2EDOA

Solution structure of the first ig-like domain from human cd48 antigen
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
121
structure length
121
Chain Sequence
GSSGSSGQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD48 antigen
publication title Solution structure of the first ig-like domain from human CD48 antigen
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 16
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edoA00
1BF8A 4LCUA 4HBQA 4R7DB 4XPFH 2HG5B 4RFOH 4TVPL 2GYSA 5IB1B 3TFKD 4B53A 4ZD3H 4OCRL 5GRJL 3C9NA 1S7XB 2R1YB 2DIAA 2I27N 4ZOEA 1KCKA 4WDIB 5FA4A 4KZDH 2F54D 2FLRT 3MZTA 5EA0L 4EUPG 1VB9A 4PJBB 3BPOB 1J87A 1G7PB 3MLTB 4BSVB 3FQRB 1WBYA 4O2EA 3BAEH 4HV8A 4U6VH 1MCOL 1K9TA 5BMFL 4OF5A 1F02I 1YEJL 3L6FB 4Y2DD 3BWAA 4OM1L 4WU7B 4Z7VE 3I3DA 4K3EH 4X7SH 3WNOA 4PBXA 2RFXB 1MAMH 1JGEA 3T0BA 2BNQB 5JW4N 1PZUB 5FK9A 4BFEA 2A1WL 2A9ML 3LRGA 3I75A 4OZ4B 5KVEH 5TDNA 4FQXB 4W6WB 3SE9L 2AKRA 1MLBA 1T5WB 4IMLA 4MX7A 2MQCA 4NN5B 1NCTA 3FO9A 4NQVB 4ZUSA 1T5XB 2VLKA 4OFPA 4ZOBA 3W9EB 3ULUE 5EU7C 3NH7H 1MSPA 1ZMYA 1IAIH 3P11H 4PGCB 4PG2C 2W9DL 4QRPD 1ITBB 1AJ7L 2NZ9D 2PN5A 1R3LB 4KMTH 5E1AA 3WKMH 4L9LB 2FX7H 3DRQB 4LLUB 2H2PC 3HE6C 4R4ND 1DDHA 4K7PH 3TYGL 3H7LA 1DQMH 5ICYA 1K8IA 3BIBX 1ORSB 2R56H 5DEGB 4APQB 3BD4A 3E2HC 5GGTH 1HEZB 5I1KL 3WS3A 1A3RL 5DQJB 3BXNB 1OSPL 3D18A 5KOVC 3IS0X 4UINH 5DD5L 1NGPL 3EO9L 3VW3H 4DW2L 3T65B 2EC8A 3NOIA 1KUMA 1ZV5A 5J06A 4K9EC 4YAQA 4OD2B 3THML 2Z8VC 2JELH 3O4LD 3QI9D 3K4AA 1FL6A 3CCHB 3FQWB 3PQYB 3O6LH 2W0FA 5SWZD 2MKWA 1HHGA 1NCNA 4DAGH 1YPZE 3KLSA 1DUZB 1BM3L 3IU3A 4HPOH 4CRPA 1Q9OB 4FMKA 3O3AB 3OAZH 2MMXA 3MCKA 4MXWL 4OLXL 4S1DD 4UNVA 3SDDD 1T1ZA 4MXVF 4MGXA 5GSRB 5IQ7L 2ITDA 5DYOB 2FWOA 1UXSA 5C0GA 3T0EC 2XWTB 3QUMA 1N5AA 3ECBA 3T2NL 3H9HA 4K8RH 1EMTL 2HTLD 4MSWB 3MBEC 3UZEA 5BOZG 4MMZC 3F7QA 5FO9B 1T83A 4W68A 1II4E 2I9LA 1XF5B 1E6OH 2FX9L 4DKAA 5DO2C 1MHPL 3MV8A 3HNVH 1EHNA 4JFPB 1FQ9C 2EIBA 2VDOH 4TUJA 4ETYA 1YQ2A 4QYOB 1AY1H 1N59B 3FONB 2VWEC 3GSOA 3FB5A 4LSPL 4PJ9D 3IFNL 1YNTA 5FO7A 5MERA 3LRSA 3VXOA 3MRDB 3QIBA 4WI2A 5HHOE 2DQTH 3BP7B 4JHAL 4H25A 1EFXA 3LZFL 2A77H 3MLVH 3S5LA 3A6BH 2R8SH 4OT1H 4HIIB 3CVHA 1BREA 1G9NH 4N0CD 4BZ1L 5H37G 5T3XD 3EYVB 1KELH 4YX2L 4Z5RA 5H94B 1N7ML 3UJTH 4I3RL 1N2RA 3A0OA 5JR1L 3IDMB 4R4BA 5DFVD 3QRFM 2OR9H 5D7IB 2X4SB 2GSGB 1ND0A 3NCMA 1QFWM 3NFPB 5ITFB 3RZCC 4UU9B 3VI3E 5EOTA 3I3EA 4JM2D 1RHHA 4OSUH 3SN6N 3MODH 3N9GL 2Y9RT 5KTEH 5HYJA 3TNMB 4IRJA 3QPXL 1T2JA 2D03H 2VLLA 4RFEB 3HUJF 1EO5A 1G6RB 2RCSL 4ZAKB 4MQXC 4PRHA 4OFIA 2FATL 4GAYA 1HIML 1SYSA 5FKPB 1MWAA 3LRHA 1ZWIA 4MNGA 5JUEH 3BEWA 4WWID 3FQTB 1UZ6E 4L4TE 5DA4A 3VWKD 1FP5A 2AXFA 4B7IA 3TZVC 1J0ZA 4M1GH 4ZTOH 4HWBL 2V2XB 3BMVA 4P2OD 2VDLL 1FL3A 3IDNB 5E4IA 4Y4KA 5IM7A 3RPIB 4KY1H 3E6FB 4M1DL 3OR6A 4OZGA 3KPRA 3FQXA 3CXDL 2IAND 4JQXC 2HN7A 5I1DA 1TVBB 4JO4L 1LD9A 4F7EA 5IVZB 2GSIA 2HH0L 3V4PH 4F9LC 4U0RB 3MRRB 4N0YL 2R29L 4WFEE 4L9DA 1QO3A 3RX5A 2VR9A 3PP3H 3QXUA 3T0XA 3RWFA 3FN0H 3MCG1 4JFFB 4M8QA 4M93C 4G9FB 5AD0B 5JIIA 3HG1E 3QB7C 5DMKB 2IQAB 2BJMH 1T2QH 5JA8B 2KZWA 1D6VH 2AK4D 3HPLB 3S8WA 1NEZA 1QHOA 3HZKA 4KTYA 3CC5A 2WV3A 1C5DA 3D2UD 3B8YA 1XF4A 3H9SA 4K07A 1G7IA 4ACPA 3ARBD 2BVYA 3HC3L 3WIFA 1MEXH 3DVGB 1W0WA 1YNKL 2VSCA 4XPHL 4DFIA 4JO1H 1I9JL 1R5VA 2BRRH 4HK3N 5I17A 5C0CA 5GGRB 5IVXF 3GB7A 1U3ZA 5MENE 1GZPB 1EBAA 4D3CL 4DTGL 3GGWB 3MGOA 1NBYA 3KWWA 5I15L 3VXME 3C6SA 3W5NA 4IIQA 5E5MA 1D9KC 3EHBC 3DROB 1ZLUH 1D5BA 3BDBA 4OQTL 3RVXD 5INCB 1W8OA 1XF3B 2R0KH 5HJ3B 4G8IB 1ACYH 1A4KA 1RK0A 2QTEA 1R3HA 3VD3A 1KSRA 3ALWA 5K9QG 4WUUB 5H35B 1BIIA 5CIPB 5I1EL 1CGYA 2GJ6B 1DP0A 2QSVA 3FOMA 1HH6B 5C7XH 1IKNA 4PJ5B 3VJ6A 2GUOB 3GEWB 1MNUH 3GMLB 4IOFC 4RAVA 4WY7L 4E0RA 4CVWA 1U58A 3QFJD 4XPAL 3T2QA 3QFDB 1ZLVH 3MC0A 1URLA 2R2HB 5I1HL 1P7HL 2DQGL 3GMNB 3KYOA 3IVKA 4NQCE 4HWEH 1N6QL 5TQ0L 2RAMA 2F5AH 1BD2D 2H8PB 5IBTL 4YBLC 2D4FA 3QCVH 1U3HD 1PKQE 3QCUL 3U2SA 2F8OA 3VFWA 1PEZA 5TE4H 2QV2A 5KG9B 4QO1A 4BKLB 4TVPE 4Y5VB 1OPGL 5IHBA 2AV7A 1FLRL 1TZGL 4B5EA 5B3NA 4ZUVB 2CDFA 2F54E 2EDDA 3X11B 2F53A 1CGWA 2BNUA 3EYQC 4Y0GA 3QQ4B 4YHNA 5D6CB 4A2MA 1XIWB 2CR3A 2M26A 1ORQB 3F7RA 2VQUA 1QLRA 2A9NH 2VZOA 1UM6H 1KYOK 2HT2C 3VFRA 3CD4A 2C1PA 5J11C 1BJ1H 3ZO0A 3AB0B 5FUCE 1CDJA 1RY7B 3CLFH 1E4JA 4FP8L 3LDBB 1E4XH 1KN4H 2M2DA 3TPUA 5ALCH 2Q7NA 3GRWA 1VFMA 3KLAB 4JZNB 4JCMA 1IFHL 1PW3A 2XXMB 1G9MH 2RGSA 2VABB 2CIIB 1L7TL 1A6VH 3BKYL 5EBWA 5E03A 4X6DE 3NBNA 4GRMA 2V17L 2W60A 5EO0B 2JE8A 4JFZL 3E0GA 1BECA 4TVPH 2ZCLL 4QRPE 1HXYA 3UMTA 2ADGA 3VFNA 3PGDA 1WAAA 3EOTL 4OCRH 1JHLH 4PY7B 4OZIA 3SKNB 5AZ2L 2BNRB 3S98A 4NKMA 3SQBA 5MEPA 4GG6F 1S7VB 2EXWD 1A22B 1LK3L 1JPFB 4IDJL 5TQ2L 2QKIA 1UXWB 4OF3A 2GKIA 3PHOA 2DKSA 1KGCD 5ESVB 1MCOH 2EZ0D 4JG1L 3H7BB 4PJHA 5BMFH 2BNQD 4UTBL 3VXPA 1DBJL 4MCZB 1XR9A 1YEJH 1AP2B 3L7EA 4OM1H 4FQXD 3MMEB 2FJHA 1T1WB 2K7QA 3WYRA 2CLRB 1UACL 1ZHBB 3MV7A 3O4LE 4TULH 3MR9A 1NMAH 4R2GC 2A1WH 2A9MH 1D5ZA 2BY2A 2MQ3A 2XY1A 3ROOB 5SWZE 3NIFF 2OR8A 2XQBL 1AXTH 3TJHD 4M6NH 2E5EA 