2EDYA

Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase f
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
103
structure length
103
Chain Sequence
GSSGSSGPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase F
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Receptor-type tyrosine-protein phosphatase F
total genus 7
structure length 103
sequence length 103
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2edyA00
3BKMH 2MQ3A 4X8JB 1AXTL 3TGXA 1S9VB 1T1ZA 2R69L 5J13C 2DMKA 4G8FB 4Y5VB 5C09B 5KVDH 2X5PA 3WV0A 2D7TH 4QO1A 4NUJB 3SCMD 1YPZB 5CGYD 1I1CA 4H1LG 5AYUL 2JIXA 1AXTH 4JN2A 3VMOA 1YNTA 5C9JA 2DQCH 3G04A 2JJWA 1S7VA 4PJXE 3BI9X 1FGVL 2XFXA 3AMKA 3GMRB 1N7MH 1HSAA 1U93B 3GJFK 4XCNB 1H3WM 2YC1B 1FH5L 3SGEI 4OD2A 1GHFL 2EZ0D 4LRIC 1ZOXA 1IAOA 3D39D 5EIIA 4OJFL 4UUJA 4X4XA 3W11C 5I18H 3CVHB 5C9KA 1S8DB 2EKSA 1V3MA 2YPKA 1YEFL 2WK2A 3ZTJG 4HK0A 3T08A 3CDGA 5EWIH 3PJSA 5B3NA 4AIZB 1T2XA 4Y4FA 4HWNA 1CQYA 1UVQB 5EG6C 3WJLC 2P44B 4NKDA 5ISZB 1EUTA 2ZPKL 2BC4A 2YPLA 2ZUQC 1HEZA 4JANB 1JWMA 5IW6B 3HFML 3ARBA 3CUPA 4DTGL 3MFGB 5GJTH 3QUXC 5I74B 3ILPA 3HTLX 5I8OL 5L7XH 2M1KA 2JCCA 4P59L 1YN6A 1OAUL 3RUGB 1NFDA 4JPIB 3CFCL 1E28B 4P2RE 5LQBH 2Y4SA 1NQBA 3G5YB 5J1AB 1QSVA 5J13B 4NBYB 1BAFL 3U83A 1MFEL 4UINL 3BD5A 3U9UB 3QCTL 4G5ZH 4YX2L 1YUHB 3UBXG 4O2FA 2DBJA 5AD0A 1T04A 2OSLA 3HN3A 2DI9A 5HGDB 3JV5A 3GKZA 1EEZA 1S7TA 3CFKB 5HDOA 3WFCH 1XF3A 8CGTA 1ED3B 3IDIA 4NC1E 4PYHA 2OTWA 4KKLC 2P8PB 4QRRB 4FQJL 2YD5A 5ESAA 5F70A 3EUUA 4JFZH 4PGEB 1ADQA 1YPZE 2APWA 3LD8C 1SJEB 4XP9H 2DLIA 3SKNA 2DM4A 1ZA3B 4YQXL 5C8JA 2DWDB 1N5AB 1Z2KA 3LQZA 3QDAA 1AGFB 4LLAA 1N4XH 3KG5A 3L95B 5C0EB 1NSNH 4KI5F 1HSBB 2Y9RT 3VXSE 3BEWB 3HUJE 1U58A 4RAHA 2I9TB 4ODSL 3O6MH 1FFPB 3WO3B 4AL8L 3RDTD 4KVNL 5GRUL 1T1YB 1P6AB 1R3HA 1FCCA 2F5BH 2J3SA 4BUHA 4WU7A 1EAPB 3G6AB 2F8VA 4RIRA 3ZMRA 3QHTC 3WHXB 3GSRA 3OXRB 2NY6C 5ECJE 5E6ZA 5FHAL 4L3EA 4FRWA 1DLHB 5E00B 5C0RH 4HEPG 4PG2C 1GC1C 3F6LA 1ZT1A 3V0VA 1LMKA 2AKRB 3OSKA 4Y5VA 4QNPF 5C09A 2R2BA 1T22A 3AUVA 4RDQF 3HE7A 2XWBA 4PJ5A 4F2MB 4X7FC 3MRLA 1VDGA 2COQA 5DEGA 5D7IE 3IFNH 2JJTA 4D9LL 3ALXA 1F90L 3EOBA 4GAGH 1Q9KB 5E94A 3MV7B 3CK0H 4XCNA 4QWWC 5LGHH 7FABH 1QO3A 3SPVA 4OD2B 3D2UD 2V17H 4N5EC 3VFNA 1MQKH 1DEEB 1IAOB 4PRDA 3W2DH 3MQIA 4KY1L 1ZA6B 2FEEL 5K59F 5HVFB 5HPMB 1YEGH 3CVHA 1WCBA 3LD8B 3U1SH 3CDGB 1KULA 1G9NC 4MQSB 4HAFA 4PLOB 1FZOA 4YDKL 4H8WH 2VLKD 1T5WB 2AV1B 1HEZB 4NN7C 4JANA 4P5TD 3DMMD 4RMSA 4FFVD 2J8UF 4X0KA 4UV4H 4OF6A 3MCG1 4PJFF 4HKBB 3ILPB 4M7KH 4PJAB 2AQ2A 4G6AC 1T6VN 2VYRE 1X5JA 2OYPA 4CAGA 4NUGL 3MLSL 1PJ9A 3O3AA 4M48L 4GT7A 5CSZB 4PJXA 2PR4L 4PBXA 3HI1A 1B6UA 2QHLA 3ALPA 3U9UA 3VD9A 1BGXH 1XR8B 1D9KD 4E42A 4N1EA 2NXYB 1C5BL 1TPXB 1CXLA 4O2FB 1MCEA 4L4JA 4M48H 3WFEH 1ZTXL 2YS4A 4PUBL 1S5IL 1OPGH 3F6IA 2VDQL 3QZWB 1LE5B 4ZUSB 3GSWB 4M7LH 4KHTH 3CMOH 1YMMB 4TNWK 2XZCH 1A3QA 2PNDA 5HBBA 1T21B 1X5LA 1ED3A 3IDIB 4W6WB 4JFZL 2BK8A 1JRHH 1C1EH 2OTWB 2XYCA 1INEH 4Z7OE 4PREA 2OP4H 3O2DA 5FGBC 5JZ7D 3QH3A 4YQXH 1J0ZA 4ODTL 1TCMA 3ZL4H 2GCYB 3C2AH 4ZPTA 5E6IB 4J3XA 1SJEA 3QXDB 4EOWL 4ERSH 2DWDA 3D25B 3WLBA 1LP9F 1N5AA 3LQZB 2AGJL 2XN9A 3KPRD 3ZE2E 3ET9F 1QSFD 3L95A 4NZUL 1BBJA 3JV0A 1Y0LA 4NBXB 4EIGB 2X4TB 2WBJC 5D6DA 4PGDB 5IB2B 4N0CD 5FYKE 5IWLC 4H88L 5JW4N 4PV8A 1R3HB 2P8LA 5I0DA 1EAPA 1R3IH 4RIRB 1A6ZB 4S10A 5E1AB 2BHUA 4L8BA 1KNOB 4Y4HC 2XIDA 1YEFH 3JV6B 5JUEH 3Q6GH 2G60L 5IKCA 3CFIC 4W4NA 3V0VB 5EIVA 4M5ZH 3KXFD 2YPLE 3C08L 4RQQA 1OAZH 1T22B 2NY1D 2XWBB 3LRSB 3LS5L 4WW2F 5KW9L 3ETBF 3SDYH 2ZPKH 3IAPA 4MNQB 5DEGB 1R3JB 4UQ2B 5LWYH 1KXVC 3ZLQC 1I3GH 4M03A 1FO0A 4NFDA 1N64H 4A6YB 1YQVH 4J12A 1R3KB 1DVFB 4HUUB 4KRPD 2XXCB 4X9IA 5DD1L 4X7EC 1QO3B 3SPVB 4YJZL 1KCKA 2R0KL 3VFNB 3WFCL 5HYFA 3JWOL 1DEEA 1J0HA 5KS9E 4DOHB 1ZA6A 5MHSD 3MRDA 2D2OA 5EC2A 4XCCL 1RD6A 3FRPA 4PR5B 1BVKA 2CK2A 3MV9B 3STBA 4RCAA 1NCBL 4HIEB 3WIHH 2CDEB 2HT4D 5DK0A 1BP3B 1FZOB 1UXWB 1YMME 1X4YA 2AJZB 3AS0A 5C0CA 3S8WA 3MJ9H 1K5NA 4HDIB 1AFVH 5EH1A 5BZDA 4KK6C 3BRGC 3IFOA 3S4SB 1CG9B 2PN5A 3SE9L 4X0KB 3RBSA 1B4JH 2IPTH 2GJZA 1MCOH 3CDCA 3BESR 5CSBA 5C07B 1CE1L 4L4TA 3WSQL 4PJAA 1GXEA 2ZCHH 1L7TL 3QUKA 1BIIA 2CGRL 5A40E 5DURB 2Y07L 3O3AB 3P4NB 4F58H 5CSZA 4U2ZA 3F7PC 4U6HB 5C0RL 3L3JB 3GZKA 2AQ3A 3L3KA 4W68A 3HE7C 4YHYB 4Y4KA 2EDNA 5CJXC 5F6IC 4JRXD 4LCCA 5EUKA 4NOFA 4PJ7E 5D1ZB 4R97C 1KPUA 3CSPA 5CKAA 4W6YB 3MRKA 4ZDHA 4MQTB 1I9JL 2BSSA 1A7QH 1RIHH 2XPGA 3QIBB 2LU3A 4YIQA 4JDVB 2C3HA 4MNGB 4WU5B 2NY1B 1N7ML 2Q8BL 5I17A 1L0QA 4O58L 4LEXH 1UB5A 2CDGA 2GCYA 1Q9WB 5T1MB 2X6MA 5CZKA 1PY4A 2FL5B 3NCYP 1L7IH 4K71C 3T1WA 3KYMB 4LDLB 3WLBB 3UXFA 4Z95L 3MGTA 2XN9B 4PRIE 4BFIB 4DZ8A 4JB9L 4PP1D 2J4WL 4WUUA 4LEOB 4Z0XA 4KHXH 4PGDA 5IB2A 1A7PH 3LEVH 3VFUA 5T1LB 2K9UA 4XC1H 5GHWH 2I27N 4YXHH 3S35H 5I1JL 4WO4A 4DGYH 1A6ZA 1P2CB 4LARL 1EEUA 1X5XA 4YHKL 1NCTA 3MJ9A 4DKAA 5E1AA 5D2NE 1KNOA 3P0YL 4JFFE 3GSQB 3JV6A 2DL9A 1I8MA 4X6EA 5FO9A 5DHYA 5IJKA 5F72S 1ZHLB 2ICWA 3QCVL 5JDSA 4ESKA 4DKFL 3RWHA 1NL0H 4RQQB 3EGSA 1T5XB 1D9KC 