2EDOA

Solution structure of the first ig-like domain from human cd48 antigen
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
121
structure length
121
Chain Sequence
b'GSSGSSGQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD48 antigen
publication title Solution structure of the first ig-like domain from human CD48 antigen
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 16
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edoA00
1NBQA 7FABL 2NX5B 3BP4A 5L2KA 2J1KA 2E27H 4RBPH 2YUXA 3G04A 4M1CC 1N5AA 2ZJSH 1LE9B 3GO1H 4QRSA 5ILTL 1F6FB 2L4OA 3SE4C 3TO4B 3QCTL 4YXKL 1FL6B 3OKEB 4ZOCA 2D7OA 2DQDL 1GOHA 4BM7A 3E2HC 4NRYB 4N0CD 2MQ3A 5J7CC 2JELL 2WBJB 5E94B 1J1OH 4FFVD 3KJ6H 2ADGA 1UXSA 1JPGA 1QBAA 1NUFA 1KCLA 1F4WH 4WDIA 1NGWA 1MLBB 1P4IH 1NCTA 3PP3K 4XMLL 4YHNA 3G5ZB 4UDTB 4YC2C 2CXKA 4XP4L 4P9MH 1INEL 2HN7A 1HOCA 5E8PA 3ZT7A 4AG4H 3NGBB 2H41A 2J5LB 4AMKL 1YEDB 2X4TA 4OZGF 1RSFA 3PGDB 1ORSA 4I5BA 4N8CL 3MV7E 4BH7A 4YDKH 4Z78B 5CBAB 2A2QT 2IANB 5IW3A 2L7JA 1OAUH 1OT1A 1AGDB 1K4DB 4IMKC 3H9SD 1QG3A 1KB9J 4KI5C 2X7LA 1JHKH 4MD0B 4I0PB 4P3DA 4HLZG 5GRYA 2P24B 2XNAA 1W0WB 2MQCA 2BSRA 2VC2H 4D8PB 1T03L 4I2XE 5IHLB 1KPVA 3GNML 1OPGH 4P48A 3TGXA 5F1SA 1FZOA 1I3GL 1PX3A 2VDOL 4J6RL 4EI5D 2RFXB 4YHIB 4WI3A 5I17B 3MRIA 1H15B 1KEML 3DUUA 1JPTH 3O3BA 2HFGH 2AKRB 5J11B 1LEIB 5B3JF 1OAKH 4ORGB 3HPLA 3VI4F 2BHZA 4L9LA 5AZEH 5SX4H 2F8VA 1ZOXA 2NY3B 2AK4E 1QLFB 4MA3B 1C7TA 3LD8C 1A7QL 2OP4H 3LN5A 1AO7B 1BZ9A 3CXDL 3FN0H 3LKNB 4E41E 4LVEA 4BELD 3BKML 4A6YL 4APQB 1OD7A 2GCYA 2VE6A 1RHFA 1A9BA 2CH8A 5FYJD 4YO0A 5I74B 2Y9RT 2FEDD 1FL5A 1ACYH 3BH9A 2EXYD 4LHJB 4WCYL 4PJHB 1EEZB 3BN3B 4OFKA 1JZ4A 4RDQF 4OCMC 5GISH 3T8XB 1BZ7A 4QXUH 5IFJB 1MH5A 1Q0YH 2YPLD 2B1AH 2FX8H 3SDDB 5FK9A 5DD6B 4X5WA 1MIML 4OIIH 5TH2B 4NKIL 1JGDA 4G6JH 2GSIA 1TXKA 3RAJH 1FIGH 5CAYB 4JB9L 5CEYB 4X6DA 1IQDA 2EXWC 3MLZH 1PQZB 3QFJD 4ZPVA 2VITB 4HJ0D 2HG5B 1QEWA 2ATPB 1U36A 3QI9D 5JHDE 1CIDA 4OFYA 3DROB 2F53D 4YDVB 5ESAA 5HGDB 4AK1A 5I16B 4FZEL 5EULV 4EN3D 1RHHB 1LO5A 3V52L 5ADOL 3G08A 5B3NA 4HHAA 1S8DB 3LKRB 4I48B 4XMPL 5HYSG 2I25N 3H7BB 4NQEA 4QO1A 1N64H 1HHIA 2IPUG 3WIHA 1JWMB 2J8HA 4G8GA 1QSFD 4OF8A 3A67L 4UINH 2AJVL 5D7LB 5BS0D 5I71B 2FJFB 4ONHB 1A6TA 3NA9L 4RMTA 1QFOA 3V8CA 5JPNB 4W81A 2FIRT 1NQBA 5C0AE 1Z3GL 4QLRA 1DQLL 4GG6E 2BY1A 3JWOH 3LMJL 3UTZB 3OF6D 1YY9D 2C7UB 3CPLB 1JFQH 4QF1A 1HHJB 2FSEB 3O8XB 5JTWA 4LCWA 2IH3A 4M6OH 3MV9A 3V6ZB 2FEEL 1A14L 2EH8L 3G9VA 3CMOL 5DJ8A 1AR1D 3RUGB 1ZHNA 1L7TH 3EYVA 3FQXA 1KT2B 4XT1C 2F58H 3NFPB 1BD2B 3DV4A 1FH5L 1ES0B 2X4UB 4RCAA 2Y5TB 3RIAK 3REWB 1MCEA 4E0RA 3ES6A 3HZMA 5IHUH 5DQJB 2C1OB 3FO2B 3D85A 4X6FA 3X14A 1EVTC 5I0ZA 2V5SA 3K2UL 3BZ4B 1G1YA 3ZKQD 4NO2B 1VGEH 2BVUA 2I60H 3VGEA 3SO3B 1TZHB 1W72A 4HXBH 5GGSB 4KI5E 3WL9B 5LQBH 4YPJA 4N8VG 6FABH 5DURD 2UUDH 3DYMA 3S97C 4HGWA 5CP3H 5J6HB 4C56A 1MJ7L 4F58H 2UY6A 4P49A 4HK0B 1P2CB 1GGCL 3QHFL 4DKDC 4GH7B 3EYUL 1WCBB 1G7JB 3CSBA 1Q9KB 3GHBL 3REVA 1YYLH 4HWBH 1X9QA 4NUJA 4NN6C 3MODL 4OLEA 2NX5A 1V7MH 5F7YC 3C2SA 4PGCA 4B50A 3Q1SL 1CS6A 2HT2C 3C8HA 4K3DL 3HMXL 3LS4L 4KV5E 2DBLL 3O4LE 4TTGA 1LE9A 2EECA 4KMTH 3TO4A 4NCC1 1FL6A 3OKEA 4DW2H 4KKNA 2HJFA 3Q0HA 4KXZH 1TTUA 2DB8A 4HW6A 1TVHB 3W0WA 5IWLC 2HFEB 4CDGC 1RJLA 2WBJA 2YMXL 5E94A 4R2GB 3GMOB 3MV11 3DX9B 5A3IC 1MLBA 1VFOA 3G5ZA 4UDTA 2QSVA 2XTJB 4WI7A 3FT3B 3RZWA 3MZTA 3HUJF 5KN5B 5FB8B 2HTKD 4M48H 2EIDA 1XF2B 1YEDA 1DVFD 2ZUTA 1RUML 4C55A 3PGDA 3C5JB 2OXGA 2BSTB 5CBAA 3CFJB 2IANA 1NCCH 4ZFFB 3BDBA 3ZE0F 4PJ9D 1T7YA 1QD0A 1AGDA 2B5IB 4N1HB 2V17H 1RZGA 4LNVA 2HH0H 5B39G 3MXWH 3QJHB 2VXTL 2E9BA 2OMNA 3SE8L 4JO1H 3AREB 1BQHB 4I0PA 4MD0A 2X9XA 3SQOL 2P24A 1W0WA 3FFCE 2EDDA 5FHBH 3MREB 4OZIB 1X5KA 4D8PA 4D0BB 2W9EH 4H88H 5F71A 3OB8A 3RWEB 5ALCL 3QUXB 2RFXA 4YHIA 5I17A 2B8OT 5HYJD 2YRLA 3E3QC 4ONOA 1H15A 4KKCD 5C6PB 4EI6B 5CD3B 3BSZH 1DR9A 3U7WL 3I50L 2AKRA 3DGGB 1LEIA 4ORGA 1AI1H 2RBLA 2ZUYA 3GRWL 4JZNB 4O00A 4UV4L 1QLFA 4NCDA 1AO7A 1K2DB 1VDGA 1X7QB 3Q5YA 3LKNA 4QHLB 1SMOA 3S96A 4APQA 4QOKB 3SGEH 5J06A 2NTSP 4GBXA 3O11B 1U58B 4QWWC 4B7LA 3WFEL 5E8DL 4HLZH 3F7VB 4JO2L 5CSBA 1EEZA 2J6EH 3T8XA 4R90H 3ZMRA 4MJIE 1IGFH 3GMQA 4NC2B 5IFJA 4Y16D 3SDDA 3ABZA 4U7MA 3EOTH 3U4BL 1NLDL 5DD6A 2A6KB 4OM1L 4LHUD 5TH2A 5HYQA 3RVTC 1OGAB 1G1CA 3OSKA 5DJ6B 1MFEH 5KSAB 5CEYA 1JF1B 1BM3L 4HFWB 1PQZA 1M7IB 2VITA 3WJLA 2ATPA 5HTSA 3GJFB 1V3KA 2FYYB 1CE6A 5HGDA 4YDVA 3L7FB 4JR9H 5DMIL 5I16A 2IADB 4YPGB 4BFGA 4E5XB 1RHHA 1MJUL 3E6HB 1DQTA 3IAQA 1S8DA 5CZXC 3LKRA 4I48A 1RUKH 1K6QH 3DXAA 3ZTNL 1QR4A 3BX7C 5BVJB 1MREH 3QPQC 3H7BA 1IAIL 3QIWC 4M7LL 1SY6A 4XGZA 5MI0B 3AB0B 1JWMA 1GH7A 3OBAA 25C8L 5D7LA 1T04B 5HHOD 5T3XE 4PY7A 4ONHA 3DSFL 3UPRB 3QWOB 3LQAC 5JPNA 4Z7OF 1WAAA 1I1YB 3NCJL 5IHBA 1A4KB 3FQWB 2DDQL 4KRLB 4AEHH 1MNUH 1JZ5A 3L9RB 1DCLA 1R0AL 1A6AB 3CPLA 4S1DC 4I13B 1FFNB 3U2SA 2FSEA 3O6KH 3O8XA 4F57L 1KEGL 1ACZA 3AAZB 3F62A 4LSTH 4EUPG 2Q8BH 4P2YA 1GGUA 4Y88A 4PTTB 3RUGA 1PD6A 1X5XA 4WHCA 2P8LB 3NIGE 4TUJB 4BJLA 5I1IH 3H9SB 1U8PB 2EDEA 