJIH 2B1HH 2IFFL 4DTGL 4OZGB 4LLDA 2LAAA 3GBML 1MHPH 4L8BA 4CMHC 2FSEB 1NCCL 3MRQB 1HSAA 3L5XL 3S3PA 1F4YH 3SKJH 5EIQA 4ALAH 2AV1B 1A6VH 4JN1L 3ZKXC 4PJ8D 4Z7OF 3MMEB 1XGQA 5EU3B 3VRIB 2ENSA 3JTTB 4ODHL 3WIFB 1HQRB 2AJXH 3CCHB 3V4UH 4ELMF 4FHBD 3MLWH 1E6OL 1OTTD 2C3GA 2QHRH 3P2TA 1LDSA 4OD2A 4DN3H 3L1OH 3K4ZA 3PWPA 4PJAE 4NM4H 1IQDB 3N1PC 2AERT 1QSEE 1DE4B 4NJ9H 1Q8MA 5E5UB 4ELME 3VFSA 4CMMA 2FGZA 3QFDB 4Y1AB 2FWOA 4Y19D 5I73C 4UIMB 3WHE1 1OSZA 5I66B 3GSWA 1N5YL 5DFVC 5HDOA 2LABA 1J1PL 1U8PB 4OGAC 5ERWB 4FFYL 1U3HC 3ALPA 1TTGA 5DRZA 4NKOA 1FZOB 4DGYL 3FT4B 3UBXA 2CLRB 1G7QB 1GYAA 3VMNA 1IGIH 4M48H 5JNYA 3TZVA 4F3FA 3RVXC 1IGJA 4PG9B 1RHFA 4R97C 4L1HA 5MP6H 5I1KL 4M4PA 4P2OA 5EOCL 5FDYA 2AJXL 3EOTH 3RWJB 1O5DT 3PWJB 4XBGA 2Q86B 4Q9RH 1NAMH 2EIBA 1UJ3A 3M1BB 2OTPA 5KZCD 4DN3L 1YA5A 4P9HL 4PRHA 2WWKO 3HE6C 5B39G 4WHYH 1WWCA 3S9DB 4S1QL 2BX5A 3MUGA 3LQZB 4XT1C 3WLWD 3LY6A 4PREB 4JQIH 4E5XB 2EDJA 5MHSE 3HZMA 3PNWB 4Y7MA 1UG9A 3NABL 3SGKC 1FBIH 4LSUL 4AENA 3QQ3B 4HMCA 4Y2DB 5GJTL 2FATL 4ONFL 5ERWA 1S9WA 4LGSB 2QQNL 2IAMD 1T5WA 4ZUTA 4IRZH 1MFDH 1TLKA 3SOBH 2CLRA 1HH6B 3BP7A 2EC9U 1A4KB 3TNMB 3IF1B 1KENH 2ZPKL 2F54D 1F90H 2B0SL 1I9JH 4XNYH 5B39B 2DS4A 5D8JL 5JOFA 4JHWH 3UBXI 2DMKA 4PS4H 4P2QD 2AJUL 3GSUA 3AM8A 5HYJB 2Q86A 3KHOA 5HVFB 2XA3A 1A1NB 4LKXA 4AZ8A 1RMFL 2CXGA 4AEFA 1EHLH 5DXWA 1U3HD 3RZCB 1JTOA 1VFBA 4JRXE 4RIRB 3MUGB 3O2WL 4U1LA 4EI5D 4OLYL 1FQ9C 2WIMA 3GK8L 4OI9A 3CUPB 4JO1L 4PTUB 1AXTH 2PYFA 4WFFD 3SDXB 1FJ1A 3SY0B 5CEXA 3OKDA 1U95A 2HKHL 1JF1B 3KPQA 2JKXA 2IJ0C 3LZFL 5C0JA 4DCQB 2UY6A 2EEDA 2ENYA 1KENL 4MVBD 4ODVL 2Q7YB 2DWDA 1Q38A 5F8QC 3F7VB 4XMKH 3CX5K 2R1WB 