4K3JL 4HS3B 2YUXA 4UTBL 2XOTA 2GTZA 3HG1D 2R39A 4RWHA 2DQTL 4A6YA 1I1AC 4DGVH 1RZJC 2HVJB 5D1ZC 1DVFA 3CFJA 5DURD 2WBWB 4NSKB 1CFSB 2BVEA 3BPCA 2ZOLB 3QIBC 5B39A 1FO0H 3QHZH 1IRAY 2FX9H 2VZSA 3WKMH 3UX9B 5DR5L 3RNKB 4X99B 3MRDB 4NZRL 4N8PA 3NN8A 4JPKL 4OD1H 4TSCL 2OJEB 1RZKC 3MV9A 1OP5H 2AJVH 5HHVL 4XWOD 1NCDL 5AWNL 3CFBB 3O11A 4PJFA 4WTZA 1KJMA 4FQQA 3PDOA 5EPMA 2WP3O 4OD1L 1E4WH 4YXLL 2YUVA 5F7DB 3TEUA 5EUOA 1QTYT 3T3PF 3NZ8B 4OQTH 1FNHA 4MNGE 1REIA 1W72B 2NY5H 2ZUYA 2ITCA 4JVPA 1SEQL 1YNLH 2GJZB 3D3VA 2MQ0A 2IPKB 5IBUB 4BUGA 4L4TB 3DVNB 3L6FB 1FVCA 5D2LB 3VXSD 4HUWB 3QUKB 1BIIB 1UZ8B 5I73B 3T2NL 3MOQA 5EU7E 3BSZL 1O7VA 2DLFL 5D5ME 3T8XB 1MREH 1RZKH 3PL6D 4K23L 3L3JA 1FL6B 2FECL 2Z31B 3R1GL 2M26A 2HT2C 5FUOL 3NBNA 2IAND 3G6JA 5GJTL 4LCCB 5EUKB 2CLZB 5KW9H 5KTEH 1C8PA 3DIFB 3LHPH 3MRKB 1YQVL 5GRXG 3JXAA 3O9WA 2BSSB 3N1PC 2DQEL 5ISZD 2VWEE 4JDVA 4OLUH 4OLZH 4JM2F 5F9OH 2M2DA 3BZEA 2NTFB 1IGML 4PB0L 2XG5A 4ZUTB 4EZMA 4NRYA 1UB5B 2CDGB 1MLCB 1Q9WA 5T1MA 1RURH 2DQEH 3EKCA 4MXQC 3D9AL 1TQBB 5BS0D 1GZQA 1HK6A 1QSFB 3P2TA 5J6HA 1XGUB 2AP2A 4A2MA 4KJWD 2DIAA 2B39A 2D9QB 4EBQH 3H9SB 1PZ5B 5E9DA 1A1MA 4YXHL 4Z0XB 3FB5A 3GJEA 1CFNA 3VFUB 1MOEA 4N8CH 1FLRL 1WICA 4Q6IB 4JM2B 1FORL 3VJ6A 2PUQT 3WN5B 3BXNA 3GSNH 4JLRB 1I8MB 3TT3H 1IBGL 1ZHLA 1BF2A 4U1LB 3TN0A 3TBWB 3QXTA 3J8F7 2HT3C 4KGJA 4ZFGH 2BRRH 1MFDL 5J12B 4PIRF 5C7XL 4Y4KC 2XT1B 4HS3A 4KRNA 2EDYA 2BX5A 5FK9B 4OLWH 3O3DB 5GS1C 4NWTL 2HVKA 3U9PH 4O51A 5DJ8A 5F9AC 4PD4K 1HHKB 4Z7WA 3EYFA 4L4TE 3ZDZE 1IC7H 1CTOA 1A6TA 3CFJB 1CFSA 1I8IA 4Q9QH 1ZTXH 1GOHA 5DEZA 3HPJA 5I1IL 4PRHA 2YN3A 3O8XA 4FABL 1AJ7L 4N8VA 4Z7QE 3P9WB 2CIIB 2VIRA 4NKIH 3SGKA 4I5BA 2CMRH 3MMEB 4LCWD 3QXWA 4XMPL 2ZCLL 4JRXB 3OG6B 3RL2B 3FFCD 2PXYC 3CFBA 3O11B 3FO0H 4PJFB 4D0CA 1NCCH 3OZ9H 4FQQB 2EH8H 4YDJA 3JWOC 4OZIB 1MEXL 4XPTL 1S7UA 1JNNL 5DC4B 5EUOB 2CJUH 2NY7L 4G8GA 5FF6A 1MWAL 3ZE2F 5I1GH 5E2UH 4FQXC 3SKJH 1PLGL 4RAUB 3C60C 5LGJA 1NCCL 3OZ9L 4ZAKA 5J8OA 1JF5A 3DVNA 3L6FA 3FL7A 3JSSA 3WN5C 2VH5H 4F8TA 3KHOA 3QHFL 3N85H 1QRND 1XMWA 3ULUL 2FNBA 4LARH 4PRNB 3MV7D 4F3FB 3QR2A 3WFDH 5E8EB 4P9MH 3T8XA 3VXNB 4NJ9L 3N1FC 1GOGA 4Q7DA 1FL6A 2EDTA 1AY1H 3GI8H 2Z31A 3DGCR 3D0VA 3OKYA 1W0YT 2EDFA 2CLZA 3RKPA 1AR1C 3ES6A 4FG6D 1UWXH 3ZKMD 3DIFA 1KEGL 1AKJA 5CEYB 4ZG1A 2Q7NA 1X5KA 3TIEA 5D7IF 5LWYL 4OF0A 1FJ1A 5DJCB 4TN9A 2VXQL 2AK4B 2YK1L 3Q2CA 4O02H 2UY7A 4OTXL 1UXSB 3SDXE 5IHZB 3LQAC 4ZUTA 4NRYB 1RK1B 1EO5A 1MLCA 2OXHA 4ZO7A 2Q7YB 1E4XL 4WFHE 1YEIL 3FT3B 4QRQA 3H9YA 4OCRL 5DLMH 1GZQB 1AQKH 4PJIA 1JGEA 5DJDB 5BRZD 5MP6L 4M6AA 1BWWA 4R8WH 3RVTC 3DO7A 3H9SA 5JXEA 4XI5C 4JGJA 3PGFH 3GJEB 1TJGH 1T2QH 4JY4A 3HPLB 4DUWA 4P4KC 1A14H 2OK0L 3S88H 4P46D 1RFDH 3I6LD 3MV11 2WWMD 3TJHD 1KC5H 4IRSC 4CL7A 1CGYA 1PYWB 1T7YA 4FQ2L 2ILLA 5DD3H 4PJFE 4ETQA 5CUSH 5CEZL 1A14L 4I3GA 2A38A 5DUPH 4MB5A 4CADA 3BMWA 5EUOE 4V1DE 4JJ5A 1KTLB 4S1RH 1X4ZA 4G6KL 2R8SL 3O3DA 2HVKB 2P7TB 5T33H 5E08L 3DROA 5GRUH 3T0WA 1R3LB 1W8OA 1HHKA 4Z7WB 2GJ6E 1RU9H 3CLEL 1QRNB 1A6TB 2BVTA 3BX7C 3ARED 4FABH 4WVRA 3O9WC 2R8SH 2BY1A 4GRWB 3CXDH 3HPJB 4KK6D 5TQ2L 3X14B 4PRHB 3BH8A 3T4YA 4XB7A 3RZWA 4NCDA 1J8KA 4S1SH 4ZUUB 3TVMB 3TIDA 1N0XL 4I5BB 4XAKE 4QHLB 2VLKE 2YD6A 4JRXA 1Z5LB 3RL2A 1RUPH 5F7LB 2YD9A 3QNYB 5AZEH 4GXVL 3GSNA 1MWAH 2XY1A 4D0CB 5HPOA 2XTJB 2X4SB 3GFUA 1PX4A 3A6OA 2X2YA 5H37G 4LFHG 1S7UB 5KJRL 4PY8J 1IJ9A 1EBAA 1MFEH 4OZFG 4UINH 3WNMA 5FF6B 4PJGA 2NTSP 3ARDC 2AK4E 3RY6C 4RAUA 4WI5A 2ZUXA 4OGYH 5LGJB 3QDME 2QTEA 1ZAGA 5D70H 3VXMB 1CFTA 3EYVB 4FXGA 2FX8H 4XP1L 5JOPD 3B8YA 1R6VA 1XIWB 5B8CC 3ARFC 1QQDA 2BCKA 4LSPL 5E8EA 1BEYL 3OAYH 3TJEH 3VXNA 3TN0C 3QRGL 1KJ2B 5LAXA 2NX5D 3D0VB 4DUVA 1I7UA 4XP9L 3IDNB 5DMIH 3HZYA 3VG0H 2VMFA 1HI6B 1LD9A 2DYPB 4F57L 3RIFK 1AKJB 1D5BB 4HPYH 4MD5B 2VXQH 5CEYA 4BYHA 3HZMA 2OMBA 1F11A 4U3HA 4Z7UA 3TIEB 3QUYC 4TQEL 3V0AC 4HBQA 4GUPA 4BQ9A 1EHNA 4KVNH 2D4FA 3HUJA 5DLML 4V1DB 5I1IH 1RK1A 3SGKC 1EGJH 3WKML 4M43L 4Q0XL 1D5IH 1JGEB 5JR1H 3RHWF 43CAA 3DO7B 2P1YA 1MAJA 3BH9A 5ID0B 1LEIB 4I3SH 4HXBL 5EA0L 2BVPB 4WHDA 4PRHE 4KWUA 4D3CL 3V6FB 4JY4B 1FYTB 2PW2A 3HPLA 3RWJB 1EEQA 3MA7B 3QQ4A 1JWUB 3DXAA 4OI8A 5JNYB 3BGAA 1IM3A 5LVEA 1N6QL 1U8JA 4GKZB 4GAGL 2ORBL 4OQTL 3X11B 3O4OC 1XIWC 3NA9H 3ARFB 4ETQB 3TYGL 4MJ5B 3UC0H 2C3GA 2OR8A 1ORQA 5IROC 1FVDA 3EBAA 1F6FB 4Z0BH 4XVTH 2IADB 4TUKL 3KPRE 4HJ0C 4X80H 3BYYA 5T1DH 1R3LA 5HHQB 3EAKA 4GG6B 3MRQB 4LKCB 2C26A 4YHKH 1X5HA 3VGAC 4YC2B 5ILTH 2Y36L 1U8MA 5GS3A 4LCWE 3L9RB 1OTTC 1PSKL 3X14A 4QCIB 4X4ZA 4ZO9A 2H1PL 3TVMA 1MJJB 3SKMB 1MCPL 4UTBH 4C4KO 5FYLE 1WF5A 1KB5A 5E8DL 2WAHA 3ZTNL 1Z5LA 3PE9A 2OR9L 5FIEA 2P47B 1SVZA 2YR3A 3NCJH 1TZGH 3T3MF 3P9LB 4PJHE 4NO0D 4Z18A 4PJGB 4P2OB 5JMOC 3NCJL 3DECA 4X6BA 3KYOB 3W9DB 1CFTB 3EYVA 5HGHA 3UZQA 4CMHC 2IFFL 1QFPA 1J8HE 5ITBL 1CVRA 1IC5H 1BHGA 5BRZB 4BKLB 1I4FA 3D2UA 3QG7H 1QQDB 2BCKB 4I77L 1AE6L 2IBGA 1ZHNB 3C9NA 3GSOA 2HA1A 4WHYH 1K6QL 4HWUA 5LAXB 1B2WL 3QXAA 4ELKA 4QRRE 4LNRB 2NY0D 3BDYL 1DSFL 3IDNA 3BP5A 4FA8A 1U2CA 4LBEB 2DYPA 1VFOA 3KYKL 4LVHB 