4MNQA 2UWEB 1BVLA 3QO1B 1BOGB 3SKMB 3RTQC 3V0WL 4U1KA 2ZSWA 4JAMA 3U36A 4L29B 5D7LB 2YUVA 5I18L 1ZVSA 3JWNC 1M71A 2YN3A 5DD1L 5JIPA 1H8NA 1HSBB 1YZZA 4PY8I 3T77B 2W9DH 4U3HA 1AJ7H 1DZBA 2WMPA 3VXUB 5DVKA 4C56B 4OGXL 2D7QA 4X4XA 4APQD 3IJHB 2OXGA 1J0KA 4FA8A 3HE6B 3UYPA 5FM8A 4JANB 1NMCC 2C4FT 2BVTA 4AENB 1UFUA 3H3KA 1RI8A 1SMOA 1MI5A 5I1KH 3E2HB 4LMQE 4MCYB 3VRLE 5EOQL 5CEXB 4S0TD 5DZLA 1OSPH 2CIKB 3BFOA 1P2CB 1U3YA 3MQIA 5EZJB 2IH3A 2CQVA 3K3QA 1NGPH 4U6HB 3EO9H 4GFTB 2DLIA 1DVFC 3PQYD 3SDYL 4G8FA 1MCEA 1ZT7A 1YDPB 1OAUL 2NW2B 4PJDE 1JTTA 3THMH 5E70A 1F5WA 3CFJB 5C0BB 4PB9L 2BX5A 3D0LA 1X5FA 2EDBA 2XRAL 3WIIL 3F5WB 4JDVA 5JQ6L 3OXRA 4Q58C 4AK1A 4JY5L 3NPSC 5KANI 5F7FA 5EFIA 2Y5TA 5KOMC 2XWJB 3ZE2F 4OLXH 3QIWA 4YDLC 3EJJX 5F1KC 2X9WA 4KQ4L 2B0SL 5CJXA 5C86A 5IQ7H 3OHXA 1CYGA 3ZYJA 3HNTH 1U8HA 1JBJA 4NGHH 3QH3B 3CMOL 3T0EB 1P9MA 3VXSA 3T2NH 4LK4A 3SBWC 1EMTH 1A6WL 3MBEB 1JN6A 4LGPB 1K3ZA 2EKSB 5IFJA 5FB8A 4YBQD 5F1OB 1GC1H 4PRBB 2FX9H 1HILB 1MHPH 4X5WB 4LSRL 1ZS8B 3UTZA 1GOGA 2XKNB 1VGKA 5J6GB 1P7KA 4WWKA 5GIRB 2VKWA 3IFNH 5CZXD 4FQIL 4ZNCD 2NX5B 2E8YA 3JWDC 4JHAH 1E4WL 3PV7A 2XA8L 1ZT1B 3LS4H 4MQ7A 3C8DA 1KG0A 3G6AB 1HYSD 5ACZB 3CPLB 2AP2A 5T3XH 3MLXL 2R9HC 2YA0A 5LQBL 2V2WA 4XMKL 2NY0C 1FNEB 4GW1B 3U9PL 4BZ1H 4DZBB 2JB6A 4QXWA 2APTA 4YX2H 2IWGA 2OM5A 4Y16C 1T03L 1EHLL 4NWUL 2XPGA 4I3RH 5JR1H 2J4WL 5IVOA 3WEXB 1NAKH 2FLBT 3L3HB 3VXQA 4KDTC 5EULV 5DJYA 4L1DA 4PRAB 3RZCB 2XY2A 2IANE 1G1CA 2H32B 3BESR 1NCCL 4MWFA 1CK0L 1DBBL 3L3JA 3PWNB 3LQAL 1FRGL 3MRFA 3QEQB 3H3BC 4ZAKD 4YE4H 1S78C 3S96B 3BH8B 1D5XB 3QPXH 5KS9A 1GZQA 2FHFA 4MXQD 4YK4C 3U48A 4MB5A 2RCSH 3M07A 4ODSL 4H0HB 5HHPB 1EAPB 4FQCL 2FATH 4LDLB 1MVUB 5K9KB 1I1FB 1HIMH 3RWHB 5L88H 4Z18A 4U6XA 4W4NA 3BIAX 3MGTA 3TT3L 2DJ4A 3LKNB 1UEYA 2HYMA 4QT5B 2AK4E 5E8PA 4PTUB 4JRXB 3W9DB 4UOW0 3TN0A 1S3KL 2B7DT 1RSFA 3O6FA 3CH1B 3TZVB 1MHEB 3OKOA 6CGTA 3M17B 4P4RA 1A5FH 4JZOA 4RMSA 4XVJH 5BVJA 4ZO6A 4PREB 3M1BB 5DK2B 4YEFA 4PJGF 3B2VL 3DUSB 4UV7L 4EN3A 3OKEA 2X7LB 1NCAL 3U4EB 1QQDA 1C12B 5GGQH 2YA1A 2CXKA 2VIRA 4P9ML 4X7TA 5E9DA 3CXDH 2H41A 4GKSA 4CN6A 1T22A 4OI8A 1Z9MA 1EVTC 1XGRA 2AI0H 5E1HB 3D69A 4JO4H 3IDGB 4LCCC 2O61A 3EIFA 4X5XA 1Q0XL 1IGCL 1T4KA 2RJMA 5J6HB 4JFFD 1Y18A 2HH0H 3OMZA 4N0YH 2R29H 4L4JA 4W4OC 4G9FD 1RJYB 3WSQL 4WHCA 4ZNEE 5EO9A 4OI9A 4YHOL 1WK0A 1XF1A 1F90L 3QWOB 1ETZA 4M7ZC 2WBWB 3ARWA 1UH4A 5HI5C 5HGAB 2P46B 3QIUA 1W72B 4M93B 1JNHA 4DZ8B 4BM7A 3C60C 4LNVA 1O7SA 4UMGA 1I9IL 1A9BB 4G80B 5JLZA 2OK0H 1FIGL 5C1MB 1A1MB 3G04A 3VXRB 4X9GA 2VLJA 3V9FA 2B1HL 3SDAA 3V8OA 5KVFL 5E94A 3VCLB 5J0BA 5HDQL 3HC3H 4NPYB 1YNKH 2GITA 2CK0L 5DC4B 4POZC 4XPHH 2OSLB 3PHQA 3UP1A 3WIHL 4M7KL 2WAHA 1Z9LA 3GHBL 4X99A 5FHAL 3V6ZA 2EC9T 4ELMF 5I8KL 4HS3A 1VKXA 1CT8A 4AT6A 3VFMB 4LHUB 5CBAB 5JHDA 2HJLA 4D3CH 4DTGH 2ENSA 4QOKB 3EDFA 3GI8L 4R0LA 5I15H 3QJHA 4OF7A 4F33B 5J1TC 1M7XA 3FB6A 3MA9H 1OB1A 1LE5B 1D9KB 4WUUD 3WS6C 2X10A 2GJ6D 5HVFB 3PGFL 4LSSL 4PJ5D 2DJSA 4HHAB 1T3FB 3VFVB 4ZUWA 5SWQA 2DWDB 5I1EH 4I0CC 5L2KA 3Q3GA 4E41A 4V2BA 3PJSA 2CPCA 4EI6A 3BPCB 4WY7H 1OGAA 2GQHA 4XPAH 5K9OB 5GRWA 2YSSA 4CMMB 1DEEB 5I1HH 5HHVH 5HHNB 2BSRA 1RZGA 4XB7A 4CN1A 1N6QH 2IBZX 3LY6A 3JUYA 4ONGL 5TQ0H 4KRPC 1WBZB 5DK3A 1MRFL 5DUBA 3EOBB 4YBLB 4L3CA 3A6OA 5EOCL 3OKNA 3QG6B 3QCUH 1BBJB 1J0IA 1XAUA 3WUWB 3PWLB 2H45A 3W0WA 4MAYC 4PJBE 1YY9D 1OPGH 4Y88A 1XIWD 3QQ3A 4I3SL 3ZHLA 2V5MA 3CX2A 3LKQA 5KSAA 5HGHA 1J7VR 1T66D 2LAAA 1EERB 3T8XA 1EA9C 3CZFA 3TYFB 4KV5F 1YEDA 4D9RD 5T1DL 4KMQA 1HHIB 3BUYA 4RGMC 5HYSA 4OZFB 4V1DA 1T1XB 4GBXA 2BNQE 2Y7QB 4RZCB 1BQHB 4Q9CA 2FL5A 4UDTB 4YDVA 1OTTD 1OOAA 5J11B 4PS4L 4HDIA 4X7FC 4GOSA 4PJAF 5D2NB 3MYJB 4U7SA 2ZWLT 2B5IC 1B0GB 3D85B 2P8MA 5EU4A 3REVB 1S7WA 2EICA 1JPGB 5ADPL 1IFHH 1A7PH 2E9BA 4NT6B 2ZG3A 2UVFA 3BKYH 3TCLB 3C8KB 1MCIA 3W2DL 3E3QC 3VE0A 2BNRD 2V17H 4TNVF 4XVTL 3LV3A 4FFVC 4WI7A 2B39A 3IDXL 3UYRL 2HJKB 3I02A 3HS0A 2Z93B 4QXTB 3FHQA 3QDJA 2HFTA 3CFDB 5AZ2H 1A7NL 3HUJB 4ZXBA 3VFSB 2R4SL 5KAQF 5IG7B 5BO1L 5L8JB 4IDJH 4AL8L 5TQ2H 3MV11 5BZDA 4IMKA 4N90E 5F70A 1I9EA 3E6HA 2J6EL 4JG1H 3EJYC 3RX7A 3HE7A 3PQYE 1N64L 4DGVH 3AMKA 4HZLA 4G6AC 3NFSL 3KPTA 1AGBA 4H26B 4KK5C 2QJDA 2R2BA 4ZPVB 4JFYB 3GSXB 5D7LD 4R2GB 4N8VB 1YEGL 4MA8L 4WHTA 2XQBH 3V6BR 4C4KT 4LASH 1RJLA 3C5ZA 1KJ2B 1QFWL 1ZLWK 3RTQB 5HVWA 3VXUD 3GMOA 5IKCB 4NCC2 3D0VA 1LP9A 5D4QA 1FZOA 4NKIL 5D1QA 1JWMA 4JFOB 5DD1H 5TDPA 1DE4A 1U2CA 2H2PD 1MCFA 3HE6D 2WUBL 4H5SA 5I0DA 2CKBA 4JRWA 3UBXB 1KJMB 2P24A 3PUCA 5CAYB 4OGXH 2XZZA 3QUZC 3S35H 1R3KB 1QKZL 2XNAA 5BXFA 3I84A 3RUGA 1NMCB 4KDWA 4NQEA 3BGFC 1ZANL 4OGYL 4JN1L 4PP2B 4DGIH 1HHJB 3WKNA 3C08H 2BY3A 4LF3B 4K9EL 4NRXA 1UCTA 5I8EB 1NUFA 2DTMH 5C0BD 2D9QB 4BELD 3BZDA 3O8XA 1DVFB 4OFVA 3U7AA 5I19L 1OAUH 3MRHB 1NFIA 4H1LB 3RJQB 1A1NA 1I85A 3V6FB 4PB9H 2MQ0A 5DRZA 1CN4A 2XRAH 3EYUL 3WIIH 5JQ6H 5D96C 2FYYA 4UBDC 3MJ9H 3FRPA 4RNRB 2FJGB 3KS0H 3NPSB 4ODUB 1X5KA 3FOLA 3RPKA 2QHRH 3J8F7 5HPOA 2VDNH 4XNZC 3G5XB 3HN3A 1I1AA 3T0ED 4I48B 2WBJA 3DXAA 5IVXB 1HHHA 3ZKNC 4YDJA 3V5KB 