2EDEA

Solution structure of the sixth fibronectin type iii domain of human netrin receptor dcc
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Netrin receptor DCC
publication title Solution structure of the sixth fibronectin type III domain of human Netrin receptor DCC
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edeA01
1G7QB 3UCRA 4EI5C 3L3OB 2MMXA 4HF5H 5K9OA 4WUKH 1ADQA 4XP4H 1JYWA 4OCSH 4WTWA 5DRWA 2EIEA 4I77L 4KXZI 4Z76B 3J7HA 1I8KA 1BEYH 3P3YA 4GBXD 3LIZL 4YGVA 3CCHB 1EEQA 3BT2L 4PJ8C 2ICCA 5I16B 5JXED 3BYYA 2QBWA 3ARED 5AEAA 2JJVA 2YN3A 5FUCE 3FMGH 3MV7E 4HIEA 4NQCD 3LD8C 5DJ6B 4R90H 3DX9A 5DUMH 2PYED 4TPRH 4PV9A 4M6ML 3HC4L 4JHWH 2R1YB 2P24A 4H8WC 1RUAH 2P42B 3O0RL 4YR6A 4GG6E 5D1QA 5TPWH 1H3GA 4G9DB 1SJHB 1XIWB 4FNLL 5DQJB 3ZKSD 1RJYB 3SEPA 4D9QD 1B90A 3IU4L 2WW8A 5BW7A 1NMCC 1JNNH 1JMXA 5KG9A 2B1AL 4IIQC 3P0VH 4PBVC 1PGRB 4KHXL 2ZG3A 1HSAA 2ARWA 1CFQA 5DJZB 4QRSA 3MJ9H 3QQ4B 4GAGH 2QKIB 3PWVB 4GRWE 3VMOA 3FB6A 3TYGL 4X6BB 3FB5B 1ZMYA 1I7RA 4KRPB 4LNRA 4PP1D 2BY2A 5IMOB 3TVMD 5ANMA 2VZOA 4DOHB 4CU8A 4WFHD 4Y4KB 3UBXB 2EYRB 4L3CB 5KVEH 1XR9A 1S9WB 1YPZB 3FFDA 3MREA 3QIWA 2GK0B 1DEDA 3N0PB 5JHLL 1IJ9A 1JZ7A 1A9BB 1JGDB 3N50A 3TT1L 1ZT7A 4EUPG 5L9DH 1QBMH 4MMZC 3O4OB 5DD3L 4UV4L 2VUOA 4U1KA 1BVZA 3VWJA 3QQNA 3K8KA 2X5PA 4RDQF 2D4FA 5F1IB 5MEND 1TFHA 3OR6B 5EC1B 2QHRL 3AU1A 3SY0A 4PBWD 2CRYA 2XN9B 1YNTB 1C1EL 1KENL 3QULA 5C0NC 4OD2B 2V6HA 4Y0GA 3RL1B 4NZDA 5FIEA 1T2QH 3QFDB 2D03L 3OQ3B 1DBBL 4AL8H 2MQ3A 2C4FT 3BPNB 3KPLB 4DFIA 5EO1A 4ZXBB 4LNVA 2P1YA 1LNUA 3T3PF 1EO8L 1ODAA 1R3JB 4QHKJ 1NC2B 5EA0L 2V7HB 1CDBA 4CKVX 5GRXG 2WBWB 4LHUG 5IESH 1MHPH 3TO4C 1JZ5A 2OM5A 4UI2A 5ALCH 3VI3E 4NNYB 3MV7B 3S37H 3MA7A 4P5TA 3GSNB 5F7KC 3ZL4L 3WXWH 1KJVA 2A77L 2R0LL 1QD0A 5FYKE 1QHOA 5L6YH 1CXKA 1P9MA 3NCEB 1NBVH 1EHLL 4H1LH 4QXUH 5HYSG 5I73C 3VXMB 5AAWA 5HJ3B 1NCWH 3U7AA 5C8JA 4JFOA 1C5BH 3MROA 1HK6A 3UJJH 3X3GH 1PSKL 2GJZA 1T5WA 4BKLB 5IR1B 3H9ZA 4H1LA 4U3CA 4XVTL 1NUFA 4JPIB 4ZYKB 5HGAB 3LEXA 3HN3A 4FN0A 4M7ZC 4LCCB 3E6HA 1MF2H 1YY8A 1FNGB 4NSKA 1MFCL 4GUPB 3QHZH 3TBYB 3RWJA 3RKPA 4OKVB 2Q7YA 4G43A 3Q5OA 4NNPL 5FDWB 2YC1B 1NGWB 3B9EA 5IBUG 3UYOD 3VWKA 3QDHA 1YN7A 4RMWA 1NFIB 4JPVL 4ZTPL 4NZUL 3NCCB 2ADJA 1TETH 5C71A 2EDRA 3JWNC 4N0CC 2XZCH 4C83B 1NSNL 1EK3A 1U8QB 1K4CA 1V3MA 2IQ9L 3B9DA 3E8UH 4OAWB 2P8MB 5B8CB 2D3VA 3ARFB 4QNPF 3MV8A 1Q9LA 4NO0A 3P4NA 5E2TH 2ZCKH 5GGSY 4XPFL 1R5VB 1WCBB 1KELL 5D1QC 5GXBB 5LCVL 2KUTA 4S1RH 3MRKA 1AGEB 2V17H 5J9PA 1ZLUK 2X89D 5IEHB 1F4AA 2DLFL 2X4SA 4G9FE 3U46A 1GGBH 3FQXA 2R0KL 4RWYH 4LOUC 5BW7C 2RCSH 4PB9H 1XF2A 4JRXE 1T1XB 1R0AL 4FQJH 4QHNA 1TCRB 5FGCB 5DQ9A 3FQWB 4YFDB 2XN9D 5DC0A 4QCIB 5GSVB 4Y19E 1JTOA 3GBNH 3IDGB 1PKQE 1RIUL 1GC1H 4MAUH 4R4BA 3OGCB 4HUUA 5SWZB 2IAMA 2VAAA 4WHTA 4WU5A 1EEZB 1U2HA 4KFZC 2BK8A 3BGFB 1BD2A 4NHUA 1AR1C 4KRLB 3MRHA 1I9IL 3C2AH 5EC2A 3RVVD 2FL5B 5C3LD 1F58H 1CI5A 2DJSA 3T2OA 1MCPL 4NFBA 5D93C 4YDVB 3QIWC 3JVGA 3S98A 3MV7D 5GZOD 1S7QB 3S5LA 4NYLA 2Y7QA 5ICYA 4NQEE 4PUBL 4N8VA 3IXTA 3HB3C 1IC4L 4MD5A 2YSSA 3VWJC 3U4BL 1NAML 1KN2H 2FSEB 3ECBB 1HH9B 4O00A 5I1KL 3LAFA 5SWQA 3VXMD 3K3QA 1O7SA 2AKRA 4XVSH 4PLKC 4JO1H 5DDHB 5IHBA 4U3XA 3QNYA 1RJZA 3Q1SL 3T3ME 1DLHB 4KROB 2AXGA 1T3FA 1KEGH 3T0AA 3GKWL 2OJZH 1AY1H 1WWCA 3GSOB 5IOPB 4Y5XB 2R1WA 4PD4K 3CMOH 4JZOB 4YPGB 5IJVA 1NLBL 5JO5B 4PRAA 2DLTA 4OF0A 3RWCB 5L2KE 3BRDA 5CEYB 1IQDB 2XPGA 2IBZX 2Q20A 4MVBC 3K8LA 4GSDL 2QSQA 3T1FA 4Z7VA 1QYGH 2O5YH 4NN6C 3REWA 4CJ1A 5JNYA 2M8XA 5E8DL 3H9HB 2C4FU 4LIQL 3ALWA 4LSSH 1AQKL 2HA1A 2YWZA 4O5LH 5LAXA 4P5TC 4Q9QL 4WHYH 4XVJL 5IHUH 1ZEAL 2EO1A 2H8PB 2HFEB 4XXCA 2PW2B 3SE3A 5F96H 3LHPL 4MXWH 3VXTB 4MD4A 4HDIA 4XBPA 3MFGB 4NJAL 5FV2A 3I02A 4UT7H 3W9DA 3ARDA 1JI1A 4R7NA 3SKUD 4LLUB 3ARFD 3CFKB 3TIEB 3VG0L 1UB5B 1FJ1B 4G9FB 4WHCA 5BVPH 5DGQA 4CMHB 4UDTB 1TPXB 3EYOA 5D4QA 5DSCA 3DXAA 4NP4L 4ONOA 4JRXB 1QR1B 4TUJB 1T0NA 4JDZA 4TSAH 3ZE1E 5HYJB 3AMKA 4WV1C 1WWAX 4GH7B 3SE8L 1HYSD 1UVQA 1JN6A 4Y19B 3CXDH 1T20B 2OTUB 1PKQB 4M8VA 3NGBC 1Q1JH 3ARGB 1FL6A 3C6SA 3NOIA 5GRVL 3VWKC 1MJJA 2HWZH 1J0IA 3MRIB 1OW0A 4PRDA 5GHWH 2VO5A 5D5MF 4BM7A 4LU5L 4X4XB 3F12A 4YK4C 4HUWB 2HT3C 5K9KB 3FO0H 3WLWD 4NRYB 5DEFA 5TDOB 2H2PC 4WTZG 1FNEA 1ZOXA 1QBAA 1YEKH 3RWGB 4LSVH 4P23B 5SWZD 3T4YA 4NQEB 1JWSA 2EDLA 2GFBA 4LHQB 4JM4L 5FYKD 3KWWA 1VFMA 4HJGA 4ZFFB 5C07E 3RVWD 4Y7MA 1KV3A 4WU7B 5KTEL 1NL0H 4OKDA 4ZOCA 2NR6D 2GITA 2EE2A 4HMCA 1QPXA 2D4DA 4YDLB 1MQKL 2VTFA 5C6PB 1PX4A 4NWTL 5F6HI 1NGQL 2ZUUA 2Y5TA 4PLOB 1I9EA 3JWOH 3M07A 2I60L 1DBKL 3HMXL 1RVFL 2OL3L 5CS7A 5FA3B 2HJKB 1TMCB 5HGDB 3WUWB 3DECA 1KBGL 2ZOKA 5C0AA 4LARH 2VC2L 2VSDA 2FNBA 5FUZH 4J8RB 3FO1B 5ESVB 4HH8A 3GDBA 4KROD 3NFPA 4XTRD 5DLMH 4QRQA 5GS0H 5I1EH 3P77B 2IAMC 5TH2B 2D7NA 4RRPA 4ZUTA 4XNXL 3SDAB 1S5IH 4R4NC 4ZFZB 5E95B 1I1AB 4HWZB 3NZHL 1LO5A 4IRSB 4Z8FL 4DAGL 5INDA 4RISL 4Z0BL 1WEJH 5EU6A 5IGXH 3JVGC 4N0FA 3Q0HA 1B6UA 4FQXA 3MYJA 2BRRH 1NUNB 1JHLL 9CGTA 1XCQA 3ZKMC 1X5HA 1YC7A 4XPHH 3HZMB 5DJDB 1HHHA 2VDNH 3LN4B 1QEWA 