2EDNA

Solution structure of the first ig-like domain from human myosin-binding protein c, fast-type
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
b'GSSGSSGAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-binding protein C, fast-type
publication title Solution structure of the first ig-like domain from human Myosin-binding protein C, fast-type
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ednA00
2Q6WA 1RUPH 4QT5B 5I1KL 4U1HB 3BD3A 3VXRA 3VXUA 4X4YB 5LWYL 5I1IL 2R69L 2FR4A 3VFNA 1DSFH 3Q5YA 5ESQB 1T2QL 2NY1D 4XCEB 4JLRB 4HKXA 5HYJB 1I7ZA 4JPVL 3TZVD 5DZOA 3TO2A 1INQB 3KPSE 5B3NA 2XT1B 3TCLB 3F7VA 1CU4H 1N2RA 4JKPH 4GRLB 4OKVA 3FQRB 5ALBL 2FZ3B 5FYKD 1R3IL 1DCLA 5I30L 2UV3A 2NTFA 3VMOA 1C08A 1NC2A 5F1IA 4PJFF 1A7QH 5SWSB 2GK0A 4AEIH 1OSPL 3WXWH 2W9DL 2X4QA 4K3EH 2CH8A 4PGCA 1T22B 3H9ZA 4QRPA 2HG5A 2VIRA 1S7UA 2IBBA 4ODWB 4ZUVA 1TVBB 3G6JF 1WZ1L 3B9KC 15C8H 4MJIE 3WNMA 1CLYH 1RHHA 1U8JB 5T1KD 4OM0L 1JHKH 2EXYC 3Q1SH 1NL0L 5CSZA 5EC1A 4O02L 3KDMB 5CZKA 2J6EH 1JZ8A 2ARJQ 4J1UB 5C0NC 4JFYB 1MQ8A 4KKLC 5F88A 5EOCL 2AKRB 2OM5A 1IQDB 5D5MA 4A6YH 3L5HA 2UY6A 3SDCD 1CS6A 3KR3L 3CFIC 3LEXB 4KQ3L 3X14B 2GSIB 3EYUH 1XR9A 2A6IA 2ZNWA 4KQ4L 4LLDB 5EBWA 5IBUB 5I18L 3L3DA 5BRZB 4R7DA 4U1NB 1FNGB 3L3OA 2BDNH 2YPLA 1QFWL 5E24E 4AM0B 1T80A 3VDAA 4ODXA 3RHWK 1Y6KR 4CL7A 4R97B 1IAMA 3D18A 1JF1B 2FB4H 4NNYA 2EICA 3U9UB 1QBMH 4JG1H 1S7SA 5FYJL 4XVSL 1WAAF 3QJHB 2DI9A 2P5WA 4PRIE 4FXLA 1K2DB 2JLLA 2WAHA 3O3DA 2A74A 4AMKH 1DVFA 1IGJB 4MCYA 5HGHA 2DM4A 5T5FL 1FLTX 4GLRI 1VFUA 2VOTA 1EXUB 1CFNB 3BZDA 2YKLH 1F4YH 1RJLB 1FH5L 2EO1A 4DVBA 2Z4QB 1U3JA 5IBLD 2XKNA 5EFIA 5HDLA 1VFAA 5E1AB 1Y18B 4I3SL 5T3XE 4GO6B 4I48B 3H0TB 4PY8I 4TN9A 2VABA 4OLUH 1HWGB 5DJAA 2GTWA 3ULVF 3P73B 1TQBC 1BBDH 5DVOA 4BZ1H 1KPVA 3ZYJA 2DYPD 3QUYB 3QT2A 5HYEA 5L7XH 2A9MH 1FFNB 3C08H 4HPYL 4GXVH 5SWZE 3LKNB 2OJEA 3ULUL 4P46B 4P3CH 3T04D 2RJMA 4IOIB 4C56E 4DTGH 4FQHA 5GISH 4KUCF 1MJJB 1JGLH 3O8XB 4TUJB 1E4XH 2YZ1A 3OAUH 4O2EA 5CEYB 2AJXH 2VDLL 2OL3A 2BRRL 5MERA 4ZUSA 3RWHA 2NX5E 5KSBF 1QSFE 3KPQA 3HZKB 1N7MH 4ZYKA 2P49B 4OIIH 3DXAD 2PETA 4XRCB 5FHAL 5ICXA 1CDGA 2FX7L 3MV8B 4D0CA 1J0YA 4K7PX 3LDBC 2BCKB 3VWKD 1IGTA 3OJDB 1MREH 1QSEB 1G9NH 3LEVL 4WWKC 1IGIH 4X6EB 3PHQB 1KN4H 3CX5J 1KCSH 5JHLH 1H0DA 5E70A 4F9PA 1ADQL 4IIQA 4PRAB 3FO1A 4I5BB 4OV5A 3UPAA 1YA5A 4CVUA 3BH9B 1YEKL 1RURL 3BN3B 4P5KB 2VAAA 4Q2ZB 4QNPF 5HHOB 1FG2B 2W65B 4HZAA 1ZVYA 4I18A 4PJ7A 4GBXD 4PB0L 4P2RD 5IB1A 4PJHB 1GGYA 5IKCB 2DJUA 1QNZL 2HJKB 3U9PH 2NW2B 1S9WA 4PJ5D 4NOFA 1G9MC 2B2XH 4K94C 2RFXB 2DTSA 2GY5A 1L4IA 5F6HJ 1FDLL 1ZHNB 3D3VE 1QVOB 5TJWK 4Y2DD 3PL6A 4WHTA 1VKXB 1MRCH 4YXKL 2JJTC 2ZKHL 1G6RA 4NKDA 3OR7B 5SX4H 3O2VH 3MV9B 1X5GA 2A6KB 3WUWB 1JP5A 5I66B 1K8IB 1BBJB 2AGJL 3HNVH 5CZVH 1ZLVK 4OAWB 2E7MA 1R0AH 4XNQA 4HIHB 3U46B 1X5ZA 3Q3GB 5F89B 4R0LA 1NGPL 1U8HB 4TVPH 5HD8C 5FOJA 1UYWH 1V7NH 5LVEA 1CR9H 2VERN 1S8DB 4M7JL 2E7LA 4Z78B 5JW3H 5I1LA 1W8NA 4YXLL 3HUJB 4XZUA 1A6UH 1B0GA 2V2XA 3OXSA 4G7YL 3UTSA 1FYTB 4ONGL 3AS1A 2FO4A 4XP6L 2YD2A 3CMGA 3P4OB 3ARED 1H15A 2ARJB 2IALA 3LQZB 2WWKO 5DFTA 3IDGA 5D9SB 5DJCB 3DX7A 3IXTB 4AIXA 3NGBB 2QHRL 1S9XA 4XWOD 3M1BA 4RIRA 3U7YL 1IAIL 2ESVB 1IGMH 3QUMA 3SKNB 4JM2C 1UM4H 2CKBB 2OQJB 4YBLC 3SE4C 4FQXD 4XNUH 3MA7A 2Z31C 4RWHA 3O6ML 2IQAA 1UG9A 2OI9B 1LEIA 3AMKA 2MWCA 5FAAA 2IAMC 5HHVH 5EWIL 1JGVL 2WINA 2BNRB 4NKOA 4NC1E 3WDHA 2Z93A 3ARRA 5KJRH 1NGWB 1DE4A 4RNRB 5DFVD 3MRBA 1RIVL 1A3RL 3IB4A 1J0KA 3ULVD 2DLEA 4XBPB 3WHE0 3BT2L 4LSUH 4JGJA 2FH6A 5MHSE 5C07B 3B6SA 4Z7VE 3SCMD 4MS8C 4NGHH 3FRPG 4R90H 1BQLL 2DM2A 4DGYH 5DK2A 4YO0B 5HHPB 4G8EA 2OCFD 3W0WB 1G7PA 1J1XH 3CXHK 3SGEH 5I1AB 3H9HB 3A6BL 4BA8A 3THML 2G2RA 3ARDD 4G43A 5GZNC 4WFHE 3HI1A 5DQ9B 2QQLL 3ARBD 3FTGB 3OJVC 3WUZA 4FXKA 3HPJB 2VZ3A 2R1YB 4XPAH 3B3IB 3IDNB 3HC0A 1JGDB 3OB0H 5F7EH 1W8OA 4KZDH 1AR1C 3J7HA 1EHAA 1T0PB 5C8JA 3VWJD 4MD5B 4XPFL 4CNIB 1Z3GH 1FO0B 3O2DL 5EBLB 4J3TA 4BFIA 2IANB 5I8OH 2FJHA 4X5WB 3HFML 5FGSA 3BZ4B 1ZT7A 4I0PD 2RR3A 2QTEA 4YDKL 4ESKA 1XF2B 3D2UA 4QHLA 4MLSA 2Y25A 2R15A 2EDLA 4KK6D 2PUQT 4Z7NF 1GJIA 4ONFL 2ITCB 3DVIA 4N0YL 5BVJA 3RWJA 3BSZH 1UC6A 5ACMA 4M61A 3RVVC 1QBLH 1I3VA 3TBSA 3D0LB 4OCMC 4PJXF 4UIMB 4YR6B 3KPSA 4F9LA 2DTML 4OCNC 3T8XB 3WNOA 2YSSB 4YDLC 1FCCA 4MHHG 3IFNL 4NQED 2YK1L 2UUDK 4OD2B 2XTJC 2DJSA 1F3JB 1I9JL 1CICB 3F7YA 1I3GH 5DTFA 3EHBC 1TVHA 1U58A 3SKJL 2CKNA 4R3SB 4F15C 1OGAD 3RGVA 3MUHL 5KSVB 4WFFD 4EI5D 4CADB 3MRDA 2BVPB 2ICWI 4LLWA 4P59L 4OD1L 4X83A 4L8BA 1A7BA 1WBZB 3CDGA 4MJIA 2BVOA 4UOJA 2IBZY 4O51A 3RUGF 2YD8A 4O00A 1NBZB 5IBTL 3WFCL 3ZDYF 4YHPA 3W81A 4TOYH 3NPSC 3S34H 2HT4D 1W72A 5HHQB 2V9QA 3VXMB 4X6CA 1IFHL 4UOW0 4Q6YA 3MUJA 2BNQE 2FLRT 4M6NH 4R96A 3MLYL 4DUVA 2VDQL 3QEQD 3S98A 3IJSA 4TNWF 4LAQL 4P2QE 1GAFL 3MRFB 3BQUC 1F4XH 3DARA 3KYOA 2OL3H 3QDMD 4LDOB 5HI5D 2HRPL 1KCRL 1JZ2A 3QJFB 5EUOF 2IMNA 4N8VB 3UTQB 3ARXA 3UTOA 1EO8H 1C7SA 3WXVL 5F3HB 3FOMB 1HXMB 5BXFB 3RWDB 3WLBB 3FT3A 3IAGC 4YHKH 3O81A 4TQEL 4E42A 3CK0H 2VLJD 5DVKA 4JZNB 2I26N 