5JA9A 3KPMB 3OR7B 2VISA 5EO9B 5BW7C 4UDUB 3MO1A 2ZUSA 4PBVC 4L8SB 2B4CL 1ZLWK 3T0EC 2GY5A 2VLKA 3W0WE 5HHPA 4M1CD 4RAVA 4JKKA 3D18A 4PJEB 1WTLA 2ICWJ 1T66C 4KI1A 4OV5B 4AZ8A 4F58L 1KCRL 2VDPH 3FQTA 4OFVA 5GISL 3UYRH 3V4PH 3QWRD 4HSQA 3PNWB 5T5NG 4KMTH 4C56D 4MWFB 2H2SD 5SV3A 1C7SA 5H8DA 2GJ6A 2O93L 3GBNL 1N8ZA 3BH9B 4XNQA 5ID0A 1LEIA 5IGXH 4YWGL 4GXVH 3WXVL 3LQAL 1MCKA 1WT5C 5I6XB 3VFVB 2VLLA 4KAQL 1FYTA 3MOBH 4X7SH 3MLWH 3RWJA 3ULUF 2A83A 5EU4A 3LN5B 3AXLA 2B4CC 5JNYA 5D7IB 3ROOB 4CMHB 4K2UL 3X11A 4Q9RH 2CLRA 3HR5A 5FYJU 1CD9B 3GHBH 5I8EB 3KJ4C 1H5BC 5GGRA 3MBEC 3NAAL 2VXSH 3B2VH 4XVTL 3IDUA 4IEFB 5GRVL 4PJ8D 3IJSB 1MF2L 3VGFA 3QDGE 5FKPB 3G6DH 4IMKC 4Z7UE 4WW2C 3MUHL 1VSCA 5CBEB 4HH8A 1EO8L 2IADA 4U1JB 2DM2A 3P30H 3K3QA 1SYSA 5F71A 1S7SA 1G9MC 3GRWA 3ULVC 4I0PC 4GG6A 3SJVE 3WIHL 2F19H 3MRQA 4LKCA 5BS0B 4MA3A 3TZVC 1BBDH 1EDQA 1ZK9A 2X9WA 1A7NL 4OM0L 2JLLA 5EBLA 1KT2A 4MAYD 2A77L 3TPUA 3L3DB 1HHJB 3L9RA 4F9PA 3JUZA 4QCIA 3MUZ1 5HYJA 1J12A 1ZANH 3QNXA 4H25B 1MFAH 2BXZA 4ISVA 3NCCB 4KJQD 4LQFL 3GMLA 1CE1H 1JYXA 2FJFA 1P7QA 1KB5B 3BZFA 1GVIA 4AG4H 2CGRH 3WS3A 4HWBL 1G7QA 3IFPB 1S3KL 1EGJL 4POYA 5HGBA 4XXCC 1UH4A 5FECA 3U0TA 2MNUA 3HG1E 4J3SA 3TESA 1AQKL 2LV4A 5I6XC 4XX1E 4P2OA 3OAYK 3UO1L 1ZT7A 4HS8L 2Y7QA 3HMWL 3K2MC 1JVKA 2AXFB 3KYOA 1ZLVK 3H3KA 3W9DA 3MACH 5I1CL 4Z6AT 5L2JB 4RSVA 4Y8DC 3VWJB 2X4PA 3QUZC 3R06B 4FHBD 2LFGA 1CICD 3MBEB 3VFOA 3CJJA 2HT4C 1I4FB 2R1WB 3D2UB 5JHDB 1MI5A 3GSOB 1NLBL 4J4PA 1JJUA 4ELKB 1W2KT 3M17B 4HXBH 1RV6X 1OP3H 2D7NA 2BHYA 3VXOA 4LBEA 4AIXA 4Z0BL 3DXAE 5EO9A 1KLFA 1XGYH 5DVOA 3GRWL 2NPLX 3MO1B 2KBGA 4UDUA 2CIKB 3OR6B 2A1WH 3S3PA 4J3TA 3GMMA 2VLKB 4PRIA 3T3ME 1VPOL 1M1SA 3TNNB 1RIUH 3D18B 4PJEA 3VRIA 1B0RA 3BZ4A 4C4KT 4L1HA 3CLEH 5GSVA 3H9ZA 4Z7VF 3NIDE 3QDGB 5FUCE 2VAAB 4XBPB 3FQTB 3MOAH 2ATKA 4LPTA 4M9PA 1ZHBB 5JOFB 4ETYA 1A6PA 3ARZA 2EH7L 1S9XA 5I16A 1JPSH 1NAMA 3C5JB 3K81A 4HUNB 4XPHH 4KTDH 2HMIC 4IOFD 4XT1C 1EFXB 5CEXB 2B8OT 4HGWA 1G84A 2F74B 2ZOKB 4G9FA 1CK0L 4I18B 2HG5A 1YPZF 1HWHB 4GXUN 4K8RC 4YFLI 3ILQD 3ZT7A 2VABA 3BOVA 5JPMA 2VLLB 5FYJE 2YK1H 3C8KB 2W91A 3SQBA 1RHHA 4IRJA 5EU4B 3AXLB 4U1IB 1XH3B 4X4ME 3HZVB 1U3JA 4LLVB 5EO0B 3UJTL 2R0WL 2QKIB 3EOAB 1H0DB 2HFFA 2MQCA 5CCKL 3KGRA 4N8VG 4BH7B 4XHJD 1PG7W 5F7EL 1X6LA 2R56H 4NQUA 3THML 5A43C 4L4VD 3IJSA 4XAWL 2FEEI 2RR3A 3KDMA 3GKWH 2XWTA 2GY7B 2H9GA 1R5WB 2NY0C 4R96A 1ZHKB 3BGFC 3P40A 2BOCA 4U1JA 4DOHE 1KJ3L 3EYOB 1SYSB 2GW5A 3AMLA 4YAQB 3LSOB 5JIPA 1HHHB 2VZUA 5A3ID 4XAWH 3MV9E 3CH1B 5IFAL 4Y16B 5D2LF 2EEBA 1J1OL 3TPUB 1MELA 4ZNEA 1DEDA 3BGMA 5CUSL 5E6YA 4Z7QF 5HYJB 1BF8A 3QNXB 2YZ8A 3S36X 3G5XB 4ISVB 4KROB 3HI6L 3O6LH 3TO4C 3C09B 4ERSL 3EO1A 4LLMA 3O2WH 1BFTA 4GSDH 3GGWA 2ATPB 1P7QB 5KSBE 3BZFB 3VFPB 2H2SC 3RJDA 4G6JH 3KPOB 4ZQKB 5E7FA 5KOVC 3VXRD 4EDWL 5GGTH 3HLAA 1AXSA 1U92B 5GS2H 2YPVL 4NJAH 5DUMH 4OZGB 4AIOA 3U0TB 1J10A 5F7FA 3RGVC 2UZIL 1I1FA 3EFDL 3MRFB 1Q8MA 2BDNL 3BIAX 1A6AA 3V79C 2X4OB 3DWTA 2AXFA 3T1FB 5CHNB 5SX4H 2W60A 3VWJA 3OV6A 3LN9A 3HFMH 4H5SB 4OGAC 4OIIL 1EK3A 4M1DL 3MBEA 2HKFH 2DQFB 1N26A 5JHDA 1G6VK 1B0GB 3MXWH 2ESVE 4P59H 1ADQH 4OKDA 2J5LC 4XCEA 4OLVL 3T0XA 3D85A 3KAAA 4H20H 3S37L 3IFNL 1J5OH 4L9LB 4MNHB 3SDCA 1ULVA 2NXZD 3A6CH 3MRGB 4DUXA 5BVJB 4ZTPH 3IAQA 5F1OB 1WBXA 1RUAL 3QUZD 3QIUC 5LGHL 3GMMB 4PRIB 3LKSA 4M6OL 1WZ1H 5I15H 3MRJB 3QDJA 5IESL 3D69B 3TNNA 1QSEB 2OL3A 5J56B 5HI4C 3QEHA 3BZ4B 5DD0L 4BQ8A 3P73B 2Y1VA 4KJQC 1B0WA 4KROC 4KTDL 3ROLB 1J0KA 4P9ML 1MSPA 4HJGB 4LLWB 5C70A 5CD3A 1JPFA 2ZP0T 4UV7H 1ZHBA 4RBPK 5JOFA 1KBGL 1U3YA 2HT2D 3GJFH 1K8IB 1MIEH 2IQ9L 4N68A 3U36A 1KELL 1NAMB 1AY1L 1TLKA 4LQFH 2BMKB 2LAGB 2F5AH 3PQYE 4HGWB 1DQTA 2F74A 2ZOKA 4G9FB 5FM4A 1GCFA 3I6KB 4PG9B 3FFDB 4JY5H 5TE7L 2I24N 2VXVH 5KSAB 1AP2B 1NLDH 3BYTA 1QR1B 1OTSC 1AD9A 5HVHB 1DBAH 4OI9A 4U1IA 1XH3A 5IVXA 5CGTA 5KSBB 5EO0A 2QKIA 1H0DA 2HFFB 3FOLB 1ZLUK 3C5ZA 3QJFA 3KYNB 3WIIL 4BH7A 2BSRA 1HNGA 3BP6B 3OGCA 4HEME 5HHMD 1B9ZA 4XGZB 1SYVB 4CVWA 3G5ZA 2XWTB 3ARBD 4R0LC 4U6YA 3QUMA 1A6VH 2FX9L 1R5WA 1JMZA 1YECL 5FEBA 1UYWL 2BOCB 4GRLD 3PIQA 1JPST 3EYOA 4L9LC 5ICYB 2O61A 4J1UB 1BVLB 4M8VA 4XCFL 3CFEA 1DCLA 1INDH 5KVDL 1U8PB 3NCEB 4ALAH 4N90E 3NZHL 4R26L 5TDNB 5C1MB 4LEXL 3V2AR 1CE6A 3C6LD 1OAQH 1CDGA 4KQ4L 5F7NC 3G5XA 5BV7C 4XP5L 5TE4H 4JFED 3EO1B 4LLMB 3RU8H 1YY8B 2ZSWB 3GGWB 1YEKL 5T3XE 5IEHA 1CXKA 1KIPA 2HKHH 4EN3C 5HD8D 2FZ3B 4BSWB 2XQYG 3ARGC 2Q86B 3IDJB 4XPHL 1OL0A 5HHOD 4HULB 3BSZH 4OZGA 1U36A 1SY6L 5GHWL 2W1NA 2J2ZA 1MCWW 1EZVX 2VDLH 1I1FB 5TQ0H 5EZIL 4QHKJ 3P0YH 5CHNA 4XNMA 5D72L 2GSGB 1I75A 3VDCA 3V6OA 4MXWL 2DQFA 4P23B 4NT6B 1EZVY 1JGDA 1LE9A 1T66D 2ADJA 3MLRL 5D72H 2GSIA 4OLZL 3GHBL 4OLUL 1YMHB 1BQLH 1NMCC 4XCEB 5FYKU 5I8OH 4MA8L 4Y5YC 3WD5L 4WO4D 3VG9B 3MLUL 1D7FA 1AC6A 3VWKC 5L0QB 1WBXB 3MLVL 4QXWA 3TZVD 1KENL 4XPAH 4OB5H 3HI5H 2VTFA 1QSEA 2DM7A 5I19L 4Z77B 3P73A 3TO4A 4LLWA 5CD3B 2ED8A 1JPFB 3UBXI 1ZSDA 5LKNA 5D7SH 3OB0H 5JO5B 1NCBH 1XAUA 3RHWK 4OZHF 2JJSC 5E8OA 5J11B 4QHUA 1NCAL 5FYJL 4UI2A 4X4YA 4KTYA 4IIQA 3FFDA 4ZNEE 