2EE1A

Solution structures of the chromo domain of human chromodomain helicase-dna-binding protein 4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSSGSSGKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the Chromo domain of human chromodomain helicase-DNA-binding protein 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Chromodomain helicase-DNA-binding protein 4
total genus 7
structure length 64
sequence length 64
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ee1A00
1B3AA 1G91A 3GV6A 4IURA 1CM9A 1F2LA 4RA8A 4X3KA 2N55A 4MHEA 3P7JA 1O7ZA 1PDQA 1NAPA 1F9RA 2B2YA 3KUPA 4U68A 5EKIA 1HFNA 3Q6SA 1HUNA 2B2TC 2HCCA 1PFNA 2CVRA 4HEDA 1XX8A 4IUUA 2FMMA 3ONAB 5D14A 2MPMA 2M2LA 5CBEE 2RA4A 1WD1A 1PLFA 1X3PA 1DOMA 1SAPA 3FPUB 4ZKCB 3I91A 1ILPA 1F9SA 4X3SA 1ESRA 5CORA 1HA6A 4HSVA 2HCIA 1QNKA 1WVLA 4QUCA 1JICA 4OIJA 1AP0A 1MGSA 4UAIA 4DN4M 1EIGA 2B2UA 1RTNA 2FJ2A 3DEOA 2KECA 2DY8A 2JYOA 2L1BA 3UI2A 4ZLTF 5EQ0A 4X3UA 4QUFA 4CJ0B 1RHPA 1KNAA 1O7YA 2B2UC 2EOTA 1DOKA 4X3TA 3I90A 1DONA 1EIHA 2K28A 2KEEA 1HUMA 1J9OA 1AZPA 2L9HA 1M8AA 1C8CA 2MGSA 4HCSA 1X3QA 1G6ZA 1E0BA 3G7LA 2J7ZA 4IUPA 5CMDA 1SSOA 1NCVA 2FINB 5T1GA 5EPJA 2L4NA 2KOLA 1RJTA 1U4MA 5DNFA 2X69A 2FFKB 1HFGA 3SVMA 1Q3LA 3LWEA 2RVLA 1QG7A 1B53A 4O42A 4R9WA 5D65A 2EPBA 2IL8A 1WTRA 1QE6A 1PFBA 1F9PA 2NWGA 4ZAIA 1TVXA 1SDFA 1EL0A 3FDTA 3D6WA 1LV9A 2K03A 1B2TA 5E4XA 1MSHA 2K1BA 2B2WC 4IUVA 1O80A 2KVMA 4ZK9B 4IUTA 2SDFA 3I8ZA 2NZ1D 1F9QA 2HUGA 2MJ8A 1U4PA 5JJZA 3N52A 3QO2A 4RWSC 4CJ1B 2RSOA 1AZQA 1DZ1A 2N88A 1G2SA 4XT1B 2K01A 4HAEA 1S4ZA 5E4WC 1U4LA 2XIWA 1IL8A 5COYA 2D9UA 2K05A 1ML0D 1MSGA 2RSNA 3GV3A 3IFDA 5EPKA 2B2TA 3I3CA 3TN2A 5T1IA 2EE1A 1DOLA 1IKMA 1U4RA 2Q8RE 2X6GA 1B4OA 1CA5A 3H91A 1RODA 4NW2A 1B50A 2JP1A 2L11A 2H1EA 2R3ZA 2MP1A 3IL8A 1EQTA 2HDLA 2L12A 1J8IA 4XDXA 4CJ2C 1A15A 5EJWA 5EPLA 1BNZA 2FHTA 3KBXA 1HRJA 1JE4A 1WTPA 2KEDA 1IKLA 3F2UA 4XT3B 1VMPA 1WTQA 1VMCA 1WD0A 1GUWA 1CA6A 4OIKA 1G2TA 2B2VA 2K04A 2DY7A 1BBXC 1PFMA 3HP3A 3MTSA 5AFWA 1NR2A 2B2VC 2VXWA 1HHVA 4RAUC 2BDNA 1WTXA 1BF4A 1MI2A 4IUQA 1ILQA 3DEPA 2HDMA 3R93A 1WTVA 2B2WA 2Q8TA 2KUMA 4LMQD 1ZXTA 1XYIA 1NR4A 1RTOA 4MN3A 1WTWA 4ZKBB 1X32A 1EOTA 3MWYW 2X6LA 3TZDA 4R8IA 5CBAE 3DM1A 2NYZD 1BO0A 1KNEA 2B2YC 1WTOA 1ICWA