4LQFH 5ESQB 3NFPA 4UT9H 1BD2A 2VDRL 1ES0A 1UZ6E 2X4UA 1MFAL 4GUPB 4R4FL 2Y5TA 3REWA 3FB6B 5SV3A 4WFHE 3T0DA 1DLHB 5HHNB 1EUUA 2COQA 5E2TL 4LPTA 5DQJA 2C1OA 1II4E 2QHLA 5F9WB 3FO2A 1EPFA 2JB6B 5DWUL 4EI5B 2IJ0C 4KZDH 3I6GB 4U49A 5L8JB 2DMBA 4NO2A 3ZO0A 1TZHA 3P9MB 1CG9A 5E99L 5GGSA 1HZHL 1YC7A 4M3JA 4ZFOB 3WL9A 1IGJB 5DK3A 3HRPA 3T0VA 1KC5H 2FD6H 4N90E 3HG1D 1H8NA 2DQEH 4HK0A 1P2CA 4JGJA 3K4AA 2DQHH 2EIZB 1WCBA 5IB4B 1Q9KA 5C71A 2ARWA 3E3QE 5BVPL 1U3HB 2ZOKB 2R0ZL 3MR9B 4PBXA 3SGKC 4K9EC 4ZFGH 4NM4L 3MFGB 3IFOB 3DYOA 2AEPL 4RGMB 2YPLB 1HI6B 2EXWD 4LLMB 2CKBB 2UZIL 4DZ8B 3DO3A 4N0YH 4PJIF 1Z0MA 1TVHA 4ONGH 2IBZX 5HDQL 1F3RB 3RHWF 5I9QC 1B4JH 5HHPA 4Y1AB 4HUXB 4WU7B 1G9NH 2MJWA 3WKMH 3PWPA 3QEQB 3GMOA 1J0IA 3C8DA 3CLFL 1PG7W 5FUZH 1YNLL 2IQ9H 1SJVA 2EYSB 2LTQC 4LVHB 1TJIH 3FT3A 1WEJL 5KN5A 4X6CB 5FB8A 2XN9E 3MLVL 5D93B 5GRUL 3PHSA 3TH4T 4RGOL 2NY5H 4XHQA 3C5JA 4Y4FB 3S34L 3U83A 3CFJA 3CFIC 4MHHI 1HNGA 4U2ZA 4ZFFA 4X7DC 5CCKH 3LV3B 3VFPB 3FQUB 3KGRA 5BS0B 5IB2B 4ODVH 3QJHA 2A9NL 3AREA 1NMAH 1HN1A 4Q6YA 5T5NG 4U1MB 4ZUVA 1AGCB 3MREA 4FQLH 4KDVA 4OZIA 1U8OB 5GGVL 1U41A 2JE8A 2JJSC 2UWEE 3RWEA 2KPNA 1MPAH 1CLOL 2XOTA 4K94C 4MJID 3QUXA 5FCUH 4G6MH 3HI6H 4NQTA 4W4OA 5EG6C 5EPMB 4F33B 1SYSB 1VA9A 4EI6A 1MCFA 3MV8E 5CD3A 4U4BA 4PJHE 2YOCA 4UI2A 4BK4A 1VGKA 3FMGH 4JZNA 5ACZB 2VLME 3VU2A 5LGJB 1PYWB 5EFIB 1S9KC 1AQDB 4LCYB 1K2DA 1X7QA 4X5LA 5JUEL 2JCCA 4PB9H 4QHLA 5JXAL 1J9CT 4W68A 1IM3A 3P11H 2VWEE 4MVBD 3DHJA 4LEOB 5E9DE 1VADB 2XKNB 1NAMH 3KLAB 2MFNA 4TULH 3O11A 4L4JA 1ZGLM 1U58A 3VXNA 4Q97A 4QYOB 3FO0H 2DQJL 3A6CH 4WNQB 3F7VA 2D7MA 1QSZA 1CGUA 4TNVF 1PBYA 4S1QL 5I8EB 3D3VE 3I6LE 4IJ3C 3KYOB 3EDJA 1EZVY 2A6KA 1HSBA 1PY4A 3DMMB 4FABH 4S0SD 1UWXH 2HT2D 4WEUD 1OGAA 3BIBX 1OSPH 5DJ6A 4EVNA 5T1KD 1LO4H 1YECL 2DN7A 1JF1A 4HFWA 3L1OL 1HYRC 1KCRL 3FJTA 3HC4H 4X7SL 3GJFA 2ADJB 1FL3B 1NBVH 3MRFB 2FYYA 3L7FA 5C7XH 4E5XA 4OV5B 2K1MA 1AD9B 3FHQA 5I1HL 4XP1H 3WFHA 2FDBP 3MRJB 2XIDA 4H1LB 2C3HA 5BVJA 5A3ID 1KN4L 2VZOA 3RBGA 4NZTL 1T04A 4G7VH 5H2BB 1ZEAL 2A73B 3T2PA 4FQ1L 3R8BB 3UPRA 3QWOA 1I1YA 3MLSL 1A4KA 3FQWA 4EXKA 5LG1A 2VOTA 5DVOA 1UCBH 2PF6A 1YQ2A 5JR1L 3TFKC 3L9RA 3WNNA 5JW4M 1A6AA 3KG5A 5DUMH 1FFNA 5DR5H 3ARZA 3AAZA 1DVFB 5JIKA 1GGBL 5LXGL 3OB0H 3IDXL 4PJ5E 5FGCB 2ITCB 3G6JB 4MZ3A 1RIVH 1OQOA 4GW1B 2P8LA 4TUJA 1T1WB 3H9SA 2K9UA 5ESQA 2CPCA 1NUGA 3ZSTA 3MXVH 4GUPA 4MD5B 2XQYK 4AEEA 3FB6A 1DLHA 3QCVL 4U1NB 3MLRH 2EDJA 5B38B 5KSBE 3QUZB 1TFHA 3VFUA 2FGWH 1UACL 2JB6A 3BAEL 4G6KH 4EI5A 3I6GA 2IGFL 4G9FD 5DC4B 4ZTPL 3L6FB 1CGTA 4I18A 3P9MA 2GJJA 4OFDA 4ZFOA 4HH9B 2B4CL 1IGJA 5F7LB 3VH8B 4WTWA 3O3UN 1P5UA 4JAMB 3MRHB 3RTQC 4EUPH 4QWWD 5INCB 3ORJA 3ULUH 4NKQB 4OUUB 4HIXH 1ZK9A 4LOUC 2EIZA 2KQMA 3H3KA 5IB4A 4PGDB 4NUGH 4DKEL 4OZ4B 1T1ZB 2O5XH 2ORBL 5T1DL 2A74B 1FPTH 2ZOKA 3QUKB 3MR9A 4NSKA 1Z2KA 4S2SB 5CBEB 4XVSL 4GAJH 4XBEL 3MRNB 3RVTD 3C08L 4JQXA 3IFOA 1KJVB 2X40A 2PW1B 2YPLA 1S7RB 3GHEL 2XTJE 1HI6A 2EE6A 1URLA 4LLMA 3QO0B 4DZ8A 4H20L 4NQCD 1EGJA 3PP4L 1MWAB 2ICWB 1EFXB 3QYCA 2Q8AH 4YXHL 3H3PH 3LOWA 1JGVH 3JSSA 1R5VA 4OLXH 1UH2A 1PLGH 1ZA6A 2X1PA 3IJYB 4Y1AA 3SKMB 4WU7A 2MPAL 5CZXD 3QI9A 3QXAB 3T3PE 3AY4C 3QEQA 3UJTL 3WNOA 2A0LC 2WBKA 2F53A 3QPQD 5T3XL 3SKNB 3C09B 3QIWD 2XT1B 1DBML 4HIJB 1MQKL 2HA1A 4X6CA 2MNUA 3SE3A 5I8KH 3L3HB 4Y4FA 5HDOA 4Z7UB 3FT4B 3RA7H 1FV1B 4JFZL 2HFFA 1QSFA 1GGTA 5EU4B 3VFPA 3FQUA 4S1DD 5BS0A 5HHOB 3FT2A 4M43H 3LKQB 1KTKE 5IB2A 4BA8A 5E9DD 4ZXBC 2A1WL 1A0QH 1W72L 4PGEB 1E28B 2B2XH 4PLKC 4PP1C 5JMOC 3OF6A 1YDPB 4NHCH 1U8OA 3TNNB 2OJEB 2DIBA 4K8RH 3ULVH 1A3LH 1EAPA 4QOKE 4XNZC 1MFBH 3V5HB 1XAUA 3MLWL 5FHAL 3I6LD 5EPMA 4WHYG 1SYSA 4JHBA 2JK5B 4MXQC 5F8QC 5HHME 2GTZB 3ELAT 4HUNB 5ACZA 3DX7A 1NUDA 4RAUB 3KPSD 3WKNA 2APVA 2AS5M 4Z7WF 1PYWA 5EFIA 3TT1H 4BH8B 1EMTL 1AQDA 4LCYA 5TFSL 1Y6NR 1M71B 4DKFH 2N4IA 2C3GA 4PS4L 1FNSL 1VADA 2XKNA 3MUGB 3KLAA 3VFRB 5TPWL 4PRDB 3LD8B 1HHHB 4WNQA 1G6RH 5LCVL 2ARJQ 3CFCL 5K9JL 1NL0H 1UM5H 1SYVB 5MEQB 5I8EA 4XAWH 1MRCL 4WW2F 3KYOA 3HG1B 3DMMA 2WBWB 5C9KA 3RPIB 1QQDB 5CMAB 4O58L 5KZCD 1MIEH 1CDHA 1FSKC 3FQNB 4DVRL 2ADJA 4PY8I 1FL3A 4ZODA 4XPAL 3VFVB 3GSNL 4M4RA 4OV5A 3LEVL 3HE6B 3QHZL 4PRAB 4PJ5D 4YUEH 5DJDB 4I3RH 1AD9A 5FYLH 3H2WA 3BD4A 3IJHA 4PGJA 4PJFF 1H8OA 1I3RB 1OWWA 5KOVC 4DOHE 4H1LA 1A7RH 2ZG2A 3GIZH 1AC0A 4ZS7H 4PRBB 4LP5A 1IC4L 1GGYA 4YAQB 4LHQB 4KROB 5H2BA 2A73A 1U9KA 4PJ7B 3WFBL 3NFSH 4LPYA 4TQEH 3CVHH 5CJXC 2R4RL 3KPRD 4NKDA 1XR8B 3RL2B 4YDJB 1XIWB 4AQOA 2G9HB 3VFGL 2AJUH 2OQJB 1DVFA 4QHKI 5I1KL 4FNLH 5I8OL 2Q20A 4KFZC 4FTVE 4LAQL 3VD9A 4PJ9A 1QFUL 1JYWA 2ITCA 3G6JA 5CEZH 4GW1A 5GS2D 1YEIL 3HMWH 5B22A 1FCCA 3C8KB 2KZWA 1CDCA 4LSPL 3SJVD 2YS4A 4MD5A 3AS3A 2BVPB 2HT3C 4PJBE 1G9NC 4XX1G 1T7XA 3O6MH 5DQDH 1F4XH 4BZ1H 4U1NA 1BQUA 3V0WL 5B38A 4WFED 4YDIH 3G6DH 1A3RH 4FP8H 4XP5H 5HYJA 3QZWB 1I9RL 4ZO7A 3L6FA 2H1PH 1TZGL 2NY5C 4KTDL 2GT9A 3PG2A 1B0RB 2X2YA 1RUAH 4HH9A 3VH8A 5E8NB 3QRGH 5CILH 4JAMA 1IRAY 2HKFL 3MRHA 3IJSB 5INCA 4ZOBA 5EZOL 5TE6H 4GRWF 1QRNB 5GS0C 4GMSH 4M61A 2BRRH 4S0TD 