1RZFL 1BBDH 2NW2B 4ZO6A 5DFTA 4WEMB 3HPJB 2CLZB 5BVJB 5EU4A 3UC0H 5FYLE 1K3ZA 1UKQA 4G9FD 1FLRL 4YXHH 4OZIE 3OKLB 4P5MB 4RGMB 3QNZA 3H7BA 1WBZB 4KI5C 5EN2B 43C9B 2K7QA 5HYFA 4JRXD 1KUMA 1W0WB 4JO4H 4OCRL 3RVTD 3N06B 5FB8B 5HYJD 4S0SD 4Z5RA 1KJMA 5CEZL 1UM6H 1Q94B 4JHAL 3JV0A 1JWMB 1P1ZA 4X6EA 3ARGD 3C5JB 1QBLL 4QGYA 3IDJA 1C16B 2YUVA 1KTDA 1X3DA 4HH9B 1A22B 1U8KA 5DHXB 4LSRL 5H2BB 3RIAK 1ZKAA 1B9ZA 4Y2DB 1E4JA 5EUOE 1R6VA 1ONQA 2BC4A 3BPCB 4PY7B 4XXCC 2WINA 2X9WA 3DV4A 4GS7B 3SE3C 3JV4B 4KZDH 3VFUA 4P23D 5IVZB 3VXRD 3ULVD 4NRXB 4N0YH 5IKCB 5DVKA 1UM5H 3ARDC 4JVWA 3JWDH 5EU3B 1NFDA 1ZLSL 3WEXB 2XFXA 4IHOB 3WL9A 4L4TE 4IJ3B 3U0TB 1TITA 1A64A 1WFNA 2CIKB 1HHIB 2VQ1B 1J10A 2BSRA 4O51A 4DJMA 3QEQD 5GGVY 5GJSL 1IAOA 1CE1L 3OPZH 4HIXH 3HZVB 1MI5E 2DKSA 4P46B 5GRJL 1JBJA 1KJ3H 4PTUB 1RUPL 2WBKA 2LE9A 1X5XA 3DX8B 3VXSE 4LPXA 5ID0B 1OW0C 1P4IH 4ONFH 5JW5B 1RAMA 2HKFL 1Q9KA 5A2KH 2BNQA 2YBRA 1RHFA 4WW2A 2XY1A 3F65A 1J18A 4L29A 4LPCA 1A4KA 4GMSL 1R5IA 5CBEA 4PJ9D 4MSWA 4UB0L 3I9GH 1UZ8B 4OZGA 5FHAL 1OT1A 1OP3H 3LKSB 2WP3O 3SDAD 5C0BB 5JR1L 1KF9B 3UROR 3I6LE 1I1AD 4IRSD 5KSAB 1VDGA 4R0LB 3CAFA 1A6PA 1QFWH 1UH4A 3C5ZA 3O3DA 1ZAGA 4IOIB 2IGFH 4RIRB 3V8CA 3VRIA 2BVQB 3ILQC 4X7EC 1EEYB 4KDTA 4EOWL 4OZIB 1DBAL 5D7IF 3QWRA 5BOZG 4NNXA 5T1KB 4E41D 5BXFB 4RNRA 3NPZB 2VH5L 1ZHLA 1MWAB 1FL3B 1DP0A 2NZ9C 1CIDA 3JWOC 4PJ7E 1RQ5A 4NKIL 5CEZD 1VACB 4HAGA 1NDMB 2Y36L 3NCFB 2FZ3B 4P99A 4JFDA 5D1XD 2JELH 1QVOA 3UZVB 1OARH 3FO2B 3HNTL 3TESA 3CH1B 1DQML 4NQSA 1XF4A 4ELMA 2APXA 2O5XL 4WO4D 1INEH 3MRJA 1R5WB 2O5ZL 1F90H 5EUOB 2IFGA 1NC4A 1XGUB 2Q8AH 1IEHA 2BJML 3CDGB 4KH2A 5F9AC 5GS0C 3SJVE 1VADA 5IHZA 3C08H 3IJHB 5CBAB 3L3JB 5CD3B 1CG9B 3P0YL 4U1SB 5HHVL 5F1NB 2VAJA 3LMJL 1A2YB 4X5XA 4PRIE 5K59F 4XCYA 4FQXC 1HNFA 1VEOA 4Y2DD 4B0MM 4U1HB 1GGIL 5B3JF 5CIPB 2NLJB 1KB5H 4L4TB 2X4QB 4HWBH 5IBTH 2NW3A 1KGCE 3G5VA 4LCYA 3BEWA 3RZWA 2VXQH 3BWAB 2FGWH 4EQ3A 1QRND 1KB5A 5ABDE 3PGCB 5D7JB 2ENSA 3TT3H 3NZ8A 1NCNA 4HWBA 2ZJSL 1A3LH 4KV5F 2JB5H 1S7TA 1MCLA 2R2BB 2J4WL 4O2CA 3MV9A 2UUDK 4XPGH 4KQ4H 4ERSL 4D94A 1YEHH 3VXSB 4HK0B 3T0EA 4RGNB 3VXUE 2YPKA 1QLEL 4MA1B 5D9SB 3O6LL 3R8BB 1T1WB 4MNGB 3GUTA 3MRCA 5CGYD 1MJUL 3S7GA 4PJAA 1GXEA 1QFUL 3S3SA 1KPVA 4CW1A 1YEEH 3TZVA 4EUPH 1SEBB 4DN4L 3QXTA 4G8GA 1H15A 4PJEE 1C5DB 4HWEL 5HGHB 2XWJA 5IB3A 4Z78A 1WBYA 1CD0A 2Y5EA 3MCKB 2FBOJ 5I30H 4M43L 1INDH 2W60A 1YMME 3WCYA 5HYIA 1IEBA 2EDWA 3D69B 4QRRA 2C26A 4LPTA 4MQ7B 4MA8H 2X4NB 2GUOB 1CGSH 2C4XA 3C5SB 4NN5B 5LBSH 4YHZL 2R2CA 4S10A 2NXYB 4LP5A 4DW2H 2GY7B 5C0BD 3DSFH 4I3RH 2G75A 4I48A 3T4AB 3FTGB 3KYNA 4KKBC 1DFBL 4PJ7B 3SKNA 3U83A 1L7IL 4GW5A 1CWVA 1NBYA 1X5ZA 4E0RA 3HCVA 1MUJB 5DO2C 5GIRA 1GOFA 3VXOB 1PW3A 3FONA 3QPQD 4TNWK 2DTSA 4BSWA 1A5FL 3MJ7A 3MRPA 3TWCL 4R26H 2OK0H 3REVB 1OPGL 3L1OL 3ROOA 1F3RB 2APWA 4CNIB 5E00A 1PG7W 1ORQB 3DX6A 3MRFB 4LHUA 1BJ1H 3GSRA 4D3CH 5AZEL 4WRLA 3UDWA 3KLSA 4KAQL 3SJVB 2FR4A 2NY2C 4HGKC 4WW2C 4EIZC 4KDWA 5IROA 1T7VA 4Q9CA 1MFEL 3FRUA 4BFIB 5AWNH 5CCKH 4YHYC 1LE9B 2J88H 1LE5B 3DBXA 4R96A 5FECB 4Z77B 3LEYH 5I75B 3QFJE 4OIIL 3V5HA 3IF1A 3OR7A 3C5ZC 5CJXA 4FMKA 5ESQA 5L2JA 1OAKH 1DQLH 4UIMA 4F7TB 4R7DB 1CLOH 3RGHA 4ZPVB 5A3IC 3Q2CA 1DDHA 5GS2H 4KJQC 3ZDXF 1MH5A 4KDTC 5C0GA 2ZSVB 2VXSL 2BSED 3E2HB 3LY6A 4OT1H 4L4TD 2R0ZL 1I1FA 1DN0A 4QRPB 4TVPH 4XPBH 3CPLB 2YUZA 3CU1A 5TE6H 5KOVC 3PE9A 1UA6H 3WHXB 5D7JD 1FNSH 4O4YL 3MZTA 1G6RH 4G80B 3RBGA 5CINH 2CLVB 4L1DA 3KPNA 3VA6A 3KJ6L 4DKAA 2UZIH 3BXNA 3NTCL 4FTVD 5ALBL 1GHFL 4L3EB 1CDJA 2X4TB 4RGND 4PJEB 2UYLB 2PR4H 4YFLF 3B83A 1MELA 3OB0H 1W72H 1K5NB 2A83B 3STZB 2HVKB 4NJ9H 1YMMB 1T0MB 4GBXA 4YXLL 4OGYL 3RU8H 5ENWB 1DQJB 2ADIA 1K8DA 1YJDL 4G7VL 3ZYOA 4TNVF 4J4PA 5EZJB 3IETA 5JXEA 4LRNL 4WI8A 1ZT1A 3BP4B 1IBGH 1N5YL 2OSLB 4GXVL 4LEOA 1CLZL 4UBDD 4X8XA 3MJ8B 1U93B 3PWJA 3WMSA 3MJ6A 2DKMA 3GHEH 4NQCA 4HIIB 2NX5B 3CSGA 2VLKE 1VESA 3O8XB 1RFDL 2PYEA 1Z9SA 4C54A 5DK2B 3BKYL 1CVRA 2W0FB 1FRGH 5JMOC 4C57C 3K0WA 3GMOA 4Y4HB 1KJ2L 2NXYD 3J8F7 5J56B 3PIQB 4J1UA 4A6YB 4PB0L 4YO0A 3AS3A 1KEML 4CUCA 2JJWA 3T0EC 1MLBA 2R29H 5FA4B 5DVNA 5E5UB 1QNZH 3QXAA 4O58L 2AJXH 5DD1L 3E6FB 4XC3L 2VLJE 3BWUC 3MRNA 1YNKH 2PNDA 3UPAA 3VJ6B 3VRLF 1CR9H 4ZQKA 4YHNB 2Z35B 1UQSA 3TZVC 4P59L 3FFCE 5KOMC 1FP5A 4A6YL 4LLDB 5IW1A 3LN5B 3OAUL 1C5CL 4YBQD 5ETUB 3QFJB 4LQ1A 5FOBA 3TVMA 4X98A 1FVEB 3IJSB 4KGLA 2G60H 4L8SA 5DD5H 3U30B 1DUYA 43CAB 4OM1H 5J1AB 8CGTA 3OV6A 1I7UB 1RJCA 5BJTA 1HDMB 3QH3A 1FSKC 3DYMA 5MP6L 5BMFL 4MA3A 5ID1B 4HPYH 2RAMA 1VFBB 3CUPB 1CD1A 1XAUA 4HEME 1RUML 4KI5F 2EDDA 4EI6A 2IAND 4YDJB 4I77H 4ZUUB 5EBGA 5KVGL 1J8KA 1CYGA 4K7PY 3RWEB 4Z7VF 2VDPL 3LIZH 3ARVA 4YHOL 4QRPD 1EBPA 1S3KL 1HQ4A 1DN2A 1PVHA 2ENYA 3BKCL 1QLRB 4ZAKD 3SOBL 3UDWC 4MB4A 2ZOLA 1G7QA 5E6IB 3L3OA 1JGUL 5JPMB 1OOAA 1XT5A 4R2GC 5IROC 3WHE1 4M6MH 4UINL 3M8OL 4L3ED 1CGTA 1U8IB 3O0RH 4Z76A 3M17B 5JMRA 5JW4R 2VLKB 1GVIA 2JLLA 5D7LD 1T66C 4FNLH 3OJ2C 1CL7I 3I50L 4MMXC 3QA3A 2AJSL 2F9BT 2Z8RA 5I16A 1YDPA 5CJXC 2OJEB 2B1AH 3LN9A 4PY8I 5CZXD 2JCCA 