4PJFF 4KK9C 3RKDC 3QDGA 3FT3B 1XIWC 4Q7DA 4H88H 3BPNC 4QYOA 4HWBL 4EDXA 5IF0A 3L95B 3HI1A 3O45A 4JQXC 5FA4A 1LO5A 4O58H 1RZIA 3QO0B 3U7AA 4JM2D 4MMZC 4JPVH 4FXGA 4V1DD 1MCPH 2CDEA 2GITA 4KV5E 4UNVA 1LEIB 4MNQA 4O02L 2BRQA 5K9OA 4G8FB 3CUPA 5DJAA 2NR6D 4LGPB 3MJGX 1DQTA 1FJ1B 2WUBH 4ZTPL 4KJWC 1DEEB 4ZFOB 3BUYB 1RIVH 4JO4H 3OKEA 4GKSB 5F89A 1A9BB 1OGAA 2BOCB 2F53B 3BIBX 3FB8B 4RFEB 5LJYH 4M1DH 3C5ZB 1MFEH 3D2UB 4Q58C 2J8UA 1BZ9A 2R1WA 4JRYB 5D1XB 3EYOA 4OFKA 5I76A 4KKLC 3ULVF 1IM9D 3GI8H 2BNRE 2FO1A 1QSFD 1MY7A 3MR9A 1MCLA 2VXSH 1N5YH 3SE4C 1T22B 3NPSB 3TIEB 5ACZA 1CD0A 1YPZA 5F7UA 4RGMC 4D3CL 4WUKH 2YPKB 1JL8A 3UYOD 4Y5VC 3DMMD 1CG9A 4JHAL 4KAQL 2VQUA 1FO0H 3KPTA 3U4BH 2R4RL 1NAMB 4ESKA 1D5XA 4J1UB 2RJMA 4NC1E 1P7HL 2R2BA 1G9NH 1IGIL 4HF5H 1RUKH 1AR2A 1KLFA 3WN5A 3KNBA 4FRWA 4KK6D 3Q2CA 4N8VG 4A2LA 3ULUF 3ARTA 1YQ2A 5IMKA 2YPLD 4I18A 3FB5B 1A6WL 2UWEA 4KJPD 2FGWH 1PAMA 4PLNC 2DM2A 4Q9RL 5K93A 3H3PL 4OGZA 2W9DH 2W1NA 3HPLB 4P9ML 1IBGH 4XBEL 3WFZA 1A0QL 1RUPH 2YD2A 5C07D 4ZPVB 4JO2L 2EE9A 1OLLA 3ZKNC 5ITBH 3V7MA 5A2FA 1I9IL 1S7SA 1NCNA 3DGGB 5HYJE 5IHLB 3LHPH 3OV6A 3V6FA 4EDWH 2QR0B 4D2NA 1JYNA 2NY2B 5D9SB 3FO1A 1HDMB 1FO0L 3HG1A 2VXVL 3MRGB 3QXDB 3ARBB 4X6CA 3KYMB 3G5XA 3S97C 1D5XB 4J1UA 2DQTL 4L5FL 1YC7A 2VSCA 1J1PH 3NIDF 5EZJA 5IR1A 3R06B 3Q6FA 3DETC 5I1LA 4HPYL 5SWSE 3EJZC 1UWGL 5CEYA 3UYPA 4EIZC 1NBVL 5CILL 3RZCC 2DQDL 4KZDH 1VB9A 5B8CC 4BZYA 4UT9H 4YK4C 2HRPL 4U4BA 5DC4B 2BSTB 5E9DA 4GLRI 1UKSA 4EUPH 3RX5A 3TN0D 2VRAA 2MFNA 1QA9A 1FZKB 2IANE 2BVOA 1KTRL 2WP3O 5A43C 1VESA 4ZPVA 1JN6A 3QXTA 4NFDA 1DUZA 2X89D 2PYEA 2GQHA 3QH3B 5FUCC 3L3HB 4NQTA 5EO9A 5IIEB 2A6JB 