3RY6A 4PGDA 4OZ4A 1T1ZA 1MRFL 3V6FB 5FECB 4WI9A 5LVEA 1GOFA 3QUKA 1SY6L 4MD4B 2OS7A 5CBEA 3CIQA 4S2SA 3SCMD 3DURA 1UVQA 1NBZB 3VRIB 2YC1B 3MRNA 3GZKA 4UB0H 5ECJE 1KJVA 1KPRB 1S7RA 4NN6B 4PJGE 5D5ME 4BZ2L 1J0YA 4X6CE 3QO0A 3O2DH 3DO7B 4M1GH 1MWAA 3U46A 2ICWA 2X4OB 5T1KB 3BI9X 1EFXA 2MHAB 1JMZA 2YZ8A 3KPPB 4KZEL 2XZQH 3SKMA 3SE4A 3IJYA 4TNWF 4U0RB 2OZ4A 3MA9L 4M9PA 3VWKB 1ULVA 2CK2A 3V4VH 5IBTH 3RFZC 5I1GH 4KQ3L 5JOFB 2HMIC 4HIJA 4BKLB 3MRQB 5ACMA 5L88L 3L3HA 2P46B 1SBBA 1DQDL 2VXVL 4L29A 1NEZG 1OTSC 4Z7UA 3FT4A 1FV1A 2BMKA 2YPVH 4L3EE 1SBSH 4JFHD 1LEKB 2CD0A 5EU4A 3TFKD 3UBXI 1NGXA 5HHOA 2CUMA 1FNHA 3LKQA 4HG4K 5F8RC 4OGXH 4FFZH 4UNTA 4H0HB 1FNAA 3UCRA 4PGEA 1UGNA 3ARGB 1E28A 4Y0GA 5C6TH 4GRLD 4RQQA 4PLNC 3HNTH 2XZCL 1YDPA 4KAQH 1IVLA 2EE2A 3JTTA 4IMKA 3TNNA 2OJEA 3MZGB 4XNMB 1CGYA 1LDPH 5F9OL 3QUYC 4F15C 1JVKA 3V5HA 4PR5B 3AM8A 4L1HA 5CD5C 4JLRA 3O2VH 1AJ7H 1UM4L 2JK5A 3SDXA 2WUBH 4EDWL 5IVZB 3HCVB 5SWSD 4GQ9L 1T6WA 2GTZA 3V2AR 1UYWH 4RAUA 1N0XL 2B1HH 4FMKA 4BH8A 4ODUB 3NCYS 5T33H 3CDGB 5F21B 1LEGB 1M71A 3QIUC 3BKJH 3GMRB 2ED8A 5BW7A 1U42A 3MUGA 3HNSH 1KCUL 5SX4I 3T2NH 3RTQD 1RZKL 1HHHA 3K2MC 2DIAA 1M7DB 3L5XL 3O3DB 1A7PH 4LOUD 3L3DA 4HAFA 4POUB 1SYVA 4WIQA 2NY7L 2DQIL 1RULL 2FLBT 3S4SG 3IAPA 1EO5A 2NY6C 1UWXK 3HG1A 4HX1B 4WHYH 1C5BL 3RDTC 3B5TA 1H9VA 2B20A 3ZKSD 3RPIA 1QQDA 2ARJB 1K3IA 4ERSH 2CLVB 5CMAA 5TDNB 3FQNA 4L4VE 5D1QC 1YJDC 3VFVA 1KGCD 2VSDA 4PJCF 5BJTB 3VRLF 4UNVA 2P5WE 5GGTA 4FTVD 3HE6A 1FDLL 4HS6B 3QQNA 3BW9B 4JQIL 4LQ1A 1OD9A 4DGVH 1ZS8B 1EO8H 4NQCB 2A0LD 3FFDA 1Z9LA 3FRUB 5D8JL 3ULUC 4O02H 4PRBA 5LGHL 3A6BH 3QULB 2OTUB 4YAQA 4WY7H 4OIBA 4HS8H 4CAGA 1E0OB 5C08E 1PKQB 1IGTB 1G9EA 4PJDF 2IC2A 1VESA 4M1DH 4FOMA 4PJ7A 5I75B 1OP5H 4XVJL 1NGQH 5HD8D 3RL2A 4YDJA 2Z9TA 1IGCH 2G9HA 3VDBA 1PAMA 1JZ8A 3IS0X 5I76B 2W9DH 2YA0A 4ZXBD 2KBGA 4OF7A 5CUSL 4ZPTB 1ZGLB 2DWDB 4PP1D 3LAFA 1XF1A 1Z5LB 1LGVA 3UP1A 4JHAL 2J88L 3GMPB 3JV5A 1A6UH 3C8KA 3RIFF 1DN2A 1C5DB 5F3HB 2BVPA 4ENED 2RAMA 4I0CC 5SWZD 4U6HB 1FLTX 4JDTH 1GL4B 3G5YB 5DUBB 3MNZA 4MXQD 4JN1L 5JQ6H 2GFBB 3UTPE 4JG1H 3MRKB 2BERA 3OJDB 4N0FB 3I75B 1B0RA 2VZTA 5IQ7L 3OKOA 3DVNA 5EOCH 3KPSB 3UBXB 5MP6L 5IK3B 4H25B 1J88A 2CDFA 3IJSA 3QSKB 1J8HE 4Y4KC 3D69B 1PG7H 2EDTA 1IQWL 4HUMB 5E95B 1MCIA 3FL7A 3V6FA 5FECA 4K8RC 4NRZB 4TUOB 4ZSOB 1ZANH 4MD4A 5EOTB 1OWRM 1UKSA 4N5EC 4NWUL 5DZNA 1NBZA 4MA8H 2P8MB 4MB5A 3VRIA 3LRSB 1RJCA 4LSQH 1KPRA 2UVFA 1T1YB 5F6IC 2O26U 4JKLA 5ACLA 4DAGL 4Z7VF 2Q6WB 3LEYH 2NY4C 2AJSH 1JPFB 1FRGL 4LU5L 3RZCB 5MENB 2X4OA 5T1KA 2MHAA 1KB9K 4YR6B 2XZAL 4CN1A 1IKFH 5KZCB 2MSPA 1UH3A 5FM4A 4PJEB 2CO6B 2P7TB 4CVUA 4JHWH 4KXZI 1ERNA 5IWLA 5I9QB 4FHBD 4NWTH 4XNYH 4HCRA 4BKLA 3P4NB 3WIFB 4Y19E 5DVNA 3MRQA 5MEPA 2D9CA 1QBBA 2NY1B 3C2AH 4G8EB 4V2BA 1IEAB 5BZWB 4HV8B 5CJ8A 4HKBB 2LFGA 1YPZE 2LTQB 4RFNC 2Q3AA 1LEKA 3OAUL 4IRZL 4P99A 4KVCL 4MWFB 3V0AC 4ODSH 5E1HB 3M1BA 2G75B 4MXWL 1ZT7A 4HBCH 3K46A 1KG0B 4ZFOL 1AQKL 5IKCA 3KPRB 5BMFL 2HRPH 1V3LA 4MZ2A 3L95B 4XNMA 3BRFA 4IMLB 1F58H 1X5JA 2CKNA 4TSBH 1OAQH 3TT3H 4PR5A 4OLZL 3TEUA 4QY8B 4QT5B 4CVZB 1FLRL 1A6WH 2GJ6B 5ETUB 5IVZA 3HCVA 4WRLA 3PV6B 3SJVB 1CU4H 3JV6A 2NW3B 3BIKB 4YFLI 4ODUA 3V7AG 2OL3H 3ZYJA 2EDYA 4JY4B 3CDGA 5CSZB 1ITBB 1JNNH 1LEGA 3O6LH 3WNLA 43CAB 3B9VA 4L4VD 3GMRA 4HK3N 2CKBL 1OAZH 1JNLH 4HMEA 5LAXB 4EKXA 1J0ZA 2P5WD 4G9FA 3P9WB 5L7XH 3VD7A 4NQDB 4X4ME 1OLLA 5IVXF 3O3DA 2ICCA 3WJJC 4XXDB 5L0QB 1KB5H 5ESVB 5GGQH 1QZ1A 3QHTC 4YWGH 1F8TL 3RY4A 2C4FT 4UQ3B 4PV9B 1QHPA 1F3DJ 4HPOH 1F45A 3R1GL 4FG6C 4TTDD 3QAZB 2J12B 5EBWB 3O0RH 3O2WH 2CLVA 2P48B 2Y06L 3EOBB 4MNGB 5TDNA 3SCMB 1NLBL 3BE1H 3R0NA 2QL1A 3LHPH 4PIRF 3N1MC 4MJ6B 1NGYB 2Q7NA 1YQVH 3UYRL 1MHPH 1G9MH 1E4JA 1KLGB 1F13A 5ANMA 1TETL 4HS6A 4YLQT 3BW9A 4OZHB 1ZS8A 5E2UH 3D1MC 4NQCA 5KSUA 15C8H 3MLUH 3S35H 3R0MA 4P46C 2E7HA 1LDSA 3QULA 4G8FA 2HMID 2OTUA 4Y4HC 5IGXH 1PKQA 4K7PH 1JPSH 4PREA 1IGTA 3CAFA 2CJUH 3WEXB 3QWQB 2RCSH 1OTSD 2VL4A 5C0BE 2X05A 5DEGB 5E24E 1UA6L 1WFTA 5AAMA 1QNZL 3P0GB 1QPPA 4YK4C 3F65A 4FZ8L 4I3GA 2PXYC 1BFTA 5EIIA 2BNRE 1OARL 1P53A 5I76A 1KCSH 4L1DA 4U1HB 4UV7L 5I66B 4YZFE 4ZPTA 2CRMA 4M62L 1ZGLA 2DWDA 4OI7A 1Z5LA 1J8HD 2Y07L 3GMPA 1C5DA 2HYMA 4AEIH 4GRLB 5CD5D 3VMPA 4U6HA 4FRWA 1ZWIB 3G5YA 5DUBA 1GHFL 2D31B 1QRNE 1KPUB 4P9HH 5D2LB 5I6XC 5F9JA 2GFBA 3LS5L 3MRKA 2HAZA 5DVKA 4N0FA 3I75A 3IKKA 3PQYB 3VWJC 3AUVA 1MRDH 1QO3B 4XH2B 2BXYA 1G0YR 5SWSB 4KJQC 1OVZA 3KPSA 2YXMA 1JTTA 5IK3A 4H25A 5C0NC 5B8CB 2XKSA 4K55A 3PL6B 2HLAB 5IVNA 2LABA 4MS8D 1ED3B 3D69A 4JCMA 1JZ7A 2ZOLB 1MFNA 3D9AL 2QADB 3RTQB 4UTBL 5HHXL 1KIRA 1BECA 2NY6D 4NRZA 4JO3L 3T1FA 3C5ZC 1YEFL 5ICYB 1SM3L 5EOTA 4JKPH 2IPKB 4HLJA 4UOW1 2NR6C 1FYTD 2P8MA 3LRSA 4MB3A 4UBDC 4J4PC 3RDTD 1IC5H 1TQCC 4HUVA 1A4JB 1T1YA 1E4WL 2VLJB 1DANU 1CXFA 3U0TB 1CFSA 5I18L 3GM0A 4OD1H 3SGKA 3D25B 5D1QD 2RR3A 1JPFA 3RZCA 5C0RL 3TNMB 4R96B 2BFVL 4YR6A 1IAOB 3V5KB 1LP9B 4F9PA 1OM3L 2XQBL 3UTTD 5ID0A 2P44B 4PJEA 3LZFL 5CHNA 2P7TA 2HVKA 3ULUD 4OZGE 2ZUQB 3D0LB 3PDGA 4LSSL 3UZVB 3WLWC 3QO1B 1RZFL 5BV7H 