2GCYB 4KHXH 4JY5L 5ITFB 5DJ6A 2NX5D 3O8XD 1A6TB 5KJRL 1TZGL 2IPTL 2WK2A 1K4DB 3TYGH 2R1YA 3LDBC 1YZZA 4JKWA 2YPLB 2AJUL 4G9DA 2VLJB 4TNWF 2BERA 1XIWA 3SDDD 4N5ED 4M03A 1J0ZA 1F4WL 4KC3B 2EXWD 2FD6L 4QXGL 5DQJA 1RJYA 2H32B 4HZLB 1G7LB 4WTZA 5JHLH 1BVKA 3T3PE 3QDAA 3PHQB 3F6IA 3TT1H 2AJ3B 2Q86B 4OGAD 5DD3H 3QQ4A 4UV4H 4GRLB 2QKIA 3PWVA 4N8PA 5CKAA 4GBXC 1FZKB 5F3HA 2NY6B 4KVNL 4LK4A 4X6BA 4J4PC 3RAJL 3FB5A 3DUHA 2DM3A 5JXEC 1JHTB 4YJZL 3AREC 1ZA3B 2QHRH 1MJ7L 4M02A 1WIOA 3P4OB 3IYLW 4AQ1B 3ARBB 5IMOA 4AQOA 3UTPD 1MREL 1C1EH 3V4VL 1KENH 2EEDA 3UBXA 2EYRA 1OAXL 4N9OB 4QYOB 1CBVL 2FEEI 4UNVA 1S9WA 2P8PB 1Z0NA 2D03H 1DBBH 1YPZA 5TE4L 1JGDA 2XA8L 1NGYB 2EH7H 4CBPA 2X89A 4D2NA 4LLQB 4ALAL 1A6AA 1EO8H 2XY2A 4OM0L 4OF8A 5F1IA 2E7BA 2IQAB 4NQDD 4HMDA 3OR6A 5EC1A 4MX7B 4K9EL 1BWMA 5DI8A 2W9EL 5E8EA 3L95B 2XN9A 4WENB 2A77H 1YNTA 2R0LH 4XCNB 1ROWA 4ONHB 4ZSOE 3LB6D 2E9IA 1YNLL 4OD2A 1BFOA 1EHLH 3QFDA 1F11B 5IF0B 3V0VB 3IDNB 1UH3A 1RK0B 1YMHB 3OKDB 3KPLA 3P73B 1PSKH 3SO5A 3UJTL 1JL8A 3L5JA 4ZXBA 4PP1C 4XVTH 3TVMC 4GLRI 1RI8A 1OSZB 1L9MA 3QWOB 5DMGD 1R3JA 5E6ID 4U1GB 1NC2A 1QSVA 2V7HA 4CN1A 2EH8L 2DIBA 4L8SC 4LCUB 3MUJA 5IB2B 3W0WE 1MCWW 4NNYA 3MV7A 3GSNA 2VLKD 3WDHA 3AB0B 2ICES 5DR5L 5EBLA 1P2CB 3FAWA 4NNPH 5E4EC 5F7DB 6CGTA 1B0GB 5GZND 1MFNA 1KTRL 1EHAA 4DKFH 4HFUL 3VXMA 5JW4N 3KPSD 1K3IA 4H0GA 1HI6A 5JOFB 4JPVH 4KHTL 4U2ZA 4BKLA 5IR1A 1P6FA 4NZUH 3CLFL 1DSFL 4O02L 4HS6B 1RZJC 3V6FB 4ZYKA 4MGXA 5HGAA 4K3HA 3RL2B 5FO9B 4LCCA 4HSQA 1HKLL 1LGVA 1R3LB 2DWDB 2X7LA 1FNGA 3BMWA 1NSNH 2YPLD 3TEUA 3LKOB 2IQ9H 2NY5L 4ODXB 2NMSA 5J06A 4OKVA 3MGTB 4N0UE 3TJEH 3DV6B 5FDWA 4NKOB 2YC1A 3MCG1 1NGWA 1BF2A 2IFFH 2IPUK 4EZMA 4XPFH 5C6TL 1IFHL 1NFIA 4TN9A 5CP7A 4MJ4A 5IVXA 2NY3B 5DMYA 1KELH 4OIAA 2AEPL 5LCVH 5SWSE 1NFDF 5I15L 4GRLD 3MLZL 4IRJB 5F9JB 2R0KH 2DL9A 3CC5B 3IJYB 1IAIM 4C83A 2KPNA 1U8QA 4OAWA 1R0AH 2P8MA 5B8CA 3ARFA 5DJCB 5F7HA 1F8TL 2BY3A 5KAQG 1BGXL 4D0CB 4XT1C 5BOPA 3WBDA 1RIUH 4JE4B 1R5VA 3JZ7A 1MY5A 3ISWA 5I18L 4YHML 3FOMA 5C0CD 4WW2F 4ZSOB 1AGEA 1XIWC 2DN7A 5IEHA 1I9IH 1IC7L 3OJMB 3KPPA 4FFYL 1X44A 1MCPH 2R39A 3D3VD 4OZGF 3U0PA 1T1XA 4EQ2A 1TCRA 2FJFB 1CICB 4PUBH 3BJLA 2EDHA 3KLHC 1JK8B 5GSVA 2Z8WC 2EO9A 3ZSSA 3IDGA 3U4BH 2HJFB 3W0WB 4DGIL 3OGCA 2FATL 5SWZA 1P4LB 4HLZG 4ELKB 4J7RA 4PG9B 1Z2KA 4MCYB 3Q1SH 4XP9L 3MRDB 1ZHBB 3WFEL 2FL5A 3GKWH 4DN3L 1HIML 1ZANL 4YDVA 1NLBH 2EC9T 4PGCB 5DA4A 1S7QA 1G7JA 3G6AA 4JFYB 1QO3B 2VL4A 3O4OC 4YHKL 1HKFA 1I1RA 2ERJB 4EDWL 2VKXA 4GSDH 5HHMD 1B4RA 2FSEA 3ECBA 3LPFA 2VIRB 2ARJB 5E8DH 1U2CA 5IHLB 4LIQH 5EULV 1O5DT 3MR9A 2GJ6B 4XWGL 2I26N 1AQKH 1II4E 5I8CB 5DDHA 4Q9QH 2E9WA 1D6VL 4N0UB 4XVJH 1S9YB 1DLHA 1ZEAH 4RCAA 5H94B 1V3KA 5D5ME 2DMCA 3HUJB 3GSOA 5IOPA 2EIBA 2MQ0A 3LHPH 4Y5XA 4PJHF 4JZOA 4YPGA 5DRNB 5EDXA 4AH2B 2W0PA 1JGLL 3BPNC 5JO5A 5J3HD 1JUFA 5HDQL 3RWCA 5CEYA 1BZ7A 1IQDA 1KXVC 5D1ZB 3SDCD 3VG0H 1T6VN 1A6WL 3R1GL 3KLAB 2DYPD 4MB5A 2ADFL 5HI5D 1B0RB 3MV11 4WTXA 4YEEA 3H9HA 1G7IB 1KIRB 1X6NA 3S36L 1I7TB 2VXVL 4JVUA 5FUCC 1FYTD 5GZOC 3DUSB 1F2QA 4IBLT 3QO0B 5T3ZD 4RMVA 4IRJD 2HFEA 2PW2A 1WQVT 1H0DB 1MHHB 1SY6L 3VXTA 1K8IB 4F7MB 2VLRD 3LRSB 2CGRL 4P2QE 1OTUC 4LU5H 1G6VK 4ETQB 5HDLA 3C60B 3EJZD 5E8OB 4WFEE 4LLUA 4PJAF 1UB5A 1FJ1A 4G9FA 3QJHB 4XMLL 1ZVSB 4UDTA 5KW9H 3HE6D 2ESVE 4LCCC 4MD0A 2MTPA 4JRXA 1QR1A 2F74B 1UWXH 4TUJA 4QHKI 4ZNCD 5HYJA 4YWGL 3WD5L 4CVWA 4JM4H 4Y19A 1T20A 2OTUA 1PKQA 5KTEH 4ORZC 4PJ5E 3ARGA 4JFZH 1MQKH 2UZYB 4FQ1L 3A0OA 3MRIA 4HJJL 4NWTH 3PABB 3P30L 4X4XA 2Z31B 4HUWA 1NGQH 2DQJL 5K9KA 4NRYA 1CICD 3BJ91 2W59A 2I60H 1WUNT 5TDOA 1DBKH 5DYOB 5CSGA 5D2NB 3ULVH 1RVFH 4I4WB 4ZO8A 2A6KA 3RWGA 1RV6X 3IS1X 1JGEB 3KPRD 4BELD 1CCZA 3L3KB 4P23A 1ZTXL 4FA8A 4TTGA 3LKPB 2VC2H 3PJSB 4J3UA 4P57B 3WV0A 5B8CC 1I9JL 4X7TB 3ARFC 1BOGB 1MFBL 4ZFFA 4J6RL 3DRTB 4WU7A 1QG3A 5F9WB 2Q3AA 4I0PD 5I1AB 2Z93B 4QKXB 4OQTL 4JJ5B 1UC6A 5HPMB 3VFVA 1PLGL 2R2EB 5GGRB 2DRUA 1S8DB 3OL2A 3LV3B 3CVHL 4IMLB 4NKMB 5DJYB 4JPKL 5JUEL 5TQ0L 5JHDD 1HYSC 1FQ9C 3NZHH 4Z8FH 3AAZB 4DAGH 2A2QT 5FA3A 4Z0BH 3T0WA 5HGDA 3WUWA 2PF6A 5EU7C 4MLIA 1B2WL 4PP2B 2GJ6D 3L7EB 1S5HB 3OXSB 4XP5L 3WLWC 3KYMB 4J8RA 5H35B 5ESVA 3IU3B 2DBLL 4P3CL 1N7ML 2V5TA 2PCPA 3QUMB 4PJ9A 1TVBB 4KXZH 4OF5A 2G2RB 3P77A 5TH2A 3BGFC 3SDAA 4ZFZA 1I1AA 4HWZA 5CMAB 3UTQA 5D1ZD 4IRSA 3ZHDA 2FIRT 1FLRH 3RVWC 1U36A 2LTQC 3KJ4C 2NY1D 2NR6C 4ONGL 4EI5B 1FZOB 4P2QB 5DZNA 4AJ0A 4OCRH 4PJIF 5D71L 1HCFX 1TQBC 4L4VD 1UEMA 5J13B 1FAKT 3K1KC 5CEZH 4GFTB 1IAMA 3ZLQC 1MFAL 4M48L 3HZMA 3LOWA 1IKFL 4JHAH 4RA3A 5FK9A 5DJDA 3X12B 4RDQG 3LN4A 3QDME 2EC9U 1BQHB 4JRYE 2NW2A 2AK1H 1Y0LB 2VABB 3HPJA 4K7FB 5BZWB 3T0XA 1CL7L 4LSRH 2CLZA 3C60D 4ENED 5BVJA 1OGAD 4HIJB 2NNAB 4KROC 4PRPB 2BVPB 4PJ5B 2OR9L 4J3SA 4XTRC 3OKLA 4P5MA 4RZCB 4U1NB 1WBZA 1YEDB 4Y5XC 5EN2A 43C9A 3K1DA 4WO4A 3RX8A 1W0WA 3UYPA 5FKAB 5FB8A 1F3DH 4QRUB 4C58B 1DZBA 1ZLSH 3TBVA 2V2TA 2ZKHL 3QUYD 2ICEB 3VH8G 1Q94A 4NBZB 3JV5A 5BQ7B 2LVEA 5HY9B 3C5JA 1C16A 2R56L 1E4WL 3MPCA 4HH9A 4WGWB 1EGJH 2Z31D 5GJSH 4NWUL 4IIQB 