2YUWA 4RMUA 5C0IB 1BWWA 2LVCA 3HAEA 4GW5A 4JFZL 5D1ZD 3ZSSA 2IC2A 3I6KB 4U6HA 1UVQA 3FN9A 1CXLA 1ITCA 1HDMA 4XCYA 5E5RB 3UYRL 3H3BC 4E42A 3QXDA 4CRPA 1UYWL 3FQRA 1PY9A 4OZGE 4X6CB 1NDMB 5LGKA 3G5XB 3SDDA 1K6QH 5BVPL 3ZLQC 4XC1L 2FRGP 3BPNB 1FL6B 1S9YB 3MPCA 4MQTB 5EZJB 3TPUA 4NFCA 4DN4L 3G6JE 5D7IA 3QXVA 3T0EA 3K4AA 5F1SA 3OJMB 3M8OH 1U8KA 4LSDA 1A7RL 5K9JH 4OI8A 3PGCA 2VN4A 4R4FL 5HVWA 3ZKQD 2C3XA 2DKUA 4LGRB 2C5DC 5T1LA 2XQBH 1LEGA 3H8NA 3GM0A 2VMFA 5IHUH 5E1HB 4K7PL 4PJBF 3JBG7 3SKOA 2BVOB 2NY6D 1IC1A 1BVKB 2VZOA 2OL3A 3IXAA 3CX5J 5F9AC 5ACLA 5IT2H 3I75A 5MEQB 1HZHL 4YPJA 3WEXB 1Z5LB 4MHHI 2NZIA 3U2SA 1F6AA 3MCG1 2HLFC 2XY2A 3GRWA 3RGHA 1R0AH 3MRNB 5DZNA 1N2RA 4PGCA 3AVEA 4LVNB 4ETQA 3NA4A 3FQRB 3H9SA 2HTKC 5AAMA 1QFWL 5H94A 2IMNA 3AFLA 4UDTA 1OSPL 1EJOL 5GZOC 1A6ZB 1LE9A 2AV7A 4N9GA 3D0LB 3WIIH 1CFQB 1U42A 2YN3A 3K0WA 4GKNA 4XVJH 2FJFA 4XI5D 3EYVA 1JNLL 5JHLL 4Y5VB 5DQJB 2NW2B 1MQKH 4RBPK 2BNUA 1U9KA 4JREB 1MCKA 5KVEH 1CXIA 4PRHE 3LSOA 5T1LB 1IGFL 5KS9F 1RZ7L 3TA3D 4J3OC 2GK0A 4NQCB 3DRQB 3R1GH 1NPUA 3KLSA 5TDOA 5HPMB 4G9FB 2ESVA 3HN3A 4NQDE 4HF5L 1T20B 4FZEL 4AEHH 3MRLA 1I9IH 1FLRH 1F8TH 1CE6B 1P5UA 3N85H 5GISH 1EX0A 1P84J 4G42B 1F6AB 5GRJL 3S98A 5CINH 3MRNA 1I1YA 5DD3L 5EBMB 4ETQB 2Z4QB 3H3PH 3AM8C 2OP4L 4PUBL 1JNHB 4G6KH 4RAUB 3BH8B 1UB5B 3MOQA 3O4LD 1KJ2B 1XGTB 1KEMH 1DTUA 1N8ZB 1KPVA 4GKZA 3B9AA 3KPOA 3UTPE 4XCCL 5JORA 5DQJA 3ARBC 2BNUB 4JAMA 2LU7A 4MLSA 3MGOA 4JRXB 5CP7A 5DURD 3JWOL 3R1GL 5IHZA 4NO3A 3QCUH 5CD5D 1P7KB 5HHVL 3C6LA 1NLBL 3NN8B 3I9GL 4NNYA 3HNVL 1S9XB 3QDAA 3TWCH 3O8XB 3SGJC 1F00I 4JFED 4FFVC 4ZUWB 1VGKB 2X41A 4CADB 3JVGA 1CDIA 4XVSH 5IJKA 1CE6A 