4RGNC 5FYLH 4BFEA 3T2PA 1H3PL 2YD3A 4M6OH 4PRIA 1TXKA 5GGVL 2EXWC 4NKMA 4NHCL 3HA0A 1OWWA 1EDQA 3MLTB 1FVDA 3PWLB 4BH8A 3WD5L 1JZ4A 3PGFH 1CXIA 3JV4B 1YMMB 1DBJH 32C2A 3CMOH 1GOHA 4FQ1H 1TIUA 4FFZL 5KSUB 1G0YR 4Z76B 4EN3D 4PRPD 1YQVH 2P7TA 2ZNXA 2AJVH 1MCPL 2D9CA 5DRNB 1IVLA 4PLKC 4EJ1C 3FRPA 2DICA 3O41B 1SEQH 1N6VA 3FQUA 5TDPB 1NCDH 1MF2H 4WCYL 4LFHG 4UBDC 4X7EC 3NCEB 3RWEB 2AJUH 5DZLA 1C5DB 4U1JA 1IC7H 3WO3B 1F6LL 3QULA 4NJAH 3MJ9H 4JFOA 1HHKB 1MJ7H 5DK0B 5ITBL 3QIBD 3O3UN 4PBWD 4MAYB 3GSRA 1MFAH 2NY7H 3ARUA 4XTRC 3HCVA 1NMCB 4Y4HB 2J3SA 4P9HL 5JTWA 3HNSH 8CGTA 2AEQL 5SWZA 1XIWD 4Z8FL 3B8YA 3CZJA 3SN6N 4YDIH 1DUZB 4C56A 4LSRH 1U8LB 2ZUSA 1XGQA 2GW5A 1DFBL 4JDVB 3RDTB 1FFOB 4OT1L 4JQXC 1SEBB 4X98B 1VEMA 5JO5A 3DX9B 4OFPA 3VI4E 3L7FA 2XN9B 3ARWA 4POYA 1QSFA 4NQSB 3K7UA 5DD0L 1MCOH 5E9DE 2AS5M 1CXLA 4ZFZA 3QWOA 2VSCA 2YWYA 5GRUL 2MPAH 1YDPA 4ODSH 3D25A 3JZ7A 5KG9A 1OCWH 2DQGH 4JDZA 4ZTPH 2MCG1 4WEMB 1DQMH 1JNHB 1JL8A 1ORQA 3QUMH 1U3YA 1T1XA 3HE7C 1KN2H 1PD6A 2FHBA 3QIUD 4NUGH 4B53A 5IFHL 2E7HA 3IFPB 3QH3A 3FFCE 3FQWB 2F54E 3FN9A 1HEZA 3P30L 1LWRA 2IFFH 4KRPC 1FZMB 2V2TA 3GRWL 1OP5K 3BAEH 3SQOH 1AD9B 2NY6C 1FZJB 3DX6B 2W0KA 4GW1B 3IJYA 3QA3B 1ZS8A 3F5WA 5EZOL 3WS3B 2W0FB 2CLVA 3V0VB 1BEYH 1WC7B 1IEAB 3OGCA 1BVZA 3U30B 3SE8H 1RFDH 3MV7E 1NDMB 3U7AA 2DQHH 3KS0J 3I50L 3D3VA 1JUFA 4H25A 4R4FH 5GGUA 4MDIB 5D7IF 4YHML 1KACB 3VFMA 3X11A 2GUOA 4K7FB 5HYJE 4JFQA 5BS0E 4XAWH 4Y4FB 1HHGA 1A1OB 1LDPL 4MA3B 5HDQH 2CLRB 5IVZB 4L9LA 4XPGL 1ZE3C 3LDBB 4X99B 1EVTC 1U92A 3K74B 3G9AB 2GYSA 2Y5EA 3NZHH 3WNNA 1X6LA 3G5ZB 3NZ8A 2R9HC 4UDUA 5EN2B 1NEZG 4FHBD 1RMFL 5CSBA 5IW6A 1MH5B 3S35L 4KJPC 4IOSD 4F7TA 5SWSE 3T0ED 3ALXA 5T1LA 2DL9A 1P7QD 4K71B 5GGRB 3FJTA 3RKPA 2GY7B 1AFVH 1AGCA 4KTDL 1MFDL 5A3IC 2JJTA 1D5ZA 1Q9OA 3X3FL 5BOPA 1HKLL 1MUJB 1TJHL 3JUYA 4G5ZH 4UIKH 1W2KT 1S7WA 5F9OH 2W9EL 4J3OC 5KZCB 4DUXA 4PD4K 3VDCA 2HTKC 1XCQA 1FORL 3HC4H 4X9FA 4LSSH 4QGYA 5T33H 3O6FB 4PG2A 2I9TB 2GCYA 1NMBL 3TJHC 5BMFL 4ZDHB 3MRQB 4JPKH 1RSFA 2EIBA 2P46B 5B39G 2DQDL 3B9VA 3ZHDA 3S36H 4GKZB 5J1AB 5J11B 4N0FA 2VLKB 2VXUH 4WEUD 1FFPA 2X1OA 5E99H 1N0XH 4PREB 3WFBL 4MA7H 5BRZE 4YHOH 3UMTA 2P42B 5A2KH 2D7MA 3SDAC 3BMWA 3LRSA 1PSKL 1N5YL 3U1SH 1K3ZA 3SOBH 3MO1B 2WUCH 4Z7VA 1CBVL 4P2CG 3VXSD 4XHQA 2DKUA 1VGKA 3WBDA 2F5AL 1OTUC 4WU5B 3X12A 5C0IA 4K7PY 2PXYB 4JM2A 4GAGL 2H6PA 3GB7A 3M07A 1EAJA 4OZGB 5DURD 1OWRM 5DHXB 3B5GA 4FNLL 4Q74A 5BVPL 1JV5B 1EIBA 5F1SA 4KJQD 4KHXL 1W72H 1ZGLA 5F7YC 4HH9B 4EDWH 5FEBA 2MJWA 5KAQG 3G6DL 2P24A 1KEGH 4YUEL 5IHUH 2BMKB 1MNUH 4L5FL 3SEPA 4YBLB 5DJDB 2APTA 3KGRA 1RU9H 1S5HB 1Z6JT 1E27B 3L1OH 3CSYB 4NRZA 3ZYZA 1J7VR 4G6KL 3CLEH 1MCKA 2LE9A 2OSLB 4WVRA 4MXQC 2IPTL 4KK5C 3QEUA 2FJGA 4J3SA 2NCMA 5EU7C 1QKZH 3DECA 3S5LB 2NY4B 5IQ9B 2EH7L 3QEGL 4OV6F 3LV3B 3MOAL 4XMLL 1NFIA 5TE7H 3PV6B 1XGRB 4R8WH 2ZSVB 2FGWH 4NPYA 5DGQA 3CVHL 1QLFB 1AXSB 3RWFB 3I6KA 4OBSA 4U7KA 1CN4A 1DN0A 4FFVD 3ZTJG 4DKFL 2Q7YB 1ACYH 3GI8H 3VA6A 3L3IA 1V8HA 2VQ1B 1JPSH 4WU7B 4ELMA 4DZBA 3WNKA 5DEFA 5EU7E 1CE6A 1AGBB 3VE0A 5T3XH 5IFJB 4NN6C 4WTZG 1TTFA 3MZTA 2R0LL 1KB9J 2A6JA 5C9JA 5I1HL 1HSAA 1QSEE 1PEZA 2D0FA 1G0DA 4JPWH 5TE6L 5FGBA 3HS0B 4P4RB 1YEGL 2PW2B 1CE1H 1A1NA 1X5IA 2QQNL 4AQOA 1NEZA 2ITDB 2BNQA 4YBHA 5CJQH 2FSEB 3FN3A 2AVGA 2X4NB 3LN5B 1ZA3B 2AEIT 2WBJC 4Z5RA 4Y4KB 4HGWB 4PJHE 1JTTA 4P2QA 4IMLB 2ZCHH 1T20A 1MFBL 2B5IC 3CSBA 4C54A 4YDLB 4U6YB 1BVLA 4RX4A 3LMJL 4HUXA 1M71A 1AI1L 1I7UA 1BFOA 5FUZL 1RJZB 3GBLA 1A6VL 1QLRA 2Y6SC 1IC5H 2VUYA 4MXVE 1HI6A 1DQTA 4LMQE 4NKIL 5MENE 2Y06H 3D69B 3L5IA 4U1SB 4PB9L 25C8L 3FOLB 2C7UB 1NGZA 4LASH 1ZHLB 4HUMB 4RAUA 4IRSA 2ICCA 3SJVD 3RX8A 5HGBB 3OKMB 4YDJA 5F21B 4HIEA 4JAMB 5DVMA 3VGBA 1J1OL 4OZFG 2HJLA 1D5MB 2UZXB 4YZFF 4Q9CA 1KC5L 1RAMA 4HBCH 4EI6A 5T1MA 4LSVL 1HN1A 3D0VB 5D1QA 4HJGB 3G6AA 1CGSH 1I4FB 2Z35A 2NMSA 1OT2A 3HUJE 3UXFA 1WICA 3A67H 2R2HB 1U8MA 1FYTE 2PO6C 3FONA 3U0TA 3QCUH 4KI5C 5ECJE 3IDMB 3I85A 1LILA 3AC0A 4MJ6B 3EYSH 3K8MA 1OAKL 4QHNB 4XHJD 2APVA 1OARH 4R26H 1LHZA 3I2CH 3GMLA 1ODAA 4JVWA 5IQ7H 1MPAH 2IH3B 5IT2H 1HHHB 1RZIA 4KVCL 3RAJH 3MBXL 2Q8BH 4CW1B 1KCKA 3CFCL 4ZNEE 4Y5VC 4S1RH 5C0FB 1YECL 3ZE2E 1CLOL 1X4XA 3REVB 2DWEB 4RZCA 4X7SL 4TTDC 3BZEB 1HWHB 3C60B 5KOVC 3QO1A 3OX8B 3KPOB 1J10A 1K4DA 3CFKA 4KWUA 2HLFD 3OJMB 3C5ZB 2OP4L 1JPTH 1AKJD 3C9NB 1MCWM 3GGWB 3HE6A 4KI5E 3VG0L 5DUPL 1BF8A 3HI5H 1G9MH 5D1ZC 4K94H 4OD3L 2DBJA 4P23D 3E6FA 5EUKB 4BFGA 1MJUH 2LQRA 4F7PB 1URLA 2OS7A 3MGAA 2AERT 1QRNB 3VI3E 5HDOA 3ULSA 5E9DA 3VXOA 2A6DA 1IM3A 4JG0L 4JVPA 4QRUA 3W0WE 4JHAL 3LD8C 3UYRL 5C0RL 4GXUM 2FBOJ 1FZKB 1PQZA 4OF6A 3JXAA 4X5XA 4PJCB 4KKBD 4KVNH 4G9FD 4OCSH 1EGJH 2UWEE 3MJ7A 2DIAA 4NN5C 1G84A 4Y7MA 1BM3L 3V4UH 3BDYH 3FFCA 5DRZA 4HMEA 5IB4A 3FB6A 4JPIA 2F54A 4NWTH 4ZFFA 4Y1AE 1CIDA 1QQDB 1RVFL 3F7PC 1OTTD 5IF0B 3QB7C 12E8H 4F57H 2EEDA 1Q1JL 4JRXB 3FO9B 4KTEH 1FZOA 2PTVA 1NGYB 3PP4H 1IL1A 2NXYB 4QT5A 1NGQL 1Q9LB 1HXYB 3PWNB 4QRRB 4WDIA 4JN1L 3O11B 1A3QA 3MV7A 5E08H 5F71A 4XP5L 4XCYA 3HE7A 1REIA 5ESQA 2NY0B 3ARGD 