chains in the Genus database with same CATH superfamily
1H9RA 3ND9A 4QJFA 5LMNW 1LTLA 1OXSC 3G4SA 2PO4A 1SFOH 2JA6H 1ZKOA 2FMMA 3O13A 3VR2A 5BN5A 4RG1A 2ICEC 3UDFA 1RTNA 3L9AX 3GTOH 2QKIC 2B63G 2L55A 3BJUA 4RHRA 2RHQB 2AMCB 3OYYA 1GUGA 1A62A 4C3IH 2AUJD 2L9HA 2M9VA 3E9HA 4C3JG 2XWBB 2KCCA 1SSOA 4OL7A 5DNFA 1PH3A 2Z9HA 3HFZB 1DCZA 3NXWA 4K2LA 1IW7D 2ZXOA 3DWQA 5DEHA 3K5NA 2EJFC 2O4XA 1ICFB 4OELB 3NPPA 1K0RA 4IJLA 4GKJL 2KCTA 2AWNA 4IQZA 3M3YH 2MJ8A 1VQ5A 1KDAA 1KQSA 4DAVA 4ME5A 2XIWA 1Z6HA 4PG3A 4HTHA 2NTSA 4JBKA 3I3CA 2BE5D 4DNIA 4TQUS 5IYBG 2B8GA 1JB7A 1X3FA 4E6IA 1OXXK 2DGYA 4HIMA 2E2IH 4ZUJA 2FHTA 1UE6A 4A3LH 2AUKA 5FO7B 1MJEA 3STBC 1B3QA 1XXGA 2YU9B 2ATWA 2UXDQ 1VF7A 1LYLA 4CKBA 2B8FA 2RHSB 4JI0Q 3R3OA 2LS01 1BF4A 2UXDL 2IX1A 4DR4L 3PUYA 4JYAQ 1XNRQ 4MN3A 2JQOA 3MWYW 3S15H 2XRQD 4JVZA 3HOXG 4PMCA 2O5JC 1XMQQ 2EY5A 1OXUA 3GTMH 4B9WA 2EJGC 3BDLA 1NAPA 3KUPA 1YI2A 1SEBD 4OWTB 1BCPB 1S5FD 3DMUA 3HOXH 3SXHA 3M4YA 1EY7A 5GQOA 2KHJA 3BYTB 4IJHA 4QGUA 3KF6B 1PH2A 5G3LF 4I7AA 3TMEA 1NMGA 1KABA 4UAIA 3DEOA 1BCPC 2L0CA 2VS1A 2NZOA 1HQRD 1N34Q 1JQYD 1V1PB 3D3RA 3G48A 3TP6A 1HUMA 2Q2IA 4DV0L 4H44C 1A2TA 3CF5A 4KD4A 4JCVE 2Y0SG 5DLQE 2F0SA 4ILWA 4X65L 1MHWC 2OXPA 1K8OA 1HFGA 2K5QA 3UDGA 5FJ8H 1I50H 1QVFA 3QIAA 2D62A 3PO2H 1FNWA 1EY5A 1XTCD 3K5OA 4FVMA 4YCVA 3CPFA 3RZOH 1SLJA 1TQOA 4B3TL 3HOWH 2PZWA 1MSHA 3KOJA 1VQOA 3VDYA 2SDFA 1EYAA 3I8ZA 4RGOS 3QO2A 5I6YA 5KNBA 1Y69U 1EUJA 2RSOA 2R92H 2KA7A 2IX3A 4OX9Q 3HKZG 4H7BA 2ZM6Q 4BY7G 4BXXH 3KLRA 5CV7A 4DR4Q 2RSNA 1QJOA 3NBHB 5C3WA 3GTGB 3VYUA 4A3JB 2F03A 3HOYG 4CDFC 3I72A 3ITPA 1B50A 1VQ6A 2TSSA 4EQNA 3ERSX 4BY7H 2RDHA 1S5DD 4KN4C 5C5LA 3CP0A 5EPLA 5EKLA 5HY6A 