1TVDA 1T1ZA 2RBLA 1WIPA 3T2NH 3GIVA 2B1HL 1MJ7H 3NCYP 1IQWH 2R1YA 5E2WH 3KPRD 2XOTA 4UV7L 4C56B 3P9MA 5T3ZL 4K3DL 2HT3C 4X80L 3KLAB 3RWCB 3CSPA 1MPAL 3MLUH 5C86A 1T0PB 1OAQL 1W2KT 4YO0B 1I9RL 3JXAA 5AYUL 5IBUB 1F90L 5I74C 2AI0H 1J12A 3P0VH 5EB9A 3GJFB 2JIXB 2EKJA 2EEAA 3I3EA 3WIFA 5JORB 4YQXL 3S35L 5ILTH 2XXCB 1KJ3L 3QG7L 1FFNB 4GLRH 2GT9A 3LEXB 5FYJH 4M93B 4RZCA 3QB7C 4W4NA 2PTUA 3BKCL 2NW3B 4FQHA 3TFKD 2XG4A 4NNXA 1LVEA 3NN8A 3E6HB 4NNYB 4A2MA 4P46D 1IGCH 1ZTXH 5IOPB 2MQ0A 1LO4H 2BCKB 1XIWA 2R0ZH 4I0PB 3UBXG 4KFZC 2BNQB 4Y5YB 3WYRA 3D9AH 2C7UA 3S36X 4LOUC 3RIFF 3WD5L 2MHAA 2GI7A 3VXUA 3P4MA 3KWWA 3UO1L 1J7VR 1EFXA 4FXKA 1R6VA 2Z31B 5IB3A 4F7PA 3DIFB 4G8EA 4WHCA 5DHVA 5MP6L 2NX5A 3TVMA 5KSAA 3IFOB 4L4VD 3ZTNH 4PLOB 3AREB 3QUKB 3SPVB 4UOW0 3O3UN 5D4QA 1R3JA 4OIIH 4PJXB 1UH3A 1LWRA 1UJ3B 4HJGB 3KDMA 4PRHB 1RPQA 3DBXA 3RKPA 5HI4D 3C60D 4KY1H 1GZQB 1FN4A 4I8DA 5FYJL 1J1OH 1IGML 1J05B 3OJDA 3TT3H 4TNVF 5FGBC 1FCGA 4Y4FD 1NMCB 2W0FA 1EZVY 1I3GH 4XP1L 2XFXB 5HGAB 1A3QA 5CLWA 1JZ3A 1F11A 4P59H 3NZHL 1R3HA 3B6SA 1FIGL 1H8NA 3ILQD 2BNQA 3TH3T 1IKFL 4U3CA 4NCC1 4D8PA 3TJHC 3MFFA 3CDYA 1LK3L 5DYOB 3MYJA 3CK0H 4L4VE 1SM3H 1Q1JH 1JIBA 3V0AC 3WS3A 1S7UB 1M71B 5HYFA 1I1AC 4G8EB 3KYKL 5IFAL 2NX5B 5DFTA 3HZKB 3CFCH 4Q0XH 4IRJD 3OF6A 3GSUB 3IDNA 4XHJD 5F1KC 3UTTA 2JF1A 4BZ2L 4YHNA 4HQQL 4GAGH 2WBWB 4G5ZH 4OLWH 3GI8L 1A1NA 5EULV 5DT1H 1J87A 1YEIH 1H3VA 5IESH 1GZQA 2HMIC 1J05A 1CFSA 3ISWA 3N50A 4GSDL 4FP8H 4FNLH 4TPRL 2PO6D 4NWTL 3OGCB 5INDB 3QUXA 2VWEC 1SQ2N 2XFXA 1HQ4A 3FFCA 3CVHB 5JXEC 1UFUA 2BOBB 4M5ZL 2ZSVB 2J8OA 1CD1B 1G7HB 4H8WL 3SY0A 3O3DB 2IH1A 5J1SC 1RUQL 2FJGB 2HFEA 5AYQA 