4FOMA 4XP4L 5I19H 1PG7L 1XF4A 5HYJA 3BKMH 4CJ0A 3MREA 3SBWC 5BS0A 2HJFB 4PJEE 1INQA 1MI5D 1D6VL 1LO2H 4APQD 4AT6A 1MSPA 1NCAL 2EDTA 3FZUD 5H8DA 4GRLA 1E28A 2QEJA 3SY0B 4J3UA 3FQRA 2FZ3A 3GSUB 3H42L 1BFVH 1SHMA 3QISA 5C08D 5TDNB 5ICZA 1U8NA 4X6BB 3HR6A 2Z8SA 1Z0MA 1UGNA 2V17H 5SWSA 4LCWB 3F58H 3C8DA 2WW8A 4U0RB 3RU8H 1JNLL 2HA1A 1Y6NR 3X3GH 2GJ6B 3MOBL 2NW3B 2RGSA 2DKMA 3BP5B 3BWAA 5MEPB 3UC0L 2F74B 3NA9L 4OLVH 1Z9MA 3D39D 3O2WH 4PV9B 1F2QA 3PHSA 5KVFH 2NY1C 3VXME 4OZFA 3VJ6A 1UWEL 2VDPH 2X70B 3P77B 3N1PC 3MRNB 4Z0BH 3TZVC 3N50A 1MCNA 4J1UA 2G5BA 4H8WC 4JFYA 4L4TB 5D71L 1IZKA 3LKPA 3QCTH 3RNQB 5C09D 2EEBA 4LVHB 4KC3B 3TYGL 1D9KD 3HHRB 4XAKD 3SDXB 1W0WA 5E94B 2GSIA 2B4CH 1WFOA 5IHZB 4LLDA 3RKDD 5JLZB 4UB0L 5BRZA 4LPWA 1KJ2L 5IGXL 3MRRB 3E8UL 1JJUA 1DLFL 4FXGB 1J1PL 1TZGH 3B2VH 1C5CL 2VWEC 1JF1A 3VFSB 3Q48A 4OLXH 1EA9C 3FL7A 1R3LB 4TVPD 2VLRD 3BGMB 2ENSA 5MP6L 3VXQB 4JO4L 5CP7A 2QV2A 4GMTL 3M17B 4YNYB 5HVGB 1TZHB 1U95B 5GRVK 1AHWC 4HS8H 4GAYB 2QBWA 2Q86B 1DBBH 5FYKE 1EXUA 1CFNA 1YMME 1I8IB 3VXUD 2BC4B 3P4NA 1J88A 1RJLA 3VG9C 2HVKA 4H20L 4X7DC 1WQVT 2CSPA 3SDCC 5ALCL 2F19H 1UXSA 2Z4QA 3FAXA 2VQTA 4WV1B 4OUOA 2OR7A 3SDAA 1CXKA 4XC1H 2EEAA 2VWEE 3PV7A 5E1AA 5IM7B 1Y18A 3RL2B 2UY7A 4I48A 4Y19B 5JR1H 4UT9H 1KEML 3ELAT 3JV0A 1E4XI 2YXFA 4N8CH 4P2OB 1VDGA 2IMMA 3P73A 2V7NB 2Z92A 3RJDA 5K9JL 1GYAA 1T7XA 3CH1A 3H3BC 5TFSH 4EKXA 3KLHD 2I27N 4JY6B 3L3KB 2XZQH 1HHIB 2NY5C 5C86A 5IMMA 1NC2D 1FSKC 2C3XA 1I85A 1YJDL 4ODTL 1AGEB 1N8ZB 3T3PF 4LVEA 4IOIA 3RZCB 5F9AC 4DKDC 4QRPD 1I3UA 1MJJA 2X2YA 3I84A 5DWUL 2DWDB 4Q9RL 1HZHL 4ZD3H 1KPUB 3T0EA 3MOQA 1FE8L 1KTKE 2XN9E 4L3CB 4GRMB 5IBLC 4ZOBA 4G9DB 1FG9C 4K23L 5I1DB 3HZKA 2B1AL 1NMAL 1BWMA 3QUXD 4NNPH 5DEGB 4M5YL 4K3HA 3TEUA 2EO9A 3QR2A 3OB8A 5B4MC 4XRCA 1LP9B 3OBAA 5F6IB 1MWAA 3PJSA 1LD9B 4KY1L 1DQDH 3HMWL 4QCIB 1NUGA 5A40E 3OJDA 1QSEA 1CGVA 4NCC2 3EIFA 3UBXG 3FQNB 4QHKJ 2R0KL 3PHQA 2RB8A 3P0GB 4NIKB 1AY1L 4XPHL 5K9QI 3QDJE 2GJJA 2YPLD 4NFDA 5BQ7A 1ZWIB 4LIQE 4GS7B 3BH9A 3EJJX 5SX4I 2XRAH 4L8SC 3T0WA 5SX5K 1FG2A 2W65A 3BHBB 1KT2B 5DDHA 4PJHA 2Y4SA 3AU1B 3HNTL 3KYKH 5E5MA 4NO3B 1NJ9B 4BKLB 2HJKA 2NW2A 3GSNA 4HHAB 4XNXH 2P5WD 3OB0K 2B0SL 1Q94A 1JPGB 1P9MC 1T6WA 2RFXA 4LF3B 2JK5A 1DVFD 4D94A 5FUCC 2E9JA 4EOWH 4F2MB 4DOHB 1QVOA 5CCKH 5MENA 4JHWL 5INCB 5IMOB 1VKXA 5DRXB 4HWBA 4Y88A 1N0LA 3H3PH 4IRJB 4N0UE 1K8IA 1BBJA 3QPQD 1YNTB 3BD4A 4RA0C 4OAWA 4IHOA 5D96C 4OCLC 1NC4B 2O5XL 3I6GB 3UJTL 1V3LA 3ETBF 4KK8D 4NNXB 4N5UA 5DQDL 5CJOH 4RFOH 1S8DA 3P4MA 3ZTJH 3VMNA 3TJEL 1MVUB 4EDXB 2ZUWA 2W07A 3HUJA 1WCBB 2HKHL 2FHCA 4NQDB 4YXHH 1MJ8L 1MCHA 1FYTA 4G42A 2VITB 4Z7WB 1J5OL 4L4VD 3GHEH 3VFPB 4ZFGH 2AK1L 5C0CB 3VXTB 1UEMA 4U1KA 5DJCA 3LZFH 3IXTA 5F9WB 5IOPA 1RZ8B 3QPXL 1UVQB 4BZYA 2EDYA 5LXGH 4Y2DC 3TM6A 4ALAL 1A7PH 5IMLA 1IGYA 3NH7H 5T3ZL 3SKNA 4ZNEA 3MCG1 2BOBA 5GJTL 2CKBA 2OQJA 1MOEA 4DGIH 1OAYH 4HCRL 2UZIH 4JFPB 4ONHA 5B3JF 2WWMD 3CLFL 2VLMD 3F8UB 3BUYA 4OI9A 3SGEI 2ZPKL 3K80A 4XCFL 1MHCB 4P2RE 3MLZH 3WKNA 2EE3A 1HE7A 1E6OL 4XXCA 2PO6A 2CGRL 5FYLD 3PWUB 2DQTH 3NCBB 4HV8A 5GS1A 2FWOB 4GAJH 4YHZH 4XBPA 3PIQB 4J3VA 3JUZA 1RUPL 4NYLA 2AK4E 1UZ6F 3GSOB 5BV7C 1UM5H 3L5XL 1PKQB 2X41A 3AREC 4XCCH 4WHCA 3HZVB 5L88H 5IEKB 1DSFL 4HS3B 5HHPA 3W0WA 3KVQA 3BOVA 5JPMA 5I1AA 3H9HA 1FRGL 4XWOC 2EIEA 4YAQB 1UZ8B 1TVDA 5KSAD 5IJKA 3BIAX 5D70L 2UWEA 4UT6L 3GUTB 2EIZA 1KBGL 2R1YA 4OZFH 1CU4L 3PWJB 4JKPL 3B3IA 5E03A 1GC1C 4LHJB 3IAPA 1A6TB 5TF1L 2I5YH 1JMZA 1BX2B 4Y1AA 3I6LE 1FV1A 5D1ZA 4MD5A 4X4ME 4H1LB 3QXVA 1F4WH 2DMBA 5E8NA 5DFVC 2VC2H 3KLDA 2R1XB 3WXWL 4N68A 4Q6IB 4RBPH 4X5WA 3WIHA 3LH2L 2GTZB 4GMSL 5IVOA 5JDJA 3BZ4A 4XNZB 1UENA 3MUGB 1ZVSB 3OXRB 3TV3L 4XX1E 4NOBA 4HEME 4K8RD 1B2WL 3SCMC 3ZLQC 1CZ8H 2F9BT 1RIUL 2R29L 1JHKL 4MNQB 4PG9B 5HVWA 3Q1SL 2ITCA 3UBXA 1YY8A 3RPIB 2QHLA 5IV2B 1PFCA 3T3ME 3G9VA 3VFUB 4OGXH 5GSVB 3ARDC 1RZFL 4FFYH 4PJEA 4YR6A 4UIMA 2HH0H 3ARBC 1WTGT 3T8XA 3UTSD 3K2UL 4HIIB 4A6YL 2JCCF 1NAMA 4LARH 2RIKA 1DDHB 1C5BL 1IEBB 1CICA 1B0RB 3T65B 3VFTB 4PR5A 4J8RB 4IS6B 3VWJC 4MB3A 4RFEA 3BUTA 4R3SA 1DBMH 4O4YH 1QSVA 5KSVA 4ZUTA 4LEXH 6FABH 4G7VH 1WVZA 2BVPA 1R6VA 1O5DT 5CEZE 4I0PC 1A2YA 1QBML 4WFGD 4JG1L 1WBZA 4K3DH 3OPZL 4FN0A 3RTQB 4RA3A 1ND0B 2CRZA 2B8OT 2AXHA 4KK6C 3QFJE 4FMKA 2D4DA 3QEHB 1A9BA 4LP5A 4AMKL 3MZGB 4ZUUB 2ZOLB 4L4JA 3VXMA 4OLEA 1XZ0B 1K5NB 4PGBB 3L3JB 3NA4A 5JXEA 3DRQA 5D6CB 5JQHC 2V9RA 3IDXL 3IT8D 4GRWE 1VADA 2C3GA 3KPTA 1KIQB 4WGWB 2MHAB 3MRFA 1R3HB 3K3QA 2K1MA 3HB3D 2VZ1A 2D7PA 3W2DH 4U7SA 4OLUL 5FCSH 1H8NA 3QJFA 3UTQA 3FQXB 2XY2A 5F3HA 1CD1B 1IJ9A 3FOMA 2YPVH 1HXMA 1S3KL 4EI5C 3DSFH 5IR1A 5BXFA 1G7QB 4I2XB 4OIBA 2JB5H 4NQUA 1AP2A 5MEOB 5DFWH 2VRAA 1MWAH 1X5AA 3WNPA 5L7XL 4JZNA 4XPBH 3TZVA 5IVXF 5DJYB 4LSPH 3C08L 4DKAA 3OZ9H 2HT4C 3MV01 3AXLB 1NBQA 1I1AD 3RA7H 3LQAC 4OM1L 4P3CL 2OX5A 4NQEE 4DTGL 1VEOA 3JV4A 1YMMA 1U3HC 4G6JH 5J3HD 5L0QC 2X4UB 2LAGB 3BGFB 3D2UD 3OAUL 3EDEA 2AJXL 3BPOC 3GM8A 3WLWD 5KSUA 4GG6E 3ORJA 3HR5A 4YHIB 1DQJA 2A83A 2CRMA 5DRNA 2CIKA 5TQ2H 4RISL 3O41A 2G9HB 