4OB5L 3RNQA 3MBED 4M6AA 2YPKB 2AJYL 4YDLB 2NQCA 4OZGF 2B0SH 1TTGA 4QCIA 1N3NA 4Q0XL 2BSED 5HYFA 1WC7B 4PJEA 5DZNA 4I0PC 1A6WH 4NUGL 4YFLI 2ZKHL 2NW3B 1T0NB 3KXFB 4KKLC 3K2MC 2VRAA 3EAKA 3OJVC 4LSRH 5ILTH 2NNAA 2C7UB 2NX5D 2FBOJ 2JIXA 1INDL 1PZ5B 1JGVL 3I85A 1YA5A 4OF8A 3WE6B 5C0EA 4HMCA 4F8QA 1AD0A 4R90L 1KNOA 1E4WH 1OLZA 4RCAA 5ID0A 3FZUC 3MRLB 5GGVL 2BMKB 2VDQH 2OX5A 1KF9B 3VWJA 4DJMA 3J7HA 2Q87A 1NCUA 3SKOA 4GKNA 4HUXA 5LQBH 4ORGB 4XMKH 4U2YA 1U8PB 2NY0B 3LKSA 3U9PH 4G43A 2OYPA 3VFUA 1QVOB 2ZUUA 3VH8G 2FB4H 1T03H 3FB7B 4Y16B 3KNBA 1EHLH 4NWUH 1CBVL 1XGTB 1FFPA 3OXSA 3L5WB 2J4WH 4ZFZA 5FF6B 2MTPA 5CCKH 1RK1A 4P5MA 1P53A 2BHYA 3QEQD 4FTVA 4KTDH 3GIVA 1DQLL 5ITBL 1G6RH 2P5EE 3ULVF 3MO1B 3IKKA 3NFNA 1NCCH 1PG7H 5ENWB 3LQAH 1FRGH 3ZYZA 3I3BA 5J1AB 1AIFA 2PXYA 2WWKT 3QSKB 2HVJB 3MOAL 3HAEB 4JFXB 4LSDA 4MQXD 4LKCB 2BHZA 4F7TB 4JFFE 4NUJB 1IQWL 1CD9B 2VL4A 5DD0H 4YK4B 2OQJB 4ODSH 1NAMA 5EZLB 1IEHA 4F80A 1DN0B 4JZJA 1IVLA 4FQCH 5DRXA 2Q7YB 4JRXD 5KSUA 4ZFFB 2AAVA 3O3UN 5TFSH 5F3BB 1H8SA 1MUJA 3TZVD 4NHCL 3GSRB 3WHE0 3TT3H 5JOFA 1X5XA 4MYWB 3P4OA 1JYNA 4WHDA 1CFTA 3AROA 1FGNL 2ZSVA 4XAWL 4XWGH 5FHBL 1KTKE 5LGJB 5AUMA 5HXMA 4QXGL 4CVXB 1CFNA 3OPZL 3MRJB 3KYNA 3BYYA 4Z7NF 2G5RA 3MBXL 1CU4L 3B2VH 1F3RB 1TETH 3X17A 3IDIA 4YR6A 4GXUM 3LKPA 3BW9B 4P3CL 4NO5A 2N1KA 5J13C 4GG6B 3BIKA 6FABL 1OSZB 5EBGA 4HT1L 2YK1L 5D7KD 4Y8DC 5C09A 2FIKA 1KPVB 3KS0J 3TWCL 1EJOL 2GTWB 4LCCB 4KU1A 4EZMA 3QDGA 4RQQA 3QIBC 4WUUE 3KPSB 4KJQC 2FEEI 4HIEA 2N7AA 4YIQB 2GJ6E 4JO2L 1DTUA 3WSQH 4UT7L 4YHOH 5I73C 4PJ5E 3X12B 1F90H 2HFFB 4FXGB 3CMGA 4NQXB 4OV5B 4M7ZB 1FN4B 4PGBB 1I7ZA 5TDOB 4KI5F 3W5MA 1QSEA 1A6TB 5D1ZC 3VDAA 4PG9A 3VXRD 2BCKA 4KZEH 4NC1E 3KPPA 3PV6B 4E9LA 3C60B 1DLFL 2MCPH 5J9PA 1FFNB 1FFQA 1IGIL 5IJVA 1FIGH 5DRNA 3JXAA 1A7QL 2B1HH 5KVFH 5HDQH 4M6OL 1WWCA 2Z31A 5MHSD 1TQBC 4LHUD 5ACLA 2CK0H 4HMDA 4HKZA 1IGML 3WIHH 3DWTA 4M7KH 1JPTL 4J12A 4QOKD 1GYAA 2EEDA 3GHBH 5FHAH 2KZ1B 3MRIA 2OCFD 1WAAF 1D9KD 3EHBD 4OZIF 4YUEL 3BP4A 5DZOA 4PUBH 3RGVC 2EYRA 2SEBA 2G5BA 4QRRB 3GI8H 3TBYB 1KCVL 5CIPH 5IMMA 2IPKA 1CXIA 2ESVB 3IKCB 1U95B 4XP5L 3D9AL 1A0QL 1HXMA 4CGTA 4NO2B 3DLQR 3I6KA 3MLSH 5CEYA 1X6NA 1N4XL 3MRBB 3PGFH 4LSSH 4D9RE 3GSQB 1NBQA 4RBPH 4JFEB 1ZAGA 3B43A 4MJ5A 2YC1A 4IOFD 4PLJC 5T1MA 4PJHF 4F7CA 5F8RC 4TQEL 1UWXK 4LLDA 4PP1C 3MNVA 4Y4KC 1C7SA 4QTIL 5ICZB 4FQJH 2G60L 5DT1H 5EWIH 3HR5B 4F58L 1WGOA 1UYWL 5C0JB 1CQKA 1KN2H 4IOIB 4ONGH 1FVDB 4NKOA 1YN7B 4KRPB 2LFGA 2VERN 2G75A 4R6UA 4ZFOB 3I6GA 3R8BB 4HFWA 4AEHL 1H3GA 2B2XL 4E5XA 3NA4A 1JTPA 1YNLH 3EYQD 4GXUN 3GSVA 4MAYB 4X80L 4W81A 4I3SH 2ITCB 1MCPL 5L9DL 4LLMB 4JFDA 1CD8A 1FE8H 3GFUA 3TBVB 4YZFE 5AAMA 1KJVA 4J23A 4U1SA 4UT9L 3RWIB 5JIKA 2BFVL 1DUYA 1CFQA 1V7ML 3CSBA 3IDJA 2HT2D 4AZ8A 1B0RB 3V0VA 5BCAA 4H8WC 1I3RB 5T1DH 1XH3B 5CP3A 4M3JA 4G42B 4A6YL 4P2RA 4RGMB 1F6FB 2FR4B 4JN2A 3BHBB 3GO1H 2E6PA 1Z5LA 1K4CA 3SGJA 2E9WA 3IS1X 3DGGB 3GUTA 4IEFB 3ILPB 3D85D 3WXWH 4XNQA 4PS4H 4PIRF 2I5YL 1KFAL 3QEHB 3P9WB 1VFUA 2UWEE 1YUHA 4EQ2A 2B5IB 4F37K 4LPXA 4YFEA 1MJJB 4YLQT 3QUKA 4NO0A 1QP1A 3T2PA 3HZMB 4O2CB 3JWOC 3VXUE 4C56E 3W2DH 1AO7D 3ULVC 3OWEA 2R2EA 5JPMB 3V6OA 3IDXH 3G5VB 3FO1A 3Q6GL 1LK2A 4IIQC 1CTNA 1IC1A 2DQHL 2C4XA 1UQSA 4PRPB 3T1WA 4WCYL 2ZOLB 4BSWB 3NIDE 4YO0B 2R4SH 3LKRA 4KAQL 5BO1H 4GT7A 2R0LL 3MRQB 4AL8H 3MV9A 4XPBH 5DVOA 3IFOB 1BGXL 2NY6C 3T2OA 5C0DB 1IKNC 2HVKB 4J6RH 2DF3A 1S5HA 2J6EH 3HB3C 3OKMA 1QFOA 3GMRB 3FT3A 4O02L 2ORBL 4R2GD 1EBPA 1N64H 1KJ2L 4CJ1A 3NFSH 4B50A 3IAQA 4QWWC 5EC1A 3PWJA 3LMJL 1CXFA 1DEDA 1B4JH 1HH9B 3MUGB 3RTQD 2EYSA 3T4YB 2V7HA 5BS0E 1LHZA 1SEQL 3BI9X 1YEGH 4PJGB 4MA8H 4QHUA 4OCXL 4F8TA 3B9AA 3OKKA 2YD2A 3U7WL 1ZVHA 3T0EE 1AXSA 5ELIA 2DL2A 3SY0A 1JE6A 4PGDA 4P46A 1HCVA 4JGUA 1T7VA 5DJDB 4FFYL 1JF6A 4QNPF 1WTGT 1K2DB 4OIAA 4P5TA 3IETA 1NCDH 1P84J 3WDHA 5JXEA 4JY6B 3L3GA 3QUZB 3GDBA 2A73B 3P30L 1TXKA 3LIZL 4JKKA 4DN4H 1AGDA 2JJSA 2BY0A 3DGCR 3R8QA 4R7NA 2ZUTA 3CFIC 1ZANH 3BGFB 4OGYH 4JN1H 2V7NA 5CWSA 4KI5C 5KS9F 2HTKC 4IRSA 4K9EH 4MS8C 1DVFD 2G9HB 3MXWL 5GJTL 3FRUB 4OF6A 1LO5B 2A0LC 1BQSA 4JJ5B 4AM0B 5C0IB 5C0FA 3IJSB 4OV6F 3HI6L 4HJJL 3WXVH 2EXYD 4DVBA 4PRDB 3ZDYE 1OARH 3UTQA 5HDBE 1I1CA 2OR7A 5C0RL 5I19H 2CUMA 4MHHI 2DOCA 1NDMB 1YYML 4LCUB 5E7FA 1FO0A 5D96B 3D6GA 2NXZC 4UILL 1I1YB 2IBZY 1AKJB 3C2AH 1H9VA 3PL6A 4ELMB 5IMLB 4XNZB 4R4FH 1OAKH 1IGFL 3C9NB 3QUYC 5FA4B 1I75A 5GGVY 3QEQE 3KXFD 3TA3A 3W39A 4Q0XH 2ZZUT 5HYQB 3I6LE 3GMQA 1HKFA 4WIQA 2AJUL 1WEJL 1QFUL 4I0PB 1WBYB 2ZKHH 4O2EB 2WUCL 1B4RA 4U1HA 3SO5A 3OBAA 4J3XA 4QLRA 1MFNA 3OF6D 4NP4L 3VA2C 2CKNA 5DEFA 1INDH 3BWAB 1LEKA 4HJGB 1NPUA 5E2UL 1BF2A 1C08B 4S1SL 4JRXE 5FO8A 1JGEB 4R90H 1MY7A 2BSTB 4Z7OF 3ULSA 3PWPE 2R9HD 4HFUL 1TQCC 3FTGB 5TDNB 2NY0D 4KUZL 3T3MF 2AKRB 1MLBB 4IMLB 1XCTA 4MX7B 1BJ8A 4N8PA 4Y16D 2YD3A 3FO9B 4ZUSB 2VLKB 1ZGLA 3QUXA 4FOMA 4P9HC 4OAWA 3QO0A 5DJCA 1ZA3A 5D70H 2H32H 4XCCL 2DI7A 2JJWA 1CBVH 3CFBA 5D9SA 1KIQB 1BFVL 1OP5H 5IFHL 1YPZA 3S4SA 4ZFGH 5IOPB 2R23A 3UZVB 1S7TA 5SX5K 4WGVB 2WLYA 3P4LA 5ITBH 