3DX8B 1X6NA 4LP5A 3ARUA 3IETB 5JPNA 1M7DB 2APBA 2R4SH 4XPFH 5KSAA 3UAJC 2NY2B 2DQJL 4UTAL 1QR1A 4GKSA 5GISH 2H2PC 3V4PL 2ESVA 3SE8L 5IVXB 3T2NH 3IJHA 2VOTA 5E2VL 5EULV 5SWQA 2RFXA 4P23C 4X7TB 3WNOA 1F58L 2GI7A 1UYWH 5JR1L 3L3GA 3IDXH 3UBXA 4U6YB 5ANME 3TBTA 1HDMB 4NQVA 3Q6GL 1YEJH 3PIQB 3SDCC 3R0MA 5ICYA 4J1UA 1LO3H 4UB0L 2J8UE 3IDMB 3VWKB 1UM4L 5L0QC 2WWMC 3RIAK 4Q9RL 1JNLH 3V5HA 1CQKA 1H8SA 1NUFA 2PYED 4JN1H 2R4RH 5FO7B 1TIUA 3HNVH 4Z7NF 1SQ2N 1NCWL 1P7KA 4UNVA 4HKZB 4ZUVA 1VENA 1YY8A 2ZSWA 4NQCD 1D5MA 3HHRB 2R1YB 3FFCB 4AENA 3CSBA 1GGCH 4LP4A 2QR0B 2QQNH 2Q86A 1KELH 1QACA 3IDJA 4LSPH 4MJ6A 2H26B 4RFEA 2DQGH 4XVJH 1RUAH 3KLAA 2J8OA 3IDGA 4WWID 3IU4H 1EJOH 1WITA 4Q9BA 3QWRA 2NY2C 4DGYL 3VG0L 4JKLA 3MJ9L 3GO1L 5IW3A 4XNMB 3X3GL 4RRPA 3LKNB 4Q97A 1MIEL 1Q9OA 4JVUA 3MRIA 4NT6A 3BP7B 5DQJA 1JGDB 1LE9B 3U4EA 2F5AL 3ARWA 2GSIB 1OTUC 1IL1B 1OPGL 1YMHA 3EO0B 4M1GL 3WUZA 5K9JH 4E41A 4A6YL 2Y07H 1KJ2L 3X17A 3TBSA 4P46B 1D5IL 1G0DA 3ARPA 2ARJB 1JZ6A 1Q0YL 4PLKD 3FN9A 4WDIA 2J88H 2ICEA 3E1F1 4K3HA 2LU4A 4DEPB 4Z77A 3TN0D 3S98A 4XMPH 4JFFD 4ZODA 1J1OH 3SDDB 1HNFA 5TGBB 2X4NB 4MZ3A 1A6UL 4HK3J 3RU8L 3MRRA 2AJYL 4ORZC 4MX7B 3L1OL 5CINL 5GIRB 4QHUB 4QXTB 3TT1L 1LNUB 5EBWA 4X4YB 4HUVA 2D0FA 2X44D 4IIQB 3KPSA 5ITFA 5A16A 1S5HB 1M7DA 1IZJA 1EHAA 2E9BA 5ALBH 5F97E 3HC0A 5HDLA 1JYNA 4GKSB 2AV7B 1E0OB 2ESVB 4O4YH 3SO3B 1CS6A 2BNQB 3WXWL 2BSTA 4MXVF 4MD4A 3MXVH 2MCPH 1DBML 1G6RA 5E8PB 4ZFOA 2RFXB 3J7HA 1KPRA 5C0IA 2XA8L 1DBJL 4FFZL 3TO4D 3UBXB 4E0RA 1MJ7H 3PV6A 12E8H 1Z9OA 2HJFA 4NQVB 4D0BA 5HI3C 5T3ZH 3GMPB 4FS0A 4HKJB 4CNIA 2H2PD 3FQXB 1IFHL 2NXZC 3VWKA 4QF1B 1NKOA 4FFZH 4WGWB 2PYFA 5DF0A 3WDIA 2R2EA 1A7RL 1PEWA 3V6OE 4FQIL 4H0HB 2CUHA 4P23D 2H6PB 3NABH 4KTEH 4JR9H 5GGRY 4AH2A 4PJDA 2R23B 1DE4A 1Y6KR 2HTKD 5DZNA 1JHKL 3B83A 3V4VL 4UT7L 5IB5B 3RPIA 2Q3ZA 1D5MB 3CX5J 2GEEA 3TP4A 2B2XH 4OZIF 1BD2A 5EO1B 3FFCA 5KVEL 3C8DA 2VUYA 3WO4C 4PJIF 1CGSH 4JFQA 4JFEE 5C6PB 4OF7A 3EFFB 5HYSA 3L3HB 5DZLA 4MJ6B 3D3VE 2H26A 3ZSSA 5F3BB 3QI9C 1NC2A 3PP4H 3DGGB 3IDYB 4PJ8A 5JDJA 2XZZA 2EIZA 4GRMB 1NBQA 3VXTA 4FQ2H 2Q76A 1GC1H 2G9HB 3DHJA 1S7RA 2YBRA 5GGTL 2ZUQB 2B5IC 3NPZB 4S1RL 4ZFGL 3RTQB 3SEPA 5F96H 5KS9F 4U0RC 3V7AE 2UZIH 1MVUB 1QLRB 1PQZA 1LEGB 4OAWB 2CKBB 4WW1B 2EDQA 3AM8C 1TITA 2W0FB 3O6ML 3C5SB 5I8KH 5C2UB 3MRNA 3X12B 3OAZK 1R3IL 4MGXA 1OTTD 3N0PB 3DYOA 3TBVA 4CVXA 3RDTC 1CL7L 4XPGH 3KXFB 3UTSD 4GW4B 5IMOA 1WWBX 3G9AB 1RIVL 4YHIB 3D87B 4LAJH 1GH7A 4BQCA 2NY6D 1ETZA 4JAMB 1UWEH 3QRFM 3NIGF 1C5DB 3WO4B 2J8HA 3ARGD 1LNUA 4JO4H 4HUVB 3QEUB 1A8JH 2AJUH 3FCTA 4PBWD 6CGTA 2XNAA 1UJ3A 2MOVA 4XX1G 1W72L 2QQNL 4I2XE 5D1QA 1JTPA 3P4MB 1TZIB 4GLRH 3EJJX 1HH6A 4NO5A 4GRLC 5EU3A 3HC0B 2R4RL 3UDWC 4W4OA 5AYQA 1H15B 5IBTH 1DBMH 3EYSH 1S9WB 3VE0B 2BNQA 4WCYL 3QHFH 5T5NF 1G7HB 2X4QB 3NACH 3W2DL 4MD4B 1HOCB 4GG6E 3RWEB 4I4WB 5HY9B 4ZTOL 4OCNC 3MR9A 1KPRB 3CAFA 5C0IB 3QQ9D 2R0ZH 1GGCL 5C08D 1I9EA 4NQXB 4JKWA 3G9VA 2A6DB 2OXGA 3N9GH 4Y1AB 4MDJA 4CNIB 5LQBL 5TDPB 1X5IA 4QF1A 4RGOH 3V5DB 1P1ZA 4Y4HB 2A73B 3SKUD 4G7VL 3O3EB 4PLKC 3S4SG 3V5KB 5BXFA 3BISA 3RVXD 5D6CB 4AH2B 5TPWL 1TDQA 2GK0B 4PJHB 1YYLH 1JNHA 1Q72H 3PV7A 3RPIB 1G9NL 1AGBB 3KPQA 3RWFB 3VRJA 4EUPB 1BD2B 1IZKA 1SHMA 2B7DT 2JJTC 5GGVH 3OKDB 3BQUB 4I0PD 4U1KA 3ARFD 4AM0B 1P4IH 1Q38A 1XR9B 4J8RA 2V5RA 5FYJD 4NZRH 1JK8B 3BAEH 4BSJA 3QYCA 3DGGA 4P5TB 1AE6H 5J3HC 3QEQE 3QO1A 1NBZA 1CDJA 3FO9A 5D5MB 2YKLL 3WIFA 3WS6A 4YDVB 5JW4R 5GGQL 4KRPB 3FQWA 3MLZL 4XWOC 2YBRB 3I02B 1VPOH 2L0DA 5EOQH 4HUKB 3LCYA 1N6VA 1FHGA 2Q3AA 3DO3A 3P77A 2VDLL 3H7BB 1R5VA 4OF8A 5F93C 3RJQB 1GHFH 3MZGB 1PQZB 2QHRL 4F8QA 1EVUA 5K9KA 4TNWF 4OAWA 3QUXA 3ULVD 2OMNA 1OARL 1FBIL 1F45A 5E99L 3DXAD 1EHXA 5D1ZD 3IDXL 4I48B 5E1HB 5IOPB 3C5SA 1J18A 3MRNB 5B3JF 1LP9B 1KCVL 4O4YL 2QHRH 4MS8D 4F7CA 4DAGL 1HHIB 3CFCH 2V2TA 3KXFA 5E8DH 5C0AB 4UT6H 4GW4A 2OZ4A 4YHIA 2R29L 3QJHA 4KUCF 4NDMA 3QCTH 4F7TB 3PWLA 3VFRB 4Y4HD 4M3KB 4XRCB 1HKFA 1D5XB 3I9GH 3VFSA 1DN2A 1MRCL 2XNAB 3CC5B 5INCA 3SOBH 4J3OC 3BN9C 1OLZA 4LSQL 2NY1C 3P4MA 4M62L 3EYUL 1EMTL 4PJDE 5JIIA 5EU3B 3QXUA 3KLSA 3V6BR 1DQJA 3S7GA 4X9BA 1DQLH 3HMXA 5HYQB 1W0VB 3SBWA 2IH1A 2I60L 2ENSA 3MC0A 4LSQH 2X4QA 1CICC 4I77H 2XTJD 3RWEA 3ZE0F 4YHPB 2WBJB 2A77H 4ZS6C 2W9DL 4P5MB 4K8RD 2EICA 5C08E 5IG7B 3QIWA 2PW1B 5IWLA 5IB1A 1KLGA 4I1NB 4NQXA 3VDBA 4ZAKD 3S5LB 1T7XA 4NOBA 4TSAH 3LQMA 1CZ8H 4NRXA 3V5DA 1P1ZB 4Y4HA 5B38A 2A73A 1QLEH 4U6XA 3QUMH 1EEYB 4U2YA 3KR3L 1M7IB 5DQDH 1ZWIA 3VGEA 3RNQB 4JZJB 1P84J 1RJZB 2V5MA 1VGKB 1T03H 2AVGA 1BZ9A 4NQDA 2EIBA 5AG9A 4KMTL 4Y8AA 4RMQA 5GRWA 3KPQB 3RWFA 1W0WA 4UU9A 1UGNA 2V5TA 3BQUA 1T03L 4NO3B 5E5RB 3NIFE 5DK2A 1VEMA 4AM0A 3QDMA 1JV5A 4KKNA 1RUKH 1DJSA 1OTUD 5DC9B 5L2KE 1JK8A 4RGMB 1UQSB 1CGVA 4U3XA 2MKWA 3ORJA 3QO1B 1VACA 1K4CB 3UDWA 5EZJB 1XCTB 5L88H 3MRCB 2J4WH 4HGKC 5KVGH 2EYRB 2HFGH 5F89A 4XP5H 3H42L 4JM4L 4YDVA 4WHYG 3HMXL 3LN4A 4XHJC 4TPRH 3WNLA 4NQEA 4OF5A 4MZ2A 3TA3C 4NYLA 1NAMH 5AUMA 2PYEB 5JORB 3FONA 3H7BA 1R5VB 1A9BB 2V2WB 3U79A 1U6AH 2BVUA 5FDYA 1J86A 3HC3H 