3GSNH 2MCPL 5TDPA 3MBEB 5FM5O 4WFED 3IDIB 4I3RL 1RQ5A 4UQ2B 5CBEA 3PGCB 3RWEA 1C5DA 2NPLX 2WP3T 1KENH 4WGVB 4QGTA 4MX7B 5HVHC 5DK0A 2J88L 4ORGB 3D9AL 4UQ3B 4AL8H 4YWGL 5JHLL 1I8LA 4X80L 3GMRB 5IP4A 1QR1B 2P8PB 1TZIB 4IJ3C 4L8DA 3RGVD 2BVYA 3SDCA 1BGXH 2MQ0A 5T1KB 1JWUB 5IB2A 4JDVA 1RZJC 2V5SA 3QHZH 4X9HA 3H9SB 1FFOA 5L2KB 1U8QB 4X98A 1QYGH 3MRJB 4MJID 3V5KB 3JTTB 3DX9A 3QDME 1AHWB 3U9PL 2XN9A 4YHLL 1GHFL 4BM7A 3M8OH 4LLAA 1YEHL 2X4SB 2D7TL 4JR9H 4NQSA 4W6XB 4LLYB 4OGZA 5MEQA 1NQBA 2HVJB 5F9JB 4ZXBB 3JVGC 5I8CB 4JN2B 4WI4A 3S3PA 1N5AA 3BE1L 1T89A 1LO4L 5MI0C 1MRCL 4XX1G 2WIIA 1TITA 1NCUA 1INDL 3QIBC 4HFUH 4LRIA 5CZVL 4G8IB 5CINH 5IFAH 5D1XB 4PJDB 1R0AL 3QDJA 1F4HA 2O5ZH 3FQWA 2C1OA 5JDSB 1XIWC 1IQWL 4K2UL 1UYWL 1V7NL 1FZMA 2EXYD 2ZUVA 4PRPE 4W70A 5HDBF 4MWFA 2BNUB 5JW3L 1AD9A 1Y0LB 1FZJA 2Y7QB 3DX6A 4GW1A 4OZHB 1NAKL 3QA3A 4JRXE 1CTNA 3JTSA 3DYMA 3CPLA 5C0ND 1OB1A 3V0VA 3V8CA 4PRID 1WC7A 2EYSB 4FP8H 1KG0B 1MHEA 5GGTL 3RVUD 4HIJB 4JFZH 5B8CB 4Y5YC 3GHBH 2DYPA 3K1DA 4PBVC 5KS9B 4WRLA 1W0YT 3SDDB 4K7FA 2I60H 3C6SA 1JPST 1UM4L 2EDHA 4RAHA 4NSKB 4JREC 4QXGH 3PUCA 1AD0B 4Y4FA 2BVQB 4H88H 4MA3A 1RV6X 5FGCE 5IVZA 1YN6B 4X8JB 3QIUC 4X99A 5T3XD 1FGVL 1KB5A 3G5ZA 2ZG2A 2AQ3A 3GI9H 4OI7A 3WO4C 1OAUL 3EO9H 1BD2D 4LCWE 1WBYA 2AEPH 3EYFB 5GJSL 5A16B 3GBML 3MRMB 2DLFH 5DT1H 5E2WL 4JM2F 1AGDB 5GGRA 4L8SB 1OP3H 5C92A 1EK3A 4KK9D 5SWZD 2WANA 2CXKA 3G04B 2I9LA 3STZA 1J05A 3O9WA 3V7MA 1P7KA 1MUJA 2RQ8A 4C56D 3Q6GH 4Z7UE 1J1XL 4UZGA 3QXTA 5F7NC 3BDXA 1T5XB 2HLAB 3HI6H 4IDLA 5DUMH 1CF8L 4GKSB 1CFSA 2EDRA 5ID0B 4XPAL 3P9MB 1ZEAH 1QSFD 5INDA 5F97E 4ZDHA 1I3RB 4K7PH 2FIKB 3PP3H 4KZDL 3MRQA 3CZFB 5EPMB 3MLVH 3SDXE 3KLAA 1C1EH 1AIFB 1OSZB 2L0DA 3NFNB 3HC3H 4X7TB 5E00A 3VWKB 3QFDB 4FZ8L 4P2RA 1BLNB 3T1FA 2VLKA 1M7IB 3NOIA 1NAMH 3O3BB 1LK2B 4QY8B 2J5LC 2WWKT 4FZEH 5C2UB 2P8MB 4PS4H 3LCYA 3RGHA 3T0EC 1TCRB 3IXAA 4DUWA 5D72L 7FABL 2XZAH 5I6XB 2AK4A 4PJFB 2CJUH 1JNNH 4Y2DA 4JFFB 4HFWB 4C83B 4GBXB 4QTIH 2PXYA 1GIGH 4KV5E 5I1JL 1B88A 2ADJB 2VAJA 5AYUH 3U36B 5DA4A 2FYYA 3BSZL 3G6JB 3DOSA 1RUAL 3CDYA 5BJTB 1JV5A 1D5XB 3DROB 3WL9A 3T77B 3MNWB 2GJZB 1FZOB 4LL9A 1N4XL 1QFHA 4NT6A 3ULUC 3OL2A 2QSVA 1T03L 3T0XA 4YBQD 1LVEA 3MCLH 2BMKA 4FQIH 1N26A 3VD9A 4TSCL 2C4FU 4FQPA 3D3VD 1I3GL 4X4MA 3SE9H 4LLVB 1SM3H 3MMEB 2H32H 4KMQA 1DUYA 3CSYA 4Y19E 3REWB 3V5HB 4XCNB 4OLWH 1MFEL 2ZUQC 3K1KC 1OP9A 3KYNB 3CNKA 1WBXB 4DVRL 2P47B 4EVNA 1QP1A 2UVFA 3VGEA 3S5LA 5IQ9A 1HH6B 1H5BC 3OHXB 4LEOB 1MCJA 3S34L 3NABH 3ULUE 3MODL 4PRDB 3STLA 2VZUA 3PV6A 1KIPA 4H8WH 3S88L 3FO2B 3ZSTA 4U3CA 5LGJB 3CVHB 1XGRA 1QSZA 3TA3B 4KJQC 3OKNA 2ICWB 3BPLC 1QLFA 5CHNB 2QSCL 1AO7E 3RWFA 1WCQA 5FYKH 2XWJA 1F6AA 3PGDB 4FQXB 3ROLA 4NO0B 2Q7YA 5IEHA 1F4XL 1PG7X 4TSBL 2OL3L 35C8H 2A9NH 5F96L 5HHME 2BVTA 5GGVY 2D9QB 4NZJA 4JM4H 3VXSE 3OKYA 1GGCL 2XFXB 1EO8L 1AGBA 2R1WA 4WEBH 5C0GB 5IFJA 3MCKA 2EZ0D 3VFRB 5FB8B 3P4LA 5IMKB 4OQTA 1D3CA 2JE8A 1HOCB 3CFEA 5TPWH 5HJ3A 4M6OL 2PYFB 3QFJA 3S96A 2CIIB 1U41A 4P4RA 1AXTL 3C09C 2DQJH 4LNRA 5F93C 1P6AB 3ISWA 1CGTA 1R5IB 1L0QA 43C9A 2CDEB 2R39A 3R06B 2XV6B 3T2NL 4AYFA 2ZJSH 5MHSD 1DBKH 3VWJA 2X4NA 3CMOL 4UTBH 1ZA3A 4FQ1L 1BZ7B 4GAFB 4ZODA 2A73B 1WFTA 4JM2D 1RUML 4IMLA 1YQVL 3TIDB 3NCJL 2MTPA 3DWTA 4ZPTB 1FN4A 4FFVC 4MHHI 1KIRB 4HKBB 4NQCB 5DHVH 4WW1B 1SEQL 4I0PA 4WFHD 3TT1L 3QAZB 1KYOJ 1MFCH 1J8KA 2AJUL 4DOHE 5KSBB 4I77L 3MLUL 3BP7B 2FJFB 4NJAL 1NSNH 4U1SA 3MJ9L 1F11A 5KAQF 5AAWA 3FOLA 1ZHLA 1CCZA 1MFAL 1IILE 3BO8B 3MRKB 1GGBH 1F3DJ 2HFFB 4FQCH 4LU5H 1X5JA 1IM9B 5HGBA 5JPNB 4QEGA 4Q0XH 3QG7H 4FQQB 4ZFOA 4NQEA 4PRHB 1KGCE 4MAUH 3U0WH 4NCDA 1A4KA 1JGUH 1VPOL 3QQ3A 3FB7B 5BZWB 4LIQH 4M6MH 4HJGA 1I4FA 3L5WB 3GNMH 4GG6A 3EOTH 3EO1B 5I2IA 2OJZH 3IKCB 3E0GA 5HYSG 2DN7A 4PY8J 4LPTA 2YC1A 3WFHB 2R8SH 2I07B 4LLMB 3VRIB 5DJ2B 3B83A 1SJHB 5C0CE 4MJ6A 4QHNA 4YQXH 1EHXA 4MNGB 2MPAL 3VFWA 1TPXB 3ARFB 1JFQH 4PJ9C 5CILH 2XACC 4BSVA 1NEUA 1X7QB 4GW5B 5ESVB 4M7LL 4CW1A 1CTOA 2DRUA 4ZTPL 3MXWH 1E6JH 4POUB 3OAYK 4J4PA 3K4ZA 4WW2C 1BAFH 1UA6H 4GUPA 5HPMB 1A6ZB 1KN2L 5FOBB 2DWEA 2GT9B 4WO4B 4JVUA 3BZEA 4LSQH 1U3HA 2JELH 2DIBA 3I3EA 1OM3H 4HC1L 5JOFB 1F58L 1MY7A 5I74B 4DQOH 1KB5H 5ADOH 4KDTA 4YX2L 3C9NA 2AJZB 3RVVD 1OAQH 4JQIL 2DDQL 3GGWA 1UH4A 3RY6C 1GPOH 3DV6B 1XGPB 1M7DA 2FBJL 1BEYL 2ZP0T 2VXVH 1KFAH 2DLTA 1QEWB 5L8JB 5EUKA 1ZLSH 4S2SB 5JHDB 4E5XB 5A43C 1NCCL 1NFDE 3UYOD 1PKQE 3VCLB 4KDWA 4R4FL 2F8XC 4XHJC 1RK0B 4FABL 2BNQD 1NH6A 3MRIB 4EXKA 4JRWA 3VW3H 5J6HB 4Q7DA 1V5JA 1FZKA 3LY6A 1FL5B 4RGMC 3WIIH 3ET9F 4LCYA 4PTTB 1JK8A 4G6MH 2AV7B 4P2QD 1RD6A 1R3KB 4XAWL 1DEDA 5CWSB 4NFBA 4JKKA 5HDQL 5L6YL 3P9LA 3CX5K 3RWIB 1H3VA 3KNBA 2A1WL 4PV8B 4D8PA 5K93A 4RX4D 1FO0L 2Z91A 4E41D 3NZHL 1HHJA 1SMAA 3LPWA 3HAEB 3LKSA 2VLJB 1P7HL 4JB9L 1YEIL 1QQDA 2HLFC 5DXWA 1C16A 4UAOB 4PRPA 2OR8A 3MLRL 4IJ3B 1OF2A 4JRXA 4IRSD 4LCUB 1NGYA 5JW4N 3P40A 3N1QC 2HKFL 1MCCA 3E2HC 4P23C 1L9MA 1AFVL 1Q9LA 1HXYA 3PWNA 1A7OH 2R2CA 3O11A 1YYLH 1PLGH 1YUHA 4M7ZC 4ZPVA 4G5ZL 4EN3B 5IHLB 5EZLB 5F9OL 1BFTA 4JFHE 4O9HH 5D1QD 