5D7KE 4XNUH 4OGAC 1GJIA 2EDNA 4JLRB 4XBGA 3D18B 4HX1A 2E27L 1VADB 3OAUL 2RB8A 3NCJL 3AC0A 1IQWH 5A1AA 4HIXH 5DI8A 3C2SA 4PJAB 5F7UA 4YAQB 2C3VA 5BQ7A 5JOEA 3QG7L 1FL6B 4U1NA 5GS0L 4QRTA 2MNUA 2YRPA 1RVFL 3RP1A 2OL3A 5DFWH 3VXRE 2GCYA 1HHGB 5EUKA 2DN7A 1GVIA 3P73B 5DS8A 1FGNH 3IU3B 1RZIA 4XAWH 5FCSH 5HHOA 5FHBH 1L7IH 3I9GH 2A6IA 4JE4B 4HUNB 1T1ZB 2VXUL 1OT2A 5CJXC 3OPZH 2ITDB 1UXSB 5EZOL 1JYWA 1KTDA 3MBXH 5MHSE 4HQQL 1JPSL 1CU4H 3QUMB 2Y1VA 3GKWL 1N5AB 1D7FA 3ECBB 4YHKL 5HI3C 2VB5A 3H9HB 2ICES 3IGAB 5BV7C 5J13B 4O9HL 4M48L 1CZ8L 1MQKL 2I9LB 1JGUL 4DQOL 6FABH 4HT1H 3KPSD 2YK1H 2OS7A 3MV8B 2FX8H 1M6OB 4TUJB 2W59A 1QFHA 4HC1H 4WWKC 4X6CF 5FO7B 3DSFL 5JHLH 1YNTB 3TC9A 3LRSB 3VXOB 4K3DL 1NDGB 4R26L 3QIBB 1AQKL 3OKLB 4JO2H 4OUOA 5BVPL 1LO0L 1N8ZA 4H25B 1EFXB 3KPMB 1CF8L 2C9AA 5I73B 1HCFX 1MFAH 3S5LB 1MCCA 4FQ2L 5C07A 2J8OA 4JFHE 2A6DA 3CVHB 1T04B 5D1ZB 4CVUA 1G7MA 4MXVE 2R1XB 4JREC 2IADA 2HKFL 2PNDA 5EUOA 4GKOA 5IESL 4Z5RB 1MY5A 2NY5C 1DLFH 2IG2H 4U7KA 1IGIH 2XKSA 1AGEA 5CGTA 1N2RB 4R4BB 2V5SA 4POZD 5I2IA 5B4MC 1A7QH 5EZIL 4KXZI 4M6OH 4L4TA 2EDWA 1ND0B 3SOBL 4D9QE 5EOTB 2XN9B 1TQBB 2EDJA 4I77L 3P2TA 3BP5B 1IGMH 2Q8BL 1RIUL 4BQCA 4QRRD 1QACA 4QXUL 1J1XL 4RRPG 2ESVD 2RQ8A 1BFOA 1UM5L 3WD5L 5JORB 5HYJB 3D39A 3N1GC 1RHFA 3BDYL 1OY3B 3MLUL 3MSPA 4YUEH 4BH7A 1BQUA 2AEPL 2VLLB 5C8JB 1F3DJ 5ALBL 3RGVB 4DGYH 4JFED 4XP5H 1ACZA 4PRHB 5GRUH 1OAXH 3FO2A 1SYSB 4N1HB 1N4XH 3HCVA 1ZWIB 4MNGB 2DIBA 1F13A 3BEWB 3BQUA 2EDEA 4ODBD 4DOHE 5HI4C 4Y4FA 1JZ6A 3K4ZA 4K3HA 4TQEH 4LEOB 4HH9A 3HNSL 3TN0C 3UTPE 3EOAA 1DQQA 3O6FC 2AXFB 3LN4A 4RGOL 4AG4L 1YN6A 4JPVH 1FL3B 1OT1A 4ZFOL 3PP4L 4KRPD 4Y4KB 5IV2A 4QTIH 5IM7B 3F62A 5DHVA 4EN3C 4F58H 5A40E 4YHZL 3OR6B 4PV9A 4DVRL 1UYWH 1HZHL 2EDYA 4OZGB 4OLVL 2VXSL 3KPRB 3WFCL 4MAYD 4PR5A 3FQXB 5ESAA 2EE9A 3V2AR 1LP9F 1BAFH 5I1JL 3HUJE 4MJ2A 5I1DB 4QY8A 4MAUL 5F7YC 2QR0A 4JQIH 4X80H 1JMZA 2YPVL 2CRYA 4Y1AB 4L5FL 4BUHA 2GSIB 3NCBB 3HTLX 5L9DH 4OZFH 4X7CC 5DVMA 4F37F 3L3KA 3PDDA 1QO3B 4N0UE 3C09C 3RUGF 4UT9H 3NACL 2BFVH 1OCWL 3RWFB 2VH5H 3HRZA 2FO1A 4M8QB 3M8OL 1FZJA 3QIUC 2QSCH 3VXMA 5C70A 5FECB 1TVHA 1RD6A 3HZKB 2X4QA 2UYLA 3CC5B 3OL2A 3H9SB 1XF4B 2I26N 2VXVL 5GSVA 1R5WA 4O4YL 1J05B 2I5YH 3DUUA 3PXJA 1KFAH 3SDAC 5E2TL 8CGTA 3QQNA 2ED8A 4HBCL 1IKFL 1W0VB 3WIFB 4KHXL 4Z78A 1YEKL 2BC4A 2D9CA 1JHKL 2DBJA 3CSPA 1IL1B 4MMXC 3CGTA 4ODHL 1KULA 4FFVD 4KJPC 5GJSL 3AM8A 5I17B 1FZKA 1DQDL 3GB7B 5LWYL 5I9QC 4PRPD 1SVZA 3MGOB 4R0LC 3Q6GH 3VU2A 2GK2A 4IIQB 4YH6A 5E5MB 3KYKL 5HDLA 5DSCA 4LCWE 1P7QA 1Z9OA 2DQHH 4O2FA 4PJEF 1PKQA 3WDJA 3KJ6L 4CVZA 1INQA 2AJVH 2CLZB 1A4KB 4KAQH 1RK0B 4OZHE 3RWDB 1R3HB 2R0LH 3EJYD 1KACB 4R96A 3RAJL 3FB8B 1RIVL 2Z35B 2HLAA 4PGEB 4X7DC 1IEAA 5IMKA 4HUVA 1NKOA 1VDGA 1BGXH 1FH5L 1YYLL 3FOMB 2NY6B 4G6AD 4UT6H 3VJ6B 4RAVB 2YA2A 1QBLH 1U58B 4KK5D 2ORBH 1CXKA 1KJ2H 1M7DA 4M43H 3F7PC 1EUUA 4TTGA 2HFEA 3IVKB 3MRGA 4LCYA 2FH8A 1JZ4A 1SBBA 3OAZK 3BN9C 3K4DA 3H8NA 1DBKL 4JHWH 2YBRA 4OCXH 3U2SB 4KRLB 4RX4D 3QDAA 4NWTL 5F89A 2VXQL 3VFWB 4I4WA 1AFVL 3U7WH 5FCUL 1DANT 2AV7B 3QUZD 4RDQF 3AU1A 5E6YA 1UJ3A 2CDFB 1KTLB 5I16A 2F53B 4FFYH 2BNUB 4ERSH 4R3SB 1J8HB 4YHNB 1GGUA 1KXVC 3DOSA 3S3PA 4X6DA 3FCTA 1RUMH 3IJYA 3P30H 3LIZH 4QRPA 1QLRB 2VDKL 5HHMB 2XWBA 1H15B 2OLDA 4H1LH 1CGVA 4J3OC 3VFRB 5DUPL 4AIOA 5A16A 2C1PB 3MXWH 4X98A 1RZFH 2HWZH 5GJTH 5C6WH 4OLZL 1FNLA 3HI6H 4JVPA 4HJJH 3BPLC 3TJEL 4HKJB 1MCSA 3ZDXF 4Z8FH 1GL4B 4UBDD 5C0RH 1J0HA 3Q0HA 2HKHL 3FQNA 5K93A 3TPUB 4X8XA 1AKJD 2B4CL 3UO1L 1WZLA 1RUAH 1QYGH 4GJTB 5IVNA 1C16B 1D3CA 5F1IA 4XNMB 4LRNL 2NXZB 5EBWB 3OB0H 1YMHA 2XZCH 3RX8A 3ZKND 2W60B 3FL7A 3O4LA 1RZJC 5A2LH 1JUFA 1RJZA 3BZEA 1XGUA 2ADGB 3VFNB 4ORZC 2QADC 5SWZA 5TE7L 4OZIB 1IGFH 3ARUA 4I0PD 3QUYB 4NKMB 4ZXBC 3DHJA 1T20A 5MEPB 5DJ6A 4LKXB 3RY5A 1P4LA 1IQDA 2AEIT 2EE2A 4KKLD 4M62L 3U4BH 4F9PA 5K9JL 1AI1H 2WW8A 4HS8L 2AJUH 5D93C 3BGMB 3SDDA 3UTTB 1A47A 4JPIA 4XBPA 1NJ9A 1REIA 4OTXL 4ETQA 4V2CB 3JWDH 4PJHB 3ARXA 4QTHA 3VXPB 3IXAB 4JB9L 4UIMA 3DV6A 1OWRM 2X5PA 3JSSA 5E2UH 1IAMA 2FJHB 3FZUD 4HCRH 4TSAL 3A67L 3O2DL 5GZNC 3MV7B 4S1SH 3MR9B 3BVNA 3H9ZA 3NIGF 2ADFH 3MRMA 2VLKD 4U1LB 2PO6A 1D5ZB 5JA9A 4HFUH 1TQCB 4KUZH 1MFBH 5IT2L 3FT4A 3C5ZC 2AVGA 4JM4H 1JNLL 5KVGL 1E6JL 4ODXB 4JAMB 3U36B 5F3HA 1XFPA 1X4YA 1ZVSB 2WIIA 1M71B 4PJDA 3VG0L 1ZSDB 2IFFL 4GG6E 4WRLA 1AD9A 1MHHA 2EE6A 4LHUG 4XCCH 3RKDC 3VI4F 1FCCA 4X4XB 1YEIL 3HAEH 1BFVH 4NCC1 1CICC 5IFHH 2CO7B 1IC7L 2OTPA 3OG4B 5H2BA 2YPLB 5CZVH 3T1FA 1T7XA 4GMTL 1BQLL 3KPSE 5E95B 2UUDH 1MI5B 1JZ3A 4KGJA 1WQVT 3L5IA 4UNUA 2AXHA 3ARSA 3SHSA 5DQ9B 3VG9C 1MCLA 5ESQB 1XGPA 3OAUH 3Q1SH 2IH3B 1RUKL 4YQXH 4J1UB 3TNNA 1B88A 2BXYA 2EIEA 5D8JL 4DUWA 1BBDL 32C2A 3MRNA 4OCMC 5EN2A 1G7JA 1ZT7B 3NIFE 1I85C 4WTZG 4GH7B 2IH1B 2OZ4A 1MRCL 4IDLA 4L4VE 5HSFA 3D0LB 3BKJH 4OIBA 4JDVB 1RVFH 3OXRB 3MNWA 1P69B 3MGAA 3QUML 4J3SA 2E7HA 4Z7UF 4KVNH 1C5BL 1EJ6A 1I1AC 5EFIB 2PYFB 2WBJC 4LDOB 1MF2L 3WUWG 5DVNA 4AJ0A 3IF1A 1AQDB 4K94C 2IJ0C 2VXUH 1DSFL 4AEEA 1XR8A 3OHXB 5EZOH 5BOPA 4HQQH 5IR1B 3OKDA 3GKWH 