1RZJH 4KC3B 5HI3D 4CRPA 2PCPB 3U7WH 3E6FB 1QHOA 5JHLL 4I48A 1HKLH 5IOPA 2MMXA 4DAGH 3C08H 3AU1A 5F1IB 3SDXB 3MREB 3PQYA 2EDHA 3AS2A 1EHLL 1U8QA 4GO6B 2Z91B 4RFNB 2O5YL 1T7ZA 2DN7A 4CMMB 2E9IA 2YRLA 4BM7A 4WFHD 1Q94A 5EORL 4F7TA 2ZNXA 5ADPL 2XKNA 2NY4D 4NPYB 4XRCA 3HNTL 1D5XA 4RBPH 3VFSB 2X1XR 5INCB 2DTMH 3B2UD 5KVEH 2NLJB 3HC4H 4UMGA 4M43H 4Q0XH 1JRHL 2A9ML 4IOIA 1FVEB 2VAJA 1I9RH 3DBXB 2HWZH 4K71B 4LFHD 5MP6H 1K9TA 1W0VA 3WS6C 3BVNB 3U6RA 4Y19A 2ED7A 4D3CH 1JHLH 5CP7A 1KEMH 5C86A 1T2QL 5GJSL 4P2QB 3P9MB 4HPOH 2WBJA 4QRPD 3QIWB 5I75C 1HXMA 3WFBH 3X3FL 3F58L 1KLGB 2ZCHL 4GW1B 1G1YA 4H0GA 4JM2C 4L3CA 4OKVA 2NY3B 4FFWC 4GSDL 4H0IA 1KIQB 1LK2A 4JO1H 1U3HC 1RIUL 3JTTB 1DBBH 2E7MA 5DFVC 4DVBB 2FSEB 5B38B 4U6XB 5IJKC 1EEYA 1DUYB 1ZWIB 5HI4D 4JZJA 2CDFB 1NCUA 2BFVH 4KROD 5KZCD 1D9KA 3ZE1E 1MUJA 1QBML 1QPPA 5IBLD 3RZCA 1W0WB 4UU9B 4OI7A 3GI8L 3W82A 4AT6A 2FD6H 4NO3A 2H1PH 5DJYB 1SVCP 1JCKA 5DK2B 3ZDXE 3AREC 1J1XL 3V52L 4HV8A 3ZE0E 1PKOA 5IW1A 1A7RH 3QDMB 1JV5B 1ITCA 4HQQL 1B90A 1UQSA 5DZOA 2VLJD 1OT2A 2FO4B 3EJYD 5JW4Q 1T83A 4RNRA 1A3RL 1K4CA 1QP1A 2F53D 1XCTA 3VI4F 4HMEA 2DQUH 3MRCA 3QG6B 1WV7T 2EYRA 5F89B 3LS5H 1CICA 4LVNB 5HI5C 5J9PA 2HLFD 5KJRH 2PXYB 2FHFA 2AEQL 2P5WA 3BD3A 1FORH 5DHVH 4EVNB 2QQKH 1QFOA 1K4DB 2BNRB 1KJVB 2FGZA 2PYEA 3GBMH 5I75B 1UKTA 4FQXB 2UWEE 4S1DC 4NHUA 4HCRA 2F54E 1LO4H 2NY3C 3UZVB 2QQKL 5L8LB 5GS0D 2PCPA 5D71H 3PGDA 2H3NA 1U3HB 1JZ5A 5D4QA 2HJKA 1TVBA 4ZD3H 4N5UA 5I1DB 2IWGA 5I73C 3WSQH 3PQYB 3PXHA 1QA9B 1LO4L 5CS7A 5H37H 2O5YH 3DUUA 3QFJE 2EE3A 3Q1SL 5L2KA 5D93C 1Z9LA 4PB9L 3WBDA 5JOPE 1VKXB 4LNVA 2XKNB 4S0SD 4PV9A 4P57B 1ZV5A 3AREB 3Q1SH 1ZKAA 1VGEL 1G7MB 1ZE3C 4FQHA 3PHQA 5IR1A 5ACMA 4NQEE 2J88L 2DBLL 4IOIB 1FVEA 1RZFL 3ZYIA 1IKNA 2C3VA 3OX8B 2JCCE 3BDBA 4LHUB 1FNLA 5CJQL 2XA3A 5DYOB 2E6QA 2CKBH 1DTUA 2FJGA 3AAZA 4Y19B 5CP7B 5HXMA 4WI8A 4QXGH 4B41A 3G6JE 3CK0L 4DZBA 3LRHA 4PGZA 4BK5A 1N6UA 2VL5A 4MAUH 4I9WE 4ENEC 5AZ2L 4YNYB 2KH2B 3RVUD 1ZGLM 3UTSB 5JW3H 2Z8RA 4OKVB 4WO4C 2DJSA 2YD4A 3OAUL 1DBBL 4ODUB 3STLB 1KIQA 1LK2B 4IRSB 4RA0C 3GRWH 1WTGT 2BVOB 1IGIL 2BFVL 5HDBF 4G9DA 4HIXL 5A2KH 3A67L 1ZLVH 3O4LD 4QHNA 5J57B 1DUYA 4MS8C 4EI5A 3MXVL 1F4YH 1TJHH 2W92A 1EJOL 3NIDF 4JHWH 5ENWB 5KSAD 1MFCH 4P5KA 4LLUB 1UC6A 1XEDA 2XA8H 4M7LT 5LJYH 3VH8A 2UWEB 4NM4H 1Q1JL 5IVZB 3V52H 4MCYB 5E2JA 1FZKB 1YJDH 1N2RA 2EC9U 4HWEH 5D96C 2WBJD 2W59A 1A3RH 4U1GB 3ZT5A 4HUMB 4FZ8L 3O8XC 1JHTB 4P4RB 2FO4A 4JFFB 1KEGH 4RNRB 4BJLA 2R9HD 4Y88A 4G6FD 5BRZE 2OS7A 5IF0A 3O6FD 4WGVB 1LDSA 3PWPD 3MV01 4L3EE 4G5ZL 4YX2H 1MI5E 3I6GB 3TH2T 3FO1B 4O02L 5J9PB 4M8QB 4UIMA 2CXKA 4LVOB 4XPAL 1K4DA 1T4KB 5CBAA 3S3JA 4F9LC 4FQXA 3ARDB 4LCYB 5DS8A 2VITA 2YD8A 4LCUB 4G42B 3C60A 1B4RA 3PWUA 6FABH 4XNXH 1T1WA 2XZQH 2NY2D 3DYMA 1KSRA 3QZWG 1V3JA 3DSFH 4APQC 1IGYB 2OZ4L 5D1XA 2H3NB 4RISH 1U3HA 5JQ6H 2E27H 5CZXD 5B8CB 4XZUA 3VXRB 1AQDA 3B6SB 4UAOB 3UYRL 4XNZB 2DI7A 4P9HL 5AWNH 3KPSE 2BVQB 3DETC 5DJAA 3AROA 4AYFA 1WK0A 4KUZL 1IQWH 4EI6A 3FQNA 1YDPB 2HYMA 5L2KB 1GIGH 3QNZA 4G8GE 5FM5M 4MLSA 4Q9QL 4Z7UF 3F58H 1SY6H 5M7QA 3B9KC 5I1EL 3AREA 1U9KA 3C2SA 3L3OA 4U1GC 1G7MA 3BO8B 4M1CC 1LEKA 4JHAH 3VFWB 2F54D 5FHBL 5C3TA 4JZNB 3IS1X 4FQCH 4QY8A 1UM5H 1ZLWH 4IHOB 4U7KA 5DYOA 4PJCE 1JPGA 2EDRA 3LQAH 4DN3H 3OWEA 3S36L 5C0BA 4JFOB 4FQCL 4WY7H 3UMTA 4OCSH 4WFED 1KFAH 5I66A 1PGRB 4NO0B 4U05A 2E8YA 4JO2H 4PJGF 5F6HI 2DS4A 4P4KA 2FJHB 3U82B 1OB1B 1ZS8A 2D03L 1YEHH 3NAAH 4IRSA 3VFTB 4APQB 4MMXC 3O3BA 3O4OB 1EAJA 3Q3GB 4G9DB 5KSUB 1MY7A 3JWDL 3BT2H 3MRHA 4HBCH 4XNZC 5I1LA 4GMTH 3VGHA 3GSNL 3KLHC 4ODBD 2IANE 1HKLL 1UADC 3VXQA 1LO2L 1XF4A 5KSVB 2UWEA 3P0GB 4L1DA 5DUBB 3DRTB 4G43B 1F13A 3X13A 4DJMA 5DT1L 4MCYA 1FZKA 3UTZA 1N2RB 3RWGB 1I1AD 1ZMYA 1FSKC 1PG7H 4HJJL 5EBGA 3V0WL 4KXZI 4WWKA 1QLEL 1I7RB 4GBXD 4U1SB 2VXVL 3QWOA 4Z5RB 3HNSH 4WNQB 4DQOL 4NQSB 5F7YC 5EU7C 4HG4J 3MODL 1CXEA 2HTKC 4HX1A 5BJTA 4KJYA 5JHDE 1T0MB 4ZO6A 1E4JA 3TWCL 3C8HA 4NNPL 1HQ4A 4M8QA 2F53E 4HAGA 4S2SA 3LB6C 4J3UA 1ES0A 3CXHK 5DMKB 2GQHA 1NCDH 3GUTB 2A6JA 3UYPA 3GHEH 3LKPB 3QISA 3RY6A 1LO3L 2VITB 4LCUA 2JK5A 3E6HA 4NQCB 2IPUK 3PWUB 5GGSY 1E4WL 4YXLH 4LLQA 1WIUA 2C1PB 3BJLA 4FFWD 4K8RH 4G6MH 4JRYE 1TVHA 1KCUH 4GQ9L 3FRUA 4S1QH 4ALAL 5B8CA 2FGWH 3NZHH 2E7CA 1AQDB 3B6SA 4M9OA 5KS9A 2A0LD 4OCLC 5ACZA 1Z9MA 5IQ9A 2ORBH 1A7PL 3LEVL 3MNZA 2VZOA 1QD0A 5K93A 4TTGA 3ARXA 3SHSA 1WBZA 3FT4A 4V1DD 1RPQA 3DUHA 2X7LA 2AK1L 1BWMA 1HCVA 2AABL 3MA9L 2V2XA 4HC1A 2BNQE 4JHAL 4NM4L 2EXWC 4YDIH 3GB7A 4TUKH 3QUYA 3L3OB 1N0XH 3B43A 1QVOB 5EZIH 2WQRA 4H1LB 4NZTL 4KK5C 4JZNA 3MTRA 3O6FC 4PJAE 1GAFH 2VDKL 4DN3L 4IHOA 3SDYL 4TVPE 4KI5C 4PY7A 2ZSVA 3CVHH 1IT9H 1KFAL 1G7IB 1CD1B 1N64L 1IAIL 3SDAB 2ARWA 2JB6B 1MCPH 4KJWC 1RZIB 1SJHB 4QRPA 3IKCB 4N9GB 4L4VE 1KOAA 4QLRA 3BHBB 5I66B 1FL5B 2EE2A 1I7ZA 4F9LA 1IMHC 2FYYB 1CT8B 3VXUB 1OF2A 1OB1A 2J12B 1H3VA 2X41A 5T1KA 5IUSA 4OTXH 5GRVK 2W0KA 1MHPH 2P48B 35C8H 5AAMA 3WNPA 5IJVA 5BVPH 1H5BB 1OAYH 1U8HA 3DX7B 5KSUA 1FNEB 4K9EL 1C1EL 2G5BB 5J6GB 3EOTH 3B5GA 4NGHL 1EBPA 1IGJA 4BFEA 1K8DB 