4Y2DA 1H8SA 4XPTL 1CE1H 3BPCA 3D9AL 4PY7A 5GRJH 5DS8B 1EGJA 1RUPH 1P7KB 1IM9B 4YBHA 3JV4A 5IMMB 1Z5LB 4ZUSB 5IVZA 4NRXA 5IKCA 4LLMB 5F8QC 4JPWL 3K4DA 1FG9C 2HKFH 2ZUXA 3V79C 2DQIL 4JO3L 3WEXA 5T1LB 4WI3A 4CMHC 1TPXC 4L4JA 4IHOA 4YHIB 2EDEA 3UMTA 3U0TA 4HFWB 5BCAA 3SPVB 4UB0H 1HHIA 2VQ1A 2W9DL 4G42B 4Q74A 3RVTC 3O2DL 2XQYG 1CF8L 2DIAA 3BQUB 1PEWA 3RTQB 5JR1H 1ZA6B 4KTDL 2A6IB 3HZVA 4P46A 5F1OB 4F2MA 4PFEA 3ARGC 3DX8A 5ID0A 2MFNA 4LAQL 5JW5A 3LKRB 3QDGB 4HKZB 1FHGA 1KPRA 5GS1C 2AV7A 3S96B 3IDIB 4HBCH 4EOWH 2F8OA 1DBAH 1KTLB 1WFUA 2VH5H 5E08L 4DVRL 1Z9MA 5K59E 4WY7L 25C8H 3A6BH 1UZ8A 3BI9X 4P23C 5FCSH 5B3JE 4NKIH 2YOCA 4J3VA 3ULVC 3LKSA 3QPXL 3QBTB 3ARTA 2Y36H 4Z7QF 5C0BA 3PWUA 1IVLA 2AXHA 4ZTOL 1KIPB 4HKXB 3WJJA 4R0LA 2H9GB 4YDLC 1DQMH 4IOIA 4JRYB 4KV5E 2Y25A 1JF5A 5LVEA 3H0TA 4RIRA 4KQ3L 2O5XH 1BZQK 1G0YR 2JKXA 5IJKA 4YEFA 1VB9A 4JM2D 5I1HL 2BJMH 2FHCA 3L7FA 5BXFA 1F00I 3NAAL 5I8EB 2VJXA 2DQGL 5C9JB 3CFJB 3T2QA 3P0YH 3QRFM 1MWAA 1FL3A 1Z6JT 5HHVH 5ANME 1FIEA 2W0KA 1CZ8L 3WJLA 3LMJH 3F62A 1VACA 1D5IL 4G6ML 5GGTL 1NDMA 2FZ3A 4MB3A 3IFPB 1GGIH 4PRPD 4PIRF 2EZ0D 4PJ5D 3D25A 3FO2A 5HTSA 4D8PA 1YUHB 4HXBL 4XZUA 3MOAL 1CE6B 4PJ9C 3PHSA 2H26B 1MVFA 3NN8B 5J4MA 4DCQB 1H8NA 2JCCF 1R5WA 5EUOA 1XGUA 3SDAC 2ZJSH 4NUGL 3THML 3CDGA 1I1AC 2J4WH 4IRSC 2BVOB 3IJHA 5CBAA 4OJFL 3L3JA 3BD4A 3SCMD 5CD3A 4U1SA 3RHWF 3W11D 4M9OA 5CIPH 5D7IB 4LGRB 2Z91B 1A2YA 4MS8D 3LCYA 3O6LH 3VG9C 4LCWB 2VDML 4DVBA 4YDIL 4JREC 1MJUH 4U1HA 4L9LB 2QR0B 3OJVC 5CIPA 5MEQB 2NLJA 4L4TA 1QFUH 3GI9L 1JE6A 3NA9L 1I8KB 4JG0L 4QOKD 3BWAA 4DN4H 1IM9D 2ZCLL 4JFEE 4Z7UF 3T08A 3G5XA 2A0LD 4HWEH 3PGCA 5D7JA 1LEKB 4PGEA 3X3FL 3W9EB 4TULH 2R2BA 4M43H 5T1LD 4PREA 1WISA 1CFSB 4FTVA 4HK0A 4PG2A 2WLZA 4RGMC 2BY0A 3V7AG 5HVHC 4G6FB 1QOKA 3MRLB 3CX2A 4WO4C 4YHZH 5D9SA 5E2UL 1T1WA 4MNGA 3BQUD 3RTQD 5CFHA 2I5YL 1T6WA 3ARPA 2GTZB 2HVJB 3D39D 1DFBH 1HHGB 2HAZA 1L7IH 5B22A 1C5DA 5HGHA 5JA9A 5J8OA 3QDGD 3MCKA 4Y2DC 1EV2E 5DC4B 3D69A 3TWCH 5BRZB 4GS7C 1OPGH 4MQ7A 3L1OH 1FFNB 3QUXB 2X4NA 2X1PA 3ZDXE 2GUOA 3C5SA 1Z9OA 3CGTA 4PJDA 1JNHB 5KVDL 2NY4D 4U6XB 5AZEH 4WEUD 1H3WM 2EC8A 2RIKA 1MRFL 3T4AA 3FTGA 1QFOA 1IAIL 1MFEH 3ZE2F 4IJ3C 5CWSB 3QI9B 2VDKL 2XKNB 5D93B 3FN3A 4OQ1A 2YPVL 5I1DB 4OCWL 1MUJA 4PJXF 5CGYC 1ZT7B 2P5EE 1A14L 3OHXB 4QRTB 2BMKB 2J8HA 4LASH 2EKJA 4CNIA 1KPUB 3MV8E 3R0NA 4OD1L 1A4JB 1PYWB 3MRFA 4TSBL 3HG1D 1LMKA 3SJVA 3C8HA 1WVZA 2VXSH 5T3XL 4NOBA 2R0ZH 1KLGB 3OAYH 4XB8A 2YKLL 4BFIA 4Y2OA 2R23B 3MSPA 5HYEA 4QF1B 1LE9A 1LE5A 1EHXA 3E0GA 4KUZH 5FECA 1NCAL 3EDDA 4Z77A 4JO2L 2Z92B 4O4YH 3UTOA 1TQCB 1JPTL 4HCRL 3U79A 3KJ6H 3UTTE 4R0LC 4RMSA 3WJJC 4WFFE 3ULSB 3NTCH 5ALBH 1GHFH 4JFEB 1GAFL 4I0CC 3VDBA 5DFVD 4F7TA 4R7DA 4K94C 2BFVL 2SEBB 4LCWD 2EECA 3PP3H 5IJKC 1AHWA 2FHBA 4KK8D 4YXKL 3LQZA 3QPQC 4OGYH 4OFIA 1EA9C 1KJVB 1YJDH 2ICWJ 1BD2E 1E27A 4DWHA 4QRPA 4LRNH 4UTAL 1ULVA 3CPLA 3WJLC 2YK1L 5IVXF 4UNTA 1N5YH 4GXVH 1CLZH 4M7JL 2RGSA 3WHXA 4ZAKA 4JFOB 3T1WA 3UTSD 4G80A 2GJZB 3K46A 3BKYH 4H1LB 4M1GL 4L3EA 2X4TA 4PJEA 2UYLA 3GNML 2FGZA 5EU5B 3KS0J 3B5HA 1WBXB 1YY8B 2ZUWA 3PL6B 1K5NA 1KJ2H 2A83A 3N1PC 3STZA 5D7LA 3BZFB 1U8HB 2HVKA 1T0MA 3RWJB 2G9HB 5ENWA 1DQJA 4WV1B 2Q7YB 2BOCB 4PB0H 5C2UB 5EZJA 1KEMH 4WCYL 3BIKB 3BP4A 2R9HC 4OSUL 2OSLA 3SO3B 2LQRA 3V8OA 3MJ8A 1U93A 4HK3J 4KI5E 4O58H 5I6XC 4HIIA 2NX5A 4XC3H 4YK4B 3O8XA 4N8CL 5EWIL 3SQOL 5DK2A 5K93A 2PXYB 5BRZD 1LO4L 4KKCD 3GRWL 1S7SB 1MCDA 5F71A 4P59H 5J7CC 1NEZB 4A6YH 4Z7VE 3OAUH 4RGOL 1C5CH 3SDDA 5D7JC 5T5NG 3PIQA 2D9QB 2P5EB 4LCIL 1YQVL 3TA3D 4A6YA 4AEFA 2DM4A 2WUCL 1MCOL 3P2TA 4HLZH 4PG2C 4RGNC 5FA4A 1U8LB 1D3CA 1QHPA 3QI9D 1IT9L 5IK3B 3S35L 4HQQL 3GMQB 4MA1C 5T3XD 1FIGL 2GKIA 3L5XL 1BQSA 3E6FA 4OFPA 5BMFH 4XGZB 3V5DB 2YXFA 5EO0B 1CDGA 1RUMH 5IQ7H 5J9PB 3RKDD 4YHNA 2Z35A 4AK1A 1IZKA 4XH2B 3G6JF 3BZEB 3LN5A 1Q0YL 3DXAE 3QFJA 1BFVL 5KVGH 5E6ZA 1XF2B 3WIIL 3UTTB 2VDPH 3DETD 1FVEA 3IJSA 3QAZC 3QWQB 4PPTA 4LLAA 4PLNC 43CAA 1E6JL 5IM7B 2K3TA 1S3KH 2BCKB 2Y23A 4NN5C 2FX8L 5J1AA 2V2WB 1I7UA 1ITBB 1HDMA 3BKCH 2NXYC 4WHTB 2I9TB 3SOBH 3PG2A 4EIGB 5ID1A 3DO3A 3V52L 5IT2L 1VFBA 3CUPA 1JGUH 4AZ8A 5IB5B 1KULA 4UINH 2AXJA 1HINL 2EDYA 3M8OH 5E7FA 4YDJA 1CFNB 4ZUUA 1U95B 5DEGB 1I9RL 4S2SB 3T0VA 4G7YL 3RWEA 3DVGB 3I50H 4NYLB 4C56B 1ZGLA 5ICYB 1T4KA 5I1JL 1NDGA 3BYTA 1ZGLP 2YSSB 1BOYA 1YA5A 3EO0B 1QLRA 2G5BB 4JY5H 4P4RB 1TTFA 2AKRB 2XT1B 4NBYB 5KJRH 5E6IA 3ZO0A 1RJZB 1TZGH 4POZD 3BEVB 5JPMA 2IPTH 5I8KL 1N5AB 3TBWB 3R06B 1HE7A 3MQIA 1U8IA 2AJUH 1MCJA 3NIGF 3H2WA 3M17A 5F88B 3ME0A 2VLKA 1F4WH 5I75C 2W0LA 2FD6H 4QXGH 5C0AE 4PRAB 3CK0L 3IFLL 2FECI 4POUB 2K9UA 4UNUA 1OLZA 5I1GL 3KPSA 3KNBB 2E9BA 2OJEA 4Z7VB 3IRPX 4EJ1C 5JNYB 3LVEA 1MCQA 2GCYA 5ITFA 4CADB 1AHWC 3E2HC 1X5YA 1TVHB 3ARYA 3FL7A 3WNMA 1K4DA 4KVNH 2PXYD 2VKWA 4I3GA 4KJWD 2YPLA 1C8PA 4AM0B 1MJ7H 1HHKB 3H3PH 3IAGC 1YJDC 3DO7B 2X6MA 2GQHA 2IH3B 4ZAKC 4GKZB 1FH5L 5EU6E 1MREH 3V4VH 3RDTD 1Z3GH 3RWDB 1T1YB 4GKOA 1OAXH 2H32A 5KS9A 1CBVH 4NDMB 3EJYD 4HZLA 3HRPA 3BO8B 3GJFH 4JGMA 2D7TH 3ULVF 