5C3EB 2D0OA 1VMPA 2F0EA 3H3VI 1GHKA 3RN5A 1PFMA 2EDGA 2EYJA 2VXWA 3I4NB 3L2PA 5IGFA 1X56A 2I46A 2C9OA 5JPMC 1PMRA 3H6MA 3FRPB 3P20A 4BBRH 1JJCB 4JV5L 4HJAA 3Q23A 4PZ7A 2SEBD 4HJ9A 4LFAL 2WB1E 4HSPA 3HEJA 4DV0Q 3MXUA 4YWKA 1EU3A 1TT2A 1Y1VG 3BZCA 5C44G 4C3IG 5C3XA 2QF7A 5M5YH 5FLMH 3DXJC 2B2TC 5D14A 5KEEA 3NSWA 2EYOA 3I91A 4KI0A 4GOPA 4LFBQ 3K57A 1WCMH 4G4KA 4B3TQ 4KJNA 1MGSA 4JBWA 5C6AA 2Q2TA 4A93G 5J39A 2JYOA 1IW7C 2K52A 2NTTA 2PNRC 2BH8A 1O7YA 3X3MA 1Y8OB 4P74A 3QJYA 1CQFA 2K28A 1K3BC 1BBWA 1E24A 2K5HA 1UEBA 1F2MA 2L4NA 1E22A 3CMAA 2G9HD 2X69A 4GLAC 3S1RH 1T5EA 5IYDG 5C3EG 1GOZA 4RGMA 3WOFA 2WB1B 4QIWE 2GVBA 4ZAIA 4CHTB 3W1BA 3D6WA 4A3BG 3OWFA 1HZAA 5E7NA 2K03A 2K5DA 2K1BA 2F3VA 4B3SL 3PIOA 2UUBQ 3LX0A 1D8LA 4JI2Q 3K80C 1AZQA 5I2YA 4EGVA 1PH1A 1G2SA 2E76C 5GROA 1TWAH 1D7QA 3HOYB 2JSOA 4QL5A 1ET6A 4LF9Q 2Q8RE 5JAVA 2JA5H 1K8MA 4KHPQ 2BA0A 2UXCQ 5D3DA 4HN7A 2MP1A 1EQTA 1LUZA 1KDCA 5LHY1 1VQ8A 1VQ4A 2E5LQ 2NZHA 1PTOD 5KYIA 1SYDA 3NTHA 2Z4IA 4JI0L 3S9WA 1CA6A 1BBXC 5AFWA 2E75C 1CKOA 1TWGH 3ICEA 3CQZH 5LMNL 1WCMG 3BVZA 3J81c 1SROA 1HXYD 2WACA 2CW0D 3MC0B 2JA5B 2VQFL 4B3ML 3NQTA 2JA6G 1VS0A 1F2LA 1V43A 1KLUD 1CSQA 4BY1B 2F52A 2CVRA 3GO5A 3K7AH 3I73A 1P16A 1PLFA 1DOMA 3FPUB 5CGKA 2JA8H 3CD6A 3H0GH 2HCIA 3BG3A 3GTKH 4G7OC 3KYHC 4IFDJ 1H95A 4JV5Q 4A3IB 1I3QH 1PZJD 1P8LA 1YJWA 4DAPA 2KCNA 2KEEA 4LF6L 3CKIB 2JK8A 3NELA 1G6ZA 4CKEA 1QCBD 1QZGA 2A68C 4FXDA 2SOBA 4R9WA 3MFGA 2R6GA 5JOBA 4X66L 1Q81C 1PFBA 2ZTDA 1NMFA 1G6PA 4YCWA 3NTIA 1A2UA 1B2TA 1PYBA 4NDXA 3HOUB 1VQPA 5GAEC 3S16H 3TBIB 3T53B 3C46A 4A3EH 1A8VA 1R4QB 4R4TA 3W3AA 3GTLH 5DM73 4Y7NB 1FR3A 1JR0D 2ES2A 3TQYA 4MNOA 1FGBD 1PRTC 4ID6A 3I4MG 2XWJB 2R93H 4N8X1 3IL8A 1STHA 1C0AA 4DPGA 4CJ2C 2F0HA 4POGA 4BA1I 3BDOA 2NVQB 2YTXA 3CC7A 1EOVA 3SEBA 4LF7Q 5C4XH 2R7FA 2HD3A 4J15A 3KJPA 4A3BH 4JI2L 5FO9B 1PZID 1LTID 5IGEA 4OHJA 2IPKD 4F88A 5LL6S 1CZGA 4NB3A 4BWGB 1JWMD 1Q7YC 3VYRA 2IJ0A 3KDFA 5LL6X 1CQVA 1HTLD 4GZYC 3S2DH 3T13A 4RA8A 