2F19H 5I1IH 4U05A 5CKAA 3HNSH 5KVFL 4ZMAT 1N7MH 1D3CA 1R5VA 4N1HB 4F37F 3EFDH 1BX2A 2VWEE 4NHCL 4PRIB 4NRYB 4K3DH 3GSOB 1T7VA 3QCUL 1EV2E 5EUOE 3MRIB 5I1KH 4PPTA 5KVEL 2IEPA 4JFEE 2OCFD 5CD3A 3UJIH 3VW3H 4WI7A 4Y2OA 1QKZL 2XY1A 4Z7VF 1F58L 5C2BH 3QUYA 5KOMC 3T0EC 1QBBA 4FFZH 5ENWB 3UPRB 4J4PC 5K9OB 4X5XA 3PGDB 3VXNB 3QO1A 1MCHA 3ZO0A 4NGHH 1ZWIA 4PJ8B 1YEKH 3DMMA 4I3SL 3PQYA 2FX8H 1T0MA 1YQVL 1L9MA 1MHCA 4H25A 3L3GA 5FM4A 3HR6A 3QNZB 1I7RB 3C5ZA 3LS4H 1AO7E 3C6SB 2NY1C 3QIUC 1QEWA 4JDTH 1BZ9B 3KPSE 4ZFOL 3BHBA 4XAWL 4Z8FL 4ODHH 1B6UA 1FFQA 3HE7A 4HAGA 2E7LA 1EEQA 4OCXL 5CBEB 1G0DA 4HT1H 4O2FA 5I9QC 2EDRA 4GOSA 1VHPA 1F4WL 4OZIE 1OAUH 2A1WH 3HCVA 4KQ3L 1XR9A 3SGDI 5E5MA 4NBXB 2B8OT 3D9AL 5CD3B 3THML 4P5TD 4OSUL 1OP5H 4MJID 5FCUL 1F2XK 1KEGH 1TJHL 4FS0A 4X8JA 4QHMB 4JVUA 1J1OL 5GS3A 1MRFH 5F1NA 4AMKL 1C08A 4OLYH 3E8UL 3FAWA 1X4YA 2VUYA 1IE5A 1ES0B 3HB3D 1QBLH 2B5IB 3ZMRA 4MDJB 3PQYB 2FIKA 5E8NA 4R4NC 1SBBA 1T0MB 3CC5A 3FTGA 2Y07L 5JMOC 4H25B 1A7RH 4PY7B 2DYPD 3RY4A 4MCZB 5ITFB 1RUPL 2IPUK 3JZ7A 4IRJA 2GAZB 1CGSH 3D85D 3GEWB 2GSIB 3QQ4A 3REWB 2D2OA 3VG9C 3MNZA 5DJDB 5DQ9B 4NQXB 4GAJL 1Z0MA 2WBJD 4QTIH 4HX1A 1QPPA 3HCVB 4PGEA 4M1GL 2AW2A 4LLWA 3HLAB 1IGTB 4WW2B 3VG0L 4TSBH 3ZZ1A 4R0LA 3IXTB 4WUUB 4WTZA 1NUDA 1WGOA 1BP3B 2OR9L 4R7DB 5D1QD 3JV4A 2HJLA 2YPLB 1E4XL 4YEFA 4OB5H 5HI3C 4TNVK 3HNTL 2FBOJ 1D9KA 1WBZB 1XGUA 3KGRA 4YFLI 5D1QC 2X4OA 1ZLSH 4L8SB 3IFNH 4MJ5A 2BC4B 5IB2A 5DF0A 1BAFL 3HG1D 3OZ9L 1WEJH 1XR8B 1QLFA 2NX5D 4HH8A 2GSIA 1BMGA 2HA1A 3LD8C 5EUOB 4NM8L 4BSWB 35C8L 3NBNA 4P4KC 3DHMA 5BXFB 2QQKH 1L6ZA 1RIUH 3K81A 4NQXA 3CDCA 5SX4I 3QUZB 1D5MA 4GW5B 5LBSL 5IEHB 