5TE4H 2XA8H 5IQ9B 3PHQA 2AJ3A 3H3KA 1JYVA 4GRLA 3QNXA 4ALAH 1FZKA 1QFPA 4OM0H 4YQXL 1I3RB 1JHTA 5C08E 3H9SE 1MPAH 3AS1A 4PGZA 3K2UL 3C6SB 2W9EH 5CZXC 4UU9B 3ARBA 1GIGL 1SBSH 3O8XC 1QRKA 1FVCB 1A47A 4U7MA 2CQVA 2P8PA 4Z95L 1RMFL 4K8RL 3FZUD 1NGYA 3CFBB 2OXHA 5C0CA 4Q6YA 3LQAL 4X6FB 3SDDC 4N5EC 4HT1L 1WZMA 1M1SA 1MCEA 3TH3T 3MLPA 3RIFK 5FO7B 3G6DL 2VL5B 4MX7A 4K3JL 5ESAB 4TTDD 3ZE0F 5K9QI 4HHAA 4K3DL 3L95A 4OGAC 1URLA 5DR5H 5D8JH 4ONHA 4C56D 1F11A 5IF0A 4BZ2L 4HFUH 3V0VA 1UH2A 1OAUH 1MFDL 1NFDE 1HHJB 1RK0A 1YMHA 4LSTL 1QFHA 3OKDA 4IMKA 1KCUL 3P73A 4KKAD 4MXQD 4KHTH 2HKHL 3GMMB 1FNLA 3CLFH 1OSZA 3LH2L 5GGQH 1DSFH 2XTJD 4O02H 3QWOA 1KYOJ 3WDJA 5F9OL 3S36X 2DQCL 1HXMA 1CU4L 4QTIL 4LCUA 1HKLH 3NFPB 3U30C 3VFOB 5IB2A 3T0DA 2I24N 4LLVB 5DXWA 5E0QA 4MNQB 4Y1AB 1H3TA 2NY5H 4MQSB 4OZFB 1F6LL 1P2CA 5F7DA 3EO9L 3MLYL 1B0GA 3W5NA 2B2XL 3U4EB 4EVNB 3EZ8A 2KDGA 2VSCA 2BNQE 3EOYG 5C6TH 1IFHH 5MHSD 4V1DD 2AGJL 4W4OA 5T5FL 2X2YA 5JOFA 3U6RB 1TJIL 2DQEL 3EFDL 1VGKB 3SDXA 4N0FB 5I15H 4OZGE 3LB6C 4HS6A 3V6FA 3T0BA 3RL2A 5FO9A 4ZPTB 1T7YA 1EFXD 1R3LA 2AQ3A 2DWDA 1X5IA 4DTGH 3VH8A 5INCB 3LKOA 4ODXA 4YDKL 2HYMA 1YC8A 3SDCA 2VLMD 1F8TH 1ZS8B 3DV6A 1BGXH 4NKOA 5DMGC 5E6IC 5DA0B 1G84A 5C08B 3H9SB 4L1HA 4X7SL 3MLTB 5T3ZH 1UWGL 5I18H 2C1PB 4YHMH 4X83A 2JIXD 5EOCJ 1V5JA 1AXTL 4JFQB 1WTGT 1IC7H 2DOCA 2WIMA 3D85B 4IRJA 5F9JA 2MCG1 1ZVYA 5GZNC 4FFYH 3RY5A 4KUCF 4JKKA 3SE4A 3IJYA 1HYRC 4JFFD 4XNUL 2VLRA 3BH8B 4JFDE 5FAAA 4JCLA 1WLHA 3IDJB 5DJCA 3EYVA 1PZ5B 4ELME 2X40A 1U8KB 3GSVB 4D0CA 4YZFF 2W91A 1VERA 4DGIH 3K74B 2FATH 3H42L 3OF6D 5F44A 4GRWH 5AD0A 3DYOA 4XAKE 4KJYA 1NBQA 3T77A 4XCCL 4JN2A 5GQBA 4PJHE 1N6UA 2H1PL 5M7QA 1LO3L 1NFDB 2CKBL 4DN3H 1HIMH 5D96C 1ZANH 2YZ1A 1J88A 4FQLL 2IH1A 3VD4A 4ZD3L 3CLEL 2FRGP 1NCUA 3MRBB 3R0MA 2BZDA 2FJFA 4U6VH 1CICA 3S8WA 5JTWA 4KMTL 4YHKH 4B53A 4S1DD 1JK8A 4GRLC 4EDWH 5DHVH 5AG8A 2HJFA 4GW4A 3W0WA 2GHWB 5DD6A 1H3PL 1RIHL 1CN4A 35C8L 3DHJA 1P4LA 5GPRA 1ZLWH 1AXIB 4XWGH 4ELKA 3JUZA 5BO1L 4PG9A 4MCYA 1D6VH 3VMPA 3MRDA 1ZHBA 1S78D 2P5WD 4HZAA 2YBRB 1K6QH 5MEOB 3GSUA 1GGUA 4WW2B 4QHMB 2QV2A 4NFCA 3VE0B 3QCTL 4PJAE 4L29B 1PQZB 1QKZL 4MJID 4MNQD 4Y1AD 4PGCA 1JGLH 3BPOC 2Y07L 4YHYB 5HDQH 2JK5A 4LGSB 1QO3A 2HTLD 5F7LB 4LRIA 1QSFE 1DBML 3R1GH 2VXUL 2R15A 2ADFH 2NCMA 2VIRA 3BN3B 2ARJA 3S36H 1F6AB 5JW4M 2GJ6A 4YHLL 3C5ZB 4PYGA 5I8CA 1KG0B 1S9YA 5K33A 5H94A 5C0JB 4WWKB 4Z6AT 3HUJA 2YD5A 5E56A 1H3VA 5I74B 1SY6H 5DRNA 4H88L 2F19H 4V2BA 4AH2A 2CGRH 4IMKC 1O0VA 1JI2A 4OTXL 3HI1B 5FCUL 5I17B 1SY6A 3K4ZA 1FBIH 1PAMA 2A38A 1NUGA 5D1ZA 1CLCA 4YHPA 4LPYA 3KR3L 4YC2B 5C0EA 2VRAA 1B0RA 1IGIL 3ZZ1A 3H9SD 1G7IA 4D9RD 1KIRA 3BPLB 5A16A 3O3UN 1I7TA 2CPCA 2BDNL 3DUSA 4YWGH 3WD5H 3MUZ1 5MI0B 3QO0A 1BWWA 3AB0C 4L8BB 1A7RL 3D85D 1ED3B 3VGBA 1GZPB 1H0DA 2VN4A 2NY5C 3D2UB 1K8IA 4KDVA 4UQ3B 5F21B 4FQ1H 4F7MA 3LRSA 4FFWD 3NCBB 3QDJB 4HJJH 3P30H 4W4OC 4ETQA 2DQJH 1MAJA 3C60A 1NKRA 5HPOA 5E8OA 4PJHB 3QJHA 4LVHC 1ZVSA 4XCYB 2AV1B 1QA9B 3FB7B 3CFCL 1ZTXH 2F74A 1Q0XL 3G5VB 1UGNA 4LCYB 5SV3A 1BIIB 3BMVA 1VA9A 1I9JH 1X5KA 3SDCC 2CUHA 2DLEA 1MFBH 1EO5A 3QUYA 2HTKD 4J6RH 4CVUA 4PGDB 5IB1A 4OQTH 5J1TC 4PJDF 3PABA 1N0XL 3SKMB 5GGSB 2Z31A 2VR4A 4XRCB 1JRHI 3NACL 2XKUA 3CVHH 4JPKH 5TQ0H 5JUEH 5DYOA 5D2NA 2FJGB 4IRJC 4NT6B 3U9PH 5IMLB 4PJIE 1J87A 1JGEA 3SE4C 2MCPL 3GK8L 3QQ9C 4TVPE 4CAGA 3CVHA 3L3KA 4RMUA 4M62L 1B2WH 4JFXA 3LKPA 5C92A 3PJSA 4P57A 3L5IA 4XP5H 3SDYL 3EJZC 5HVWA 4X7TA 1BOGA 2DDQL 1G9NL 1QSFB 4OCYL 3U36B 3DRTA 2DBLH 3FT2B 1N7MH 4FFZL 4P3CH 1WBYB 5I1AA 2Z93A 4EUPB 2CJUL 4JJ5A 3QUZD 1IEBB 5D72L 1ZT4B 5GGRA 4R9HA 3QCVL 3LV3A 4IMLA 4NKMA 4DGVL 5DJYA 1D5ZB 2AW2A 5ADOL 3AAZA 3DVIA 4NQCE 1JWUA 4ONGH 2XYCA 4LSPL 1D5XB 4U7KA 2PYEE 1MCCA 4JR9L 4PP2A 3L7EA 1S5HA 3OXSA 1KFAL 3KYMA 5H35A 1CICC 3LS5L 4GW5B 1NBYB 3IU3A 4WWKD 1MFAH 3QUMA 1IKFH 2E8ZA 1TVBA 5E2JA 1NBZB 4BSWB 3MRPB 1JJUA 4D9QE 2X44D 4X6DA 4KK9D 3OKKA 4FQQB 1P53A 1CL7H 4NN7B 4U0RB 5E00B 4FXLA 5CMAA 3GM0A 1VGEH 3QG7L 1E6OL 2OR9H 2VYRE 5A2JH 3OG4B 4I0PC 2VE6A 5CGTA 4H26B 4HUNB 3FRUB 1A7BA 3VDAA 4JM2A 4LSDA 3IB4A 5HYSB 3P11L 2ZKHH 5AYQA 2OS7A 4LRIC 3U82B 2BVYA 1GPOL 1CVSC 1YEFH 4XBGB 3VI4E 4NRZB 4ISVB 4WFHE 1WV7T 1G9EA 4AIOA 5EO9B 4HS3B 3V5HB 4OZFG 1L0XA 2R56H 3QDJD 1E4WH 2MKLC 5FGSA 3IF1B 1Y0LA 3OR7B 5CLWA 4K7FA 5BZWA 3UPRB 4NWUH 4IS6B 5ESQB 2FECL 3ALPA 2NNAA 4PRPA 4XPTH 2BVPA 3JV6B 4PJ5A 3D9AH 4RZCA 1FLTX 4U1NA 1WICA 1YEDA 1PG7L 4AENB 5C0IB 1W8OA 1WWBX 1NMAL 5FKAA 5MENE 3QEHB 1PKOA 4JPWH 1YYML 4C59B 5D1ZC 2DQIH 4JO3H 3ZDZE 1HSBB 1AGFA 2ICEA 3NCJH 4PJIB 3SCMA 2NY1C 5IFAL 5BQ7A 5HY9A 1GOHA 3RZCD 4Z7QE 5KBNC 1ZLUH 3BDYH 2W9DH 3BH9B 2J6EA 3O2DH 3EW3B 4IIQA 1G6RB 1CF8H 1A6VL 4KTDH 4ZFGL 3B8YA 1FV1B 5FF6A 5DS8A 5A2IH 3IDMB 3O2VL 4FXKB 1P7KA 2ADIB 1IM9A 5IMMA 1W72B 1Z5LA 4ZUSA 4LAQH 4LLMA 5EZOL 1T03L 4ENEC 3U1SL 3C60C 3AREB 4K2UL 4PJGF 2FJHB 5T1LA 3GIZL 4GW1B 5JW3L 1KIQA 4YHIA 1UACH 1KACB 3O11B 5E08H 1AI1H 1UB6B 4DVRH 2N7AA 4HFWA 4PBXA 4WY7H 1FPTH 3SPVA 4R4FL 1J8HD 4G42A 1Y6KR 3QPXH 3C6LD 1T22B 3BQUA 