4YHKH 3VXSB 3MV8D 3X13A 4WI6A 3TP4A 3EYFA 2X4RA 1F3JA 1JN6B 3QJFA 3WCYA 2W38A 4HWBA 5BV7B 5IFJB 3QEUA 2ESVE 4M48H 4O9HH 3QHFL 1CZ8H 3WV0A 1ZLUK 1KXQE 3SE3A 1JWSA 4S1QL 3QIBD 4K7PX 4KJQD 4ENEC 4JG0L 4YHIA 4OZFG 3UTZB 1LNUA 1NL0L 3FFDA 5I1AA 1EFXD 1VGKB 4M00A 1BQHG 3O6KL 4WWKB 3DSFH 1RURL 5DWUL 1T89C 4K3DH 4R26H 1AQKH 1GIGL 5BVPH 1LO0H 5D1ZD 1IGYA 5E2VL 3WFEL 5JOPD 1CF8H 2F58L 1ZKAA 3AS2A 4I18A 4MQ7B 1MJUL 1MCJA 4FQ2H 2V2TA 5C9KA 3S9DB 4Q9RH 2V2WB 3QT2A 4KPHH 2JB6B 4JREB 3EOYG 3RWGA 1J5OL 3JVGA 5FAAA 2Y36H 2CJUL 3VXQB 4NNPL 2AK4A 4NIKB 4TN9A 3BGAA 1MREL 3SOBH 4HUWA 5DJYB 4PLNC 5HYJD 4IRJD 1Y0LA 1RIUH 3RGVD 4MWFB 3ARBA 4QXUH 3L3JB 1WZ1L 3IRZA 2HFGL 5HPMA 2PXYC 1P6AB 1UM5H 3G5ZA 4O51A 4PRHD 3VH8A 2OJEA 1FCGA 3SPVA 3BDYH 3MLUH 2I9TB 3DVNA 5KS9B 5A2JH 2BK8A 1H3WM 3WFHA 5HVGB 5EIIB 4XXDB 1TPXC 4JZJC 5IJKA 4PLJD 1PFCA 1Z0NA 2VDPL 4EKXA 1CVSC 5GS2D 1CI5A 3MGTB 3DSNA 2FRGP 4N8VG 3RWJA 4PP1D 4Y4KD 1CQYA 4U1JA 2P4AB 3TN0B 1FYTA 2IBGA 3CX5K 4ZNEA 3O6FB 4RGOH 4OQTA 4Y5XA 4AG4H 3OKOB 3QZWG 2DBLL 3KPRD 3FQUA 2EEBA 4EN3B 3UBXG 3OKEB 4PJFA 4DVRH 4Z6AT 4J7RA 1HZHH 4QRUA 1I8MA 4OLVH 2VXSH 3WFCH 2AK1H 3EZ8A 5JXAL 4EBQL 2VIRB 4KKCC 3FFCB 1CLYL 4X7TB 4Y1AD 1ZHNA 5E9DB 1IGTA 5ISZB 2JJTA 4HKBA 5I1JH 2BDNL 1XGRB 2D0GA 4MAUH 4JY4B 2EDFA 5I1LA 3U0PA 2ICWI 4XP9L 1KB5L 2O61B 43C9A 2YPVH 2C26A 3O11A 4X5XB 1T4KB 4L5FH 5C0AB 1V7NL 1U3HA 3CFKA 4K3JL 4X0KA 4G6JH 4PYHA 5EO9B 1A7OL 3C09B 3NACH 1ZT4B 2ZJSH 5LCVL 1ETZB 1DQJA 3N0PB 4H1LG 1LDPL 3M8OH 3H9SD 2J1KA 1WV7T 3QIUB 2YUXA 4RFOL 5F7WC 1NBZA 4MDJA 4P3WA 3B5GA 3G6JA 2J3SA 4PJGE 4Y89A 5JLZB 5D6DC 5DJ0A 4O4YH 3G04B 2EIDA 4GMSL 2BVOA 3JWOL 2VLJB 3O3EA 3SDAB 2LAGB 5E2TH 1J8KA 1T7ZA 5DJZB 3ULVL 2J8UE 2Z31C 4KHXH 2F9BT 2HLFD 1YEKH 3ULVD 1X5LA 2JB5H 3T09A 4ODHH 1FG2A 1EGJL 4NO3B 3ZT7A 2F5BH 2O5XL 4R7DA 2NZIA 1VKXB 2HG5A 4AT6B 1DQDH 3VDCA 1PBYA 5EORH 5LWYH 4CNIB 2HJLB 5JHDB 5I9QB 1JJUA 4HUUB 3G5YA 4R0LB 3LEXA 4K3EL 4X7SL 1WUNT 3FB6B 3KYKH 2EDRA 1OB1B 3ULUF 4LLAA 1S7XA 2R1YA 1MAML 1B90A 2AEQL 3MJ7A 4WDIA 1F45A 1INEL 3KJ6H 2NY6D 5KVEL 1CCZA 3HB3D 4WO4C 4NN5C 4ZUWB 3RAJH 1YEHL 3GMMA 5SWQB 1P4BL 4X6FA 1L0YA 1YYLH 4QHKI 5L2KB 1YQVL 3Q3GB 4E41B 4QWWD 4EI6B 1SJEA 1OGAB 3L6FA 5E00A 1WVZA 4WU7A 4KK9C 1U8IB 5IHUH 2BSRB 1Q94A 1KCUL 5DTFB 1RZGB 2FX7L 4JJHA 4P0DA 1D6EB 4M3KB 4K7PL 4ELME 1ZTXL 5K33A 2YEZB 5MP6L 1U8QA 1DBKH 2R56L 2DQDL 4L3CB 4PFEA 2X70B 3OKNB 4MD4A 4PD4J 3STLA 5GGTL 4HSQA 4NWTH 5C08A 2C3HA 2F53D 2IQ9H 4CUCA 3W0WB 1AFVH 1IM3A 1J8HD 5FCUH 3F7VB 1TITA 3QQ3B 1H8OA 1P6FA 5M7QA 4Q7DA 3PIQA 5HGHB 1YPZF 5CGYC 4NDMA 4X6CB 1WIUA 2NY4C 5HHMD 4YNYA 4HWNA 5GPRA 1C8PA 3CZFB 4KI5D 2HTKD 4MS8D 1YEDB 3OB8A 4ONHB 2P8PA 3ARFA 2A0LD 5HYSB 2VDKH 4V1DB 3SGJC 2OTWA 1EV2E 4NFBA 4APQA 4HPOL 5DUPH 5DQJA 2FL5B 3VGAC 4QHMA 1D5MB 4O5LH 4HDIB 4OLZH 3SGDH 1T21A 1NGQL 1QR1A 1QA9A 3K7UA 5CZKA 1X7QA 4PRNA 3TJEH 3ZSTA 2GFBA 3BPLB 3GBLA 1PVHA 4LSUH 3T65A 2NXZD 15C8L 2HKHH 5EU4B 1S7WB 2P45B 3UO1H 5IK3A 3U83A 3F58L 4ALAL 3RIAK 1KB9K 2EDKA 4PLKC 1QRKA 5GRXG 3RHWK 4LRNH 4WTWA 1E6OL 5ECJE 3UZQA 1FBIL 3QUYD 2Y72A 4PV8A 5F9DC 3V6OC 3LV3B 4NZRH 1MHCA 1Z6JT 2DM3A 2VZ1A 3I02B 3HS0B 3RNKA 1Q9OA 3O3AA 2X4UA 5TE7H 3QDJB 2QADB 2YHGA 4N8CL 4KV5E 3UTTD 2FIRT 7CGTA 4ZXBB 5E2JA 1MIMH 3U9UA 2Q86B 1NMBL 2AEWA 3WFBL 4N5EC 4M62H 1JV5A 3MLVL 3TGXA 4HS8H 4MSWA 5DMJB 5BZDB 4OT1L 5D93B 1L9NA 5FO9A 4LLQA 4PJAE 5IB5B 3O0RH 3E6HB 4G6KL 1LEIA 3MV7D 1I4FA 4LLWA 1DFBH 3TH3T 4NJ9L 3UTSE 3TPKA 3MRKA 4HZLB 4GXVH 2A74A 3SO3C 4TSAH 3A67H 3O2DH 4DCQB 2BOBA 1DR9A 4WFGE 1GGBL 1I7TA 4ZDHA 2KH2B 2CRMA 2QBWA 4Q2ZB 2QQQA 5IT2H 3CXHJ 1HN1A 3RVUC 4OSUL 3C5ZB 5EUOF 1JNLH 3P0YH 5KVGH 3OJMB 3DX9A 1E6JH 5K59E 5EC2B 2ZCHH 3Q48A 3GMOB 3D0VB 3LN9A 1LP9B 5KTEL 1I8LA 1JWMB 5TDPB 4P46C 1DE4B 1V05A 3GIZL 2IFFH 1CDIA 4H5SB 1RZ8A 2A38A 2PKDA 2YPLD 4EJ1C 2VE6A 2CKBB 4PGZA 4P5TC 1NBVL 2P24B 5GZOC 2R1WA 1YEIH 1MI5D 5IB3A 4OGAD 2VAJA 1CICB 1IC7H 2JJSC 4OLYH 5KVDL 5F88B 5BXFB 3RUGB 5CJOH 1XGQA 3R06A 2BY1A 4NQEB 1BQLH 5C6TL 1A02N 2BVPA 2FZ3B 4NRXB 4FFWC 4ZTOL 3VG9B 5FUOL 4E42A 3B9DA 3FHAA 1FDLL 2P7TA 3B3IB 2VXTL 5D8JH 1BBDH 3O8XB 5JOPE 4DWHA 1NFIB 5K9QI 3VFPB 1MRCH 1F6AA 1NC2A 5CJQH 5DRZB 2Z0BA 2FYYB 5B38G 3CNKA 1CE1L 3WL9A 2ZCKL 4RAHA 3LKOB 3PL6C 3QUMH 4PJCF 1ROWA 4W6YB 2F74A 1C5BH 3QPQC 1I1AB 1RIHL 2XN9E 3VXSD 2WBJB 3DXAB 3P77A 4WUKL 3E8UH 1F4YH 1HHHB 2C4FU 5HI3D 3ZZ1A 4YDJB 3IDNA 3RNQB 1DSFH 3X14A 4QCIB 3TA3C 1N3NB 2V9RA 1IAII 3X3FH 5HYJE 3ULUC 4J8RB 1LMKA 5DR5H 2LU4A 4OM0L 4PJEB 3WN5A 1ZA6B 5I1IH 5I1GL 5GS1A 1PY4A 1VPOH 4WWKD 1ADQL 3QHFH 4PRHE 3P0GB 2BJML 3W11D 4S1QH 1PGRB 2ZUQC 4JG0H 2NNAB 4EI5A 1TZIA 1A6UL 1NL0H 4M4RA 1G9EA 2JIXB 3ZKXC 4J2XA 3O6KH 5IVZA 1IAOA 5C0EB 1RURH 5DWUH 2P5EA 1AD0B 2XZQH 3DVFA 3MRRA 1T7YA 5FV1L 1MEXL 4BK5A 5ID0B 2NY5L 3ZYIA 2F58H 1MJUH 3VWJB 2BRRL 4GW5A 5IHLB 4GKNB 4HUXB 5C2UB 1KCLA 4AIZA 5B4MD 2RHEA 4OZGE 3HPLA 3VFUB 1F97A 5IBUB 2WWMC 1Z2KA 4K2UH 4WW2A 1J5OH 3OXSB 1FFPB 2NY3C 1OWWA 1U8JB 4K55A 4R8WL 4NNPH 4PRIE 3QQ9C 5CJ8A 1MREH 3OR7A 3DVGA 1SM3L 4FTVB 4P2YA 1NGYA 4Y1AE 3GIVB 