5C0CE 2LVCA 3WIFA 1I7UA 4GLRH 5CKAA 1B0GB 4G8EA 3V4PL 1AKJD 1IEAA 1AHWC 4G7YH 5BZWA 4UT7H 5GSVB 4HV8A 4BFIB 4HKBA 4PYHA 4JM2B 1KENH 2AJ3B 3EFDH 4MWFA 1MF2L 3QXUA 2ZPKL 2G75A 1CE1L 2F5BH 5F7NC 1KG0A 2E3VA 5KS9A 2O5ZH 3ARDD 3KPRA 4XI5C 2VMFA 5IG7A 1OP3K 3U9PL 3ZE1E 3L95A 3UZEA 5EBGA 3J7HA 4IMLA 4KY1H 3KPOB 4ZXBB 1QFHA 5B3JE 3VI4E 2FWOA 4QY8A 3CC5B 3VFTA 2X9YA 2G60L 4QT5A 4CVZA 4OGAC 1FORH 2JJSA 5ETUA 1HWHB 3QXDB 5LWYH 1NDGB 4EQ3A 1UWEL 3PV6A 4XNZB 3SJVA 4X6DF 3BIKA 1EJ6A 1QBLL 4JY4A 5SWZB 1RIUL 3MLYH 5CSZA 5CS7A 43CAA 1TNMA 1RPQA 4HIHB 5TE7L 4D9RD 5LAXA 5C07B 2BHUA 3VGAB 1B90A 5JHLH 5BRZE 4UZGA 4Y4KD 1MWAL 2Y5EA 4O9HH 4XXDA 5ESVA 3WO3B 3NABL 1HILA 3K1DA 4MNQE 3OAYH 4UQ3A 4PV9A 2OLDA 2VKWA 3HNVH 4K8RD 3ULVD 4N5ED 3WUWG 1MJ8H 1BAFL 5E4EC 3ETBF 3WYRA 1NUNB 2X9WA 1D9KB 4HD9A 2VXQH 5EBWA 5C0BD 3RGVC 4U1GC 4Z7NF 4MCYB 4RFOL 1J86A 5DFTA 3BPNB 5ALBL 4MNGA 1N4XL 3SCMA 4M6AA 5HYSB 4L5FL 5FUCC 5CGTA 3M8OL 5KVEH 5IBLC 1NGYA 1BREA 1N59B 3P30L 2YD6A 1SVZA 5KVFL 3GSXB 1KLGA 4TSCL 1CGSH 1ZE3C 4OZHA 1OQXA 3SDCB 4FQIH 1PX4A 4DFIA 1OCWH 3VXQB 2EKJA 4XC3L 3DUSA 4OQTL 3OQ3B 2D7TL 1YYMH 5KJRH 3WEXA 4AYFA 3K8LA 4XCFH 5CP3A 4TPRL 3SGDH 1TMCB 4UOW0 5DEGA 4KK6C 1Q9LB 1FNEB 4XNUL 3RVWD 3Q3GB 5J9PB 5D6DC 3TYGH 3MGOB 2B39A 4HWBA 2WM0A 5I66A 5KVDL 1HWGB 1JYXA 2HWZL 5DRXB 3H7LA 5I1DB 4MJ4A 3IFNL 3MLXL 5IESL 1C16A 5F7FA 3UTSB 1E4XI 3BQUB 2IG2L 1AY1H 4HBQA 1YEEL 4JFEB 5C2UB 1I8MB 5FYLD 2DWEB 4NM8H 4GRLA 1H3XA 1D6VL 2H32H 3QDGE 4WEBL 2DJSA 5C09E 3P4LA 4POZD 2D31A 2MTPA 1UWGL 1KIUA 5D2LA 5EC1B 1OSZA 2CK0L 2YSSA 2X4QB 3CLEH 1DL7L 4P3WA 4QTHB 5TF1L 3PQYA 4ZSOE 4U31A 1T1XA 1QO3A 4XH2A 5SWSA 1DZBA 3RBSA 1Y6MR 4RMUA 1NAKL 5F7EL 1CLYH 2EE3A 2AXJA 3NCYP 2HLAA 3PL6A 3VXOB 4QRRB 5GGTL 1ED3A 3BH8B 5EU7C 4ALAL 5DMKB 1N6QH 2ZOLA 4LGPB 2QQNH 5MENE 3VI3F 5CEZD 3VXUE 3RTQA 5JOPD 3EYSH 3VXSD 2DKUA 2ZUSA 4J3UA 5ICYA 4Z0BL 1ADQL 1D5MB 3PGFL 2DD8H 4RGNC 1CDYA 3QEGH 4LL9A 4S1RL 5ITFA 1A4JA 3MMEB 3U0TA 35C8L 1A7BA 1ZLUK 2J2ZA 3D25A 3S8WA 4X7TA 1UENA 5IFAL 2VH5L 4HGKC 1T0NB 2D9QB 3NAAL 3TNMA 2OJZH 2VXSH 2FJHB 4R96A 3MOAL 1BIHA 1RJZB 5ABDE 3V5KA 1LP9A 3SKJL 1CFVL 5DK2B 2XWBB 3BDYL 1RUPH 4Q58C 1TVBB 4XPBH 3ESUF 4P46D 2JELH 3D0LA 4ZUTB 1WICA 3GB7B 4Y4HD 3QO1A 2BXZA 1B0GA 3AY4A 4H26B 5B39B 3FQTB 3MGAA 5GSVA 4FQJL 5DVMA 4BFIA 4XMLH 4JM2A 4YFDB 4IBLT 4MDIB 4U33A 2F9BT 1INEH 3RWGB 2J6EA 2AJ3A 1GGIL 3CJJA 3SDYL 2W0LA 3B43A 4FQ2L 2GJ6E 2PXYD 1SMAA 2Z8VC 1U92A 2D0GA 3MLTB 2ZSVB 4PJHF 4M5YL 2NXZB 3U4EB 5F7DB 1CXLA 4FFWD 5BRZD 1P7KB 1QR1B 2JIXD 3KPOA 3OG6B 4ZXBA 1ZLWK 3HE7C 1XGYL 1X5GA 4MNQD 4QRPB 4ZAKC 3CC5A 4NN5B 3PJSB 4NQDE 3LKPB 1WK0A 1Q0XL 4XNXL 3PWNB 1FVDB 4F15B 4WO4C 4XX1E 1P84J 4MGXA 1P9MA 5SWZA 3HFML 1NKRA 5D96C 3VWJD 4WI4A 5EO1B 4KJQD 2OR7A 4HIHA 1J1XL 2CDGA 3FO9B 1F6LL 5C07A 1MAML 2BSED 1OOAA 5C0ND 5JIPA 3CXDH 3IXAB 5F96L 3T4YA 2E6QA 4JQVA 4D9QD 4ELMB 2C26A 1FBIL 2Y25A 1OF2B 1S7VB 5TE4L 3T4AB 2ZKHL 4QRUB 4Y89A 2HJLB 1V7NH 3LSOB 3C5ZD 1EHAA 4LPCA 1LE5B 3VG0L 1WAAF 2NR6D 2ZCHL 3MNVB 4HCRL 1D9KA 4UBDD 4EBQL 2CLZA 4J4PD 1B2WL 4GKOA 4GRWH 4ODHL 2W60B 4KI1A 4UIMB 4MCYA 1A6VL 4P9HC 1MIMH 5HYSA 4P5MB 4NKIH 1FYTB 3JXAA 4Z8FL 1DUZB 1N59A 4FXKB 3QNXB 3RUGF 4JB9H 3GSXA 2VDLH 5D6CB 1VFBB 1F4YL 2BC4A 5BCAA 2VISA 4IOFD 2D0FA 4OI9A 4R97B 4MA1B 2CRYA 1XGQA 5EU7E 3SDCA 5F70A 4EDXB 3T09A 5T3ZH 1U6AL 3QDMB 3VXQA 3V52H 3Q5TA 4NP4L 1L9NA 4HF5L 4TUKL 4XMPH 3RHWK 2J4WL 3UTTB 3ZHLA 4P2CG 2VNCA 2VN4A 2F8OA 4EUPB 2QEJA 3HB3C 2EDLA 4O5LL 3WXWL 1Q9LA 3GKZA 3A67H 1FNEA 4L3CA 1QLRA 4PG2C 2AJVH 2P8PB 3Q3GA 5J9PA 1VEOA 1AKJB 3CUPB 3WNPA 5E70A 2WANA 5CJXA 3BKYL 4X5XB 4TRPL 4XI5D 4JANB 2BVYA 4JDVB 5I1DA 1X3DA 1MAKA 2B0SL 1K5NB 2DMCA 5TQ0H 3FQRB 4JRXB 3RI5F 4JFEA 1I8MA 3CK0H 2DWEA 4UT6L 3S36X 4JKKA 3ARDB 1N5YH 1NCDL 2J8UB 4TN9A 2R4SL 2BJMH 1FAKT 1HKLH 1YEHH 3ARQA 5BV7C 3QRFM 2X4QA 4QTHA 4LLQB 4LSUH 3ARFC 3OR7A 3WDIA 4I1NB 1YEJH 3TBYA 2IFFL 4CN4A 4Y5VC 5SX5K 5FA3B 3MYJB 1F00I 2ERJC 2BDNL 4U1LB 3SDAB 1C12B 3HI5H 3F7YB 4NGHL 1SEBB 2AV1B 3RJDA 2VLJE 2JJTA 4OD3H 1GC1H 1HIML 5E2VL 3VXOA 2XA8L 4QRRA 5KSVB 3BH8A 3DVGA 4D94A 1IFHH 3DARA 2DYPB 2J7LA 1G7QB 4ISVA 3FRPG 5DMKA 3IDIB 1WT5A 3BPOC 3FO1B 2YD1A 1P4LA 4OAWA 1MJ7H 3WCYA 4PRHB 3M17B 4TSAH 4NNPH 1P6AB 4LHUG 4TVPE 1D5MA 3EYUH 3QG6B 4KTEH 4O4YL 4PJIE 1PVHA 4QEGA 1X6NA 4TNVK 4P2OC 3MODH 3RGVD 3QDJD 1JIBA 5FYKE 3MMEA 2EDOA 3Q1SH 1UB6B 4Z5RB 4PJAB 3X12B 3HMXH 3LS4H 2AXHA 1T0NA 2DBLH 4OZIF 1DN0B 2FJHA 1RJZA 5GZNC 1BJMA 2YUWA 4FFYL 4DUVA 3C6SB 1KXQE 1E4KC 5DTFB 3IGAA 2X44D 3B9EA 1RK1B 2E27L 1TVBA 1KFAH 4ZNEE 2ZJSL 1KACB 2P43B 4ZUTA 2NY2D 3GB7A 1UQSA 3UTOA 1NAMA 4X6EB 5C70A 4H26A 5B39A 3FQTA 1UKQA 3EYQC 2MCG1 2JCCF 4KK6D 4MDIA 4K2UH 3RWGA 1I9JH 4ELKB 4G80B 4YXLL 4C59B 3I9GH 2ZSVA 4OQ1A 1P4IL 4V1DD 1EXUA 3MBEC 3QUMH 3U4EA 3HKFA 5F7DA 4JRYD 2VLRE 3IKCB 1FVCB 4CADB 1P7KA 4P9ML 2HVJB 2FH6A 4JFYA 2VXTH 4AG4L 1GZQB 3SQOH 2A9ML 4LPUA 4YDKL 1T0PB 4RWHA 1C5CL 1FG9C 5JOEA 3I2CL 1FVDA 1JHKL 1G7PB 3PF2A 3S36L 3AROA 2VC2L 5EZJB 1M4KA 1I7RB 1MOEA 1RZJH 1OPGL 2MMXA 1GIGL 3FO9A 1ND0B 1KNOB 