4NQVB 4WHYG 2VN7A 3EJYD 3N85L 2Q6WB 1INEH 5I71C 3O4LB 4U1MA 1KG0A 3WE6A 1H3GA 1NFDF 4P2QA 5FHAL 2CLVA 2MOVA 4X9IA 1BIHA 1XGYL 3FQNB 4W4OA 4JEGB 2VLKE 4F80A 2YPLA 3ES6A 3REVB 3BUTA 1W0WA 4M8QA 1WBZA 4I3SH 4KI1A 2X09A 4LSTL 3RPKA 5J1AB 3TBTB 2CR3A 5DJCA 1OGAD 5BZDB 4V1DB 1XFPA 3Q6GL 1T3FA 3SO3B 1JV5A 1LP9B 4KMTH 1F58H 1VKXA 3BE1L 3NFNA 4M9OA 1CL7L 3CSYA 5J12B 5BMFL 4R8WL 3FN0L 4G5ZL 2Q8BL 1Z5LA 3TVMC 5CUSH 4OZIB 5IM7B 1MOEA 1GGBH 2DI9A 2Y6SC 4MNQD 2FCBA 4MD5A 4FTVD 4K55A 3O41B 1FVEB 3QIUB 2AJ3A 2M1KA 3CFKB 3MRKA 4DEPB 5IKCA 1HNFA 1Y18A 3VH8G 1PYWB 1CXEA 2IQAA 4JQVA 5FHAH 1KCRL 4RNRB 4XTRD 2DQGL 3OB0H 1OQOA 2DDQH 5HDBF 4QRTB 2QJDA 4P57A 3OKKB 1QFUL 3WFCL 4MXQC 5JUEL 3PQYE 1FNGA 5B38G 5ADPH 2ZUWA 4MHHG 5FFLA 4M3KB 2JTDA 1JWUA 4GXVH 1I1FA 1NBVH 4JKLA 1U8LA 1X6LA 1U91A 3Q0HA 4WW1A 4Z6AT 3EFDL 4MXVF 3KPMA 4NN6C 4X4ZA 1X44A 2EDQA 1AP2B 3JWDC 5BZDA 5LGHL 3GUTA 1X5LA 2VERN 1LP9F 1OAZL 3O6LL 3THMH 3BE1H 2ZOLA 2M8XA 2GK0B 4NQCA 4R2GC 5DMGD 3WLBA 5IK3A 1UM5H 3FB7B 3CSYB 5DEZA 3WXWL 4CDHA 4JFFA 1YJDH 2AJZB 2EC9T 4TULH 1NGZB 1HILA 1I3UA 5KBNC 3NFPA 2LE9A 5EC1A 2J5LB 3RVXD 5TGBB 1EHNA 4QOKE 4M1GH 2AXJA 4IRZL 3K8KA 3MGAA 3HPJA 3RWGB 5ICZA 5K9QI 2XQYK 3K2UH 2E7LC 3NIGE 5F93C 3NCFB 4LAQH 4FXLA 1EZVX 2W38A 3TA3A 4RGND 1QYGH 4P2QE 5EIVA 4HBCL 1E4JA 2L7JA 4HWEL 4YHPB 3ETBF 3P77B 5JLZA 4KMQA 1SVCP 1HQRA 3TCLA 3S37H 4Y4FB 1ETZB 3MSPA 5LGJA 5FYKE 2J7LA 3QI9A 4L3AA 1N6VA 1RZKH 5C0RH 1CQKA 1WICA 3D2UD 3MTRA 3VWKA 5CIPB 4YFLF 1JBJA 4CW1A 3ZT5A 2VC2H 3HNVH 4RX4D 4NO3B 2C1PB 4JLRB 1JYVA 4MXWH 5EG6C 1OSZB 5I66A 1OD7A 1UM6L 4JZOB 4DZBB 4L8SC 3CVIH 4P5TC 1IQWL 4JR9L 1R5WB 4K71B 1IT9H 2Q3ZA 1PEZA 5EC1B