2PTVA 5AZEL 3L3OB 4UI2A 1E27A 1WZ1H 4HJ0C 4DEPC 2HFGH 1KCRL 5C7XL 4OJFL 1BX2A 2PXYB 4HZAA 5F6HI 4WJ5B 5DHYA 4P3DB 1GZPA 4K71C 4UDUA 3GGWA 3V52L 2JLLA 1NAMB 3ZL4L 2AGJL 1TPXB 4JZJB 5AYQA 1CGXA 5HI4D 5GS2H 5DRXB 5KSUB 2AJSL 4LFHD 3TN0D 3KG5A 2VDPH 3H9SE 3O6FD 4GW4A 1JWUB 4M5YH 5JOFB 4X83A 3P4OB 1CFTB 3WNPA 5H35A 1FFRA 1G0YR 3L1OH 2ZSVB 2GJ6A 5TE4L 3DBXA 1F2QA 4EN3D 4PJ5A 2R0WL 5F7LB 5JZ7C 2DBLH 1EH9A 1CFNB 5GXBB 3KYNB 2R2HA 4M02A 3FFCD 5E9DD 1U8MA 2H3NA 3QBTB 3ULVE 5ISZD 5CLTA 3W81A 1XIWC 1EX0A 2OXHA 3FJTA 2WINB 5E7BA 3Q5OA 2KBGA 2Z92B 2H8PA 5JXAH 3BIKB 4EBQH 2Q20A 3MXVH 1CLYH 4NRZB 5C0AD 3RGHA 1H5BA 1OM3L 3EYSL 5C09B 1LILA 2BDNH 2FIKB 5KG9A 5E6IC 4S1RL 1OF2A 3QXTA 4BKLA 4Y5VA 1ZHKB 4H8WH 3ELAT 3CLFL 3QDGB 4RQQB 4EDWL 4TYUA 4X6DF 3TVMA 4LQ1A 1V7NH 4ZPTA 2VISA 3K74B 3SJVB 3HZYB 3QIUD 5F9OL 1A7OH 1CDGA 2IFGA 2R0ZH 1LDPH 3VMOA 4DUVA 1I7ZB 1G9ML 1VHPA 1QSEB 4BFBD 1A6VL 4PG9B 4PJXE 3SCMA 5E6ZA 4AQOA 4HUMB 1CXHA 2VLJD 4NKDB 4FQQA 3SDAD 1BMGA 3MA7A 3KPPB 1Q9KA 5J9PB 5IJVB 5KN5A 1JHLL 4GMSH 5DRNB 3JWOH 4J3TA 4J4PA 3K1KC 4KJPD 3ULVH 2E7BA 2Z31B 1R3IL 1UB5A 4P59L 5AG9A 2B20A 4WFFD 1U9KA 5JHDD 1QSFA 5BRZA 4HKZB 2DM2A 2AJZA 1EGJH 2A83A 2X42A 3O41A 2O5XH 1J8HE 3TT1H 2VLRE 3MRIB 3O4OC 1W8NA 4GLRH 1NFDA 1JP5A 5KVMC 3S3SA 3DECA 5IMMB 2IPKB 3MRCA 5HHME 1TCRA 4K7PY 4PY7A 1HOCA 5A43C 1YECL 3DMMA 4TULL 2AEQH 3QNZB 1NMAL 2VUYA 5BW7A 5CEYB 1INEH 5L2KD 3T0AA 4E41D 1KPRB 1QBAA 3BQUC 1IZJA 3BO8A 4H88L 1AXTL 1OGAD 4M6NL 2YC1B 2BHUA 3G08B 4WO4B 3HKFA 4Y4FC 1A7RL 4RRPA 1YEHH 4F7CB 2VDRH 2NTFA 1P4BH 4XMLL 2ADJA 2BRQA 4LRIA 1MQ8A 4AEFA 2FECI 3RIFK 1YQVH 4XB8A 1UZ8A 4LLDB 3H7BA 1OD9A 3CUPB 3GK8H 3MNVB 4MCZA 4Z7UB 3GSWB 3BN9D 2W9EL 1GRWA 1T1WA 1KCUH 2FHBA 3RWEB 3N85L 3W0WD 2J6EA 1ZTXH 1MCWM 1WAAE 1EVUA 1JYVA 4OZIE 5MP6H 2G75B 2DD8H 3DJ9A 2DQDH 3I6GB 4PJDF 4HFWB 3KPOA 2XOTA 5DLML 1IEBB 4E5XB 5FM5O 2BOCB 3LSOA 1A9EA 2AQ2A 3PGCA 4GKZA 2OP4H 2X9YA 1YEFL 3LPFA 2IBBA 3UTTE 1MCHA 1V3KA 4XXCC 3T0WA 4YXLL 1OVZA 1KJVB 2IEPA 3PG2A 4JHZA 2GY5A 2CK2A 2NY4B 2YRZA 4U1SB 4V1DD 4XGZA 1K8DA 4C56A 4PJHE 1DUYB 2ZUWA 3RIAF 3V0VB 1YEEL 3SDXA 4P2RB 1S5IL 3CSGA 2FEDC 3MV7E 4JN2B 1K4CB 3GUTB 4HGWB 3GRWH 3MFGB 3DO3A 5DQDL 4XNQB 3VGAB 1EO7A 5GS3A 1NGQH 1CL7L 3NN8A 3HNTL 4NGHL 3UDWA 2NW2A 1NSNH 15C8H 1VA9A 4N0RA 1HWGB 1OW0A 1JF5A 2MPAL 3F58H 4ALAH 3AM8C 3AY4A 5B3JF 4O58L 3OSKA 1GC1L 3QDJD 1DBAL 2QADD 3QWRA 4C57C 5J56B 4MJIA 4FQHB 1FBIH 5KAQG 4UTAL 2RBLA 4ZXBD 1FLTX 4JDZA 2YPLE 4PD4K 4PYGA 1Q9LB 1LK2B 5BS0A 1BPVA 3SGEH 1H3UA 5HYIA 2D31A 4N8CH 1MI5E 3F6IA 1CR9H 3P4MA 3JZ7A 1VSCA 4NQDA 1NMBH 3LKRB 1SY6L 3WFBH 3T0EA 1LVEA 3LS4L 3MV9B 4YGAB 2CR6A 2DDQH 2DTSA 3BUTA 3UPRA 5T3XL 3L5JA 4RAUA 4MVBC 5F9JA 1PQZA 4NBZB 1S5HB 4G6KH 3OKMB 2R39A 5GZND 3MZGB 4X5WA 2D0HA 1ZS8A 3A6CL 4LARL 1OAZL 4NJ9H 3QNXA 5J6GA 4XRCA 1NAKL 1B3JA 3SO3B 3C5ZD 4YPJA 1CE6A 3PWJB 5C3TA 1H3XA 4P9HH 1GGBH 2EYSB 4RMTA 2V7HB 1Q0YL 2LU7A 5D1QD 1ZT1A 4NCDA 2CKBL 3DX7A 3L3IA 4EVNB 5FUCC 2EH8L 3CPLA 3OKKB 3RWCA 3RKDD 1E4XI 1T6WA 4YE4L 1AXSB 4J3UA 3K80A 3SY0B 3OQ3B 3GIZH 4PGDB 4P46B 1CICD 3T0VA 4NQED 2PTUA 1NBVH 2VQ1B 4P5TB 3U4AA 3WEXA 2YZ1A 5I71C 3Q6FB 3L3GB 1ZK9A 2PYEA 5L88L 3KPLA 1NGWA 5KVDH 5KSBA 3NAAH 3CFEB 4R7NB 4WEUD 3RZCA 2MFNA 4BK4A 1JK8A 2V7NB 5C6TH 5CWSB 4HIJA 3O8XD 1BLNA 3DTXA 1WISA 3QEQA 4JGMA 3S6CA 2A6JA 4OI7A 3CAFA 3TBWB 5C0FB 5FUOH 1D5XA 1A5FL 1JNJA 4XVJL 2WM0A 1FDLH 2VXTH 4LU5L 5FV2A 3F12A 1QLFA 5LXGH 3CDFA 1I1FA 3KR3H 3O81A 5K9KA 5GGQL 4K94L 1I1AD 1IAKA 1FO0B 2WBJD 3DXAD 1CE1H 1N6VA 2ZCKH 3PDOA 2AI0L 3PL6B 3CXHK 3IDYC 3PWPA 1BZ9A 1RIHH 4ZS6C 3CH1A 2V9TA 4WUKH 4XP4L 2X05A 3M17A 4PJFF 4DK3A 1MVFA 5JQHC 4PREA 4U6YA 3QNYA 1ZLWH 3TA3B 2PW1A 3W39B 3JTSA 4RIRA 3GMQB 5KS9E 4TNWK 4ENED 4OM0H 5I1GH 2JIXD 2FD6L 2V9QA 1ADQH 1IGJA 3S35X 4U1HB 5F93C 4ONFH 2ZUQB 3O9WA 4KQ3H 5DEFB 1A6UH 4LVNC 4FFZL 2EIZA 1LEKB 1OGTA 4LPCA 2OK0L 3ZKXB 3VWJD 3MUHL 4Z9KB 3SKUD 5FO8B 1QRNB 5BJTB 2PO6C 1NCWH 3ULSB 4FG6C 2AXGA 1XF2A 2NY5H 2X1XR 5DGQA 5C2BL 1UADC 1XCTB 1M05A 5HGAA 3BZ4A 5SWSA 5ICXA 4PJIA 4F3FA 3MLWL 3C5JA 3CJJA 3G6JF 1ZGLB 1X5AA 4KRNA 4OAWB 4DZ8A 3QXDB 2DB8A 3LQMA 3QO0B 3R0NA 4FTVD 5TPWH 4JPKL 3FFCE 4QGYA 5E9DE 3CFBB 2H6PA 4LP4A 2NY3B 3MA9L 1LO4H 5ISZE 3VXRA 5D9SB 4PJ8A 2VITB 4R8WH 3VCLA 4D0DB 1YPZB 3S4SB 2JJUA 2PXYD 2R23B 1SM3H 2LU3A 1EEQA 5A2IH 1S7TB 3NCYP 4I9WE 5C0AE 4L8SA 5IQ9A 5AZEH 1NAML 3WJJA 1NLDH 1MFEH 1MJ8H 1I3GH 4XBGB 1KCRH 2DQFA 4OJFH 4DEPB 5IFAL 2IMMA 4HX1B 4X8JB 3MACL 4Z7OE 4K71B 3PABA 1T7WA 3V52H 4LMQI 1E4KA 4F33A 3T3ME 2VC2H 5DI8B 5HHVL 3ZL4H 2AGJH 1TJGL 2C3VB 2AJSH 5GRVL 4U1NB 4QRTB 2CD0A 2OL3B 3ROLA 4K23L 3MJ6A 5EUKB 1A3LH 5DS8B 1ZVYA 5HHOB 1IZKA 2QHLA 3GJFA 5GGSY 2A6IB 2KKQA 4C54A 5EPMA 2R0WH 4EXPX 5SX4H 2GJZA 3IFLL 2K7PA 1LO2L 4ZOAA 1AGCA 4KRMB 1ZLSH 5FYKL 1S9WA 4KKCD 1DEEA 5KZCB 5C09D 5FYKD 1BIHA 5TF0A 2ARJA 2DMKA 5CP7A 4C4KO 2D7OA 4OFYD 3QDGD 1K6QL 1OM3H 3EYSH 3SJVD 3WUWA 5DMIH 4ISVA 5E6IB 4S1RH 5D2NC 3QDMA 1QPPA 1PG7X 3UC0H 4EDWH 2ARWA 1QSED 2CDEA 4E41E 4XNYL 5F9OH 4H20H 1X3DA 4I18C 1BVKA 4DK6A 5C07B 4FS0A 