1CK1A 1HUNA 1LACA 4N9TA 3PO3H 1SNQA 3RMHA 3RR5A 3HOUG 1K73C 1E1TA 1D2BA 3EROA 4LAAA 4JBMA 3BU2A 1GD7A 1D6EC 1QUQB 1TU2B 1OO9B 2MO1A 4PMWA 2B39A 1EFID 3OSOA 2OQKA 4RFBA 5FLXL 1JC7A 3NENA 3PUZA 3V2TA 1V9PA 4C3JH 2NN6G 2N49A 2E2HB 2XRSD 1PYSB 1Y1VH 4RCOA 1ESFA 4HCSA 4DAMA 3H09A 2J7ZA 2EZVA 1SYCA 5CMDA 1NCVA 5T1GA 4LF4Q 2GVAA 1DD2A 2HQEA 1U4MA 1VQMA 3D6CA 1CKNA 4R4CA 5BN3A 3BS1A 4LF8L 1XNQL 2JA6B 3S14H 2KQ3A 3MVVA 2EPBA 4DUZQ 4LF6Q 2DUDA 5D3IB 2R7ZG 3TRZA 2EYPA 3VA7A 4BXXG 1QZHA 3PIPA 3F8TA 2OT2A 2EIFA 3T56B 3TDQA 1A3VA 2MQHA 4EQPA 1QNUA 2WAQG 1ZYRD 2YTVA 1ENAA 3CQZB 2RBMA 4A4IA 1U4LA 3D31A 1I6HH 1ML0D 3U58A 2HQLA 1JT8A 3T1YQ 2EE1A 1X65A 3PF5A 3L0OA 4NW2A 3S15B 1EWCA 1LTAD 1Q46A 1OXTA 2QGQA 3S1NH 4R4OA 1QWYA 3DLLA 2Y0SB 1Q8KA 3FPPA 2RQXA 3M9BA 3RZDH 4L5SA 1EQRA 3K5LA 3QG1A 4QY7A 3IKJA 1EQVA 3ZYYX 3S1NB 4GKJQ 4DR1L 1PH8A 1FVIA 1NUCA 3WOEA 1BOSA 3A7AB 4O2DA 4K5XA 1RTOA 2IT1A 4L5RC 4P73A 1JOOA 1FNUA 2NVXH 1B3AA 2RCFA 3GTJB 3BVGA 2R7DA 4XYQA 2QCPX 3I4OA 3TZUA 2R7ZB 2B2YA 1UE5A 5C4ZA 5BR8Q 1RF2D 4KKTA 3S1MB 1I4HA 1XNQQ 3S16B 5CBEE 1X3PA 2VQEL 5IE8A 1XPRA 5M9OA 2NVXB 4DK1A 3CC2A 5ELCA 1PH4A 1JJ2A 1WJJA 4RMFA 1X3EA 1JICA 4G7ZC 1AP0A 2QDBA 3S1MH 1SNMA 2DY8A 1S40A 2WP8J 4ZYSA 4WRDA 2A69D 3GP7A 4IO9A 3IRBA 2F3IA 3J80E 1KLGD 1F2ZA 2MGSA 3A55A 3F1ZA 1X3QA 4DR2L 1IZ6A 2FINB 1YNJC 3PCOB 2YTYA 1CKMA 2F0UA 3I4MH 3D8GA 4A3EB 1SE8A 4X62L 1PRTF 1X55A 2VUMH 2G5DA 2F0GA 3KK7A 4OGQC 5CC4A 1Q1EA 4KTAA 2LFNA 3GTQH 2F4VQ 4K6LA 1Z47A 1IYVA 4BY1H 1SFOB 3S2DB 2K5NA 5JVH3 2QW7A 5GAHC 1L2FA 1IL8A 3GV3A 4LF5Q 4XQQA 4N9PA 2JA8B 3OIPA 5T1IA 1DOLA 2EY1A 4LF8Q 1S5BD 3SK4A 5K5PA 2PYKA 1AEXA 4DU9A 4KKUA 5IP7G 1B1ZA 2ZXPA 1J8IA 4A3IH 1BDOA 5JJIA 1CHPD 1L1OA 1HRJA 1JE4A 2VUMB 1FNVA 1HNWQ 3HKZB 5CV5A 4OIKA 3MXPA 3OTOL 2K04A 3I4MB 3MTSA 4LUOA 4R4QA 2LXJA 4ZRZA 2CH4W 3NEMA 4DV2Q 1SYEA 2F0KA 1SJED 1LTBD 2A69C 4C1NI 2XGTA 2WIIB 3A7LA 3URYA 4NPSA 3EIVA 3FKIH 1L1OC 2JE6I 3GTLB 1LABA 4DR1Q 4ZUIA 1EZ6A 1O7ZA 2QILA 5CV4A 