4Z18A 2EEDA 4C57C 4LP4A 3HRZB 3IXAA 2FX7L 3BD5A 4ELMA 1CXHA 1JPTL 1BMGA 2ZCLH 2HFGL 3CVHB 3OAYK 1MI5D 4R3SB 1OF2A 1S7VA 2NLJB 2WP3T 3T4AA 5E6IC 3WFEH 5E8DH 4JG0H 1G7LB 3WV0A 4JO2H 1NSNL 1X44A 2HJLA 3LKOB 3LSOA 5GHWL 1LE5A 5HHQA 3MNVA 1NGPH 4LVNC 1Q72L 4RGND 1I8LA 1U0QA 2RIKA 5JW5B 4GFTB 2W60A 4UIMA 3FCTB 3PXJA 3OKNA 3U4BH 1NLDH 3VXSB 4MXVE 1D7FA 4OM1H 1X5YA 2FB4L 4HDIB 1FYTA 2UV3A 5GISL 4Z76A 1CZ8L 1DUZA 4FXKA 5GRVL 4QXUL 1UEYA 2KZ1B 4IOIB 1VSCA 5D6CA 1CN4A 2FHBA 2FX8L 2UZXB 4OD2B 3S88H 1I4FB 3D39B 3OHXB 5D1QA 3JWNC 3L5JA 4OIIL 4LCIL 3B2VL 4EDXA 1B88A 2XACC 5F72S 2R1YB 2VDQH 4J3OC 3RAJL 3QDMA 1KOAA 2GUOB 2PTUA 5HVHC 3ARBC 3UTTA 3UTSE 5D7IB 3ZTNH 3QQ3B 3MV01 4EUPA 5EZIL 3N1QC 4M7LH 3P40A 1BFSA 2P4AB 5CLWA 1KJ3H 4PTUB 3ULSB 5T1LD 2R0KH 3H6JA 4OJFH 4GW5B 2P8PA 4KKBC 1AKJA 2X4SB 3CUPA 1UJTA 3NCJH 2QSQA 2DDQH 4X5XA 3BN9C 2EE9A 4JDVA 4OCYH 3EYFB 1EDQA 3PHQB 3ZKMC 1IZKA 4C58B 4WW2C 3CX2A 3FQRA 4GKNB 1RURH 2PXYB 4JRXA 1MVFA 3KPTA 1VHPA 3HE7D 3MACL 1KTDB 3ARDA 3O6FC 4ZAKD 3MCLH 3JWOL 4GS7B 1NMCB 2AGJH 4Q9BA 4HZAA 4EOWH 2J8UA 1JFQL 3DBXB 3HN3A 4FQXC 4Q9QL 5FOBB 1U8LB 5GJTH 4R4FH 4WO4D 3JZ7A 3IAGC 4LLQA 2LU7A 1AXSB 1L7TL 2UY7A 3UDWC 5FEBA 5DLMH 4UMGA 5DWUH 5I6XB 4PJXB 1ODAA 5EUOB 3SDAA 1C12A 4CGTA 1F4AA 1WFNA 1D6EB 1SEBA 5EUKB 1DJSA 3ZE2F 4DZBA 1PZUB 2ADFH 5E99H 5GGRB 4ZD3L 1HZHH 3UEZA 1S7UB 5KSVA 2DYPA 3UX9B 3MJ7A 1G7QA 4AQ1B 3IDIA 1A2YB 4X6CF 4F3FB 4R0LC 4UNUA 4M7ZC 3FO1A 2KL6A 2VUYA 4PRHA 4JZJB 4U2YA 1S9VB 3IF1B 4CMHB 1MHHB 5FUOH 4HXBL 1JPST 3B9KC 1NFDB 5JORB 4U6TA 3BKCH 2Y4SA 5BVPH 6FABL 3PP3H 5CJQH 2R0ZH 1I85C 3DV6B 4FXGB 2BRQA 2P5ED 4F58L 1UB6A 4Z5RA 4X0KB 1OAXH 4PJAA 2AEPH 2WNGA 5D7JC 5DMYA 1TQCB 1DN0A 3AMKA 2OTWA 4K7PY 2CR6A 2LU3A 3S37X 2UZIH 5JIHA 4R7NA 1NC2D 5E08L 1Q1JH 2FBOJ 3C6SA 5DTFA 1DBAH 1D5ZB 4W4NA 3MUHL 1T22B 3NPSC 5IBUG 4MX7B 3B3IA 3KYKH 4X6EA 3CLFH 4DW2L 1A1OB 1A1MA 4ZG1A 4WGVB 3HB3D 3VXTA 1PFCA 3E6FB 1SQ2N 2PR4L 4QRPE 1G6RA 4KGLA 5GRUH 3MLVH 1FC2D 2V5YA 4JY6B 2E7BA 4GKZB 4UU9B 1XF4B 4ELKA 4RGOH 4G80A 1S5IH 5D1XC 3NACL 1AHWB 1CF8H 1CTOA 3S34H 2DBJA 1XGUB 2WP3O 3IKCA 4CADA 4IRJB 1YMME 1JTPA 2HVJA 3FONB 4P2QE 1A02N 1NKOA 1TJHH 2P49B 4OCLC 2A9NH 4AH2B 2VRAA 3OXRB 2ZUVA 2PTVA 1NCCL 4Z7WE 4HGMA 3DWTA 3HLAB 1I8KB 3P4OB 1CLOH 2HH0L 3WFCH 2MKLC 5I8CA 3KYNB 2APBA 6CGTA 1G7PA 5EZJA 5FHBL 1U8KB 3ARFD 2Y36L 3EJYC 2NYYC 1I7RA 2W9EL 5BQ7B 3LPWA 3EFFA 4JFDB 4H88L 1ND0A 1KNOA 5AWNH 4DEPB 1RZIB 4R9HA 4XXCA 3N50A 4P4KC 1JGUL 4NO3B 4WJ5B 5JXAH 4F8TA 4HMDA 2OTPA 5IP4A 3CVHA 3WS6A 4R3SA 1E27B 2I24N 2YR3A 3ZYOA 4HKJB 2NLJA 3AXLA 4TVPL 2Z31C 3TVMB 1DLFH 4G5ZH 1G7LA 1L0YA 4EIZC 1F5WA 3KXFD 5FGRA 2E6JA 3T0EC 4K3JH 1E6OH 2R56H 4P2OD 2R2BB 3FCTA 3E8UH 3VXSA 3RNQA 1GPOH 3HC3H 3BP7B 4LMQI 4PJFE 4HDIA 1IGFL 4LLDB 1U8JB 3EUUA 3G6JF 1B0WA 1YECH 3RVXC 4XPTH 2EDHA 2WUCH 3QDJB 4OD2A 1CT8B 1I4FA 3D39A 1H3GA 3QG7H 3OHXA 3EOTL 4QXTB 4I3SH 3U1SL 4CU7A 3G5VB 1V3MA 1KN2L 3NTCH 1ZXQA 4M8QB 1P7QD 2OR9L 3S37L 2GUOA 4PJ8B 5I1HH 2YD7A 5EA0L 3VGBA 5F1NB 5D7IA 1ROWA 3QQ3A 5IROC 4JRXE 4TNWK 1YNKL 3FZUC 5D1ZB 4JR9L 1WWWX 1ZTXH 2C1PB 3IDGB 1TVDA 4PTUA 3B6SA 1DQQB 1WVZA 2IAMB 3ULSA 2YXFA 2NY2B 1TJGL 3V6OA 3C9NB 4FQ1H 4EIGB 3KJ4C 2X4SA 1K6QL 5DQ9B 3MLSH 1LO0H 3MBED 1X4ZA 3EO1B 5JR1H 2PYEB 5AAWA 1UT9A 5HVGB 3S3JA 4LIQE 3LDBC 1BPVA 3PHQA 4MAYB 2DI9A 3UMTA 4X9GA 2QSCL 2PXYA 4KK8D 3ZYZA 2UVEA 1NGZB 3IFPB 1GGBH 5LXGH 3IDXH 1KTDA 4V1DB 3O2DA 1UJ3C 2VR5A 4JRYB 4AEHL 1MNUL 3LB6C 1GSMA 2DQTH 1K8IB 1LO3L 2YKLH 32C2A 1NBYB 2JIXA 5FOBA 1U8LA 4KU1A 4QGYA 5IT2L 3VA6A 4BQCA 4JFFE 1FVEA 3QCVH 3UJJH 5L2KB 5DJZB 2EC8A 1AXSA 2IEPA 1X5HA 2AJZB 5I1IL 4UT9L 3BAEH 2FIKB 4PJXA 4QRSB 5EUOA 1KV3A 1D6EA 4ZTPH 5INDB 3QCUH 3VWJA 2ATKB 4YBLB 3MJGX 3W82A 5A40E 1S7UA 1YMHB 4CBPA 2ZCKH 4YHKH 5FM8A 2VDNL 4N0RA 2WLZA 5E6ID 4LPWA 4OTXH 1IGYB 4JZJA 1UXSB 3FTGA 1S9VA 3IF1A 4Z7UF 5DGRA 4XAKE 2E7LC 1MI5B 4WDIB 3RP1A 3WHE1 1NFDA 5JORA 4YHNB 2E9IA 4DKEH 2ORBH 4DN3L 4GRMA 5T1DH 2FO1A 3DV6A 2FD6L 4KRMB 3C5ZA 2DQEL 4X0KA 4XBEH 3C08H 4J4PA 4MQ7B 2EIBA 3C60C 3GHEH 4WFFE 3B2UC 1J87A 1YMMD 4H20H 4P2QD 2LVEA 2GY7B 1NEZB 4P3DB 4S1SL 1D5ZA 2OL3B 1T22A 2XFXB 4M93C 2ICES 4JVWA 3MRCB 1NMBL 2EDXA 5CKGA 2K3TA 1HH9B 2MPAH 1G0XA 3T0EE 5DHVH 4N0YL 4PPTA 5T3XH 2M1KA 3PIQA 1DBMH 3E6FA 1I1AD 4ONGL 1BF2A 3TBSB 3BYYA 1OAYH 1KB5B 4JY6A 4GKSB 1B4JL 3U82B 4GKZA 3C87A 1XF4A 4UU9A 3U7YH 3HPLB 4W6XB 3L5HA 3Q48A 4GLRI 4KKBD 4YX2L 1AHWA 4U0QB 3WLBB 5FUZL 1HHGB 3WN5B 1XGUA 4UAOC 1W0YT 1ZVYA 1BZ9B 3BN9D 5T1LB 1WBXB 1QLEH 2AV7B 4GW4B 1TJIL 4IRJA 4PRPE 5EBLB 2EDKA 3FONA 5CGMA 3ZKMD 1JUFB 2A6JB 3UAJC 1GRWA 4AH2A 2A1WH 3V4UL 3OXRA 1FL5B 4M03A 3O6FD 1N26A 3D18B 5CIPB 1XMWA 5CCKL 2V9RA 3MRDB 3HLAA 3QDAA 1I8KA 4FQXD 3KYNA 3MLWH 1NMAL 4NQSB 3RU8H 3RIFK 5FHAH 4AIOA 4FQLL 2G5BB 2ESVE 5BQ7A 4FQHB 2GSIB 2YN5A 1JYVA 1MPAL 5FCUL 4G6ML 3HI6L 2VR9A 1EMTH 1RZIA 2R1XB 3QB7C 4W70A 1TIUA 4L8SC 4LCUB 4L3AA 1FNSH 1EAJA 5HGAB 2EO1A 5TPWH 4HKJA 1BQHG 3FMGL 5HJ3B 3TVMA 4HUWB 1RU9L 2IALA 2VLKE 4PJ7F 3IRZA 5K9JH 3HUJA 4RWYH 1SJEB 3W39A 5IMLB 3WO4C 3B9KD 2V2TB 