3TYFA 1A7PL 2A6DB 1T1XA 4CN4A 2IADB 4BQ9A 5EUOB 2Z31D 1UCBH 1AGEB 3ABZA 3NA9L 2O26U 3BPNC 3UYOD 3W0WE 4A6YA 5CEZD 3LCYA 4ZS7H 1B0GA 4KUCF 1R3IH 4ZYKA 3D85A 4P59H 5F72S 3LEYL 5D71H 4L3EB 1Z3GL 3IU4H 1M7IA 4X6CE 2BVQA 4HH8A 1BFOB 3TCLA 3C8KA 2AS5M 5CJ5A 3O4OB 3D39B 3IFPA 1LGVA 4BH7B 2XQYG 3EW3B 2NR6C 2JCCE 1YJDC 4DGVL 3EUUA 4QXTA 4V1DE 5C92A 4WO4D 1YECH 3BX7C 3FO2B 1RQ5A 3HCVB 1EAJA 4Q9BA 2A6KA 3RVTC 1F6LL 4H88H 3BQUB 3TCXA 3HI1A 3EDDA 4LASL 2X2YA 4TPRL 1A7RH 4Y4FB 3DO7A 4XMLH 2DYPA 1LEGA 3EOAB 1DQQB 4G9DA 5L8KB 4KK9D 4Y5XC 4N0UA 1YN6B 3UTOA 4PJCB 2Q76A 2X09A 3C5SA 2FJFA 4JRYA 4M8VA 5DHVB 2W9EH 3N1QC 2HMIC 5T1KA 5IF0A 1UG9A 4PV9B 3S35L 3N85H 1OD7A 4OCNC 3DHMA 4N8VA 4PR5B 3IXTA 5ESAB 3KVQA 1JTOA 3QDJE 2JJTC 4DGIL 1UKSA 3B4NA 3C08L 1KJ2A 5DLMH 5DUML 3EJZC 4QY8B 5CGYD 4X5LA 3RTQA 2NY4D 3QZWA 1C5CL 2DTML 4D9LL 1YEFH 3ARQA 3RI5K 4RMVA 5HGBB 3T04D 2D7MA 4D0CA 5E08H 3L5XL 3HZVA 3BD5A 4P2RD 4YXLH 3L3KB 1F11A 1NKRA 1P1ZA 2EECA 1JGLL 3UAJD 3IAGC 1NH6A 3HRZB 1C1EH 2EXYC 4ZUTB 1R3KA 1FZJB 1YEEH 1CDCA 3MJ9L 1QLEL 3LOWA 1S5IH 5E8DH 5T3XE 4PP2A 1HHJA 4LCWA 1FORH 2WWKO 1A6ZB 4N9GA 1TVHB 2J7LA 4Q6IA 1FVCA 2QHRL 4XHJC 2VDNL 2UYLB 3JV4A 5DQDH 5GSVB 2DQJL 1J1PH 1R5WB 4IJ3C 4OZHA 1UH2A 1IM9A 3FAWA 1CL7H 2VL5A 3VRJA 1L0XA 4PLKD 1DVFA 1UWXH 4H1LA 1RZJH 2X1WL 4OCYL 3TF7C 4WW1A 1KCSH 3ES6A 2MPAH 1QEWA 1CLOL 4O58H 5E8NA 1H0DA 1FZKB 2KQMA 1DBAH 4ZO9A 4NNXA 2FJGA 1OP5K 4UTAH 5ILTL 4L8CB 3CDCA 4LVHC 1JZ8A 3IDUA 4UUJA 4GQPH 4N5ED 3P9MA 3V0AC 5FGSA 3MV9D 3VFOA 4BFIA 4BQ6A 1V3LA 1WT5C 3V5KA 5DSCB 1P7QB 2YPKA 1PKQB 4NYLA 4CVZB 4B0MM 1INQB 3N1MC 1SY6H 4LEXH 4QRSA 2VDQL 3HPJA 5B39A 4R96B 2HLAB 1JRHL 4HUVB 1IEAB 5IMKB 2COQA 2VR4A 3Q2CA 3MV01 1T0NA 2BERA 2IMNA 1MCKA 4I3GA 4NHUA 1ERNA 2FB4L 2GT9A 1OAZH 3A6CH 4LARH 5I1CH 2K1MA 1A2YA 3BRFA 1AR2A 5CCKL 1RULL 2AV1A 2HFEB 3WE6A 1P4IL 2NYYC 3MRGB 2AERT 3RVUD 5JNYA 2I07A 4LCYB 1WTLA 5JW4R 3H0TB 1Q0YH 4NBYB 1QHPA 4KTDL 1TIUA 3MRLA 2CKBH 1G6RL 8FABA 2YBRB 4P46D 5F7KC 2EH8H 4OLEA 5F89B 4LHJB 4OF0A 1PG7L 2GHWB 4I4WB 5EIVA 5FOJA 3V8CA 4LBEA 1OP3K 4WW2F 4P5TD 5GZOD 4P23A 4PJEE 2VLMD 3VRIB 3AU1B 1QVOA 1KJ3H 3FB7A 4DKEH 4FXKB 1Z9SA 5DD0L 3WFDL 5I16B 2DLGA 1HK6A 5FF6A 4OD3L 4X6DB 4MA1C 3FCTB 5I71B 3ARGC 5TFSL 3IJYB 4ZSOA 1FZMA 1DLHA 1J18A 3ARFC 4HS6A 4FFWD 4KDTA 3ZT6A 3RL1A 1ES0A 2XWBB 3MO1A 1U0QA 3FKUS 4TSCL 5A16B 4XWGL 5J1AA 4NM4L 2DLEA 4Z95L 4LFHG 4HLJA 4OUUA 2HJFA 4LU5H 4GAGL 4GRWF 3QEGL 5EZLA 1AC6A 1TETL 3NPZB 4TNWF 4HAGA 1TNNA 1NANI 5E56A 1YMMB 3PL6D 5T1LA 5F3BA 1JHTA 5F1IB 4K94H 2O5YL 3QPQD 3ZKQD 3GSRA 1YMHB 1QNZL 4JR9L 5D2LA 1ZHLA 1JUFB 3DRTA 3TA3D 4FTVE 1RJZB 2DJUA 2ZPKH 4RA3A 3BZEB 1XGUB 3EGSA 3IDYB 3ULUD 1RV6X 4XP4H 2PUQT 3RKPA 1T20B 5DJ6B 1U8OA 1U36A 1P4LB 4IS6A 4M7JL 3FN9A 2V5RA 3BH9A 4U1IB 4YFLF 4YGVA 1HI6A 5CBEA 4GG6A 3NZHH 4OKVA 5F6IC 4JPIB 4XBPB 2FD6H 1NJ9B 1OP9A 4KZEL 3GJFK 3MROA 1R5IA 4QTHB 1QRND 3QFJE 2MCPL 4FFZH 4LVNB 4UIMB 3VXTA 1AHWC 3DV6B 43CAA 4CW1A 3SGKA 3KPSA 3BISA 3BVNB 2GK0A 1BD2E 1VGEL 3MRMB 2PO6B 1S9XA 4Z7WE 4W4OA 3HMXL 3L5HA 3X12A 1TJIH 3FT4B 4KJYA 4FXGA 3CDGA 5C2BH 4WHYH 4XPGH 1S7QA 2WWMD 1RPQA 1V5JA 3MLWH 5F3HB 2NY3D 1I8LC 5TE6L 5F7DA 5BZWA 1LDSA 5E8OA 5TF1H 2X4OA 4PJDB 3MCLL 3OX8B 3C60A 4I5BA 4PUBL 1AD9B 3QQ9D 4L4VA 1MHHB 4JPKH 1J11A 4FHBD 4LPWA 4NZTL 4W6XB 5FM4A 4WV1C 4BFGA 5C09E 5CLWA 5FYKE 1UB6A 2DI8A 3MLSL 4HJ0D 2GTZA 5CFHA 4OLUL 3QDGE 1U93A 1NAMH 4QEGA 1NFDF 4YWGH 3SJVE 5IFAH 3NIGE 3EO0A 3MACH 3TNNB 5FKAA 4FQJL 32C2B 3MRNB 5EN2B 5DT1L 5EWIL 2Y07L 2ESVA 1U95A 3CK0L 1KIPA 1TJGH 1KN2L 4NO2A 3WS6A 5HHOD 4YZFF 4K23H 3MNWB 5LBSL 2BXZA 5D1XA 4ODVL 5CILL 1HDMB 5JZ7D 3HC4L 1F4WL 3VI4E 1YNLL 5KZCD 3IFLH 1FE8L 1LO2H 4XWOC 1PDKA 1XR8B 5FYKH 2VAAA 4XCYB 4S10A 1KENL 5EU6A 1GHFH 4ZODA 3OKDB 2VSDA 3WN5C 2P8LA 3X13B 1GH7A 5B38A 5GS1C 3EYFB 2X4RB 1F3JB 1FVDA 3QJFB 5E6ID 3QEUB 1KGCE 3OJDA 4BQBA 1JWSB 1K6QH 3GO1L 3K2UL 4EI5C 4YHIB 3S88L 4YEEA 3FFDB 2X4PA 1PJ9A 5I1AB 3WXWL 4P2QB 5F96L 5C07D 4L8BA 5SX5H 4LLMA 3LH2L 3RY6A 1UM4L 2MJWA 3OZ9L 2XKUA 3SE8L 5DJXA 3SDXF 4RFNC 4XNYH 1A4JA 3LAFA 3RWIA 2YKLL 4I18B 4HLZH 5DC0A 4Z7UE 2V2TB 1B0RA 1HINL 4G42A 3ET9F 1PX4A 4FNLL 3NIDF 3H42L 3RDTA 5EU3A 5FIEA 4BSJA 3QYCA 1IC4H 4L4TD 4UQ2A 3RWGB 2Z91A 4WW2C 1EZVX 4EOWL 3B6SA 5C0NC 5CEZH 2E3VA 5T5NF 1AO7B 3JTTA 4L3ED 3NA9H 3TO4C 4NQUA 3BPNB 1JFQL 4HUWB 4G7VL 3D39D 1H3VA 2EYTA 2B1AL 1Y0LB 2NPLX 4TTDC 3LEYH 4XPBL 4YPGA 1Z3GH 3BEVA 4GSDH 3WNMA 4GQ9L 4R9HA 4LDEB 3G5ZB 4J6RL 4O51B 2OJEB 4XCNA 3VMNA 3SPVB 5E5RB 3DVNB 4ODWA 2ADIA 2DLTA 4X7EC 1MCDA 3WFHB 3BRDA 4XMPH 3D3VB 5ANMA 5EBMB 3BQUD 4XH2A 4DN3H 1HKLL 4Y4FD 5ERWA 4G8GA 1B4JL 4XAKD 1XCQB 3WUZA 1U3JA 1S7UA 3RY4A 1AR1C 4XTRC 1G7QA 2FSEB 2E7MA 3S37H 1FJ1A 1PYWA 3RWJB 4TPRH 2ZUYA 4U1JB 2ICWJ 5EB9A 1FYTB 3RI5F 4Y5XB 1HQRA 1E0OB 5E99L 3FQUB 1OQOA 1HWHB 1N5YH 12E8H 5FYKU 5I0ZA 1NCDL 4PJFB 3V6OE 4QRUB 5I8CA 1I8MB 1I8IA 4X4MA 4F7MA 4DN4L 3JV6A 4PJGA 3KLDA 3MFFA 1H5BC 1ZHNB 4NRYB 1IGTB 4HKBB 5DUMH 1Q38A 2J8UA 5I1LB 3U0PB 4Z0XA 1C5CH 43C9B 3MV9E 4D9LH 1AC0A 3TVMC 3WXVL 3F7YA 3CFKB 3L5XH 