4QY8B 3RTQA 1ZA6A 4WHDA 2D7QA 3QUYC 4ZTOH 2A6IA 1GCFA 2JCCE 3D39A 3LKQB 1N8ZB 2DQUL 1TZIA 4YO0B 4KQ3H 4DUXA 4GLRH 2Z31C 3LKRA 3QDGA 4HKZA 3S96A 3IDIA 5I1IL 2VISB 5I1HH 4PD4J 1KTLA 2HN7A 1KC5L 5D2NC 1ZWIA 3NAAH 2DQGH 1CDHA 2AP2A 3RFZC 4U6YB 1D6EB 1CZ8H 1FZJB 5TF0A 2UV3A 4ZQKB 2CRIA 1D5IH 4ZO9A 4G6MH 3IFNL 1UKTA 5IV2B 2VDQL 5HHNB 5IW1B 1KIPA 1CLYH 4HKXA 4HAFA 4Z7UE 4RBPK 3FO9A 2H9GA 5F9WC 3TVMB 4WFGD 3RQ3A 4NQTA 4QHLB 1AGBB 4HXBH 3MOAH 4JRYA 3VD5A 2BY1A 4HKJB 4UAOB 2IC2A 4NUGH 3THMH 5BJTB 2YEZB 2XZQL 5BS0D 1OVZA 2EDTA 5IIEB 5I8EA 1IGYB 1ETZB 1SYVB 4OJFH 5C9JA 3CFJA 5JDJA 5E4EB 1F4YL 3U48A 5SX5K 1T04B 1TCMA 5MENB 3QUKB 1IM3B 1FG2B 2P44B 1GJIA 2XICA 3D18B 1YPZE 3HG1A 4YDIH 3WS3B 3AROA 2HH0L 4LGPB 4DKDC 1FO0L 3GI9H 3NA9H 4JG0H 4OZHF 1YUHA 4CJ0A 3T8XB 5DVOA 2H26A 2BSSA 3NN8A 4DCQA 3O3AB 1NJ9B 1Q9WB 1MNUL 3BZ4B 4ODTL 4H0IA 3X3FH 4FQ2L 4OCNC 1HILA 1TLKA 2BVOA 5HHXL 4NZJA 1P69B 2XN9E 5M94B 2BVEA 2PW1B 5D7IA 2Z91A 5E2UH 2EDXA 4LCWA 3SE9H 3N9GL 3ZE2E 5J13C 4RMRA 4YX2L 4JM2C 5KS9F 4L9LA 2QR0A 4HGMA 5MEQA 2I5YH 4JCMA 1VFUA 3C2SA 2WV3A 3QA3B 3INUL 1HXYB 1YDPB 1LEKA 5D6CB 4AY0A 1DQDL 4Y5VB 3W9EA 5CSBA 3N1MC 2GAZB 1I4FB 4PGBA 1MIEL 4EDXA 2EZ0C 2JCCB 2Z0BA 1FFRA 1CFSA 4M00A 5DVLA 1NCTA 5E8NA 3S35X 3MRLA 1EVUA 4PJBF 4LKCA 3VXME 3C09B 1FZMB 1U0QA 1CFBA 2GTZA 2V2XA 3SCMC 4DEPB 2HVJA 3W11C 3QR2A 4TRPL 5A1AA 1HHGA 2VDKH 4MS8C 4OCWH 1WAAF 1BVKB 2FIKB 3Q3GB 4Z7UB 1BHGA 2BP3A 3ZDYF 4NFDA 5B4MD 3IDYB 4I2XB 2WZPD 4UDUB 1IGTB 1A14H 5BRZA 5I1LB 3BVNB 2AK4D 5F3HB 1FFNA 2EEBA 3QUXA 5C0FB 1JNHA 3AMLA 4OD1H 4U6XA 3K4AA 3MJ9A 3NH7H 3BRFA 4MDIB 5IVXE 5T3XH 1KLUA 1ADQL 2YKLH 3MGAA 5GGVL 5CWSA 3QI9A 4RFNB 1LEIB 2XKNA 1DQQB 3WO4B 5I1DA 1NCAH 4JO2H 3VA2C 3BQUC 3OTTA 1JPTH 1U91B 4HCRH 4NM8L 3RTQC 3O6KL 3MUGB 12E8L 3ULUL 32C2B 1CXIA 4ODVL 3OHXA 4QRTA 5FYJU 2BMKA 3IRZA 1A6AB 1GAFH 1KPUA 3DIFA 2GW5A 4XNZC 4HCRA 2Q7NA 1A4JA 1PYWA 2UWEB 2BFVH 7FABL 5HBBA 2J3SA 5DI8B 4YXKH 5E8EB 1EUTA 3V4PL 3CFIC 5JORB 1KLGA 3T2PA 3QP3A 2DF3A 2R23A 4UTAH 2W65B 1BFOB 2YK1H 3ZTJG 3BIAX 4QF1A 1BJ8A 4M7JH 3PV6B 2IADB 3SDXF 5EU7E 1A02N 1CFTA 2Z92A 1NCBL 1RUAL 3DROB 4OLZL 2WBJB 3QEUB 2Y06L 5FGCE 5ADPL 1A7QL 4PJXB 3ULSA 4M1GH 4JANB 4JFEA 3GNMH 3AM8A 4OIBA 1NANI 2SEBA 3HFML 5SWZE 4F15B 4ORGB 4DQOL 2JJUA 4EXKA 4LF3A 5EBLB 4WCYH 3WIFB 1UJTA 1QP1A 3ARRA 5FDYA 2IJ0C 4OSUH 2AJZB 3VXQA 3CU7A 3DMMB 1QFWM 1HI6B 1SM3L 4N8CH 2IPUG 1DJSA 2R4SL 4MCZB 1XCTB 3SQOH 1QSEB 3X14B 1LO4H 2XWTA 3GRWH 4GG6F 2Q87A 5EU5A 1WBXA 3PL6A 1NCCH 2X7LB 4RGOH 3UX9B 3BZFA 1U8HA 5T1DL 3CFEB 2G9HA 5IW6B 4WV1A 2A74B 2BOCA 2B4CC 3AUVA 1RU9L 1FFPB 4S11A 2WUCH 2EIZB 1MJ8L 3BIKA 4F80A 3QHFL 1IT9H 3S35H 2DJ4A 3BP5B 1FIGH 3L5XH 5CP7B 5IVXB 4KK8C 4GRWF 2P45B 4NM4L 2VDLL 4L9LC 5FM5M 5CZVL 4CVXB 2PXYA 5AAMA 3ZKXB 1S7SA 2GYSA 1KCVH 1JRHL 1NEZA 4BUHA 1Q0YH 3ULUD 5CJ8A 4N0CD 4LEXL 1BFVH 4DKEL 3WIIH 2P5EA 3VD9A 1IC5L 3PXJA 2OCFD 1U8LA 3PUCA 2FX8H 2E7CA 5IK3A 2LV4A 3KYAA 4KRMB 3GMQA 3S4SG 3RX5A 3EDFA 3FOMB 1JVKA 2VZ3A 1CXFA 4XGZA 3V5DA 3S37L 3V52H 5IT2H 5EO0A 3NIGE 4D0DB 3EO1A 4XH2A 2UVFA 3KPPB 15C8L 4JB9L 3BZEA 3S9DB 1P7QD 1NBVL 3DURB 5K9QG 2CDFA 1RIVL 4QXUL 4MYWB 1BFSA 4NUJA 3U0PB 1I9RH 1OD9A 1ZLVH 1SYSB 3GJEB 4G7YH 3MZGB 2CSPA 2QQNL 4NKQB 3UTTA 1WGOA 5FFLA 2XACC 5HYJE 5I1JH 4KKCC 3EDEA 4JKMA 4PJFF 3TH2T 4N68A 1EZVX 5L88L 5IM7A 3QUXC 2FX9L 3HI6L 2BCKA 4X5WB 3BISA 5GS3A 2P7TA 2V2WA 4M3JA 1S9XA 2I9TA 3CX5J 3HUJF 5J1SC 2WBJD 4JJHA 3TA3C 1NAMB 5IB5A 5I8KH 2LTQB 1OM3L 3KJ4B 4LAJH 3H8NA 3QI9C 1CFNA 1T89A 4JGJA 3LSOB 1U95A 5DEGA 2IF7A 4S2SA 1TQBB 3VRJB 3DVGA 3VXRE 4NO3B 3G6JB 1G7JB 3CK0H 2F53B 3G6AB 3IFLH 3ULVE 1VKXB 4B7LA 3RKDC 5I1GH 3MLVL 4XX1G 5JW4Q 2D2OA 2DIJA 1J1OL 3EO0A 3H3BC 3DMMD 1LK3H 1QPPA 2G5BA 1EAJA 3MR9B 1B0WA 4P4RA 4NOFA 3QIUB 3QEQE 5CHNB 2OP4L 4JG1L 3BEVA 3DETC 5I19H 3TYFB 1N5AA 3TBWA 1QSED 2ZOLB 1CK0H 3R06A 2EDJA 4AEHH 3PHOB 1BP3B 3UTZB 2MPAL 5LGJB 5F88A 4HV8B 5GGRY 2UUDH 5B39B 1UG9A 4QXTB 5DJ0B 2B5IC 1FH5H 1CIUA 1NEUA 1TQCC 4OI7A 3RA7H 1JUFB 3AVEA 1BZ7B 2GSGB 1DQTA 3MGOB 3KNBA 4LL9A 3RGVB 2CK0L 4V1DA 1E0OB 1ORSA 3AM8C 1H3XA 2FB4L 2H6PB 3GKZA 1FYHB 3JSSA 4KGJA 1YEIL 2Y4SA 4CADA 4PLJD 4OLEA 1TVHA 5AUMB 1YECL 5C7XL 3ZE0E 1KCRL 4YQXH 5J57B 1EFXA 3O6FB 2LU3A 5CJOL 3KXFD 4AM0A 3K2UH 1HHKA 3DO7A 1NGZB 2IH3A 5IFHL 4GKZA 1GIGH 1CGYA 4YPJA 3RWDA 1T1YA 4OGZA 4POZC 4NDMA 5HGBB 1E28A 4C4KO 3BO8A 4Z95H 3PWPD 4E41E 1UKSA 2JIXA 5IQ9A 4G8FB 4MD0B 1HZHL 3PL6C 1J05B 3LQAH 2XRAL 4HT1H 3SGJA 5CEZE 2DJUA 1AC6A 3G6DH 5C0DA 4JFFA 1I3RA 4GQ9L 1MCIA 4M5YL 5A2LH 2BHZA 3MOQA 1KN4L 4TOYL 3SO3C 2H3NB 1FAIL 1MCKA 4GKNA 4K3JH 1A21A 2ICWI 4K3DH 3B2UD 4UU9A 5DQDL 3VWKD 1FVCA 5GS1B 4IEFB 4B41A 2PXYC 5ILTL 4BZ2H 5I76B 1EAPA 2D7OA 1MFDH 4KJWC 2A6KB 3OF6A 4HPOL 4LSTH 2QSTA 1KCUH 1CGWA 3CFBA 2ORBL 4X6FA 2HKHH 3LRGA 3VXRB 5B38G 1RK1B 2OL3B 5FO7A 3TBSB 5F9OH 2DQCH 3EJYC 1CU4H 4QTIH 3NABL 2VL5A 4X6DF 5ESAA 2X4PA 2O5YL 4X0KB 1T0PB 1Q9OB 4DGYL 2X10A 1I7ZA 3VFVB 3QEQB 4AEEA 1LDSA 4APQB 4Z7NF 1QRNE 3EO9H 3MLYH 4FMFA 4O5LL 1JTTA 2F53D 2B2XH 1AJ7L 4PRHE 