4TVPH 4JFDB 4LLDB 3UJJL 3VXPB 1CYGA 5F9DC 1XF4B 5KSVA 3QEQA 3DRTA 2L7UA 3U30B 4G43A 3B4NA 2EO9A 4QHKI 3UTZB 4KUZH 5GSRB 1BQHA 3AFLA 4Z7NE 4YHNA 5JXAH 5T33L 5E08H 4GS7B 4YC2C 4BZ2H 4HC1L 2PTTB 2VC2H 4PRPA 4DK3A 4FQ1H 1I7RA 1X5GA 3QWOB 4H88H 4IDJH 4NFBA 5F96L 4NQSA 5MENB 1ZGLA 5DUPL 4HX1B 2N4IA 2HH0H 3PHOA 3WYRA 1VB9A 5D2NA 1GYAA 3SN6N 2VZVA 3GJFA 4XBEL 3UPAA 1A7OL 4JQIL 2P43B 1BX2B 2EH7H 3LEXA 3SDAC 5DMGC 3KPTA 3QQ9C 3UTQA 1J1XH 4D2NA 1WGOA 4H20L 1RZGB 1PX3A 4X6CB 3HE6A 2BY3A 3GUTA 2C3WA 2A6JB 4XBEH 4Y4KD 3SCMC 3W9EB 3FQUB 5FB8A 3E6HB 3PABB 1JTTA 1OP9A 3OMZA 2FIRT 3RVUC 4LLQB 3VI4E 2YEZA 3D6GA 1QSEE 2I9LA 1FFRA 4D9LH 3VH8G 4KK8C 3FRUB 3RVXC 1A5FL 4UT7H 3FN3A 3LB6D 3U7YH 3QDMD 4X6DE 3OTTA 1AGCA 4OCXH 2VH5L 3O41A 2UYLB 5C6WH 5IQ9B 4HT1H 3MNZB 2CLVA 4ODHH 1UA6H 5CMAB 1S7WB 1KG0B 1RJLA 2DQDH 4C56A 1MQ8A 1M71A 4LVHC 1MFAL 4OCXL 5IBUG 2XWJA 5FM5O 4LSTL 5C0GB 2I26N 2IJ0C 1F8TH 4L8SC 3GB7B 1A1OB 3B9VA 3DV6A 5GZNC 1XF2B 2F19L 4H26A 4H1LA 1ODAA 1BPVA 1IKFH 2XG4A 5CILL 2VLMD 1SJXA 2BNUA 2CH8A 2P8MA 3LMJH 3SJVD 3BIBX 1ZANL 3MROB 2KKQA 1G7IA 5KSBF 2MHAB 1IAKB 3RVTD 1SJHA 5EFIB 3GSXA 2DKMA 4ZSOB 3BKCL 5I1KL 3HS0B 3BHBA 4DCQB 1I7ZB 5J7CC 3VXRE 3W0WA 2ZWLT 2EYTA 1ZEAH 1C5BH 4XVUD 1M4KA 4XP4H 2CK0H 3WLWD 2VL4A 4TVPL 1P4LB 3K7UA 1TJIL 1FNEA 3MRPB 1WLHA 1HINL 5CZXC 2FR4A 2OK0H 2DICA 4KKLD 1YEEL 3KJ6H 4ZPVA 4OIIH 1K8DA 1RY7B 3VFGL 3CDYA 4QOKA 4X6CE 1G7JB 4QTIL 3BGFB 5ALCH 5CEZH 2I5YL 2OM5A 2Y72A 2UVFA 3CXHJ 1I8LC 5GSRA 1F4XL 4ZYKB 4YHNB 2D4DA 3K8KA 4XP6H 3TYFA 4M7JH 1U8LB 3QULA 5SX4I 3WFDL 1II4E 3C6LC 3K1KC 3ZKQD 4X6DB 1MFCL 5MENA 1ZGLB 3O6FA 1CGXA 3PHOB 3NCFB 2W0PA 5D2NB 3R8BB 4L8CA 5HD8C 1BX2A 1UWGL 1BOGA 3KPRB 4ZMAT 1CXHA 2RCSH 5I1AA 1WVZA 3V95A 5HHNB 3JVGC 2UWEF 1N3NA 3RGVB 4XNYH 3HE6B 3DX6B 1FCGA 3ECBA 3TM6A 3FQUA 1DQML 1NGQH 5J06A 2K3TA 2VXSL 2IANB 4HLZG 3KPLB 4JFHE 1TZHA 1OAUH 2IBZY 1PKQA 3CIQA 3ULSB 1MF2H 3GMOA 1MRFL 4U6VL 1YNKH 2DTML 4HKXB 5ITBH 5C92A 3WUWG 2UYLA 2GT9A 2R0WH 4KFZC 4G7YH 3RY5A 4Z78A 5CMAA 1A02N 2HWZL 4CW1A 3OJ2C 3DOSA 5C0NC 4G6FB 1RJLB 1TTGA 3U7AA 3UJJH 1B2WH 2LVCA 1AGEB 5BW7A 2L7JA 5FA3B 2Q87A 1LK3L 2LVEA 5I71C 2YZ1A 4FTVE 2ICES 2H8PA 3NCMA 1M05B 1A1OA 3PWNA 5MI0B 4LIQE 3TC9A 4NRZA 1IEBA 3E0GA 35C8L 3X3FH 3C6LB 4ZOBA 4AY0A 1BLNB 4O9HH 5JZ7C 2PO6C 1QFWM 1KV3A 1HHGB 1KCRH 2BY0A 2VDPL 5D2NC 1HXYA 4OF3A 4MJIB 4DQOH 3H9HA 5EBMA 3NA4A 2VUOA 1RZ7H 2W0LA 3WIHA 1T89A 3C5ZD 1P4BH 5ICXB 3GSXB 1KB5H 1JBJA 1H8OA 1XGQB 3N1MC 1WT5A 3HS0A 4NNPH 4WJ5B 3U0PA 4DCQA 2VDMH 3VGBA 1N0LA 2YD1A 4EJ1C 3W0WB 1JWSA 2EYTB 4JO3H 1X4XA 5EU6D 5L2KD 5T5FL 3IU3B 1JF1B 4LPWA 2H41A 3CVIH 4GKNA 4OZHE 4UDTA 2X89A 1MHHB 4PJCF 5JQHC 1QG3A 4K7FA 3RWIB 3MRPA 4C56E 4FQPA 4OBSA 4YGVB 4Z7VA 5CFHA 5DJZA 4ZPVB 2XTLA 4GG8B 2Z8SA 5F9WC 5MEPA 4IMKA 1X5YA 4CU6A 4R0LB 1G7JA 2QSCL 1AO7B 4Q2ZB 4UB0H 1VFBA 4JFEA 4O00A 4R4BA 3D85D 2XKUA 1LDPL 1VEPA 5D1XD 1IARB 4XVUC 4ODHL 4RZCA 1FC1A 3MOBL 4X7SL 4OGAD 4CN1A 3WLWC 3BW9B 5DRXB 3WD5H 5I71B 1U8LA 1Q9LB 5MI0C 5B3JE 4N0CC 1FFNA 4TRPH 4F9PC 4KH2A 1A7NH 5IB3A 4D9QD 1WBYA 2PO6B 3X3GH 4JG0L 1A4KB 1LILA 4LAQH 3STZB 3V8CA 2A6IB 4MSWA 5IBLC 5IMMB 2ZUTA 4L8CB 3CLFH 3AB0B 4R2GB 3UPCA 4LAQL 4M5YH 1X7QB 1GAFL 1B4JL 1I3UA 2IPTL 4PJBF 4R7NA 4JFDD 3RGVA 2X4UA 4K3EL 4DWHA 2PTVA 1CZ8L 4MDIA 3CMGA 3KNBA 3SDCD 3QFJA 5E5MA 3HR6A 1KGCE 5EZOH 1IGTA 1OHQA 3QPQC 1XCQB 1L0XA 3MGOA 1TZHB 4HFWA 1MCSA 5C3LD 3SKOB 5F1SA 5D7LA 4DGVL 4HWZA 3H2WA 3L7FB 3GMOB 1T1XA 2WUBH 4U49A 3V7MA 2CO6B 5EN2A 3EDEA 3ULVH 4JE4B 4PPTA 5E2VH 2FX7H 4PLNC 3QHZL 4ZXBD 3INUH 4UIKL 1VFAB 1KTDB 2F58H 1A2YB 3OKEA 5SWZE 1AGEA 1CL7H 4XPGL 5FA3A 1N6QH 3L5JA 1ZVHA 3PWJA 4LKXA 3TFKC 1UCBH 3PHSA 4EIZC 3QCUL 4CVUA 3I3DA 5INDA 4JDZA 3M1BB 1P84K 1IEBB 4AJ0A 1CXIA 3EJYC 1TETH 3C6LA 4PJBA 4Z9KB 2AQ1A 2ED9A 3FQRB 1GZPA 3O45A 5FYKD 4QYOA 4WHCA 5DA4A 5C0JA 4MJIA 3IFLH 2BJML 3REWA 2ICWI 3DV4A 3E8UH 2EEAA 2C1OB 2KZ1B 2Y36H 3GNML 3JVGA 2X1PA 3U0PB 1NMBH 3MV8B 3TBYA 4YFLF 5DTFB 1JPTL 1NFIB 4F7MA 2VLRD 1FNGA 2HKFL 3H6JA 5IMLA 2VDOH 4ODXA 4C83A 3ZKXC 3MXWL 1AHWC 3BKYL 3B5TA 4K7FB 2HLAA 1J0JA 4MA8H 3RWIA 4Y2DD 3SQOL 4U1MA 2WM0A 4YGVA 4JREC 5DJZB 4KDWA 2QADB 1WZMA 5FFLA 2Q20A 1AO7A 1ERNA 4Q2ZA 4EDXB 2NR6D 3F65A 4JFEB 3FMGL 5C0CE 5A2IH 4JO2L 1IQDA 1XZ0B 1UB6A 5FYKL 1U8OB 4PRID 4XHQA 5ETUB 4WUKH 2EXYC 4X8JA 2XRAH 2WNGA 1FFNB 5HHMB 5KVMC 4WFGD 3TJEL 6FABL 2V7NB 1L6XA 2JIXB 4HFUH 4JN2B 3DSNA 4GRWH 3L3IB 5IMMA 1S7VB 3GMRA 4PLJC 3ARGA 1HSAB 3RPKA 3QUYD 1S7QB 1T89C 4F33B 5JMRA 5I2IB 2YC1A 1X7QA 4UILH 1HILB 3MLTA 4HPYL 3DUSA 2C9AA 1ORSB 5SX5H 2X4UB 3O8XD 3MLZH 4LRNH 5EIIB 1KB5L 1GIGL 3QFJB 1S8DA 2EKSB 1NMAH 3O81A 1JYVA 1XCQA 3EDJA 5CEZD 2X09A 5IFHH 5L8KB 3LRGA 5D7LB 4X5XB 1J0IA 2AERT 5DVMA 1T0NB 5CD5C 3DYPA 3QIBD 4NKDB 2B1AH 3QQ3B 1JI2A 1RIVH 4WTXA 5F8QC 4JREB 3WEXA 3RL1A 1JWMB 4ZUWA 1JRHI 3DMMB 1VFAA 1OSPL 1HINH 4J23A 4R7DA 2G60H 4Y5YA 4PGJA 4NKIL 1WC7B 3OKEB 1KB9J 1CLYH 5EU6B 3VG9C 1TVDA 4M6ML 4WUUE 1FV1B 2YA1A 1WISA 1A0QH 4PS4H 1YN6B 1ACYL 3RUGA 4IRZL 2WIIA 4FFYH 3QIUA 1E28A 2GJ6D 2ZCKH 1MI5D 3M1BA 