2XQYG 4R8WL 5GZOC 5F44A 5FCSH 5A2LH 5D9SB 5I1JL 4PJCE 2R2BA 3VRLE 1MEXL 4OGYL 4GSDH 4OCSL 2H45A 1G0DA 5HGHB 3BP7A 4BQ8A 2OBGA 4Y5XC 2XRAL 4CKVX 1N0LA 4YQXL 4LLDA 5D7JD 1MCCA 1U8JA 3EDDA 5K9QG 3OZ9H 3MBXL 3QDJA 4X4ZA 4O58H 1CT8A 2P5EB 4X83A 2ICWJ 4DVRH 4ESKA 2GK2A 4FABL 3PWJA 4JDZA 5FF6B 3UPAA 1CYGA 4PJDE 3GSNH 3O4OB 3WSQH 1MCSA 3LEVH 1JV5B 4L4TD 4M8QA 1BLNB 1PKOA 5DJ8B 1LO4L 2AI0H 1ORQB 4PJ8A 3INUH 3QIBC 5F1NA 2K7PA 2XWJB 3NBNA 5ISZE 3TA3C 2R69H 2A38A 2C1PA 3IDGA 4OI8A 1DQQA 3ES6B 3KS0H 3OGOE 4XP6L 3WHE0 3ZT6A 4KUCD 2X6MA 3C9NA 5GRZA 2DOCA 4Y8AA 2NZ9C 4X6FB 3CVIL 1I1FB 3WFBH 5J57B 5DQ9A 3IDNB 2EYTB 4F9LA 2R4RH 3EO1A 5D6DA 2QQQA 2WK2A 3VFGH 1QSEB 4G7VL 3THMH 2H6PB 5I8OH 1NGZA 1TITA 3IFPA 3N1PC 2ZG1A 3T2QA 4V1DA 1QFUH 5K9KA 2H9GB 4JRYA 3AS1A 1UCBL 1E4XL 5DUML 2EKSB 5T3ZD 1NBYA 4J3VA 3IDUA 3MA7B 3LQAH 4N68A 2NPLX 4P5TB 2KQNA 4LVOB 4HFUL 4GXUN 4Y2DB 3L3IA 4WEMB 5DJZA 4PGCB 3EJYD 2NYYD 2AJZA 2WLYA 5JW4R 2FIKA 3NIFF 2GAZB 3FAXA 4BFEA 5INDA 1I9RH 2DICA 5H8DA 1UCTA 3U30B 4P4KD 5LBSH 3BYTA 1BGXL 3BMWA 2ATKA 2HJFB 4MYWB 3F58L 1YMHA 5GRXG 3W0WB 2ERJB 2FGWL 3GSOB 2Z31D 1RJLB 4K3EL 5CINL 5TGBB 5EZOH 3NOIA 4NJ9H 4RSVA 4U1KB 1IGYA 1FJ1B 4QGTA 5CEXB 1MI5A 1RUQL 5B21A 1RQ5A 4Z7VE 1MRFH 1J0HA 1WISA 4P23D 3BT2L 4MLSA 2WV3A 1SY6H 2GK0B 5FO7B 4MQ7A 4Y5YB 5IFHL 4J1UB 3RVXD 4I0KA 2O5XL 4BZ2H 3MOBH 1MCOL 2MWCA 1H3VA 3X11B 1RZGB 5EC2B 1TCMA 5I2IB 1NEZA 3ARRA 2OL3A 2XFXA 4J8RB 4KZEH 3MRCA 4KHXH 1BBJB 1HH9A 5H37G 3H3BC 3RKPA 1K4CB 3V7MA 4PV8B 4K9EH 4I9WE 3RJQB 4M4PA 4B53A 3FZUD 1Z9MA 3ZE1F 1UADC 4PRID 3TBSA 3H3PL 1JGVL 1KB5A 4GKSA 2HP4A 3CSPA 1MCPL 5L88H 2E8YA 1JRHH 1U93B 4OT1H 3WLBA 4LIQL 1HHGA 3WN5A 1R3JB 1Y18B 5JXEC 5T1LA 1WBXA 2AV7A 3BUTA 3MRGB 4GW4A 5EBLA 3S96B 5F7UA 2I9TB 1DDHB 12E8H 1BJ1J 5I8KL 1JUFA 5J12B 4JFDE 2A6JA 2Q1EA 4K7FA 5C0IB 1UKTA 3QR2A 4GBXB 1M6OB 5DZLA 4XP9L 1UZ8B 2RGSA 2XZCH 3D18A 5CIPA 2VLKD 3LB6D 2CIKB 4WUUE 3VFOB 3MRDA 3TPUB 2FHCA 5F9OH 3GMQB 4ZO6A 4IOSD 3RGHA 1F2QA 5GJSL 4NQSA 3HE7A 2QQKL 1LK3H 4URTB 5CSGA 3HZVB 4NHCL 2G5BA 1GCFA 1CGWA 5HYQB 5EU6E 5IVXE 4FQHA 5AG8A 3ULVL 2N56A 3UYPA 1A3LL 5FM5M 1JHLH 1N0XH 3HA0A 2R29H 2XPGB 4WO4A 3VXRD 1MCBA 4F80A 3S4SA 2R1XA 4IM8A 1T20A 1CBVH 4WTZG 1GAFL 3K0WA 1SJHB 4LCUA 1MSPA 4ONFL 3TV3H 2F54E 1JYNA 1CE6B 4L9LC 4E9LA 5GS2H 5HGAA 5D7SL 1KCUH 3IDJB 2EDWA 1RZKH 4K94H 5HJ3A 4HUWA 3TT1L 4J3TA 4PBWD 2R23B 3DXAB 4DKFL 1Q94A 1SJEA 5IMLA 4D2NA 1GXEA 2V2TA 2NY7H 4XC1H 5D7KE 4XGZB 3BEVB 5DD1L 2DQIH 1RULH 5D9SA 5E6IB 4XBPB 2GIYA 3AU1A 2PCPA 4KPHH 2VDMH 4PY7B 5IM7B 3R06A 5HGHA 4FQCH 2DI8A 1C5BH 1NL0L 1UM5L 1ZHLB 2WINB 5F1IB 1QTYT 4XAWL 2AEWA 4K23H 2DQCH 3B2UD 3VFSA 3U2SB 2P5EA 2GEEA 2PYFB 4N0UB 5FF6A 1DBKH 2ZSWB 4LPVA 1JV5A 4NKMB 1BLNA 4HQQL 3U4AA 3OR6A 2OX5A 1ORQA 1C1EL 3PDOB 3UO1H 2B4CC 3SKUD 2JTDA 2PYEE 4U1JB 4JQIH 2XKUA 5C86A 2XWJA 4PD4J 5D8JH 5I19L 3P73B 5LGHH 4XVTL 4JPVH 5DA0B 3DJ9A 5FYLL 1F4HA 5HVHB 4RISH 4HZLB 3X3GH 1A7RL 1I1FA 4BSWB 2DL2A 4G9DB 3IDNA 2BNQB 1A7NL 2EYTA 1I1AB 1CDJA 3I02B 2EICA 5J13B 4PG2A 5L2KE 1CG9B 1GOGA 2VQUA 3MRLB 3PWUB 1QSEA 4LLWB 5EU5B 5KOMC 2H6PA 4PY8J 2BVOB 3UAJD 5KVMC 1S7TB 4WWKC 1B3JA 1PEWA 3NZHL 5DD5L 3NFSL 3VXMB 4JGUA 5HPMB 2H9GA 3RNKB 5GS1C 3TIEB 2EKSA 4NQVB 3W5MA 4G8IB 5F9DC 3PABB 3MA7A 4CDHA 3O6FB 4P5TA 5IJKA 4Y2DA 5HGBB 1DBJL 4NO0D 2DM7A 4HC1L 4JN1H 3WD5H 1FFRA 3MV7D 3X13A 2GAZA 1J11A 5EDXA 1R3IH 3O6ML 1F4XL 4PJEF 3BEWA 3ISWA 1KULA 1CICC 4NKOB 4QHKJ 4YDIL 3G6DL 3GJFH 5MP6H 3GSOA 5FYKU 5TGBA 5HHPB 4OFVA 3IFLL 4U1KA 1S7XB 1FJ1A 4HWNA 1YUHA 3PWPB 4UILL 5CEXA 3GUTB 1IQWH 4I9WD 1UM6L 1RUAL 5F6HI 2X42A 5GZOD 4YHML 3QRGL 4AEFA 2BVTA 3KR3L 4M7LT 4GG8B 4KMLB 2AABH 2QBWA 3NH7L 4NWUH 5B38G 2GK0A 3CFBA 3HAEG 4IIQC 4GMSL 2EEAA 5FO7A 1W8OA 2AK4D 4Y5YA 5I1LB 4J1UA 3MJ6A 2DM4A 2WIMA 4YEFA 4NN7B 4E41D 3X11A 5EC2A 4MHHG 3BXNB 2BVQB 5I2IA 4LU5H 4D9LL 2DQUL 1U8QB 5GPRA 5D7JB 4ZUVB 5MHSE 1IM9B 4J8RA 2XZAH 4L8BB 1OTUC 3BJ91 1BBJA 1K4CA 1HKFA 4PV8A 3LH2H 3QIBD 4WUUD 2X10A 4NBZB 3SE9L 3TA3D 1T83C 2D03L 4L4TB 2YEZA 5C6WH 4B7IA 4BUHA 5DT1H 2XZQL 3EO0B 1FN4B 4X80H 1P84K 5EU6D 1VGKB 1PZ5B 1U93A 5IBTL 3W11C 1MFDH 1R3JA 2CRZA 1Y18A 4IRZH 3KLHC 3FN3A 3MJ9A 3MRGA 2JCCB 3K80A 2I9TA 1DDHA 2VL5B 1IM3B 2YBRB 3NGBC 1WZKA 5C0IA 1JI1A 2J5LC 5JHDD 2HT4C 1DEDA 5AYUH 1M6OA 3VXNB 4OF5A 3VE0A 3MBEA 4X6DE 2APWA 1UZ8A 3S98A 5BMFH 3GSRB 2A83B 2O61B 3PV7A 5J1SC 2CIKA 3VFOA 5C3LD 4U6YB 3TPUA 4P2RB 2EC9U 1WZMA 3C6LC 4FFZL 4OGXL 4OLZH 4LNRB 4OKVB 2VN7A 1HSBB 1V5JA 3HZVA 2QR0B 2VABA 4NQEE 4M1CD 1LDPL 4EVNB 5C0AD 2XPGA 4G8GE 5IMOB 3O2VL 4OZHF 4JKMA 1DEEB 1SJHA 4QXGH 2WUBL 5DUPH 1S5HB 2CKBH 1R3KB 5E6YA 1UYWL 3IDJA 5ELIA 2NY3C 4Q9CA 4P4KB 3WFHB 2R23A 4LCWE 4Z7NE 5I1CL 3GIVA 3BKJL 3MV9E 1PG7X 3NCFB 5D70H 3BEVA 5FOJA 2Z31B 4KJWC 5E6IA 4XBPA 3T2NL 4EJ1C 4ZDHA 2DQGL 3UJIL 1FP5A 3BGMB 4LSRL 4CUCA 5IM7A 3ARXA 2H32A 1ZHLA 2WINA 5F1IA 1HCVA 4P23B 4R4BB 1NLBH 2A77L 4XPHL 3BOVA 2PYFA 2VWEC 4KI5D 4N0UA 1ZLSL 4K07A 3T08A 2FGZA 1BF8A 2ZSWA 4O2FB 4NKMA 3WMSA 1U8MB 1ZSDB 2OXHA 4X8XA 3PDOA 4ERSL 1TETH 3WDJA 4U1JA 5D2LF 1C08B 