2I5HA 4ZCKA 4L8JA 2HCCA 1KDBA 4XXEA 5C5MA 2J4XA 4L63B 1HJPA 3AFPA 3NBIA 3UE1A 4X3SA 2CFMA 1WTHA 4IPDA 3HOYH 1XMOL 4A3FG 3MXNA 1BR9A 1V8QA 1ONLA 4OIJA 2D5DA 3WDNA 3PUXA 2C5CA 4DR3L 1N36L 3E0EA 1I4QA 4JI5L 1EEFD 4CJ0B 2A6ED 1RHPA 4LW1A 2IX0A 2K32A 4X3TA 1YITA 5TSSA 4YY3Q 1TWFH 2OF1A 4A3BB 3CAMA 4IPHA 1UE7A 1TWAB 5IT9E 3D4DA 3A0JA 3KLSX 5E3FA 1V1OA 4KHVA 3CCJA 2UU9Q 4A75A 5D65A 1B53A 4N8FA 5FJ8G 2K4KA 1TWFB 2AQ3B 3J80i 4Z9CB 1XJVA 4IPCA 1WYDA 3HRZC 2A73B 4AH6A 2KVMA 1TWHH 4JYAL 2A19A 1Q1BA 1I5FA 4WFN3 1IL2A 1WCMB 4HMIA 4A3DG 1B9MA 3RLNA 2CWPA 2RKSA 3MA2B 4DGZA 1KL9A 1CUKA 2UUCQ 1YHBA 3PO3G 4HR7B 4DV1L 4RGTA 2BOSA 2UUCL 4LF5L 1IBLQ 5JJLA 5DAUA 3HGBA 1IBKQ 4DAYB 5IWAQ 5EAYA 1GM5A 1VQNA 1FJGQ 5ELFA 3TS2A 1IBLL 4OO1G 1CKNB 1Q8IA 1XMOQ 1PV4A 4X64Q 3OMGA 2FMCA 1I4GA 1AW7A 2HDMA 3DEPA 5ELBA 3HZXA 3J7YW 1SE2A 1SXTA 1UEAB 1XYIA 2K50A 5M5XB 1HQMC 1RL2A 4ZKBB 5C0XI 4K0KQ 1W3SA 3V05A 3MZ5A 1WTOA 2J0TD 1TY2A 1YNNC 1PTOH 3PO3B 5M5WH 4X66Q 1HFNA 4KLKA 5CV8A 1H9SA 3C1EA 4IALA 1HZCA 2K5WA 2RA4A 4ZKCB 1PHJA 1Y8NB 2MUYA 3TP5A 3GTGH 2KCMA 5CV6A 4NXNL 1EYDA 5C3EH 3A8JE 4F7XA 1L1OB 2TMPA 1IYUA 2GN5A 2Q2HA 3FP9A 4RKLA 5EQ0A 4QUFA 5IYCG 5IGGA 3TS0A 3PGZA 2AQ1B 4DR2Q 2JEAI 4DV6Q 3K81C 1BBUA 1E7ZA 2NBFA 5CV9A 2RCNA 1J9OA 4K5WA 1GUOA 1Y1WH 1C9OA 4AIMA 2FFKB 2R7ZH 1G291 1YEZA 3S1QH 4YHHQ 5IGDA 1QILA 3QOJA 2PQEA 1PTOC 1TVXA 1EL0A 1SJHD 3BYYB 2AKWB 2YV5A 4FO2A 3PIO3 3J81L 3U4ZA 1BKBA 3A8KE 1O80A 1LTTD 2HIXA 5G3LD 5JJZA 2R93B 2D2CC 5A35A 1AN8A 4GKKL 3R2IA 3MXGA 5E4WC 4KMUC 5EGTA 3AMUA 3EBEA 4O0AA 2OCEA 4HJ7A 3H0GG 1YJ9A 2Z4HA 4V190 2IY5B 4BBSH 3LNNA 1F2YA 2QDLA 3GDEA 4JW0A 2PI2E 2CHBD 3S1RB 2WV6D 3KBGA 1STGA 1M90C 1O7IA 2DJGC 4BS9A 1PH5A 4MTNA 5IGBA 5ISRA 2DY7A 4MTKA 5I4DA 5JEAH 1SMXA 2IHEA 1ENFA 5ELEA 2EXDA 4WJWA 4EX5A 3GTOB 5LMUQ 3R93A 1GXDC 1K9MC 3LWUA 1DJRD 4TRDA 2H5XA 4AYBG 2GA4B 3H0GB 1C7YA 1WTWA 3VR5A 5ELDA 3M4QA 3P1HA 1I6HB 4K6DA 3GV6A 3I7FA 4A3GG 4MHEA 1Z7TA 5EKIA 2F0WA 2NVYH 4XQNA 1HPCA 2M2LA 