2R8SL 3MLXL 2J5LB 1YEJH 1HHJA 3V5KA 4U6TA 5E9DB 2AGJH 5T5FH 3AFLA 5EZIL 4JM2F 2W1NA 3EFDH 2DQEH 3GMMA 3QIUD 4UT7L 3TNNB 1JZ2A 4OZFH 4XNYL 2C1OB 3VFOA 5HHPB 4LLVA 1J5OL 5EIVA 2PCPB 4MNQA 4Y1AA 3FZUC 4PJ9B 1CTNA 3IKCB 4YDKH 5I71B 4YZFE 3ZKND 4OZFA 4RA0C 1N59B 3N85L 2IAMD 2XZZA 3U4EA 4EVNA 2P4AB 1JZ8A 1GC1C 3UTQB 4R4ND 4X7SH 4E9LA 2FH6A 3DUUA 4WUUB 1NFKA 2Y9RT 3CXHJ 1UWGH 5FKPB 3RGVD 3ILPA 3U6RA 4TTDC 1T89C 4K7PL 2Q6WB 1VGKA 1AXTH 5DGRA 1BLNB 3VG9B 5C0RL 4IDJL 4ZPTA 4JREB 1G7HB 1LDPL 3MC0A 4XNUH 5C0BE 5DD0L 4E41B 4KVCL 4U6HB 3O6FD 1J0HA 5DWUL 5FK9B 2ITCB 5INCA 4D0BB 4Z7WF 4KKAC 4MXQC 3CMGA 3QEGL 1ND0B 2XTJC 1ZS8A 5T5NF 2CXKA 5DT1H 1U8NB 3G08B 3H9SA 5C08A 5D1XB 3MLTA 4KK6D 4L9DA 2C1PA 3H42H 4YAQB 3ZYIA 2IWGA 3EZJB 4ZS6D 5HVHB 3DYPA 1M4KA 4WO4B 4XCCH 4JFQA 3D85A 2H1PH 2ZUVA 4N1HB 2CLRB 3TBVB 2CKBH 5F7MC 2V2TB 3BH8A 4F8TA 4FQLH 4ZD3H 5I1CL 3CLEH 5DJAA 1A0QH 5E99L 5GRYA 4KMTH 1PZ5A 2CKBA 4JDVB 1UADC 2BX5A 3GSVA 5L8LB 3M1BB 1H3PH 1RIHH 35C8H 2LAAA 3QCUL 3IVKB 5L8JB 5BO1H 5DLML 1YYLL 5GS0L 1QRNB 2R4RL 3ZKQD 4GOSA 3FQRB 1NUDA 4PRHB 3QISA 2FWOB 3HHRB 3MTRA 2B1HL 3GM8A 3O2WL 3QCTH 5J12B 1MRCL 4ODSL 4F3FB 4ZDHB 3MRBA 4QTHB 4YNYB 2IG2L 5JLZA 2EDBA 2QSCL 3SGJC 4APQD 4HG4J 2VXUH 2GJJA 2L4OA 1IQWL 4GG8B 3LQAC 2CUMA 4F2MB 5E9DD 4YHLH 4K23L 4JRWA 1DE4A 4FTVE 5DJXB 4RGNE 5CEXB 1IC1A 4P2RB 4X7DC 1KPRB 3W39B 4HEPG 2AV7B 1BZ9B 4MNGE 5MEOA 4QHMA 4JY4B 3VE0A 1J9CT 5TE7H 2AAVA 1JZ6A 1MVUB 4Q6IA 4H88H 4JHBA 1PQZA 1A6UL 3DX7B 4OTXH 5FCUH 3G5YB 2W9LA 3MA9L 4JDTL 1DLFL 5GISL 1OTTD 5KN5A 1U41A 4BK4A 3KR3H 3QIBB 5EZLA 4BQBA 1IGIH 3PWUB 1N64H 1XGPA 2DI9A 4WUUD 1KT2A 1F6AA 2OR7A 4JFHD 1AE6L 3MNWB 2BDNH 5J6GA 1XEDA 1WSST 1KG0A 1S7UB 3H0TB 4S1DC 2QEJA 4HC1L 4PJDE 4WWKA 1TDQA 2OXGA 5C0JA 1A7RH 1PG7X 4G6AD 1WIUA 2P49B 3L7FB 2AVGA 2MHAA 3HI1A 1KXTB 1ZLVK 4F37K 5I17A 1X5GA 1S78C 4OGXL 3WN5B 1ZVHA 4MNHB 2BOBB 3CDYA 3CFCH 4ODWB 2OZ4L 3D25B 1Q0XH 3WE6B 4D8PB 3MODH 4XZUB 2HTLC 2E27L 4L8BA 2IALB 3OXRB 2ED8A 1ED3A 1GZPA 3UBXI 3PNWA 5DC9B 3D2UA 3MBXL 4UQ3A 2D0HA 5B39G 1AGCB 3QDJA 1N0XH 4M1CD 4MJ5B 5K9JL 1FGVH 3CX5K 3EIFA 5E24E 3NACH 1P7HL 4PJHA 2R1XB 4X9GA 1T5XB 5I6XB 2AV1A 1SVCP 1N26A 1QA9A 4UOJA 1H3UA 4DVBB 3FB7A 3JTSB 2MCPH 3ZT7A 3ORJA 5D2LB 5C1MB 5AZ2L 1G1YA 2GTWB 3N1FC 4U1IB 4AT6A 4M62H 5SX4I 4JEGB 2OLDA 1BIIA 4LSUL 4OD3H 4XHQA 1HEZB 4HWUA 2DDQH 2IANE 3G5XB 1G9NH 4OCYH 3I9GL 4WJ5B 3BDXA 5C09E 5IBLC 4F9LA 3ARWA 4FFZH 3F58H 4PGEB 1P84J 4FRWA 4PRHD 4WI6A 4PGDA 3RZCA 5JQHC 4PREB 3F8UB 3SKMA 1FNHA 4FTVB 5GGSA 1K85A 4XRCA 4KUCD 4QRPE 3QCVH 4PV8B 4DGVH 1EJOL 5ADOH 5E4IA 1VPOL 3MLWL 2FJGA 3MOBL 4Q0XL 4NT6A 1RZ7L 5IMLA 5CJBA 4LSPH 2WP3T 4FFWC 4HXAL 3TFKD 4JR9H 2QQKL 2B20A 3TJHC 3VU2A 1KFAH 3BHBB 4L3EE 3R4DA 4NQXA 1QSFA 2J2ZA 1FL5A 1OF2B 3U36A 4P2RD 3FT2A 2B39A 5MERA 1LP9B 3AC0A 5EUKB 4EUPA 5D7LE 1MLCA 3B9VA 4AG4L 2YA0A 3QAZB 1ZT4A 3C6LA 2VXTL 4HJ0C 4PJDB 1D5ZA 2NY7L 2HTKC 3QG7H 4Q58C 4KY1L 1E6OH 1NMBL 3QIBD 3I84A 5DJ8B 3ZTJH 5JXAL 2NX5E 3CVIL 1D5XA 2FYYB 5KVFL 3Q48A 1MCFA 2CK2A 2DL2A 3HC0B 2DM7A 3MBEB 3JWDC 4KKBD 1F4XL 3P11H 3B2VL 4Y5YA 1W0YT 4Y8DC 3TBTB 5DO2D 3B9KB 1NBZA 4NC0B 3T09A 1KLFA 4NHCL 3RRQA 3WKML 4PJCB 1YEGH 1A7OL 4FQQA 3U7YH 4P4KD 1IGFH 5IBTL 2KZ1B 4GT7A 3X17A 4NZRL 3DI3B 2PTVA 5JIPA 1PG7H 1DL7L 4PJGE 4H26A 4Q6IC 1F6FB 1NMAH 1OT2A 2AJYL 4KQ4L 2JB6B 1YEHL 2BRQA 4EKXA 5FYJL 3RIAF 1YYMH 2F54D 5HYSA 3LRHA 2LFGA 5KSUA 4M9PA 3O4LD 1JYXA 4XBGA 5IFAH 1EIBA 1C08A 4NRZA 3UTPE 1UXSA 4ISVA 5EO9A 1G7PB 4HS3A 1GSMA 1RZGB 3UPRA 3PWNB 4IS6A 1KNOB 2IANB 5F7UA 1X5LA 2EYSB 2H41A 3W81A 5C09B 1A6VH 4ZFGH 3JV6A 4WWKC 1H5BA 2BNRD 1AHWB 5I74C 4AENA 4NGHL 3O2VH 3LQZB 5C0IA 3VXNB 4KKLD 2ADGB 4OF7A 1E27B 5JZ7D 1T03H 5EZOH 4NQDE 3QEHA 1CQKA 4ZO7A 4K2UH 1YN6B 1HSBA 4ZAKB 4PJIA 1QTYT 3V6BR 3U2SB 4YC2C 2BXYA 4X4ME 3IKKA 4H25B 3BPLC 3D5OF 2X4OB 4R4FH 3BH9A 5D7KD 2HMIC 1G6RA 5EIQA 5MI0C 4N90D 1FV1A 5JIIA 2ICWB 2D31B 2YD6A 3OAZK 5D7LB 3IDMA 1VFOA 2P46B 1NAKL 1NC4D 1AO7B 4FXKA 2DQUH 1W72A 2ZUQC 3T65B 3ETBF 3GBML 1KJ2B 4X80L 3AREA 2WLYA 4RRPG 2FJHA 5DFWH 1NGXB 4F8QA 4GW1A 3UO1H 1KC5H 3CXHK 1T83A 3O11A 4UQ2A 3B9AA 1UB6A 3V6ZA 1U8PB 2D7PA 5F70A 3JBG7 5ISZB 3KPSE 1T22A 2WWMD 4OZHE 4QY8A 2VDQH 3F7QA 3CFDB 4TUOB 3SDDB 4QGTA 4F9LC 4BA8A 5LQBL 3LKQA 5E6YA 1N8ZA 5GGUB 3RZCC 3NFSL 2J1KA 3MV9D 4HGWB 3PQYB 3HKFA 4M7LH 2VISA 2YPLE 4XVUD 3T0ED 3MBED 4N9GA 2XZQH 4OB5L 4HUVB 4U6YA 1D6EA 1F4YH 4M5ZL 4PJGB 3B9KD 4CL7A 5FYJD 5J11C 1FZJA 4GO6B 2WM0A 4OT1L 2V5YA 5KS9E 3V4UL 3QJFB 3ESVF 5ICZA 5IV2A 3F7YB 5ACZA 5EFIB 5HHNA 3P0GB 2HH0H 4G8GD 1J11A 3RY6A 4OLXL 4JAMB 4QHLA 1AGBA 1JPFB 4FS0A 1CGXA 3FHAA 5CINL 4ZG1A 4HKJA 2BVTA 4XNQB 3QQ3A 1MNUH 4QRRD 1A1NB 3C6LC 1XZ0B 4ODTH 4FQ2H 4G6JL 4KK5D 2YEZA 2HLAB 5HHXH 5IIEA 1IGYA 1ETZA 1SYVA 3LPWA 1CDIA 3IXAB 1MCRA 4Q9BA 1T04A 1J86A 1FCGA 5D7SL 4BFGA 5MENA 4NQDB 3KHOA 3QUKA 1IM3A 1FG2A 3D18A 1CXLA 5EOTB 1S9VB 5C09D 3WS3A 5A40E 3PP4L 4Y5YC 5C0CE 3GI8L 3FOLB 1ZGLB 1WAAE 3T8XA 3INUH 1T4KB 1NDGB 3BT2H 3O3AA 1NJ9A 5CP3H 1OWRM 1Q9WA 1DBJL 3D3VE 3BZ4A 4HG4K 4NN7C 1DQDH 