3TT3H 3C6LB 1P4BL 1HDMA 1T04A 2AABH 2YBRB 1HIML 4YJZL 3HC4L 1G7MB 2CK0H 1CXFA 4U1LA 4LSSL 5T33L 5MI0B 2VXSH 3MACH 3HZMB 4QXUH 3TVMB 2OZ4A 3SY0A 1EO5A 5ADPL 3GSUA 3MR9A 3S36L 3LKOB 5JOPE 1TETH 2VXUL 2KZWA 4HF5H 5E6IB 5FECA 4CVXA 1I9EA 5M7QA 4YC2C 1MRDH 4X6BA 3MPCA 4HZLB 1OTTC 4YHOL 4LCWA 3O3AB 3WN5B 3J8F7 5BV7H 1HILB 4YDVB 2DQIL 2WUCL 3SOBL 2EE2A 3GM0A 4OCXH 3BZFB 1BJ1J 2NW3A 1F8TL 3I9GL 4HUKB 1OD9A 4HUUB 1ITCA 2F74A 5FYJU 1WUNT 4QKXB 4Z7UA 4XVUD 2YN5A 5A1AA 2NY2D 4PV9A 5EA0L 3CFJB 3LIZH 3DO3A 5ESAB 1KELL 5F8QC 4PLKD 3QIUA 3ARGC 3HE6D 2X70A 5E0QA 3CC5B 3P77A 5D7JB 4BELD 3MRCA 4HLJA 2Q7NA 4APQC 1KEGL 1J86A 3FZUC 5IHUL 3NCYS 4PJXB 5E9DD 3RX5A 4JREB 3SDXA 5DSCB 2EDOA 1HQRA 5IHZA 1KJ2B 5I8KH 2HT2D 1A9EB 5D2NB 4WJ5B 1PW3A 4GKNB 5JLZA 5F7HA 3PWPD 3UTZB 2H9GB 4DEPC 5IESL 5TGBA 4LHUB 3DI2B 2VDOH 4I8DA 3VFSA 1FAIL 5FA4B 4YFEA 1I7RA 1DL7H 2JB6A 1R3LA 1UJ3B 3FFCD 3QHFH 4HT1L 3BGMA 2F54D 3KJ6H 1WEJL 3VXQA 5CEZH 5HYSB 4M62H 2NY3D 4MZ3A 2DLHA 1TZHA 4OQTH 4JGUA 5E8EA 5TE7L 2Z8RA 1JCKA 3NFPB 1OW0A 3CSPA 2IGFL 3RUGB 2NXZD 4N9GB 4R8WL 4MDJB 5DMIH 2D3VA 4GAYA 5KBNC 1MCEA 4XWGL 5HGAB 2BC4A 3V8OA 2XIDA 5IB3B 4I4WA 4LLQB 4HKJB 3LN4A 2EDXA 5IG7B 3CXDL 1D9KC 1F42A 4WV1A 2WLZA 4P0DA 4GRWH 3HE7D 3GMQB 3RKDC 3RL2A 1MLBB 5HYJD 4Y19A 5BS0D 2Q76A 3FB5A 2CDFA 2PNDA 4Z7QF 3SGJC 1WSST 4AEHH 1Q72L 4RGOL 4MJ5A 4GRLD 5E2VH 3D39E 2XA8H 5HYIA 5EUOB 2E9IA 3QRFM 4MD4B 5JA9A 3T0EB 4OCRL 4P99A 3L3KA 3LSOB 1HHIA 4OCWH 4YE4L 3VH8B 1BQHG 4AIZB 2X7LB 3NACH 2XNAB 2P44B 5C09E 5SWSD 4LVNC 3F7RA 3LEYH 1ONQA 3RZCA 1T1YB 2X09A 1UACH 1ZHBB 3H9SE 4NZRL 1IC4H 4PGZA 5L2KE 1AO7A 3WHE1 2DWDA 1KPUA 2X6MA 1A7NL 5DK3A 3AB0C 3KPNA 4L3CA 2G60H 4Y5XC 4AG4L 4GRMA 1NCTA 5F1NA 4MXVF 3GSQA 4P9MH 4XVJL 5DEGA 4LQFL 3VXSA 2APBA 5FO8B 2ICWJ 4NBYB 4MB5A 3T0AA 2BFVH 2ZZUT 1LD9A 1JPFB 2A38A 4QCIA 1GVIA 4AY0A 5LQBL 4LASL 3KLHC 4NZUH 3ZKXC 1YMHB 2Q1EA 3ZDXE 1ADQA 3Q0HA 3LQAH 2GI7A 5BRZD 3HPLB 3S7GA 4OZIF 1TDQA 3AUVA 1YYML 5LCVH 1ZWIA 3MXVH 1H5BB 4HBCL 2LVEA 1S5IH 5FO9A 5DS8B 5E2TH 2P45B 1S7VB 1RUKH 1S9YB 3BHBA 5E8PA 1KT2A 4OZHE 3F12A 4NO3A 4EIGB 4BKLA 4RMVA 3A67L 3BEWB 4HHAA 1JPGA 1EMTH 1NCWL 3FO0L 3QIWB 4LF3A 4NO2B 3R0NA 2ORBH 5E4EB 1PVHA 3EYSL 4KROB 3TBWB 3QUXC 3H9YA 3GSWB 4RFNB 4F2MA 3DX8B 3Q2CA 3ZE2F 2OYPA 3RAJL 3PNWB 5INCA 2N56A 5IMOA 1SJEA 3QZWB 5F7DB 2W91A 3GIZL 4M6AA 4RBPK 4BH7B 4HK3J 4LDEB 4S1RL 4RMUA 2JIXA 5C3TA 2HRLA 3AVEA 1E4KC 1Z2KA 2ZSWB 5FFLA 3WFEH 1ZKAA 5GSRA 4OGYH 1BP3B 1NC4A 4J2XA 1LE5A 5KN5B 4KI5F 3I6GA 3KJ4B 3VRLE 1RZJH 2DI7A 2ZUUA 1JRHL 4D0BA 2R2BA 5GGQL 3QHTC 4NM4H 1A6WH 5ENWB 4PRNB 3CIQA 4R2GC 3QUYD 2XWBB 1MVUA 3HI5L 4EDXA 3EOAB 4ODBD 1G9ML 4K94L 4HDIB 2VITA 4Z7WA 5I1KH 3NCYP 2MFNA 3VFPA 2AXGB 5D5ME 5I1IH 4WY7L 5JIPA 5IIEB 5C0CA 1ACZA 1DVFC 3DMMB 2R69H 3QUZA 4P46D 1QZ1A 1UVQA 3RWGA 3UTTB 2UWEF 2O26U 5ACZB 1F97A 3VDBA 3PHOB 1KXQE 4HD9A 1T2QH 3TN0B 4UOW1 1KJVB 5DD6B 1KCUL 1EGJL 4M8VA 5D7IB 2OTUB 4JFPA 1JIBA 4G6FD 4H5SB 2CR6A 1IAOA 4MXQD 3QPQC 4A2LA 3BDYL 5EIVA 5C1MB 3A6OA 5TQ0L 4ZTOL 1Z9LA 5H37G 2OZ4H 4KK8C 1GGIL 2D03L 4U6HA 5I16B 3PWUA 3WS6A 4F57L 4NN7B 3QNXA 4JO1L 1T66D 2B1HH 3PIQA 1QSED 2VR4A 1OSPH 1OP5H 5EZJB 5J12B 3QDGB 2W9DH 3OKEB 5F7FA 1XF5B 5CIPA 4PJ9A 1I8MB 3RIAF 3E6HB 4UV7H 1LE9B 5FF6A 4JFFE 1NFDA 3DV4B 1PKQA 1K3IA 5E08L 4NDMA 3HZVA 2N7BA 3HZYB 3OKOB 4OM0H 4WW2A 1N59B 1OVZA 4PJEF 2GFBB 5I19L 2CRIA 4W4OC 4Y0GA 1MELA 2XG4A 4O02H 5K33A 2PW1A 3O4LB 3BKML 1UZ8A 4ZUWB 4NWUH 3P3YA 1FNEA 5C2BL 5EOCH 2WWMC 2COQA 3IDYC 2VH5H 1J0IA 3MLXL 3VGFA 1CG9B 1A6TA 1U8KB 3EOBB 1PZ5B 5EOQL 4TNVK 3Q6FA 3MA9L 5EC2B 5C0EB 1MRFL 2V5TA 3PWVA 4PGDB 5FA3B 2C26A 3O2DA 4IBLT 4H1LA 1WWWX 5I18H 2V17L 3TBYB 1ZHKA 3MV9D 4L4VE 2R1XA 1QFWH 3F58L 4M93C 5I1GL 1XEDA 4P48A 2GTZA 4FQ2L 3U79A 2X40A 3PG2A 1WISA 3MUGA 1XR8B 3ZYIA 4S1DD 2X4TA 1ZT4A 1ZANL 4TRPL 5AD0B 4GQ9L 3D1MC 2F53B 1N64L 4X7FC 4XVSH 4XGZA 3MX0A 2PCPA 3NAAL 3B4NA 4PJGE 5IV2A 3GKZA 1QR4A 3VFUA 5HYQB 4HKZB 5KVFL 5GSVA 2VLME 1GZPB 4I18C 2VUOA 4ETQA 4A6YB 4DK6A 1CFTA 1WAAE 5KSAC 1ZVHA 3QCTL 1FYTD 1FJ1A 1KLFA 4HIIA 2VNCA 1KNOB 5KVDH 1R3JA 3CVIH 4HMCA 1WIOA 1DDHA 4M48L 3U2SB 1FH5H 1IEBA 3VFTA 1B0RA 4I0CC 4P5TB 1VEPA 3AY4C 1RZGB 3PE9A 2QJDA 4P23A 3AFLA 2MNUA 4I3SH 2CUIA 4YK4C 2ED8A 5CJ8A 3B2VL 5HSFA 1Z0NA 1UB5A 4R7NB 1AKJB 2AW2A 2O61B 4K8RC 4X6FB 1OTSD 1VGEL 1ND0A 2BNRD 1RZKC 4PJ7E 1VFBB 1J0ZA 3BIKA 4NC2B 3KXFE 5ID1A 3U4BH 4HIXL 4OLYL 2ZOLA 4HPYH 2E7LC 3DO7A 2Z8VC 3BPNB 3P0VL 1XZ0A 2J8HA 4LSTL 4WI2A 4PGBA 3L3JA 4LPXA 3ULUH 3V0AC 1PYWA 2IH1B 3UAJD 3S3SA 1J11A 5D2LF 3V6ZA 2R2EA 5C07D 1HK6A 1PGRB 1TJGL 4F7MB 3UROR 2F19L 1KIQA 3NN8B 1EEQA 4HPOH 3W0WD 2DKSA 4XC1L 2BRRH 3QI9B 3RHWF 4OFKA 1RJYB 4F80A 5JR1L 4AH2B 5JORB 3SKOA 4UT9L 5HHXL 5DJXB 3FQXA 4L1DA 4PP1D 5FHAH 1S7RA 5DMYA 1CD1A 1DEEB 2FX7H 1MLCA 2FH8A 3WSQL 4Y1AD 1M6OB 3LEVH 1EUTA 5D93B 5GRJH 5D6DC 3QCVL 3VU2A 4KRNA 3ZT6A 1QBBA 2YA2A 3ZE1E 1LEGB 4PRHE 1X5FA 3OMZA 1YEKH 4LMQI 3C5JB 3W39A 5J06A 1K4CB 5EO1A 3ARGB 3LKRB 4ZD3L 2F58L 1MHHB 4PB0H 1NBVH 2GHWB 5HY9A 4U1GB 3TP4A 5JIIA 4YHIA 4F7CA 3OF6A 1T21B 