3P73A 4HS3B 2I5YL 1IGIL 4C56E 5DEFB 1CK0H 1AIFB 4HUKB 2EYRB 5I30L 3VFUB 3I85A 2NQCA 3PUCA 4HZLA 1EO8L 2VTFA 4OSUL 4DGVL 3HI1B 4BSWA 3O4LD 4G9DA 4V2CB 2BNQA 1I1AA 4WV1B 4X7CC 3I02A 1BJ8A 4PRIB 5JXED 2NX5E 3A6BL 2X4RA 4I18B 2YN3A 4WI8A 3MRLA 1QNZH 3PWUA 1EEUA 4LLWA 4FZ8H 5EU5A 2ZP0T 5EBMB 2BVOA 3KJ4B 1S7TA 3AC0A 4M1DL 1FE8H 1Y6KR 1YZZA 3VXMA 3DNKA 5HPMA 3RNKA 4PGBB 1NGQL 4WHTB 5KAQG 5K9OB 2Y07H 4YBQC 3TIEA 3O8XC 1IKNC 4LDLB 1JZ6A 5E6ZA 4NQVA 4G8IA 3W0WE 3PABA 1CD8A 4PG9B 2Z8WC 3W5NA 1AGEB 3O6FA 2R15A 4NSKB 1F42A 4YFLF 5HGBA 3U6RB 3U48A 3W9DB 5J1AB 5DD0H 2VERN 1A6UL 2V5MA 1LP9F 3KPLB 3ILQC 5HYFA 3VI3E 1RVFL 1H0DB 3FN9A 4NKOA 5JQ6L 2IANE 3FFCD 4JG1L 3VXRB 1R5VB 1ZA6B 3QFJB 1TENA 1S7XA 3SO3C 3QI9B 4WFGE 4YHOH 4MQXC 2F53B 4JM2F 3GUTA 3QUMB 3D9AH 4YDLB 4EN3B 3TCLB 5HHXH 1T7ZA 4GG8A 3WFDH 4JO3H 2QHRH 1BX2A 2C4XA 1SM3H 2A6IB 3ZYIA 3FOLB 1WSST 1CL7I 4HIIB 1WC7B 1PG7L 2AQ3A 3B8YA 1XF5B 3OKMB 7CGTA 2HFFB 5DMJB 5JZ7C 2FECI 5I1LA 1QSFB 1A64A 3QZWG 3OKDB 1I85A 2JJWA 5D2NB 3FT2B 4X98B 1ZANL 5C92A 3BXNA 2NW2B 2AXGB 2BVQA 4XBGB 5FM5O 4MA8L 2IBZY 3LIZL 4Q9RL 5C0RH 5GS0H 1U8QA 1WV7T 5D7JA 4W6WB 1IM9A 1CWVA 4QNPF 2EDRA 1AO7E 4L8BA 3I3BA 5CGYC 4K3HA 2XQBH 1EAPB 3LZFH 1RZKC 4OFYD 2KUTA 1LMKA 2Z35B 4H8WL 4L4TA 4M93B 1SHMA 5F88B 3ESVF 4KHTH 4LSSH 1Z6JT 3EO0A 5FO8B 5CJBA 1FN4A 4K7PX 1IKFL 4R2GC 3ZKXC 1PZ5A 1X6LA 3DX7B 4NQED 1BEYH 2X1XR 3HAEH 3N9GL 2I9LB 2XTJC 3P0YL 2ICWI 3IYLW 3V9FA 2VL5A 2YBRA 2ZPKH 3S5LG 4GAGH 1CE1H 2LAGB 2YD4A 4WWKD 3O41B 3MSPA 3GSRA 2A83A 5EWIH 2YK1L 1L4IA 3JVGA 3U9PH 4DN4H 2O61A 4U3CA 3OX8B 2B5IC 4U6YA 4K71B 4P2RA 3V0VA 2Y7QB 2FL5B 5DURB 1T66C 1LQSR 3BMVA 4HBCL 4MAUH 4NHUB 3RI5K 4LNRA 3VW3H 3L3KB 4OKVA 3NIDF 3QXVA 2G60H 4QHMB 5T3XD 2HRPL 2QR0A 3DXAE 5E00B 1UWEH 2A6DB 4TSBL 2X1WL 4ZS6C 4JFOA 1EJOL 4W4OC 5IMOA 1QBLH 1RIUH 5D7LE 1DEEA 1IEHA 1I75A 4KVNL 1A6WL 1CICD 1S5HA 1R3KA 3MV7B 1WAAE 1DBBH 3IRPX 1TLKA 4IDJL 4MXVF 3W2DL 1NCBL 3IJHB 3BESR 2OL3L 4I77L 4P4KA 3K1KC 1WTLA 1JNNL 4XMKH 2H2PC 1OAZL 1JNLL 4WFHD 2Z31A 2QSTA 3RUGE 5AZ2L 1IAKB 3BGMA 4I2XB 1BAFH 1BD2E 3BO8A 3TC9A 2OI9B 1KB5L 4NFDA 1VACA 3JUZA 2W1NA 4YWGL 1RV6X 3SOBH 5IHZB 1EH9A 4P23A 4NKDB 4R4BA 1WFUA 4RFOH 3KYMA 2NX5D 5ALBH 2HJKB 4L5FH 1D5BB 2X4PB 5LGKA 3GBLA 3P30H 2AK4B 3N85L 1XT5A 4O2FA 2VZUA 4PJ9B 5KVFH 5KSAC 4OLVL 3O0RL 5GGUA 4TSCH 1U8MA 1OTUD 1ZSDA 4N90D 4E41B 3AVEA 5TJWK 1C08A 3BE1L 4KTYA 3ARPA 3LHPL 3OJ2C 2G5RA 4PBVC 1WQVT 1YQVL 3IS1X 5TDOB 4XC3H 4OQTH 4HS3A 4XRCB 4BQ9A 1G9ML 5BOZG 5DEFA 1AIFA 2F5AL 2EYRA 3QIBB 5IROA 5E2UL 4TPRH 1YJDH 3HI1A 15C8L 4RDQG 5HYJB 1X4YA 3RVUC 4WV1A 5MI0C 3AB0C 1S78C 2R39A 3A0OA 4PRIA 4XNUH 2NTFB 3KLHD 2XXCB 2YA2A 4FFVC 2GT9B 4K7PL 4GT7A 4QHNB 4M6MH 5EBMA 2BCKB 2HT4D 4QKXB 1P6FA 4YHLL 4YHZH 1MY7A 2HWZH 4PGBA 3VG9B 1JF5A 1I1CA 4WHTA 2YUZA 5EORH 5K9OA 3HMXA 4M61B 3WXVH 4GXUM 4WFGD 1NFKA 3ZDYF 5JHDB 4UIKL 5FAAA 5JQHC 3C6LD 4PG9A 1LO2H 1TNNA 1D6VH 4PUBL 1AGEA 3U6RA 5EN2B 2XN9D 3W9DA 3WIHL 2OM5A 1FO0B 2DKMA 3DURB 1D5XB 3PWPE 1UVQB 5J1AA 4Q7DA 5I1EH 1UWGH 4U6VH 4J3SA 5DHXB 4DGIL 2DS4A 3IDYB 5C0GB 4JY5H 3KPLA 4Y16B 1DL7H 4AEIL 5TF1H 1HEZB 5F1KC 5ICZB 4LHUB 4HJJH 3DYPA 1H0DA 3GJFK 4RZCB 1T5XA 5F9WC 3U46B 1DANT 3EOYG 4P9HL 5C0AB 2NY3D 2V5RA 3VXRA 4GG6B 1EHXA 4R4NC 3QFJA 4P4RB 3EJJX 1RZ7L 1DUYB 3E2HB 3QUMA 4EN3A 3GEWB 3LPFA 4KJWD 3TCLA 1B4RA 2ITDB 4OZIE 3MV8D 2A6IA 4Z0BH 1ADQH 3FOLA 4L29B 4JE4B 4HIIA 1WC7A 5GIRA 2BMKB 3OKMA 1XF5A 3EDKA 2RJMA 1FG2B 2VLMD 4S1RH 5K59F 4YC2B 2JB5H 1U3HC 3OKDA 3DRTB 1NGXB 5D2NA 4X98A 5IFAH 2NW2A 2AXGA 4XBGA 4M7KH 3ZHDA 1AFVL 4JQXC 3JWDH 5E2WH 3UBXG 1FAIL 2IH1B 4RGMC 1FGVL 4RQQB 4JJ5B 2V2WA 1IT9L 3JTTB 2JCCE 3SKJH 4HUUB 1CFVH 4YBHA 4PYGA 2GJZB 3ARWA 1WCQA 3BDYH 1FZJB 2Z35A 4JLRB 3D3VD 1AH1A 5F88A 1KIPB 1EEYB 3SDXB 5IUSA 5FO8A 5C8JB 5DZOA 4ZYKB 4FQJH 3HR6A 2BX5A 1ONQA 1V8HA 2I9LA 4LVHC 4OCNC 4ELMF 5D93C 5D7LD 1S7WA 5EOQL 3SE3C 4FQ2H 2VKXA 3QXTA 4Y4FC 2AJYH 1OGAE 5DJ0B 4L8DB 3O4LB 2FO4B 3O41A 4M5YH 1WIPA 1KENL 2EDNA 3VD4A 1J1PH 3OX8A 4OUOA 3L3DB 2IPTH 4YBQD 1KJ2H 3O8XD 5TQ2L 5DC9B 2Y7QA 3GM8A 2FL5A 2F5BL 4NHUA 2O5ZL 3L3KA 1Q0XH 4QHMA 5E00A 1U3ZA 2DJUA 1LWRA 2DM3A 1JJUA 2A6DA 4KY1L 3ROOB 3ILQD 1WF5A 1NANI 3HFMH 1R3LB 1FORL 5DF0A 5LWYL 3MV7A 4WGWB 2W0PA 1MAMH 5C2BH 4OB5L 3MLYL 3G6AB 2R2EA 4L8SA 1DQML 1J05B 3ULUF 3FFDB 1FBIH 4MQXD 4XNQB 5TE4H 3ECBB 4YNYB 2FLRT 5C0FB 3FFCB 3MUY1 2ZKHH 4R26L 4QCIB 1FIEA 4LSVL 1IAKA 4I2XA 3H9SE 2ZCHH 1AP2A 3MUJA 4EBQH 5JZ7D 1B2WH 4YH6A 5IHZA 3HC0B 3HNVL 2HJKA 5KG9B 1D5BA 4L8CA 2X4PA 3DMMC 3MJ9L 4Y5XA 4Z8FH 5DRNA 4X4XA 2AK4A 4XWGL 5HHVL 1EX0A 1INDH 3CU7A 4P59L 2J8UF 3QJFB 5CGYD 1S7SA 4E41A 4M6NH 4RNRB 2R2CA 5KVEL 1WBZB 4HJGA 3VGGA 1U6AH 1KYOJ 5TDOA 5L2JB 5M95B 2ZZUT 4XRCA 1YN6B 4TUKH 1CGSL 4NO5B 2VZVA 3EKCA 3MNZB 3QIBA 4R2GD 4RA3A 5FYJE 4MJIB 2HKHH 3WXWH 3MQIA 1JF6A 2XTJD 3GDBA 4W6YB 2NTFA 4OFPA 4X4YB 3P77B 2W9LA 4QHNA 5KJRL 4HT1H 2BCKA 3OKOB 3DVNB 4XCCL 5JW3H 4XCFL 2CDFB 2WQ8A 2YPLE 1HSAB 3BKYH 5HDBF 4TRPH 2Y1VA 1U91A 3TYFB 2HTKC 3FB5B 2B0SH 3TYGL 4OCRL 5JHDA 5JW4Q 4LRIA 1K8DA 4WWKB 5A1AA 