4F7EB 1NJ9A 1JGUL 4G80A 3MBXL 4HHAA 1G7LB 1UM6L 4U33A 5MEOA 5DGQA 5MHSE 4WTZG 2F9BT 3FQRA 2AXJA 3SDDC 4KZEL 1MIMH 5DJ0A 1V8HA 4QYOB 2NCMA 2EIDA 4Y19D 1T04B 3RZCD 5C0JB 2CO7B 3JWDC 1WWCA 3DV4B 2IQ9H 4ONFH 4XCCH 2DJUA 4UV4L 4RA3A 4Y1AE 1E27B 1YEGL 1D6VH 4QRRA 5IK3A 2IQAB 1BFOA 1IGCH 3MV8A 3TBYB 2VZTA 4U7SA 5ESAB 4WCYH 1NGYB 1NFIA 5F9JA 4F7MB 2OBGA 1AFVL 1U3ZA 4G7VH 3SO3C 5C8JB 4FQJH 1NGPL 4HIIA 4ODXB 4C83B 4W6XB 2KDGA 3RKDD 4AG4L 4P2RB 4NQDE 4GLRI 2HLAB 3QP3A 4XNUH 3RGHA 3EDDA 5T3XD 1U58B 4OZ4B 3WIIH 1MFBL 4WI7A 1DN0B 4PTTA 2HJLB 4PGBA 3UTTB 5F7EH 4NWUL 4YFDB 4HS8H 1A1NA 3WCYA 4NN6B 3FJTA 3CSYA 4ZO8A 1V7NL 1JP5A 4BZ1H 3OXRA 3GSRB 2WP3T 3FAXA 4ZFZB 2HLFC 2Z92A 1N5YL 4X7DC 4L3EB 4OFYD 1WZKA 5ETUA 5C0BD 4E5XB 4LF3B 1ZT1B 1BGXL 2LE9A 2AKRA 5FHAH 3SGDI 5KN5A 3B9DA 4XTRD 2D0HA 5I8KL 1RUML 2DDQH 1MCNA 5CJQH 4NGHH 4ONHB 2V7NA 4D9RD 4CU7A 2GAZB 3BE1H 1EA9C 4KKBC 1B88A 2Z8VC 1NKRA 3TCLB 4EN3A 3EOBB 1JNNH 2VLRE 3SE3C 3VW3H 2NY7H 4WI4A 4F33A 5L88L 5I2IA 1HILA 3RTQD 3DUSB 4MA1C 2FRGP 3BWAA 3IDYC 4PRDB 4M7ZC 1NEUA 3LOWA 4FQXD 5HPMA 5HVWA 2VO5A 3Q5OA 1OGAD 1I85A 1WCBB 3SJVA 4ONGL 5GRJH 3H8NA 2D7QA 4JHZA 2DI8A 3V6OC 3ME0A 1F42A 1FPTH 3QQ3A 2BJMH 4N1HB 4ZUWB 2HRLA 1EVTC 2NR6C 4P3CL 5HDQH 5ABDE 4IDLA 4R7DB 2HAZA 4HKBA 3WNNA 1WC7A 1U95B 2IAMC 1F4WH 4OGZA 5EU6A 3VRLE 1DBKH 3FN0H 3CVHL 2HFTA 3MBXH 2WIIB 1RK0A 1UM6H 3ZKMC 2XACC 3F62A 4KZEH 4F7EA 1NJ9B 4G80B 5CJBA 1IGMH 4PB0H 5H35B 5MEOB 4HZLA 4PJ9D 4KDVA 2SEBB 3QFDB 1EXUA 3U46B 4E42B 2PR4H 3QUXD 3D9AH 3HNTH 5IFJB 1P7QD 4ZUSA 1IAMA 1O7SA 4L3AA 4UZGA 5E56A 4CU8A 4QT5B 3KPNA 3NVQA 2G75B 5FYKH 3NIFF 4FNLL 2GIYA 2IQAA 5IK3B 3QH3B 3CCHA 5C09E 4HZAA 1NGYA 3MNWB 3Q48A 3ZYJA 1DANT 4HIIB 2CQVA 1I8KA 2DIBA 3QIUD 3O4LA 4YO0A 3OKKA 1BBJB 4YHZH 2X4TA 1BQUA 4A6YH 4OZ4A 4QRTB 4WFFD 5C7XH 5GPRA 3P11L 3ARBC 2HJLA 4PGBB 3UTTA 4PV8B 3T4AA 4MQ7B 2P8LB 1QLFA 1A1NB 5I1EH 2X42A 4ZFZA 2Z92B 2OJZL 4RWYL 3TWCH 1BFVH 5I1CH 3EDKA 1D5ZA 4JHBA 5LXGL 3NTCH 5IKCB 2UZYB 4LF3A 1S9VA 5AYUH 4G8FA 4IRZH 1JNLL 3OKMB 5KN5B 4XCFH 2MPAL 2ZG2A 3LRSA 1MY5A 3H42H 4JM4H 5TF1H 3NFPA 1JGUH 4ONHA 1S7XA 1R3JA 4UQ2A 2P5WE 3TJHC 4OFPA 2QQLH 1TETL 3G04B 3LKRB 1R3KA 4LPYA 4IBLT 3RUGE 3H3PL 1CLYL 2DOCA 1MAMH 4Q6YA 2FGWL 5I18L 4X98B 3QI9B 3I3EA 4YE4L 5FGBA 1L9MA 4OIAA 4P5TC 5HTSA 4XTRC 4AEIL 1MRCH 4UUJB 5E6IC 4JFXA 4PR5A 2YPKB 3SJVB 2Q8AL 5BS0E 1AR2A 4HK0B 2DL2A 1JGVL 1NMBL 4YE4H 3RVVC 3T0BA 2HN7A 1OCWH 1NGXB 3IF1B 4AIZA 4G6AD 4AEHL 1UXWA 5C0CB 3GK8L 4YXKL 1CU4H 1K5NB 4HDIA 4P99A 2E7LC 1LO2H 2BC4B 2YPLB 5BZDB 2QBWA 1Z3GH 3RTQC 4K94C 3IFOB 4XMKH 5DD5L 3ARBB 2GITB 2X1OA 3H9SE 3EO9H 2NY6B 4P2CG 1AD0B 3HZKB 1NFDB 1BAFH 4DKFH 1RMFL 4JPIA 5BO1H 4PG2A 3P4NA 3RAJH 3G5YA 5J1AA 1MJUL 5HGGS 3MZTA 4U6HA 3RDTB 4JJHA 4WEMB 2XQBL 4RGOL 4OZGF 3HUJF 4LPXA 3QFDA 2SEBA 1EXUB 3U46A 1YUHA 1YECH 4KKBD 3RAJL 5AD0B 5F6HJ 3ZTJH 1U42A 2OSLB 3GEWB 5I30H 2O26U 5HGDA 4Q74A 1KJ2H 4WTWA 3QCUH 5B4MC 3KPNB 2XPGB 1WFTA 4RDQG 4WU5A 4FZEH 3REVA 4LGRB 3CCHB 5I17B 2P24B 1WIOA 5FUZH 4W4OC 2XZQL 2Y6SC 1JUFB 1P4IL 4M93B 1WFOA 1ZA3A 3I50H 4O58H 3K4ZA 3BAEL 2E27L 1I8KB 1AGFA 5C0EA 4DZ8B 3BE1L 4TOYH 1L7IL 3BMVA 1HSBA 1BJ1H 3MCLL 2YOCA 4WUUB 1PDKA 3BEWA 5FUOH 3D1MC 1FRGL 5T1LA 1FFPA 5F7HA 3S3SA 1MPAH 1T1YA 1IM9A 5MENE 4MQ7A 4WU7B 4JM2D 1OGAB 3NTCL 3AS1A 1P2CA 2E6PA 3WHXA 2NY4C 4OCMC 1DLHA 1I9IH 5E00A 1F4WL 3BQUD 1D5ZB 3GSQA 4ONGH 1BMGA 5T5FH 1TTUA 5FO9B 1A22B 2NZ9C 2R29H 3KPPA 1ZLSH 2ICWB 1FDLL 2R2HA 4BQ6A 1AIFA 4M1DH 4PJ9C 3RWHB 3OKMA 2R2BB 3EGSB 1GGIL 1T5XA 3HE7B 4PJ5B 1GOFA 4F2MA 4Z8FL 3ZTNH 4JCMA 3NFPB 3MRLB 32C2A 3QCVH 1QBLH 4TYUA 1BM3H 1S7XB 4CGTA 3RUGF 4JO4L 2JE8A 3RVWD 2C3XA 1SJVA 1FQ9C 3LKRA 3U4BL 2HVJA 2BVYA 4QRUA 1Q9KA 5E94B 3MV7A 3A6CL 1CDCA 2E9JA 3BEVB 5MEQA 2YA2A 4WY7L 4LMQI 5IB4A 3LEYL 3BPCB 5B39B 4X98A 4W81A 5A2JH 5L8JB 3QI9A 1GPOH 5JIKA 1OD7A 3RNKA 2AI0H 1CLOL 4LSRH 3P0VL 4JFXB 4M93C 2OJEA 4AEHH 4ZTOH 4EUPG 1YMMD 4KRPC 2HN7B 1NGXA 3EYUH 3IF1A 1RZ8A 4PJ7A 5JW5B 1JGLH 1KJMB 3PDOB 5EPMB 1T5WA 4XNXL 4OIBA 2AV1A 5D6DC 5F7DA 4K3GA 1CGSL 5MEND 3K8LA 1W72A 2IG2L 5E2WL 5J4MA 1OTSD 4G3YH 4JY6B 2GITA 3D3VB 4FOMA 2OR7A 5HVGB 3SGDH 5C71A 4YHML 1AD0A 3HZKA 1UZ8A 2EIEA 2V9QA 4NWUH 3LPGA 2YPVH 2BRQA 3QQNA 4NJAL 5DUML 4G6KH 4EI5D 5CKGA 5HYJD 1Q72L 4PJXB 5F7KC 2AEPH 2D7OA 4PJ9B 2AJXL 3RDTA 1PW3A 3D39B 2VDML 3HI1B 3CNKA 4ZSOE 2VDQH 1PD6A 1XR8A 3ABZA 3CX5K 3G6JB 5F1KC 3CSGA 1LE5A 3QZWA 1I1AB 3QA3B 3GSWA 5FHBH 1YMMA 4YBQD 4OLXH 5CWSB 4P48A 1T21A 3UTSE 4ODTH 4M02A 1ADQL 1BFVL 4PREB 3HE7D 4PJ5D 4Y5XA 3HRPA 5EUOF 1CWVA 3REVB 3BZEB 2NTFA 3PDGA 2P24A 4OLYH 4LOUD 1CF8H 4ZPTB 1JUFA 5E6IA 1P53A 3PGCB 1A7QL 3ULUH 1I3VA 3DTXB 3QXDA 5GGVY 3D25A 3Q0HA 3SDXF 4FQLL 1QSFA 5J6HB 4R2GD 3GBLA 1XGUA 5FOBA 3U7YL 3EYSL 2WQ8A 1Y0LB 4ONFL 5F88B 1A1MB 5D70L 2E7LA 3FB5B 3WNKA 4EQ3A 1URLA 5C0FA 3QIWC 3EHBC 4OUUB 4YEFA 2FX8L 1YJDL 4YGAB 4YUEH 3U2SA 2APXA 1W72H 1IM9B 1MCWM 4HK3N 1OGAA 2Y6SD 1F8TL 3VJ6B 1ZXQA 4BELD 3BXNB 1HCFX 4L8BB 1F4YL 1TJHL 4JLRA 1KF9B 5CP3A 3KPPB 3NFSH 4HWBA 2R2HB 1CDHA 4XNUL 1AIFB 1JZ3A 2VLJB 