4AENB 1AC0A 4ZS6D 1L0XA 5HI3D 2X4PA 3EZ8A 3HB3C 1YEFH 3OAZH 4ZAKC 3OQ3B 4UQ2A 3PGCA 4F58L 3QQ4B 3WEXB 4JFDE 1DQDL 4MX7A 3W5MA 1N6QH 1IBGL 4YXKH 1LNUA 5I73C 1YNKH 3L3GA 1CICD 4UQ3A 4PD4J 4KJYB 1BPVA 2EDEA 2K7PA 1RULL 2AGJH 5ISZB 4PFEA 5E6ZA 5C09A 1TZIA 5EBMB 4X0KB 1I1AC 3BP4A 3SO3B 3QUKB 1MIEH 1JWUA 1PKOA 2R23A 4TTGA 2XRAL 3DTXB 4FRWA 3H9SA 1MQKL 1CFVH 5L2KA 5LG1A 5J3HC 3KYKL 1AGFA 3V5KA 3S4SB 1G1YA 5I17B 3WLWC 1FYHB 2V5RA 4XNXL 3PP3K 3NIFF 4PUBL 2X4SA 4ONGH 2VZOA 4XP6H 5F9JA 3VXMD 2ATPB 4ZXBA 2FEEI 1D9KB 3GK8L 1BZ9A 4JN2A 4JZJB 43CAA 1MAML 3T0DA 3JWNC 2YMXH 5JXED 3DUSB 5EU5B 1KB9K 1IMHC 2QHRH 1C12B 3U7YH 1IAIH 1L7TL 3H3PL 2E7BA 4CGTA 3CGTA 1FQ9C 4G8GB 2NNAB 3MYJB 2VLRB 3SKMB 1D6EB 4MZ2A 1CL7H 3IRZA 3GRWA 3EYOA 4UDTB 2NLJB 1JGVH 3RGVC 3V7AE 4YPGB 3UJIH 3BPCA 4XPTL 4Y5XA 5CJOL 4RFOL 2IPKB 1CT8A 3PDOA 2VXQH 4KHTH 3BP6B 4NQXB 4OZHA 2CK2A 5DJ6B 3BT2H 1P1ZA 2Q6WB 5TE4L 4WFEE 3LQMA 3FQTB 3GHEL 3CCHB 2EYSA 4JFEE 3UO1H 3VXRB 3VXUB 4ZFGL 1KG0A 4CUCA 5CIPH 5B8CA 3QBTB 1BQLH 1CDCA 1UWGH 1YMMD 5LXGL 4PGEB 3L7EB 3A6BH 3SDDA 3THMH 2WM0A 3UJJH 1I7ZB 4NSKA 3R1GH 1KXVC 4TPRH 1OAYL 3TO2B 1VHPA 4DGIL 2QQLH 2BVQA 2J12B 1YN6A 4BSWA 4EUPG 1N2RB 5A2LH 1ORSB 2KQMA 3AGVA 3MLZL 3UBXI 2C5DC 2XOTA 1GL4B 2Y36L 1I9RH 4XPFH 1C08B 2VKWA 4LVOB 1KLUA 5B38B 4I9WD 3O2DH 3EYFA 3QUXA 1NLDH 5A16A 3MRMA 3DVNA 2X4QB 4X6CE 2YPKB 3H8NA 4PGCB 4FFWD 4QRPB 5HGDA 3ARSA 2HG5B 1MEXH 1ULVA 3PABA 1S7UB 1RUQL 4UTAH 4ZUVB 4YDKH 2HYMA 5HVFB 4WIQA 3N85L 3RVUC 2HFEA 1KJ3H 1MCQA 4ONFH 1E4KA 1TFHA 2V2WA 4N0YH 5CSZB 1J8HB 4AEFA 1O7SA 2HLAA 2XI9A 3FCTB 1OLLA 3BWUC 4Z7NE 5J0BA 2XN9D 3W9EB 5GRZA 5F88B 2M26A 2DTMH 4O58L 4P4KB 4EQ2A 1DLHB 1I3RA 4DWHA 2FIKA 3IFNH 3GMOA 4PJXE 5EPMA 2I5YL 4MXWL 1I9JH 1XR9B 5DLML 3VD4A 3O3BA 5EBWB 3U6RA 1HINL 1F4WL 4GSDH 2CLZA 5FK9A 5B21A 5JW4Q 3SKJH 4R7DB 2VC2L 3O3EA 2DS4A 4JRYB 1CIUA 2QADB 3V6FB 3D18B 2R4RH 2ZOKB 3QG6B 2D7QA 3QDJD 4JFFA 4KKAC 4P59H 3T3MF 1CZ8L 5FHBL 4KK9C 3TO4A 5JXAL 1S7SB 1CK0H 1TCMA 3U36A 2P5WB 5IBTH 3WFCH 2MQ3A 1L0YA 4OGXL 3G6JA 2CUHA 3O45B 3O3DB 3RBSA 1DVFB 4MCYB 5HGHB 3MLSL 5BJTA 1K85A 1D5XA 5B4MD 2UZYB 4JY5L 5ILTL 4ELKB 4LCCC 4BUGA 3MLYH 3T2OA 2VDQH 4JHZA 4X9IA 4DVBB 3G5XB 4N1CA 3MRHA 4LAQH 4L3EE 1BD2E 3CUPA 5EFIB 3IETB 4KKCD 3LHPL 4OQ1A 4V2CB 1UH3A 4DN4H 2OK0L 4CRPA 1S7QB 4L4VA 1VACB 2FD6L 3OG4B 3REWA 2VABB 1ZMYA 4XCNA 4Y4FD 5DJAB 1T7WA 2GTWB 1F3DH 1EFXB 3WXVH 3KYNA 3TPKA 3PF2A 4YHYB 3RX7A 1WBXA 2W1NA 4W4OA 1VENA 4TQEH 1HH6A 1CD8A 1TQCC 2J8UF 3B2UC 4LEOA 4PJGA 4XBEL 4RWYL 5GGVH 1SY6L 4M4RA 4PRDA 4NHCH 4PJAF 1PG7W 5I15L 5GS0L 2ZCKH 2KQNA 3NTCH 4GRWF 1WAAA 3CVHA 4CDHA 4ONOA 4FQHB 5F1KC 1R24A 4YBQC 5H37H 3OV6A 1IEHA 4YGVA 5DD1H 3IRPX 3O9WD 2DQUH 3EYVB 2OL3B 3PGDA 4PLJD 5MERB 3WKMH 4NO0A 3NIDE 2JJSC 1MCPH 5KZCD 3KPMB 3I3DA 3W2DL 2PR4L 1B4RA 4CMMA 4C4KO 5C0GA 2YPVL 1JWMB 3O6FD 4L9LC 4X4XA 4D0CB 3C2AH 1SYSB 2DIJA 3VFRA 3AS3A 3QQNA 4U1MA 5ITBH 5IMKA 3GFUA 4XPBL 3QYCA 4M8QA 2VLKD 1HOCA 4LSPL 5KSAA 4EUPA 4TSAL 5I75B 1PZUB 3KXFA 1P5UA 3OZ9L 3U4EB 3OR6B 4P9HH 1NUDA 2AEQH 1RK1B 4IIQB 1F5WA 3FO1B 1R5IA 4Z8FH 4OV5B 3R06A 1JHLL 5FCUL 4GG6F 3BEVA 3AY4A 2AK4D 3K0WA 3TH4T 1DFBH 3C8KB 1WIUA 2AJSH 1SBSL 1ZT1A 4I18B 2A73A 2PXYD 5E95B 3ZE0F 5EIIA 2YUXA 4LHQB 1NPUA 3VGGA 1G0XA 3HTLX 4WI3A 4WW1A 3U7WH 2FATL 4RQQB 3ZKQD 4W4NA 5DD0H 3L3HB 4XB8A 5JZ7C 3I75B 3TNNA 3F6IA 2I24N 5GRUH 5DQJA 3PL6B 3BP7A 4PG2C 2FJFA 3RWCB 3ZKSD 4ZS7L 2EZ0C 5I0ZA 4NKDB 4NZTH 4X6DF 3BO8A 4AL8L 3I6LD 1HSBA 4NC1C 2HFFA 5CFHA 5BW7A 1VA9A 1LO3L 5C6TH 3ABZA 2DL2A 5IFHH 2H41A 4ZOCA 3MFGB 4FQQA 1G7JB 1UQSA 2D0HA 4ZO8A 4PRHA 4QLRA 4GW4A 3P30H 1HNFA 4R0LB 2XICA 1MCSA 5KVGL 5BZWA 1KUMA 1F02I 2HN7B 2NY4D 3EO1A 5DGRA 5EZOH 1B0GB 3OXSB 3IKCA 2BY2A 3I02A 1KOAA 3WFHA 2BRQA 3TBTB 3VRIA 1H15B 2E3VA 2IALB 2C9AA 2ICES 5GHWH 3MTRA 2ZUXA 5J13C 3GJFA 1Q0XL 4RSVA 1G7IA 5EO9B 5T3ZE 2R0ZL 4JFDA 4PP2A 1X7QA 3M1BB 4RIRB 4YHMH 5D6DA 2JJUA 3QUMB 2LVCA 5IJVB 1BIIA 1TNNA 3IAQA 2GITB 2QSTA 5I9QC 5M95B 2Y5TB 4XMKH 3BKYH 5D7IE 5HPMA 4DJMA 1A6ZA 1JE6A 1LDPH 5FOBA 3MA7B 4WO4A 3NFSH 4Y16B 3P9WB 5FKPA 2IQAB 4XPGH 1CDBA 4XMPH 3RVTC 2VL4A 1LEIB 2CMRL 2HAZA 4M43L 1WLHA 2H2SD 2WINB 1KIUA 2ZG1A 5JOFA 2Z93B 1FFRA 2FEEL 5CEZD 5E8OB 1DE4B 4ACPA 3FHQA 3ILPB 2X4RA 3DV6A 4ZAKA 1MCRA 4IDJL 4MA1B 5SX5H 3QDGE 3QFJD 1IE5A 4HK0A 1KULA 1NCBH 1P84K 4XNMB 3B6SB 1BZQK 3BXNB 4G8FB 4N90D 3RY5A 4E5XA 2YEZA 1V05A 3ZHLA 1UJTA 5DK2B 2W59A 5K9OA 1RK0A 3X3FH 3MGOB 3MRIA 1HKLH 1TJHH 2C1PA 2W9EH 2X9XA 1CLZH 5CMAA 1FLRL 2B4CC 4G43B 4Y4KD 2I60L 5AUMA 3O4LE 3DYPA 4QXGL 5FKAB 5EU6B 1I1AA 1P2CB 4FXKB 2EKSB 5DMGD 1T1WB 5BMFH 3HC0B 1G9EA 2E5EA 2DQDH 4WENB 3MRGB 2BXZA 4XXDB 3V0WH 3V4PL 2I25N 1UCBL 3EO9L 4K9EL 3WFBH 2KZ1B 4OLZL 2Y07L 3SDYH 4LCUA 2DLFL 2YD4A 5DT1L 4XBGA 2BSRB 5DZNA 1ZT7B 1WZKA 4JFEA 4Z7UF 5FGBC 3BMVA 1YNLL 3Q6GL 1HH9B 3RWJB 5J4MA 4M61B 1WK0A 1L7IH 2EDNA 3IJHB 3HI6L 2LU7A 4ELME 1U8IB 4OZ4B 5BVPH 3KPSB 5ABDE 1G7MA 5LGHL 2AXFA 3N1MC 4KHXH 4LKXB 1A21A 4UU9A 4K7PL 4HX1A 2CDGB 3VFGL 1F2XK 5C0DB 4Z6AT 4QRSB 3TVMA 3MLVL 4UT7H 3IU3A 4L5FH 