1HCZA 5F2DA 2R93G 3HOZG 5AJ3L 1FJGL 1ESRA 1PRTB 2SNSA 5CORA 1D5MC 3ULPA 1PVOA 1VQEA 5FK9C 2I07B 2PZTA 1SNCA 4GLVB 3T1HQ 2PW5A 2NB0A 1HR0L 4FF2A 4YY3L 3HKSA 4X3UA 4LWCA 2XTIA 2B2UC 1J5EQ 2BH2A 1YNXA 1SNPA 1AZPA 4KHPL 2UXCL 1C8CA 4NXMQ 1JOKA 1E0BA 3G7LA 1J5EL 1I94Q 2UUAL 2VUMG 1N9WA 3HOVH 3S1QB 3EN2A 1T5XD 2PQAA 5IT9c 2DNCA 4ALPA 1KD1C 4ZQ3A 1K28A 4AQYQ 3W5OA 3OW7A 3H94A 4JI7L 1ENCA 1QE6A 2ZM6L 1A3TA 4RCNA 3EQLC 5KIXA 3HOVG 4JI3Q 4P71A 1CI3M 2OTJA 5KRUA 1Z9FA 4OXPA 3L7ZC 1VQIA 3NBHA 4DXFA 1RKNA 1VQJA 5EBDA 4IFDI 3CW2C 2NZ1D 2E2JH 1U4PA 1EQQA 2LY7A 2WB1G 4XT1B 1E2VA 3AQQA 2K01A 4X62Q 4WJ3M 4H0LC 1YIJA 3TSSA 4WJ4A 2VW9A 3UE0A 4AYBE 3NUCA 4LK1C 2QEXA 1B4OA 1CA5A 5C44B 1SYGA 3UDIA 1LM0A 4EQ5A 1A0IA 1O78A 1TIID 1PTOB 4KY7A 1E2WA 1BNZA 3KBXA 1LTSD 1IKLA 3K5MA 5C4XB 4A93B 2F0FA 4K2KA 3CCRA 1TS3A 2IW3A 4M1UB 1C4QA 1MJCA 3IAYA 4DK3C 3I4NG 4K14A 4DA2A 1RCVD 2A6EC 4PV1C 4OX9L 1NY4A 3FVQA 1VDZA 1HA5A 3J7A5 4MIUA 3K58A 1EY9A 4DR5Q 1EOTA 3BZKA 3QR8A 2F0VA 4Y7NH 1Y1WG 4IURA 3CMEA 1I6VC 4FXGC 1MIUA 1PDQA 3PUWA 2VNUD 3J7AF 1EY0A 1A6XA 3JAME 1T9HA 1UAPA 2MO0A 4JBJA 1WD1A 1HNXL 4A3FH 2WKCA 1U0LA 1G8ZD 3K7UC 3KJOA 1CSPA 2JA7H 4KJOA 4HIDA 4DF7A 1LTGD 3HOUH 4JI8Q 2Y0SE 4A3MH 3I4NH 2HT1A 4ODGA 4OO1I 2DNEA 2A68D 2EOTA 3CPWA 3I90A 4TSSA 4OONA 4EVOA 4JI8L 1VQBA 5I9OA 1M8AA 3CRLC 4LNQA 3OIQA 3C2PA 3OW2A 2AQ2B 5IP9H 4YHHL 5EPJA 2KOLA 1EIYB 1STEA 2K7VA 4JI6L 3JAML 1X6OA 2UUBL 1K83B 4DK6C 4HCEA 3CCUA 3I70A 4FF3A 3D4RA 1WTRA 5M5XH 1J6QA 1ASYA 1A3UA 3UDXA 4OO1H 4PZ6A 4QMGA 3VR4A 1SDFA 2A5HA 3SGIA 5IGCA 5FKAC 3MHBA 1LV9A 3M7NA 4FYDA 4IUVA 3TP8A 2WFWA 2ASBA 4JK1C 4L5TA 4NXNQ 3U9OA 1R4PB 2NN6H 4IOAA 4KY6A 3R2TA 3RUZA 4FXKC 1STNA 1Y1WB 4LJZC 3V96A 4DXGA 2B2TA 3PIP3 3TN2A 4DR5L 2F3WA 3PUVA 5GADC 2F0LA 1RODA 2MHVA 4C56C 2JP1A 3CU7A 1FL0A 1EZ8A 2AHOB 1LLRD 1E2ZA 4A3CG 5FLXE 3FHWA 1QB5D 2NVYB 4XT3B 3A5UA 4R1JA 5J3BA 1BXTA 4XQJA 4C3HG 3A74A 4DR3Q 4C1NK 3A54A 2B2VC 2K6AA 4CBVA 3B6YA 5K36G 3J80L 4JPBW 4C3IB 