4UT6H 3ULVF 1T66D 3E0GA 2QQLL 5DI8B 1JP5A 5JDSB 4Y1AE 5EN2A 5GS1B 4PJAF 1NCDH 1FO0A 3RX7A 1D5XA 2R4SH 3QEQE 1T2QH 3ZE2E 4MJ2A 1QA9A 3ILPB 5CWSB 2F53E 5A2IH 1AY1L 3FRPA 5C0GA 4ZS6D 4Y16A 1ZHKB 5B4MC 4NPYA 1HEZA 4JPWH 5DHVB 1T4KB 1UC6A 5ICZA 4LHUA 3JV4B 1HCFX 3TO2B 3QUZC 4RZCA 3UTQA 1QSVA 2ID5A 3VGDA 2BDNH 2PUQT 5D72L 5C0AA 4ZUUB 2HRLA 4NGHH 4GG6A 1QSFE 3NN8A 1HIMH 4P4RA 2EH7H 4X8JB 3OL2A 5BS0E 1D5IL 1DUYA 4QOKD 1AXTH 2H2PD 3T04D 1PGRB 3UYOD 1FZKB 5DRZA 4KMQA 3U0PA 1BVLB 2C3XA 2FCBA 2ITDA 1XH3B 3BP5B 4Y2OA 5MEPB 2R0WH 5HHMD 1N6VA 4O4YH 3RY6C 1FG2A 1N6QL 5IBUB 3KDMB 2KH2B 4GMTH 3DRTA 2M2DA 3EYSL 2IBBA 2PN5A 1BWMA 3BHBA 3M1BB 2O5YL 1ZT7B 5FV1L 1AE6H 1OGAD 4WW1B 1WIOA 2IH1A 5IKCB 3QEGL 4JJ5A 5KSAD 3T3ME 4FFYH 1O5DT 2D7QA 2D4DA 4HUUA 1OP3H 1B6DA 1VPOL 2GJZA 1FZJA 5CP7B 2OJZL 2VXSL 1KIPA 3HS0B 1EEYA 2PO6C 1RAMA 4KDTC 5C8JA 3CU1A 5DFWH 2DLIA 3TH2T 4ZYKA 3JV6B 3C09C 1RUPL 2CGRH 3MO1B 3RVUD 4XPBL 1S78D 2MCPL 3NA4A 2GHWB 3QQ4B 2YD2A 4YXLH 3PGCB 4LGSB 5DJ0A 1JRHI 4L8DA 4F7MB 3O4LA 4G9FB 2FO4A 5C0EA 5DJCB 3OKKA 4XCYB 5JXEA 4NZRH 2LQRA 2VQTA 4XPFL 3CH1B 3H42L 4OLWH 4NQXB 1PW3A 2L0DA 3VCLA 2A9MH 1N3NB 2PTTA 4ODTH 4OM0L 1C5CH 4DK3A 2BY2A 1A47A 3GSNB 3H0TB 3I2CH 5E03A 3VD5A 4DTGL 2AP2A 1L7IH 3ROOA 2W07A 5KW9L 3C6LB 3AM8C 3MRMB 3S36H 4QRQB 3DOSA 2XN9B 1R3LA 1Q38A 3DVFA 4YHPB 1GIGH 3P3YA 3T0XA 4R4ND 1YY8B 4WUKL 5ANMB 5D7IF 2FX7H 3G6AA 1J05A 5KSUB 4XNQA 5BW7C 4FA8A 3ECBA 4PFEA 3F7PC 4YNYA 5C0FA 3FFCA 1DQJB 1A8JH 4G8FB 5FGCE 3S3PA 3U0WL 2X89D 4QCIA 1NSNH 3G6JE 5GHWH 3BZEB 4PREB 4GXVL 2UWEB 2DTML 1Q72H 2VQ1A 3BDXA 3TIDB 5IEKB 4CU8A 3QIWB 4Z77B 2QJDA 1U3HD 3LQZB 2IMMA 3HC0A 1XCTB 3MV8B 2EEBA 1KCVH 3QPXL 3BZFA 1G7IB 5KG9A 1EO7A 1V7NL 1A6ZA 2FB4H 1T80A 3VGFA 5EIIB 1CZ8H 3X3FL 4HH8A 4PLKD 5HYJE 1QYGL 1JGEB 2WQRA 3SKOB 3QJFA 5DGQA 5LJYH 1H8SA 4RNRA 5I15H 5E9DB 4LCIH 3B2VH 5GRWA 3LQMA 1WBZA 5L2JA 3HE6C 3TBTB 1YN6A 2VDLL 5DD3L 4Y1AD 1EBPA 2Q3ZA 4NO5A 3SGJC 1S3KL 3QXWA 1WWCA 4DVBA 4PJXF 3QEQD 1T6VN 5EUOF 5EZIH 4J3XA 4MJIA 5F9JB 4P3CH 1NCUA 2Y6SC 3CDCA 3D3VB 4U1IA 5T3ZL 3U7AA 3RKDC 3CSGA 2CUHA 4FMFA 4X4YA 4KROC 3P77A 1CD1A 5GXBB 4C4KT 3LRGA 5L9DL 5TF0A 5JDJA 4Y4FD 2MQ0A 1KJMB 1HSAA 1M1SA 2NXYC 3TBWA 3TYFA 4JHZA 3FB5A 5K9QI 1XIWC 3JWDC 1NFDF 4GAYB 4WWKA 2ICEA 3MACH 5DI8A 1KIRB 5JDSA 2AVGA 3GI9L 5GS1A 3T1FB 5HDLA 3VFNB 4Q9QH 2BHYA 3ILPA 5TQ0L 5CWSA 4L3ED 4OIAA 4HUVB 3CK0L 4AIZB 1ZHKA 1EK3A 2GTWB 4G43B 1CFSB 1E6JH 5DHVA 1T4KA 1N5YL 3JV4A 3F7QA 3TO2A 1ZLUH 2IWGA 3VA2C 2BJML 4AL8L 4Z7UE 1HKLL 2Y23A 3BP6B 1YEHL 4X6BB 4ZUUA 1BBDL 3GFUA 4CVXB 3T65B 2XWTB 1UXWB 3EOAB 4LSUL 2PW2B 4LBEA 4X8JA 5HHOE 5ID0B 3GK8H 4ZD3H 1KLUA 1IILE 1CICA 1ZVHA 3PHOB 5CHNB 4ZOEA 2HVKB 1YEJL 3DLQR 5F7MC 4Z9KB 1FZKA 4AT6A 3HI5L 4PJ5B 1BVLA 1XH3A 2XA3A 3BP5A 1R3HB 5SV4A 3EJZC 4OD3L 1GC1L 1I7UB 4S10A 4MVBC 1Z9SA 4F7EB 1IFHL 1MCLA 4DGYH 1BOGB 3KDMA 2D7NA 2V7HB 5KTEH 1QKZL 3SDXE 1JN6B 1DSFH 4TSAL 5KSBB 4NNPL 3NCMA 2BK8A 3DMMD 4OLUL 5ADPH 4LKXB 3U79A 1NFIB 4G6FD 4IIQA 5BZDB 1N8ZB 5KS9B 4WW1A 4KTEL 5CZVH 1Q9OB 2PKDA 5IG7B 2R8SH 2GI7A 5E08H 5DYOB 1PDKA 4JFXB 5CP7A 2HT3D 2CDEB 5FYJL 2FWOB 4X9BA 1ZLWH 3VFTB 4DJMA 4C54A 5KVGH 3HS0A 1JCKA 4U0RC 3VWKC 3RWDB 3O3AB 4NOBA 5C1MB 1P4BH 1R6VA 4NRYA 3MO1A 1T83A 2PR4H 1KFAL 3IT8D 5EZLB 4F7CB 3HG1E 1PEZA 3QISA 3GKWH 2FRGP 3MPCA 3RQ3A 1QACA 3ZKXB 3NACH 3QQ4A 5J4MA 3PGCA 4F7MA 1T21B 1KELH 5DJCA 4XCYA 1OY3B 1EGJL 2PETA 1M05B 4ZTOL 4JGMA 1CR9L 4K2UL 3VMNA 3CH1A 1I9JL 5GS0D 1OLZA 1AXIB 2XY2A 4NQXA 5IMKB 1HILB 3SGEI 2DLHA 4Z78A 1CDIA 1N3NA 3I9GL 3ARGC 4D0DB 3QUML 5HVWA 5C08D 1K4DA 1ITCA 4X99B 1CIUA 5DA4A 4F8QA 3GSNA 3H0TA 4KUZL 3P0VH 3PE9A 1N7MH 2RB8A 5AD0B 5L6YL 3C6LA 3MRMA 3OPZL 4IJ3B 4QRQA 4WVRA 5B4MD 3ZL4H 4F37F 2Y36H 2XN9A 4YHPA 5FGBC 3QUZD 1CLZH 2DRUA 4PJ7E 5J89A 1RFDL 1WZ1H 2WZPD 3QEHB 3MRBB 1KIQB 1YY8A 3ZSSA 2EDFA 1JGUH 5MEOB 3UC0H 4JPKH 2GKIA 3TH3T 1RZJL 2YZ1A 2R0LH 4TVPH 4XPGH 3DUSB 4MA3A 1DQJA 5FO9B 3T0BA 2FJGB 5I1AB 1NCWL 3BZEA 1F90L 1KXTB 4PD4K 2UWEA 5FYKH 4NYLB 1RIHH 3TIDA 2ZCLL 5IEKA 3QIWA 3UTPD 4C4KO 4Z77A 3MC0A 1QBMH 5GRJH 3LQZA 4JG0L 4LASH 1XCTA 3MV8A 3ARVA 1G7IA 4PJHA 3DETC 4NC0B 5HVFB 5HHMB 4KK9C 1NGPL 3GBMH 1H3PH 4NQUA 4CN6A 1JGEA 3SKOA 3U1SH 1C16B 4Z95H 1KN2H 3RWCB 3QUYD 5E9DA 4KQ4H 1JHTB 2Z8SA 4OLYH 5I0DA 3VFWB 1EFXD 2OR9H 4RAHA 5ITBH 3S3SA 3S37H 3TBTA 2PO6D 5EA0H 3S88L 2AEQH 4GOSA 2HG5A 4OF6A 1FGNL 2QTEA 3DROA 1YNKH 1OSZB 2YSSB 5F3BB 4KK5C 2VDQL 3D3VA 1J5OL 1TJGH 1T1XB 3JV0A 3QIUD 5A2JH 3QBTB 2I26N 1EIBA 5I75C 4QTIL 1KJMA 5SX5H 1KJ3L 2R0KL 4OJFL 4OCWH 2FJFA 4GAYA 1YNTB 2QSCH 4JKWA 2XY1A 3OAZK 3EO9H 4XB8A 4G3YL 3NIFE 3UTZA 1I1RA 4Y19D 2C7UA 4OCYL 1LO3H 1HHJA 2Z91B 4HWEL 4ZNCD 1IKNA 3VFNA 4DOHB 4LEXL 1XCQB 5EH1A 1RURL 1H5BC 5ITFB 3V6ZA 2UYLB 5IT2H 1G7HB 4AIZA 2GTWA 1MFCL 1P7HL 4G43A 3MCLL 1LHZA 4FQQB 4X7TB 2AGJL 1KT2A 4EOWL 4ZMAT 2CQVA 3BP6A 5GJTL 4E42B 4X6BA 3SBWC 4HMCA 4X7EC 1X4XA 4CVXA 3T65A 2XWTA 1UXWA 3EOAA 2PW2A 1ZV5A 2VO5A 1HXMB 3PHOA 2Q76B 5DLML 2Z92B 1RMFL 2VDNH 3BZ4A 4FTVB 4PJ5A 4ZOAA 2D0HA 1R3HA 1DFBL 1A5FL 2YUVA 4YFEA 2VXUL