3HC3L 5F7LB 2QLVB 5E6IA 4CN1A 3DURB 4XC3L 1VB9A 4HZLA 1U58B 1MCWW 1F45A 3K8KA 4FG6D 4G6KH 4HXBL 4J4PD 4PS4L 3U83A 1LK3H 3S37X 4JQVC 4NQVB 4IRSC 3DI3B 3LAFA 2EYRB 2CJUL 1HILA 5I76B 4YDVA 1JNNL 3BVNB 4LLWB 4IRZH 3C60D 1JWSA 2YXMA 1U3HD 2E6QA 1QFUH 4L8BB 4QTIL 3T4YA 3CDGB 1GIGL 3D85A 3KPRE 2BVOB 4O51B 4HUUA 1HYRC 4PJIE 3TBVA 2EH7H 4LLUA 3CFJA 5ESAA 2QQQA 1A4JA 1W72B 2FL5A 1CGUA 5D1QC 1G7LB 2EDQA 3MOAH 4XMLH 4HQQL 5D7JA 4E41E 2OMNA 4D9LL 5CS7A 1YQ2A 4RMWA 2YRLA 3CH8A 4Z7OF 1ZOXA 4R96B 2BHUA 3MCLL 1QRND 3KPPA 3CVHH 1E4WL 3IJSB 1T83A 4PJXA 2AQ2A 5CD5D 3O4OC 3TYFB 1I8KA 3PXHA 1KJ2A 1M05B 2D31B 1A9EA 2JCCB 4WJ5A 1EJOL 1YC7A 4GKNA 1OD7A 2ZUYA 3MRLB 4DCQB 3KYOB 1DQLH 2H9GA 4XP9L 3SQBA 3B9KB 3EO0B 4JDTL 4JFXA 5DJ8A 4WI9A 2E27L 5FA4A 4DGVL 1GSMA 3FT3B 2R0LH 2P4AB 3ULUF 3RVXD 5I1HH 4N5EC 1KTDA 3NABL 4PRIB 1OPGL 4XVUC 2ZCLH 3EFDH 2NY2C 4DW2L 1BJMA 4FTVB 1YEGH 1FVDB 3IGAA 4BH8B 4F7EB 3HE6C 4EUPH 4JRXD 2EC8A 2QQNH 3IFOB 4MCZB 2NXYD 2XXMB 3TCXA 3JV6A 5HGAA 8FABB 5IB3A 4QRRD 4JCMA 4LLQA 4HKJA 5FYKL 2F5BL 4L3EA 1BD2A 4NHUA 2P7TB 4YGAB 4GFTB 1MFBH 4FQLH 4V1DE 2NY0D 3OKKA 4M5ZH 2HT2C 1G6RH 2A77L 2A9NL 2QR0B 35C8L 3GZKA 3LMJH 5EORL 3FQUB 1AI1H 1JHTB 4DN3H 5FUZH 1H3WM 3AM8C 1A6VH 5ERWA 2WV3A 4U1JB 4D9RD 1Q9KA 4TUOB 1TJIL 4K8RH 5E2JA 1T1ZB 4JFOB 1RZKH 3V5DB 2YRPA 4MD4A 1JN6B 3VH8A 2NY3C 4Z9KB 3IDUA 4M1DL 2X7LA 3F65A 4LCCA 4LPCA 4LCWD 1PDKA 5IVXB 2XWTB 5CJBA 4OCYL 4N1EA 1KC5H 2NXZC 2FRGP 2ZJSL 3JBG7 1T1YA 1UEYA 1XGQB 5CEXB 1ZHBA 1DBKL 4LSVH 4UTBL 3H7BB 2DLIA 1FNSL 4X8XA 1B6UA 4YZFE 4NM8L 1JI2A 3PWPE 1FP5A 3L7FB 1FVCA 1CQYA 1XH3B 2HP4A 2NX5B 2YD9A 4S1SL 3SHSA 4CN6A 2VQUA 1TQBB 1MFCL 1KXTB 5FO8A 1OAKH 1ED3B 3A6CH 4ZFZB 2DLGA 1CFQB 4PTUA 3VXPA 4MA8L 1JPFA 4KVCH 1QD0A 5KG9B 3V52L 3GJFH 3MBXH 1CDHA 4GRLC 3W9DB 1BVKB 4O5LL 4IMKC 2NY5L 1GGBL 2DD8L 1YECH 4LU5L 1CLOH 4M4PA 1I1FA 1GGUA 1D5BB 5E8DL 1YPZF 3HPLA 3QH3B 1A6AB 1KCLA 4LP4A 1CGYA 4FS0A 1S7VA 5FYJD 2JJSA 2OP4H 2P5EB 2VDKH 3CD4A 4LIQL 2V2TB 1S9YA 1U93B 1IGCL 2C3VB 3GNML 5GS3A 3IJYB 3VG0H 5JNYA 5DUPH 2OJZL 4MMZC 3BEWA 2YUWA 1JNJA 3DGGA 4Q9QH 2R8SL 4U2YA 4NO2A 4U6XB 2W92A 3TBWA 1G6VK 3KWWA 3GSWA 4YQXL 3FFDA 5CAYB 1JUFB 1UB6B 4NRYA 3DX8A 4JG0H 5GGUB 4D3CH 4P57A 1SJXA 3UYRH 4WWKB 3T4AA 5C0RH 4HXAL 1WWBX 4U6TA 3X11B 4L1HA 3MXWL 5IVNA 1V7ML 5CP3A 4JFQB 1BAFL 1HHGB 4PJ8A 3DVGB 4POZD 1BM3H 4Y19D 1FVEA 1U92B 1QA9A 1OM3L 4B7IA 5KN5A 3IYLW 1GZQB 2R56L 4DQOL 4R97C 1RVFH 5E56A 1ZLUK 5IW6B 5EBGA 3OG6B 1KTLB 3SPVB 1I1YB 4F7TB 3FB8A 4Z77A 2XWBA 3EOAA 1BREA 1X5KA 5T1LB 1NFDF 2VXVL 2XYCA 4HDIA 2CO7B 1NGQH 3ULUD 4WW2F 2SEBA 1AGCB 4JKMA 1V3MA 1YEDB 5ELIA 3DMMA 1D5ZB 1S7TA 1FNHA 1Q9OB 5A2JH 2WUBH 4ZO7A 3RZCD 4XP5H 3UTTA 1S7WB 5ACZA 5J1SC 3PHOA 1J8HE 4ENED 1AO7D 2H26A 4HCRA 4XP4H 1PG7H 3O0RH 5E2UH 1RJCA 5DD6A 5GS0D 1U6AL 5D7IA 5K9KB 1NFKA 4BSJA 1H8SA 1TNMA 4H5SA 1D6VH 1CXEA 2GCYB 2NQCA 2K7QA 1NCAH 4YPJA 5HHMD 1HYSD 1W0VA 1F90H 2FECI 3RNKA 4PJBF 4F33B 5ICYB 4RRPG 3H42H 4LGSB 1YEEL 3DYOA 4B5EA 1FFPB 5TDOB 3BGAA 3EYQD 3QXWA 4NFCA 4ETYA 5DJZB 3QUYC 1LO0H 4PBXA 1F3RB 2B20A 3QDGA 1XF5A 5TH2B 4OI8A 2IF7A 1JNLH 3E6HA 1I9IH 4B41A 1A7OL 1LE9A 3QWRD 3V6BR 3N9GL 1VGKB 1PLGL 4PPTA 3X12B 1I85C 3DV4A 3MOBH 3N1FC 2DI8A 4JM2B 1Y6MR 2H6PB 4P46C 3EBAA 3H7LA 2FX9H 4NCC1 2IG2L 1N59A 1JZ6A 3UC0H 1QFWI 4U4BA 2Z31B 4X4ZA 4WUUB 2BK8A 4MSWB 3O8XC 3O4LA 5J9PA 4ZUWA 1UWEH 2IAMB 5I1EH 4GG8B 2CK0L 2R4SH 3P2TA 1ZGLB 5D71H 3MROA 4JZOB 1NUNB 4UI2A 4QO1A 4P3WA 2X4OB 3VGHA 3TYGH 3EOBA 5I9QB 1TETL 3AMLA 2VDRH 4NUJA 4XH2B 5EC2A 4E0RA 4OFDA 1INEH 3WJJA 3NBNA 2X10A 4PGDA 5FA3A 1EEUA 1MRDL 5EU3A 5CUSL 4UB0H 4NRZB 3TBYA 5DD5L 4R4BA 5DYOA 3KHQA 2JIXD 2HFGH 1T66C 3KPLA 3LKQB 1J1PH 1UM6H 1BOGA 4J7RA 1U8OA 3QEUB 2FJGB 5H35A 1NC4D 4JCLA 5AD0A 5MP6H 4JO4H 1KGCD 1XGYL 2VDMH 3LIZL 3OAZK 4GKOA 2DQEH 2PKDA 4HKZA 5C6PB 3OKLA 1GZPA 1NFIB 1WV7T 4A6YA 5L2JA 2HWZL 4NQDD 5CZXD 3GJEA 1F13A 1GC1L 2P48B 1Z5LA 3MV8E 5C0CD 3I6KB 1QFPA 3QUZD 4H20H 1CD9B 1Q0YL 1DN0B 5ALCH 3TLRA 4P5TA 1DQQA 2CPCA 5I8KL 1RZGA 4WUKL 5IK3A 2BY3A 3L3IB 1IKNC 3ULVL 2X1QA 4DZBB 2X44D 1EVUA 5AWNL 1KEMH 2VDOL 3VE0B 2OLDA 3FAWA 3V4VH 2E8YA 1DL7L 3ECBB 1WZLA 5HHOE 2E9WA 4S1DC 3KPRA 2O5YL 5C9JB 3VD5A 1VFBA 4N0RA 4PJIA 5J6GA 2PN5A 3T1WA 5BZDA 5JW4R 4EBQL 1YJDH 4ODTH 3MLWL 2XTJB 4E41A 1X44A 4YIQB 1NEZB 2IH1A 2BNQB 4DKEL 4PJ9D 1JGEA 3T3PE 1ES0A 4CU6A 4KUZH 4Q9RH 2R0WL 3NN8A 5DVLA 4F15B 4P2QB 1A7RL 1CD0A 3MV9E 1FE8H 1T20B 4JQVA 1EAPA 3QI9A 3NGBC 4HWEL 1A0QL 1OGTA 1X4ZA 5L8KB 4JY4B 1BVLB 5DR5L 4HUXB 2PYEB 2B1AH 1I7UB 4AH2A 5JORA 4M5YH 4Q97A 3MLPA 4AEHL 3MNVA 1HI6B 5JUEL 5SWQA 1DBAL 5E2VL 3NPSB 4S0SD 4KY1H 4NBZB 2OI9C 3HMWH 5BO1L 3N06B 3LRGA 4K3GA 4RAUB 1OTSC 1X9QA 4GQPH 4Z0XA 3VXNA 1U8PB 1KCVL 1CXHA 1TTUA 5IWLA 3NACL 2R0KH 4XXCC 2XZCL 1T3FB 1AY1H 4HIEB 1EH9A 5IBUG 5J56B 4KTYA 2ZWLT 5DEZA 5GS1C 5B39B 4RRPA 1LEGA 2XPGB 2GSGA 1P6FA 4EI6B 3C5JA 5T1MB 3UAJC 3BQUB 1IC4L 1I7TB 3WJLC 3LKRA 2Z35B 2ESVE 4U7MA 2G60L 2VL5A 4KKNA 1EJ6A 4V1DA 5AZEL 1T21A 4JFHD 1NGXA 3FT2A 2UYLA 2B0SH 3WE6A 3GO1H 3U0TB 4HK3N 5JOEA 3O4OB 