4LF7L 2BDNA 3F2CA 1WTXA 2JA7G 4IUQA 5BR8L 3NHHA 1JOQA 2VB3X 4DR6Q 4GNXC 1H9KA 4HIOA 1BVSA 2E2HH 1K83H 1V1PA 4O1NA 3RLOA 1ICWA 3U50C 3MEHA 1PYWD 2N55A 3P7JA 2RDFA 3J80c 2VY3A 3NTKA 1PXUA 4JI1L 5FOBB 2A8VA 3C3LA 1XX8A 3J81j 4IUUA 1HR0W 3S2HH 4EQOA 4U673 2ZJQA 2O5IC 3GTPH 3NP8A 4A3JH 1JE5A 1F9SA 4GN5A 1HA6A 1B8AA 3A8IE 1EY4A 2E8GA 3SK8A 1W2BA 1NJIC 1HNWL 2FJ2A 1NE3A 3CCQA 1AFPA 3UI2A 1EWIA 3EA6A 1YVCA 1KC8C 3GD7A 1GUNA 3T1YL 2G9DA 5LMUL 4A3MB 3HOWB 1Q86C 3Q0AA 4BBSB 1HTPA 3CRKC 2B29A 1RJTA 4JI7Q 3STBD 4C3HB 2JJQA 5DM63 3GTJH 1TY0A 4HJ5A 3RN2A 1Y14B 3A5ZB 4O42A 5EKKA 2Z6KC 2A6HC 4A3DB 3FEWX 5JEAG 1JCKB 4A76A 2EXZA 3OOCA 5J1ZA 3TP7A 4ZK9B 3S17H 2BE5C 1PZKD 1LT4D 3E9IA 2HUGA 1JWSD 3T1HL 5E1FA 1M1KC 4KKSA 3I2ZA 2K05A 1ZEQX 2F0JA 4IZ8A 3CCVA 1AE2A 4X65Q 4NKLA 1TKWB 2ENBA 3JC66 5HGTA 1K8AC 4A3GB 4PZ8A 5M3MG 2SNMA 4TVAB 4LFAQ 3FMCA 2CCZA 5M5YB 4DNTB 3Q22A 4V0BA 4OWWB 4JOIA 1V1QA 5C0XH 2ZXRA 3ULJA 5EJWA 5A2QL 4Y52H 4BA2I 4UPAA 1WTPA 1CFMA 4DUYQ 4JI4L 3K7AB 4RGNA 4FNFA 4PQXA 4UDUC 3CC4A 1W6JA 1B44D 2Z6BA 4CDDC 4LFBL 2K14A 2KHSA 4DV6L 3P75A 2ZTCA 1ILQA 2H4OA 4G57A 5KNCA 1YHQA 3T4AC 2KJXA 2LMCB 4LMQD 3FKIB 1EYGA 4CKCA 4YWMA 2E2JB 4JC0A 1MBYA 1G91A 3S14B 2R61A 4A3KG 2ZTEA 1N36Q 3F2BA 5ELNA 4IOCA 4JOIC 3K0YA 2VZAA 3I55A 3C1FA 1A63A 4HMJA 1SAPA 2WAQB 3JAMc 4YIJA 4GNXB 4F87A 2JA5G 3M85A 3LGJA 4DUZL 3PO2B 5J22A 1N34L 4MZ9A 4DN4M 4GKKQ 3H15A 1RDPD 4LUVA 1I4RA 4ZLTF 4IPGA 2B3GA 5CYUA 1JORA 3T51B 4X64L 3BZDB 4ABNA 4A3GH 2XVSA 4K8JA 4A3LG 1VQCA 4KD3A 4JI1Q 3G6EA 5JJKA 2A1AA 2Z6KA 3D0FA 5M3MH 2RVLA 4DV7L 3AU7A 2VB2X 3W1GA 5C4HA 1D1IA 2NWGA 1SN8A 2P5ZX 4PNYA 3GTPB 2CQAA 1G51A 2E2DC 1LO5D 3JAMi 3N52A 1DZ1A 3RZDB 2V4DA 5LMNQ 2XNAC 1NNXA 2WINB 4HAEA 1KTKA 5COYA 4DKAC 2PPBC 3L3OC 4J6HA 4BBRG 3IFDA 2AWOA 1QUQA 2B63B 2PMZB 1U4RA 1IKMA 1R9TH 3SE0A 4CDEC 3A56A 1X54A 2OWOA 3AYHB 2L12A 1EIFA 3KFUA 1LT3D 2JA9A 4GN4B 2F1MA 1RD9D 2KHIA 1BUVT 2YU9H 1GUWA 1NTGA 1SYBA 2OEOA 2F0DA 3AB9A 3KDFB 1G2TA 3HP3A 5C0XG 