4U0RC 3SN6N 1MIEH 4JY6B 5JOPD 2PW1A 4BFBD 4PGJA 1PZUB 3HC4H 1MEXL 2RFXB 1U3ZA 2Q3ZA 3RI5K 4RAVA 4E5XA 2OTPA 4Y16B 3MNZB 1XR8B 1AO7D 4TRPH 5EOQL 1HXYA 3MRGB 3IU4H 4F7EB 1QACA 4AYFA 3FB8B 3KPSB 3QXWA 4FXGB 4OZHB 1NGPL 3ARSA 5D6CA 4PRBB 4Y5VA 5FM8A 3OBAA 2GAZA 1I4FA 3GMLB 5DMKA 5TQ2L 1H5BC 4K3EL 1SJXA 4WW1A 4YBLC 4U05A 2KQNA 3F5WB 5HHME 1SEQL 4FQPA 1UENA 5ISZD 4Y4FB 3P9LB 3S37X 3W5MA 1FZMA 5E5RB 3EYFB 1UZ6F 5DTFB 1ADQH 3SDXE 1RULL 5KS9B 5GGVH 4LPVA 5C9KA 4HPYL 2ZG2A 5D96B 5HHOD 4A2MA 5FUOL 3PQYD 2FIKA 1RZJL 3Q3GA 4Z7UA 4NM8H 1VEMA 5LGKA 3O6KH 12E8H 3ULUH 3RWFB 5I1LA 4I2XA 4UDUA 1IGTA 4ODVH 1HNGA 3GJFB 5B38A 3BVNA 3QNXB 4HD9A 5DRZB 4AIXA 5C0FA 2XXCB 7FABH 4LFHD 3MRRB 5FO8B 4J4PD 4MDIA 5JIKA 1FYTE 4F58L 4PJBB 2KH2B 3V4PH 4I9WE 5ITBL 1T83C 4X6CF 2IBZY 3ARXA 5T3ZE 4ZODA 1RSFA 1ES0B 1NKOA 1V7ML 1HN1A 1LEIA 1DQQA 2UVEA 2VLRE 1NCBH 3BPOB 1U91A 4UT9L 3MUGA 4OLZH 5C0CB 32C2A 1CD8A 2R69L 2Y06H 5ADPH 2X42A 1A7QH 4OLVL 3FKUS 5HYQB 5IG7A 5EA0H 1P7QA 2VWEC 3D3VB 4XI5D 4BH7B 2E7LA 2UWEA 5IUSA 1XGQB 1P84K 3HFMH 2DI8A 5DMIL 4HHAB 3ZL4H 5B4MC 5TDPB 4DQOH 5JORA 2W65A 3NBNA 1OD7A 3PV6A 1F42A 3B43A 2IADA 1KCSL 3CH8A 1SM3H 3QT2A 4JQVA 3DROA 2WBJA 3QEUA 2R4SH 1GGCL 1MRDL 2DQFA 3RY6C 3BGMB 4PJXA 4YIQB 4JANA 1U9KA 1X5AA 3VCLA 5M95B 1HXMB 1X7QA 3KPRE 3BP7A 4QNPE 4ZOEA 4CMMB 2HFFB 4UAOC 1MFCH 4WEBL 5T1DH 4Q9RL 4ORGA 1IAKB 1AQDB 4Y16D 1RU9H 3OKMB 1MJ8H 4FQCL 3WIFA 3QHFH 5HHMB 1SBBA 2FBJL 1D5BB 3ROLA 3JXAA 5KSVA 2XKSA 2AJZA 3DMMA 4CDHA 1FNFA 2VR9A 3EGSB 2VDOL 4NM4H 2VDLH 4MCZA 5CZVH 1XCTA 4ZTPH 3IDXL 4X9IA 3SDXB 4LVHB 1QSEA 3X14A 5EH1A 5JHDE 1ZE3C 5C3TA 1JRHH 5E1AB 4P3WA 2YD9A 3VFMB 4LEXH 4Y4FD 3VH8B 4DKEH 4PJFE 5JDSB 2YHGA 3CFEA 1CGUA 2GJ6E 5IW6A 2A74A 3SDCB 2EH7L 4X5LA 1IC5H 1FFPA 2EIZA 2ATKA 2DYPB 3MCLL 1OSPL 4GXUM 3HUJE 1ERNA 1P5UA 3BP5A 2YXMA 3P40A 5ERWB 1T7XA 1FYTB 5E2VL 1BVLB 2X1WL 4W4NA 1SVZA 4CVXA 5CJQL 1OQXA 2BSTB 4J3OC 2DLFH 3VXPB 5L7XL 3KXFA 3VFGL 1OP5K 15C8H 4JB9H 3GZKA 4KI1A 2VLRB 3WYRA 1RIVH 4Y5VC 1EDQA 4GG6B 3MMEB 3UJIL 2QL1A 2QQNH 4M6AA 3EYVB 1NCDL 4L4VE 1D9KB 2A9ML 3HE6B 4UILL 5L88H 3PWPA 2F8XC 2FX9H 3CZFA 3HI6H 3GSNL 4UOW0 4I0KA 3KHQA 3K8MA 3C09C 1G9ML 5AD0B 3EYUL 4KJYB 2FO1A 3V7AE 3T77B 1OGAE 2IPKB 4D0DA 4JN2B 4DEPC 1G0DA 1XIWD 1OM3H 4GRWB 2DLIA 3NA4A 2X1QA 4BZ1L 3DURA 5EBMA 1BBJA 4DKFL 2IH1B 5EOCL 1SYSA 3GJEA 4WNQB 1EXUB 1V7NL 4LDLB 2O93L 1T21B 5F1SA 3IDYC 2NYYD 3VD3A 3MLVH 1IC4H 3KLHD 4X5WA 3RI5F 1NAMH 4GW4B 5I1KH 3KPRB 1J1OH 5F8RC 5DD6B 2A6DB 1BREA 3ULUC 5FGBA 1DEEA 3P9MA 2COQA 1S7RB 1IAII 5DHVB 5ACLA 2OP4H 4JG1H 3VW3L 1NAMA 2E7HA 3NCYS 5DUPL 4KRPD 5I2IB 4LFHG 3C8KB 5H37G 2WANA 1XF5B 1L6XA 3TJEL 5D2NE 4I0PB 4K7PX 4Y4KD 1FE8L 4RFNC 4KU1A 3GSUB 2IFFL 4P5KB 2MPAH 3LSOA 4GAFB 1WZKA 3WO4C 3CSYB 3VRJA 4NO3A 3G6JA 2F53A 1VKXA 4NQVA 2JK5B 2OMBA 4OFKA 5JHDB 3MLSL 2CK0H 4X7FC 3OKYA 2FB4H 1L4IA 2CO6B 3BKJL 2E7LC 4PJFB 2DQTL 3QIUA 2N4IA 5AYUL 1BQLL 1YEIH 4R3SB 3AXLA 5CHNA 2M26A 3LEVL 1YECH 3TYFA 5C7XH 1KCRH 1T80A 3BIBX 1WZLA 5CJOH 3PHOA 3UTZA 3EOTL 5LGJA 3SGDI 3KYOB 1KXQE 4HV8A 4Z0XB 5EIIB 4NJAH 2CDGB 1IARB 5B39A 5IFHH 4QXTA 5DJ0A 4JQVC 5F7EL 3V9FA 2WBJC 3PDGA 8FABB 2GSGA 3FRPG 4MQXD 1U8MB 3MGOA 3RVVC 4ZXBD 4YHPB 2RHEA 5CILL 3RGVA 2NY1B 5C0EB 4U2YA 2H6PA 3RVXD 2YD7A 1NC2D 4NP4H 1HZHH 5A16B 1BX2B 2XRAH 2GSIB 2YA2A 4L4VB 4F15C 4X6DE 4I9WD 4OBRA 1IZJA 5AUMA 3SE8H 3HE7B 4GQ9H 3O6FA 4M5YH 5IVNA 1KN4H 1AC0A 4TOYH 2KQMA 4Z7NE 1FAIH 2I25N 5FYKL 1NGZA 3DMMC 4XNMA 5DQDH 2ILLA 4U3HA 3I2CL 1PD6A 3QXDB 1OGAB 1OTUD 5I0ZA 5HGBA 1WC7B 1D9KD 5ILTH 2YD8A 4HPOH 1JIBA 4AIZB 4G8FA 1J05A 2ORBH 1TXKA 3EDKA 3NPSB 5C2BL 4ZNEA 2WAHA 3HC3L 3QUYB 4UZGA 3NABH 4PRPE 3BN9D 2H3NA 3W2DL 5IB1B 4U1JB 3MRQB 3T04D 4DGYH 3RUGF 3U9UB 1D5MB 4ETYA 5GS1A 4PLJC 1AJ7H 5I76A 4K71B 3ZKXC 2R8SH 3HMXH 3MLXH 3TM6A 2OL3H 1T7WA 1KCLA 4PRNB 3BZDA 1MSPA 1AD9B 1P9MC 5EZIH 2A6JA 1UM4L 4V2CB 3CVHB 1CT8B 1KBGH 1OGTB 3VXRA 4JFXB 3WFBL 3HMXA 1RK1A 2OL3A 4BSJA 1X4ZA 3EFFB 4NO2B 3TBSA 5F7WC 2FHFA 3HPLB 5EORL 5IW3A 4Z7WE 5DK3A 4H0HB 4XNYH 5DK0A 1J5OH 1PDKA 3I6KB 4QOKE 3ZT5A 3RY4A 3K80A 4X0KA 1Q9OA 2BHUA 4ZFOB 4CGTA 4BUGA 3QEQA 4OFDA 3DVFA 5F93C 4APQA 3N85H 1SJEB 2DQDL 4XNXH 5F89B 1DR9A 3EHBD 5A2FA 3MNVB 3VFRB 2OI9B 5E9DA 3JTTB 3VFNB 4RISH 1JWUB 5IFJA 4JZJB 3WFCL 4K7PH 3B2UC 3PGDA 3BD5A 4OBSA 5C0RH 1RY7B 5GSRB 1J0KA 1JHLH 4IDJH 3TNNA 3HTLX 4ZFOL 3CJJA 1LDPH 2C1OA 2F58L 5DD0H 4NZTL 4KVCH 5HHPA 5DWUH 5KW9L 4ZUWB 1W0VB 3IKCA 3D39E 1SHMA 5FGBC 4OUOA 4JZNB 1RZFH 1N59A 4X6DB 3QEGH 3OKKB 1PY9A 2IMMA 4X4ZA 3QDGE 1UT9A 3FCTB 1M6OB 4WUUA 2YD3A 1IGJB 5FKPA 3NIFF 2GT9B 1EBAA 2VE6B 3MRMB 2Q6WA 3SKOB 3KDMB 4JFZL 1BLNA 4Y88A 4XC1L 1G7HA 4JM2B 3UBXG 1WWWX 1M7DB 3HE7D 4JQIL 4E41A 4U6HA 3Q6GL 2XTLA 3ULVL 5E1HB 5I1CH 2ITCA 4D0BA 4QXWA 4BSVB 1QR4A 5E99H 2R2HB 1QBLH 4JGUA 3VDCA 1LD9B 3MJGX 3QIUC 1ND0A 3L3GA 5DJ2B 1ZGLM 5I8OL 4HMEA 1U8NA 5L2KB 5CZKA 3G08A 2OYPA 5D1XA 1V05A 3IFOB 4N0RA 3PDOB 1GGTA 4YAQA 3GHBL 4X9HA 3QCUH 2DQHL 3ZKNC 4Y89A 1INQB 1YYLH 4MAYB 4NQUA 4NO5B 5I9QB 2R4RH 1QQDB 5T33L 2J8UA 3HG1E</