4QRQA 5DF0A 5IJKC 4CKVX 3ZMRA 1MFNA 2BNRE 2BFVL 3GMLB 4PP1C 2YWZA 4RGNB 1MCBA 1EZVX 4JHWH 2J2ZA 5JOPD 4NZUL 2M1KA 3BW9B 4JO2L 4RZCB 4QHUA 5CP3H 5ISZA 3LQAL 3QO1B 5C07E 4X0KA 1N3NA 1IAII 2O5XH 3QUKA 1S5IL 3UJTH 4M1CD 5E2TL 1OHQA 3BH8A 3HE6B 3RTQD 2QQKL 4OFYA 3RRQA 3BISA 4LAJH 3S4SA 3PWPA 5I17A 4U1IA 3AM8A 3E6FB 1CL7I 4J6RL 4OB5L 2ORBL 4J3XA 4OTXL 4ZS6C 2ATPA 5HI3C 2AK1H 4ERSL 1MIML 4QXTB 3DUSA 5E5RB 5GZOD 2ATKA 5EU5A 5GGRY 1C12A 3ZL4H 4ALAH 4X5XB 3K46A 2BZDA 3IF1B 5T3ZH 5GJTH 2IQ9H 5EU6E 3Q5OA 1CICC 1QO3A 4JY6A 1T4KA 2IANE 4HGMA 3CLFH 4LRNL 4U1HA 3FFCB 5DRZB 4ZSOB 3SKMA 4X4YA 1D6EA 3FB6B 2F54B 4JPIB 2MQCA 2ZPKH 2AJYH 1RZJL 4UDTA 5B3JE 3ESUF 2NR6D 4D9QE 2NY3B 4NM4L 1A6WL 3L6FB 4LPUA 1E6OH 4YFDB 1A5FL 2UVEA 2CGRH 1NLBL 4U0QB 2BJMH 4XCEA 4JLRA 2VDNL 5D5MF 3HKFA 2KUTA 2HTLD 5GGTA 1IL1B 4D2NA 3FQTA 1JVKA 1VESA 3CCHA 3TCLA 1KYOK 4WDIB 3MV7B 1JF5A 3L5XH 2ADGB 3P0YL 3DPBA 2FCBA 4IMKA 1UZ6E 4XCYB 1S9VB 4PGEA 5JXEC 3P11L 3HE7B 1JZ5A 3L7EA 1EHLL 1FRGH 1U36A 1XF4B 4G3YL 2XQYG 3MREB 2DBLL 5BS0B 1BHGA 4OF8A 1L6XA 5D70H 3QWQB 4UT6H 3ZTNL 3OF6D 1KBGH 4AT6B 4KRPB 1NANH 3OAYH 1T22A 3HG1B 4ODVL 1E28B 1ORSA 4JO3H 2NY6B 3MBED 4LBEB 3RJQB 4ODWA 5TF1H 1TVBA 1P5VA 3FT4B 4BUHA 1U8JA 2OZ4L 1RZ7L 5ICZB 1U8NB 5CJ5A 1T2JA 1DZBA 3N1GC 4KZEH 4F8TA 1FL6B 5B38A 2B1HL 3KDMA 1OAXL 4HWZB 3GKWH 2YPKA 3LH2H 4GMSH 3WUWG 2VLLB 4UV7L 2AKRA 3TV3H 1IQDA 1B2WH 1K6QL 3BWAB 2E6JA 1RIUH 4TYUA 2R29H 3LEXA 3X14A 1YEJH 2FECL 1DANU 3H9SD 1J8HA 1WIPA 5L2KD 2AV1B 3FCTA 4OZFB 5EOTB 3VJ6B 4NWUL 4U1NA 1RZFH 1FNGA 4IEFB 4U6VL 3W9EA 4AM0A 2G5BB 3N0PB 2DOCA 2VZVA 3LKPB 4P4KA 3K2UH 4KPHL 2ERJC 1DLHA 2VH5L 4BQ6A 3U9UA 4ZXBD 1A14L 5H94B 1W0WB 1C5BH 4K3JL 3GBNH 1FPTH 4BQCA 2JCCE 3QJHA 4O2FB 1ERNA 1K2DA 3B8SA 4JRYA 4MAYC 1IGJA 3RY4A 1P4IL 3V6FA 1NMCC 2Q8AL 4Y4HC 2ZOKA 3QG6A 5D1XD 4FFWC 1I8LC 4PJGF 3C5SB 2FO1A 3OPZH 5CP7B 3JWDL 5K59F 3KLSA 3RDTC 3HN3A 3O45A 3QRGH 4FTVE 2WP3O 1OY3B 3H0TA 5KVDL 4ELKA 2VKXA 3P4NB 3CVIL 3IDXH 4AIOA 2HVKB 1FBIH 4QRTB 1UXSB 3G5XA 1CGXA 3QUYA 1MCIA 3B5HA 4I9WE 4F3FB 4JKWA 3SDAB 4TULL 1T89C 3IETA 1RIHH 2LU4A 3SDDD 4XVTL 1S7QA 1FFNA 3QNYB 1VACA 2AQ1A 3LKNA 4P46A 4PJ7F 1EFXA 3LS4H 3QNZB 4LRIC 1S3KH 3CFDB 2Z92B 3CH1B 3O8XA 3FMGL 4TUJA 9CGTA 5CEYA 1QG3A 4L29B 4D0DB 1FAKT 1NBYB 3U4BL 4YHNB 5IMMB 5IUSA 4TUKL 1OOAA 5DMJB 1Q38A 5IVXE 3AROA 4OM1H 1V3JA 4MNHB 5KVEL 1WT5A 1FGNL 5D7LB 5DD3L 3MV8A 3U30C 2XTLA 5AG9A 1QTYT 2BCKA 3OWEA 4HPOL 2VYRE 3EYVA 4G6FB 5I0DA 3KPMA 1MCLA 4X6EA 4KKCC 4OSUL 4RISH 5AEAA 2MCPH 2WSKA 3ZO0A 4QOKB 1GGTA 4PRAA 4V2BA 4I5BA 3EDDA 4I3RH 4Y4FC 5HGGS 5DA0B 1JWMA 1MWAB 5J7CC 3PJSB 1SYSA 4P5KA 4Q2ZA 2Y23A 4H0GA 5HHOA 4R2GD 5FV2A 3MJGX 5LBSH 2J88H 3D9AH 3ZE1F 5IKCA 5GRJL 1T7YA 3FKUS 1QLEH 4YWGH 3U4EA 1WGOA 3OR6A 2W60B 4GH7B 4X80H 1RK1A 1KF9B 1MVFA 5BQ7B 1I75A 2APWA 1ZHNA 1AE6L 2AXJA 4K71C 1SQ2N 3C8KA 2P5EE 3ZDZE 5C7XL 4JFFD 1IKNA 3TO4D 1NBVL 1B90A 2EH8L 5DDHB 3QQ9D 5CD3B 3RIFF 5E5MB 3OGOE 3OR7A 4ZO6A 3MV9A 3O9WC 3GSNB 2A6KA 4YHLH 3WUWA 1GHFH 4PLJC 1YEHH 1Q94B 2E6PA 4XP1L 4NN6B 5I66A 2D7TH 4RQQA 2JK5B 2VXTH 1YEFL 2FX8H 2GK2A 2Q20A 3L3HA 4QYOB 4HIHA 2F8OA 3U46A 3I75A 3MJ9A 3Q3GA 5F89A 3BE1H 2BHYA 5MENB 1U8HA 1LO4H 3HMXL 3O6FC 3RWCA 1N6QL 4MQXC 1YNKL 1GH7A 4DAGL 4Z78A 1INDH 5J11C 2N4IA 4XNYH 4IHOB 4NO5B 3NIGE 5GS2D 1G7JA 1YN7B 2KDGA 2WBJB 3SGDH 3P4OA 2ARJA 3LQZA 2QKIB 1MIEL 5D9SA 1IQWH 4K2UH 4WI7A 2B5IB 4JJHA 4N8VG 1J0JA 4OZIB 1CFVL 3P4MB 2ESVA 2HN7A 1NAKH 2PXYC 4KAQL 3O6LL 2ADFL 1RPQA 5HDBE 4FQJH 4G42B 5SV3A 4C55A 4QF1B 3JWOC 3BJ91 3TBTA 3UPCA 3IDJB 5GGTH 4I0KA 4U1KB 3TWCL 4M00A 3TA3D 1X5XA 2YMXL 5IOPB 4HSQA 2BNRA 3NCCB 5EO9A 2VLKE 1NGWA 3WDIA 5IMLB 5IJVA 1IGYB 4RNRA 2BOBB 2GITA 2Y5TA 3ZKNC 4NO0D 5HTSA 4ONHB 2GKIA 1NDGB 4Y16A 5DVNA 4HC1A 3WJLA 5C07A 1FGVH 3BUYB 1CL7L 5DO2D 3UJIL 2YA0A 4MQ7B 1UWXH 4YO0A 2N1KA 5E8OA 2PO6B 4KHTL 2VXQL 4OZGE 1OAUH 3ILPA 4HV8B 5GS1B 3V6OC 2OBGA 2NY4C 4NYLB 3GBMH 5DQ9A 5GJSH 3R8QA 5E2WH 3FTGA 3KXFD 4X9GA 3HPJA 4XNMA 3UO1L 3BXNA 4G8FA 3IDNA 4LPVA 1JGDA 3MJ6A 4Y5VB 1UWGL 3MGOA 5FV1L 3S6CA 5JPMB 4WUUE 3UJJL 1XGTB 3IU4H 1E0OB 4EXPX 4CNIA 3R1GL 5C0BB 1A7QL 4TPRL 5FKAA 5EU6A 4XI5C 4KUCD 2EDFA 1FO0A 2UWEB 3IKKA 4QWWD 1GRWA 4AEIL 1P2CA 4S0TD 1CF8H 2EIZB 5EBLA 2EKSA 2IANA 4NQCD 4NJ9H 1H8OA 4K3EL 1T1WA 3TIEB 2WQ8A 1S7XB 2EECA 5DRWB 1XF2A 15C8L 1CLYL 2H2SC 4Y1AB 1FV1B 4FZ8H 5D1ZB 3V6OE 3MRGA 1ZGLP 1I9RL 4R6UA 4XXDA 4X6CF 5E8NB 1NLDL 1TLKA 5BCAA 3D0LA 2J6EL 3MRPB 2BSRA 1ZK9A 5D72H 7FABH 3B9AA 1IM9D 1MEXL 3LD8B 2YSSA 4UTAL 1BJ8A 2ED7A 1EO7A 2APXA 4KXZH 4PRHD 4OD2A 5I1JH 1KJ3L 2X1XR 1F3JA 3EYUL 3UBXB 1HH9A 1YY8B 4NN5B 5ACLA 2BY0A 5F3BB 2VE6B 3IJHA 4Y4KC 1G7HB 2BDNL 1RUAH 1U8IA 4PJEB 4OZ4A 4HUVB 4HWNA 4LKXA 1N4XH 3BKCH 4OUUB 4CADA 2FB4L 1T03H 2CDGA 5DMGC 5ETUB 5C0DA 1UKQA 4HJJH 4QRSA 1NAMB 3DJ9A 2P43B 4TSCH 3GDBA 2DM7A 4PR5B 3ARFD 3DURA 1C7TA 1CDJA 4JFDD 4PRBB 1NBZA 4GSDL 4O2CB 4RFEB 5I1CH 3S35X 5HHQA 5EG6C 4N90E 1ZSDB 4NQVA 4ZUTB 2EYRA 1MFEH 4WO4D 2R4RL 5I76A 5C0AB 3BVNA 1A2YB 3TPUB 2YKLL 4DVRH 1F4YL 1CK0L 1EZVY 5LAXB 2VJXA 1A9BB