5C6TH 4JFPB 3T3PE 1J8HA 5C07D 32C2B 4MNQA 2A9NL 5FK9A 4ODVL 5F6IB 1Y18A 2F53A 2NW2B 3PF2A 5ICZA 4LCCC 1FO0B 3VWKD 4UT9H 3EYFB 1C12A 3UJIL 4YBLC 4HUUA 4QRUB 2QSTA 2FATL 4OLWL 4Y89A 2XICA 3BEVA 4M7KL 5MEQB 1I8IB 4UOW0 2A9NH 4U6VH 3O2DH 5F44A 2R56L 5IB4B 4F7PA 3HMWH 5E2TH 4KRMB 4RGMC 3HB3C 3WDHA 2C5DC 1NCNA 5EC2B 4IRJD 2VIRB 5D7KD 4LU5L 2AEWA 3F7VB 3MMEA 1BVKB 5ADOL 1TQBC 3OAZH 5DD3L 1A3LL 2AJ3B 1E4XI 3WFBL 4MD0B 5CLWA 2DYPD 4HIEA 1PG7X 1MHEA 5SWZA 2CDEA 1RZ8B 4PJ7B 5DK0B 1TJGL 5JW5A 2AJZA 4YDJB 3EOTL 1FAIL 4KQ3H 1F4AA 3TA3B 2P4AB 4NZUH 4G8GB 2ADFH 5GS0H 1GC1L 2NZIA 3S4SA 1CG9A 4Q6IC 1KC5L 4PJBE 4YDLC 4JY6A 5J89A 3SY0B 1J8HD 1FAIH 4KJPC 5C07A 4HPOL 1KB9K 1F6LL 2A1WL 3NPSB 4X5LA 3IXTA 2AJXH 3CD4A 4PRNA 4F3FA 4WEUD 2EKJA 4PJ9A 3D39A 3AGVA 3L3KB 4JO1L 3ULUD 4BA8A 2R1XA 4JZOA 4Y4KB 1CR9L 1JZ8A 2MFNA 12E8L 4LHUD 4RX4A 2C4XA 3I2CL 5GS1A 4OLXL 1CK0H 1I1AA 3QA3A 5F9OL 1U3HD 1A7OH 5F7UA 2WANA 5D1ZA 4JKMA 1KPUB 1L4IA 4ZDHB 1XGPB 2DQUL 5CWSA 2IPUG 5DJCA 2H32A 3QIBA 4YIQB 4FFYL 4MNGA 4FXLA 4Y5XB 1PBYA 1H9VA 5J0BA 4ZOEA 1LO5B 1UXSA 1LP9E 3LEYH 5IHZA 4NBZB 1F02I 1C16A 5FYLL 4LGPB 2D3VA 3PGCA 2FL5A 1CD8A 3DTXA 2W9EL 2QSVA 2XY2A 5E24E 3KYMA 3P0VH 3FT3A 4QRQB 3TNMB 1FE8H 2ZZUT 3MGTB 1EIBA 5DJDA 4BFIA 4BK4A 5FOBB 1QFHA 1MJ8H 4NN5C 5F88A 4LEOA 4S11A 3NH7L 5C0FB 1W8NA 3QPXH 1FYTD 1MHPL 4OUUA 5J1TC 2DQGL 4XVJL 3SOBL 1ZVSA 3U2SB 3N50A 5FM8A 5EZLB 1IBGH 4WO4B 4YZFF 1YYMH 3S96B 1YY9C 3NPSC 2AI0L 1AKJD 1PYWA 3LV3A 2BRRL 2ZJSL 2RGSA 5F21B 4Q9CA 2VQUA 4TSAL 1QZ1A 4X6EB 5GXBB 5DHYB 2BHZA 1KIRA 3R8QA 5JDSB 2Z9TA 4CADB 2VLJA 2X10A 4LSSH 2R4SL 2WWKT 4XPFL 3ZT6A 4JFPA 4JJ5B 2Z31C 3LIZH 1J8HB 1KTLA 2YD7A 4P2OD 2GTZB 1GGTA 1Y18B 2F53B 2NW2A 5ICZB 3VCLB 2P7TA 4M1GH 3DROB 5E2WH 1C12B 3EZJB 1AJ7H 1BJMA 1V5JA 1GGBH 1F58H 3OF6A 4NSKA 5D96B 4OCWL 4JQXA 2A9MH 1EJ6A 2ZOLA 4F7PB 3BH8B 3T4YB 2VE6B 5DVNA 4Y5XC 3MUY1 2FX7L 4X99A 3T09A 1OLLA 3NN8B 2RBLA 3F7VA 4QHLA 1KN2L 2FEDD 2AJ3A 1JZ2A 4MD0A 3QNYA 1MHEB 2CRIA 5SWZB 4JN1L 3RBGA 3MJGX 5JXEC 5D8JL 4IM8A 4OV6F 1QYGH 3TA3A 5ERWB 5CIPA 3NZ8A 3U4AA 5AAWA 4K8RL 2ITCB 1UT9A 3SY0A 2IPKA 3QAZB 5B22A 4BH8B 3ZDYF 5K9OA 4LSVH 5CEZE 4FXGB 4NZJA 1FVCB 5D2LA 4HUWA 3IXTB 2J7LA 2NNAB 1QSFE 2HFGL 2VDNH 4OM1H 3E8UL 3QO0A 3BPNC 1F2XK 4HWEL 1NDGA 1XGTB 1KJ2A 2ITDB 2R1XB 4JZOB 3QEQD 4HBCL 1I7UB 1BVZA 5D93B 1JPTH 5GS1B 2E5EA 3VD3A 3GIZH 4YDIL 4GXUM 2E3VA 2JF1A 4MD5A 3HZMB 1XGPA 4Z7UB 3O9WB 3IS0X 3S34L 2H32B 4GUPB 3HB3D 4HJJH 3BN9D 1G9ML 3M45A 1LO5A 3MLRH 2XQBH 2IFFH 4V1DA 1NAKL 1FO0L 1C16B 3S35X 2VDRL 3I9GL 1YYLL 3T2PA 4K9EH 4KGLA 3TNMA 2J6EH 2Z4QB 3H0TA 1EMTH 3QT2A 5L9DH 3KHQA 1CDYA 1GL4B 1OAKL 2MWCA 5GGVL 5C07E 43CAB 2DQTH 2C4FU 5JW4M 2XTJC 1PZ5A 5E9DB 4OB5L 4PD4J 3WDJA 1CFNB 5EU5A 4G7YL 1UACL 1KXTB 2D0GA 3V6FA 5L9DL 2K1MA 4Q6IA 1ZVSB 4JM2A 5EZLA 2ADGB 3QAZC 4ZAKC 3QQ4B 1INDL 3S96A 1IM3B 3WN5A 3LV3B 2VKWA 4JRXE 3ZZ1A 4HIJB 3AS3A 3ARFA 5ALCL 3WL9A 1KIRB 4MJ5A 3G6JF 2FECI 4U1LA 3TN0B 3TBWA 1RU9L 1ORQB 1T20A 2DD8L 1FVDB 4OFKA 3KYKH 1YA5A 1INQA 2D9CA 5DJ2A 3KR3H 1H3PL 3RZCC 4RMUA 3VCLA 1TFHA 2B4CH 4O51B 5DJ8B 5HHQA 4G8IB 5LG1A 4K7PY 1KCVH 1U8MB 2FIKA 4YHOH 2M8XA 3HCVB 2VE6A 3O8XB 4UOW1 4N8VB 2CIIA 2C4FT 1IEHA 3SKMA 1PKQE 1PSKH 1I9JH 2RCSL 4LOUC 1U8KA 5EU6E 3U4BH 5LGKA 2R15A 4OZIA 4MHHI 3P9LA 3MRBA 4G8GD 5ERWA 1SBSL 1GSMA 3QDJD 3MLWL 5CIPB 1UKSA 3TA3D 2MCG1 4XP1H 1V7MH 3JWOH 1UH2A 1A64A 1FIGL 4JRWA 3GM8A 3QDGD 3H3BC 3T0VA 4X6BB 3WHE0 2VLJE 1YNKL 3BT2L 4ZAKB 4BH8A 3VWJD 1ZGLP 5K9OB 5K59E 5IHUH 4OQ1A 4XC1L 2NNAA 1FG2A 1MCJA 2Q8AH 4KK8D 2DB8A 4M6OH 5BRZA 3V9FA 5TF0A 3TCXA 4LASH 4UAOC 3QO0B 4KMLB 4ZD3L 1ZHNA 1NDGB 3SGJC 1XGTA 2ITDA 1WUNT 2GKIA 5FCSH 2K7PA 2R0ZL 4LNRA 3NH7H 4ELME 5DO2C 3JUYA 5IEKB 1BFSA 4JDTH 1AC0A 2X40A 2IAMD 3LIZL 3ES6B 2FLBT 1LO0H 2YUWA 3QRGH 1UH3A 2H45A 4Y2DC 1YYML 1B6DA 4HG4K 5F3HA 4JQXC 1FJ1B 1IKFL 3QWQB 3RIFF 1F6AB 4NM8H 4PJGE 1IILE 4K7PX 3B2UC 2AK4A 3UJIH 4OV5A 2FH8A 4XP4L 1YEIH 15C8H 3TVMC 4RGNB 5B38G 1U8NA 4L4TD 3PNWA 2Q7YA 4DN4H 4Z7VE 2OJZH 4RWYH 2Z4QA 3H0TB 5CGMA 2DKSA 3EFDH 4PJIB 2GJ6B 4QEGA 3JWNC 2HH0L 3O2VH 1N8ZB 4XNQB 4UOJA 5BQ7A 3KXFE 4J3VA 5EU5B 1GGBL 2QQQA 3VFVA 4E41D 5SWSD 2A83B 2ADGA 5MERB 4KJPD 4M7JL 5AZ2H 1EPFA 2DIJA 5GS0L 3NIGE 2CLRB 3HR5B 5I8EA 1J1PL 1OY3B 5GGRB 2YKLH 1FC2D 4HIJA 4LGSB 4EOWH 1QEWB 3FO2A 3WL9B 3OHXA 1J5OL 5A2LH 4JB9H 4LHUG 4EUPH 5FKPA 4O5LH 1T20B 3UAJD 5DMYA 3VXUD 5CBEA 3U1SL 3K8MA 1YEKH 1INQB 5DJ2B 3U30C 1M7XA 1S7SB 3NACL 4P2RD 3AY4A 3SE4C 4MA3B 5BS0A 1QRNA 4G8IA 1OARH 5FKAB 5EBLB 1KT2B 2DQDL 4WWKC 1QBMH 3I2CH 2FIKB 3HCVA 1IGIH 5ISZE 4H25A 1FZMB 2FD6L 4ZUUA 3TIDB 4M5ZL 3GMLB 1U8KB 4N0FA 4HW6A 1UWXK 2HRPL 1G7QB 3GSNB 1I3GL 1E4XH 2RB8A 3MGAA 5HI5D 5HGBB 1Q1JH 1A6WH 3RP1A 2X4SA 1PFCA 3MRBB 4OGYL 3FB8B 5BZWA 1ZT7B 1M6OB 2Y7QB 4WEBL 4RGNE 4S1DD 4U6TA 2VXTL 3OKNA 3VXMA 2R0LH 4HF5H 5T3ZD 3ZDZF 3R06A 5IQ7L 4YEEA 1FG2B 2P5WD 1ZVYA 1XIWA 3MACL 4ZS6D 1IE5A 2R1WA 4NQTA 3T0ED 1SBBA 2P5ED 1MI5B 4LDOB 3GSUA 4WW2A 4G6JL 1A6UH 3KLDA 1FYTE 4OSUL 3M17A 3PGFL 5IEKA 3VXOB 1V3KA 3HZYB 1EX0A 1HI6A 1NLBH 3IXAA