1OARL 4X0KB 1CLZL 5HGDA 5FDWA 1I7RA 5KSBF 2FEDD 3DUHA 1JGLH 3OJ2C 1S9KC 3CSYA 3LPWA 4P4KA 4GAJL 3SCMC 4MNHA 2DQCL 2Z4QA 1QLEH 1NBZB 4MDJB 3L9RA 3C2AL 5D7IE 2YR3A 3FRPG 2NLJA 3G6JB 4M9PA 3TIDB 1Q72L 2C1OA 4R4FL 2XTJC 1OAKL 5DJ0B 2DQJH 3ME0A 5DURB 2BVOB 4IJ3B 3IJSA 4G8EA 3O3EB 3S36H 4MA3A 4F2MA 4OCYH 2PCPA 1TJHH 4QHKJ 1A64A 3OKYA 3NCCB 1NDMA 2MKLC 1CLOH 1F58H 1I1YA 4G6ML 1P7QD 2VLME 1VEOA 3QA3B 4LNRA 1X4XA 1AKJA 3OAYH 3UJIH 4PTTB 1KLGB 3L95A 3G5YB 1JZ2A 4ELMA 3LEXB 4LVHB 3IT8D 2W92A 1VFBB 3VXNA 5IBLD 4TVPD 5IMLA 5D5MA 3GSNA 1HQ4A 3DMMC 4XHQA 2MHAA 2UUDK 5JO5B 4EUPA 3MJ7B 5BW7C 3EDEA 1FV1A 2JK5A 3RJDA 1QBBA 4MVBD 1UGNA 4P5KB 5HYQA 2X40A 1Z0MA 4YXKL 3GM8A 3N50A 1CGUA 3GMMB 4ZG1A 1JRHH 1J86A 4I0PA 4Z77A 2GAZA 4QF1A 4LRIC 5DJ8A 4M7LT 4X6FB 4M4PA 3TH4T 1EEZA 4KH2A 1SJEB 1FC1A 1UVQA 5D70L 5E00B 1ZGLP 4YHML 3ARYA 2Y23A 1BJMA 4HJGA 5IBUG 1YC8A 5DK0A 1RULH 1C08A 5GHWL 1Q94B 3KLHC 1P4IH 1DBML 3QAZC 3WO3B 4WHYG 2BSTA 4ZFGL 4RDQG 4PJIF 3SDCA 3FTGA 1U8QB 1IBGL 4MD4B 5IMOA 4XNUL 3STLB 3NMEA 5C08B 4IOSD 3MOQA 1IM3B 3O2DA 2VQTA 5JPNA 4PJ7A 4AH2A 2ZUVA 5H8DA 3NGBC 3PIQB 3RQ3A 4HIXL 1WWBX 4G9FE 4NDMB 2ICWA 3WFDH 4YNYB 1KT2A 4OD3H 1KIQA 3EYOA 4MA1B 5I66A 3ARGB 4JKMA 4NC2B 4LCIL 4X9HA 5IOPA 2P8PB 3ARFB 1VEMA 5EDXA 3S34L 1YY8B 4TUOA 2OTWB 3VD9A 1QRNE 4EEEA 4TSCH 1KLFA 5DJ2B 1T6VN 4JLRA 1L7IL 4IHOA 4NM4H 3I9GL 4QHMB 4Z95H 1T21B 1QR1B 5ID1A 1B2WL 1FO0H 1QA9B 1VADA 1YMMD 1X7QB 4PRNB 4OCWL 2GFBB 5FGCB 4Z7QF 4FQPA 4GAGH 3UDWC 2YD6A 4P57A 3QEGH 4PJAA 2ATKB 5IW1A 1FIEA 1DANU 1OW0C 2NXYC 5IK3B 5DDHA 1CGSL 3AY4C 4LLYA 1T83C 4MJ6A 2O5YH 3UTSA 4ZS6D 4JO3L 2YXFA 5I8OL 4PV8B 3P73A 3T3PF 2FX8L 1QNZH 3ULUH 1MHCB 4JR9H 4QHLA 5IHZA 2BZDA 5GGRY 4HC1L 3RNKB 4UOJA 2X4UB 4FZEL 4EDXA 5JHLL 5CINL 3CFCL 1QFWI 1W72L 4D8PB 2Y6SC 1T0MB 1S8DA 1F4AA 2X89A 2XA3A 3CLEL 3U9UB 2APWA 3UX9B 1JV5B 1TTFA 4M7JH 1MFAL 1UA6L 1V3JA 3S7GA 3IGAA 2ID5A 1QOKA 2IGFL 2JF1A 5F6IB 3LQZB 3KPNB 4LLQB 1FNAA 2CRZA 1LEIB 3C6LA 4KK8C 1I4FB 3S97C 4LLWB 1CTOA 1M6OA 5SV3A 2D7NA 2IG2L 2PO6D 3WLWC 4FG6D 1A6AA 3MRKB 3QDHA 1AHWB 4ZQKA 2A74B 1IILE 3T08A 4EQ3A 1GSMA 2BOBB 4HLZG 1NDGA 3GHEL 3OKLA 3T4AA 1I7TB 1WWWX 4ZDHB 1VGEH 2NY7H 1TMCB 3DX6A 4KMLB 3HI5L 3HMXH 3U0WH 3KPMA 1PLGL 4GUPA 5LAXB 2OTUA 1VCAA 3AFLA 3GSUB 4UB0H 1MAKA 1KIRA 4G5ZH 3DX9B 1T04A 5D1ZA 4FRWA 5TE6H 4XCEA 4IRJC 2R1XA 3IRPX 4LSQL 3MCLH 2YN5A 3KYMA 4U49A 4KTEL 1NC4B 1RZ8B 4NM8H 1CWVA 2VE6B 3UEZA 4DGYL 1BVZA 2IALA 1ED3B 4NZTH 3G6DL 4FZ8H 4JKWA 5HTSA 3U7YL 3MLZL 5GRUL 1HHKB 5E0QA 2R1WB 4WV1B 1OAXL 5IB3B 3V4VL 1TDQA 2DLFL 3LHPL 4C59B 4OLUH 1XGQB 4UQ3A 2XN9A 3R06B 2IAMA 3AREA 3BP5A 1HNFA 2BVPB 2OZ4L 1K85A 1JPST 2Y06L 3ZE1E 5JORA 4F57H 5C07E 4JPVL 2OL3H 4E42B 1CD0A 5FM5M 5SV4A 2P7TB 3CH8A 5C8JA 3RGVA 4HPYL 2A2QT 3NABL 2JJVA 2Y07H 3CK0H 5EUOE 3F65A 4U3CA 1F6AB 1NC2B 1CXEA 1MRDH 4NSKA 2H9GA 5C6PB 5LBSH 3WL9B 4ODVH 3QCTH 2BNRE 5CILH 1EEYA 1BAFL 3HC4H 1F4WH 4LEOA 2F74B 5E24E 4JQIL 3P77B 4L3EE 4N0FA 1G7HA 1L6ZA 1RMFL 3X14B 2HT4C 2ARJQ 3D39E 1U8NB 1G7LB 5DJAA 1KENH 5DEZA 2FHCA 3TBSB 2LTQC 2EDHA 3WN5B 2VH5L 2W91A 4D0BB 4JFQA 5GS1B 2QSCL 4P2QD 1N26A 5INDB 1CXLA 3K2UH 3O9WC 3S88H 3MUZ1 4EI5B 1TZIB 1WCBA 4PRIA 2P48B 4ZTPH 4LPVA 5F96H 1IAOB 4Y1AA 4F15C 3P9LA 2P5EB 3CU1A 2EDLA 2F19H 4YFDB 3LH2H 4XAKE 1UM4H 3OZ9H 3PWUB 5D7LE 3SE8H 3TBTB 2XTLA 5EU7E 5B8CA 4RFNB 2YKLH 4PJCE 5C9JB 5CD3B 4GW5B 3VGEA 4I2XA 1KB5A 1NGXA 1HINH 5F6HJ 2HLFC 2GY7B 4FNLH 3H42H 4AIZB 4OZHF 4Q9QL 5FECA 4PGJA 4ELKA 2AQ3A 5EIQA 4J3VA 1ODAA 4WW2B 5E8EB 2P43B 1I9RL 3M45A 4EOWH 2I25N 4FABL 1A1OA 3B5TA 3UXFA 1J05A 4PJ8C 4OCSL 3O2VH 3TO4B 1W0VA 1BZ7B 2G2RB 4LPTA 4Y19A 2AJVL 3OR7B 1JFQH 5L0QC 4G7VH 1YJDL 4L8SC 1NGYB 2B1AH 5GGUA 4XCFL 1IL1A 2PW2B 2NR6D 3WJJC 5I30H 3VGBA 4GRLA 1FVEA 1E27B 2P5WB 4GQ9H 3D3VD 3ZT5A 1BX2B 4UT6L 3U79A 5C0BE 5DHYB 4F7PA 1QBLL 4UDUB 1X5HA 1E4KC 4M61A 3AXLB 3KAAA 4M43L 3RVTD 2W65B 2UZIH 1EGJA 1HKLH 1TENA 1KEML 3U46A 2EO1A 4XVUD 3OGCB 2VOTA 1FYTD 4GRWB 4TOYH 2CLZA 4GW4B 3GMPA 5JDSA 5F9WC 4JHWL 3RWDA 5DHVH 3FB8A 2Z35A 4PGEA 3NCYS 1X9QA 4XT1C 5B21A 1JGDA 4RMQA 3DBXB 2VN4A 2VTFA 2Y5EA 1VACB 2HMID 3FT2A 4LLVA 3EDJA 5E99H 5KSVA 1N0LA 4ERSL 1U8MB 1EO8H 2H3NB 3ZDZE 4PJXA 2J8HA 3I2CL 3VFTA 1RUML 1UC6A 3EJZD 1CLCA 4JKLA 2NMSA 3GM0A 4KJWD 3EFFB 2X4TA 2VWEE 2PTTB 3DI3B 3FN3A 5AAWA 1H5BB 2WP3O 2NX5E 2ED9A 3CVIH 1RZFL 2HWZL 3I50L 3L7FA 4FQLH 4FXLA 1F4HA 3WBDA 1OF2B 2EH7L 3TVMB 2YWZA 4ZPTB 1SJHA 2VISB 1KTLA 1CLZH 4Z8FL 4R3SA 1J8HA 2DL9A 2VLRA 5GGTA 3C87A 4WNQB 1CFVL 1RUAL 1QYGL 4XHJD 2WANA 4GAJH 4Z7VA 1X5GA 1MCBA 3SCMB 2DQCH 5DURD 2XZCL 1KLUA 1F00I 4FQQB 1H15A 2E6QA 3MA7B 1Q9KB 3MNZA 3PXHA 1Q72H 2VZUA 1G0DA 5AWNH 5KN5B 2XTJB 5IIEA 1UH3A 2HAZA 2XZAL 4HKJA 1UB5B 3U4BL 1JYXA 5IEKA 1AI1L 1QSFB 4N1EA 1BFSA 5BRZB 2AJZB 5CHNA 2A83B 1GPOL 1C16A 4HV8B 5D2LF 4OKDA 3O41B 1QD0A 5F9AC 1MH5A 4XNMA 5ACMA 3V5DA 3P4NA 3JWDL 4G6MH 3MYZA 1NFDB 2E7CA 3DIFA 4LVEA 4WEBL 4RISL 4D94A 3MRCB 4HCRL 4Q74A 1TCRB 4WU5A 3RVWD 1HOCB 5GRJH 2VDML 3DMMB 4G7YL 5I6XC 3QUYA 2ADFL 3P3YA 5FK9B 1R24A 3KDMA 1OTUC 3B8SA 3I75B