3K59A 4DK0A 1LT6D 4J8QA 2E5LL 2EY2A 1WTVA 3VR3A 1NR4A 1DYQA 1I94L 2UUAQ 4JG2A 2O2LD 2E74C 4R8IA 1UNSA 3SHLA 1SRUA 4GNXA 1CM9A 4HJ8A 2F0PA 4KN7C 4XYOA 1D5XC 2Z1CA 3E5SA 3QB3A 2LKVA 2EJMA 3EJIA 3M7GA 3U9SA 3J7ZC 3M3YB 5KGUA 4HEDA 1UE1A 2K75A 3EVQA 2MPMA 4I65A 4PMBA 2IHFA 3PO2G 1ILPA 3VR6A 1TS4A 1GO3E 1B70B 1MD2D 5JVG3 4DV3Q 4BY7B 2B2UA 3E6ZX 2KECA 1TR5A 4UHVA 3MFYA 3KLSA 5M3FB 2F4VL 4IUNA 3PQIA 2VQFQ 1DONA 1NSNS 2HIVA 2NUCA 2EYHA 4DAYA 5IYCH 1U5KA 3FKIG 2XSCA 1QVGA 3OMCA 4LF4L 3S2HB 4IFDG 2VQEQ 2QA4A 5IYDH 1O7LA 4H02A 2EQSA 3VA5A 2HHHQ 1WFQA 1F9PA 4B3SQ 1PH9A 3FDTA 4BY1G 2HHHL 5AJ3Q 1GJXA 1YHAA 1XPOA 1EU4A 1EY8A 1XNRL 1VQGA 3GTKB 1VQLA 1HZ9A 4DV7Q 4XTCS 3CCLA 4A3CH 3MEFA 4DR7L 1PRTD 1SE4A 1XMQL 3PV0A 2FXQA 1STAA 1XWEA 4R4IA 4UP9A 1GVPA 3BDCA 3DM3A 1BQQT 3KF8A 1KRSA 1XTDA 2NN6I 5FLMG 1QVCA 1II3A 3F2UA 3M4OH 4K5VA 1FD7D 4A3FB 1TWHB 4APVA 3KF8B 2I5LX 3RLFA 1SMYC 2YYZA 1C48A 4QF4A 2V1CC 5IYBH 4FF4A 2OQ0A 5JEAJ 5IWAL 4DNRB 2I0QA 1HNZL 3CXCA 2N3SA 2PI2A 2X6LA 3S24A 4P75A 3AEVA 1DGSA 5IY0A 1OXVA 3SK5A 1L0WA 3CHBD 4X3KA 1CTMA 5KNDA 4A3KH 4ME3A 4GOPB 3K0XA 4POFA 4U68A 1HR0Q 3TREA 3I56A 3Q6SA 1DM0B 3NQIA 4JI5Q 1PFNA 1YJNA 3PSIA 4LFCQ 4QQBX 4R8NA 2PZUA 1PH6A 2A74C 1KRTA 4DV5L 3EFXD 1GHJA 4GN3B 1WVLA 4JI4Q 1S5ED 3IFTA 2L1BA 1IHZA 4KK7A 2CW0C 2PQAB 4B08A 1KNAA 4UY8C 4KHZA 3DWPA 2WAQE 4LUZA 1QOHA 1EIHA 1YNJD 5C44H 1CZWA 1VQFA 1AE3A 3HOWG 4JI3L 5IODA 3F2DA 4B3RQ 2B63H 4A3MG 4IUPA 5C4JB 4KV6A 1EFWA 4BBSG 1IBML 4TKOB 1Q3LA 2ALYB 1N32Q 2KBNA 1QG7A 2D0PA 2PCFB 4OEMB 1CHQD 2CH4A 1STBA 2B2WC 1IBKL 3OHXC 1Q12A 1GUTA 3DHQA 1B9NA 3VYSA 1TS5A 4CGYB 1VF5C 1H9SB 4DV1Q 2D9UA 1DXMA 1MSGA 1HNZQ 1VQDA 2JN4A 5EPKA 2CQOA 2X6GA 2MFIA 3KF6A 2PW7A 2ZT9C 2F4IA 2R3ZA 5CR3A 3U4VA 2UU9L 1NBWA 1I4XA 1UUPA 2QEJC 3BVMA 3CCSA 1OTCA 3E3XA 2Q2UA 1EEID 3I4LA 3PF4A 4FDBA 1IXRA 4YCUA 4P72A 3OTOQ 1L0XB 1M4VA 1S5CD 2MNAA 1WTQA 4RH6A 4DV2L 4K0KL 3GTQB 2EVBA 5I2XA 1SYFA 4A3IG 1AH9A 1HHVA 3Q8DA 4RAUC 2F0OA 1SBBB 3HS0C 1ASZA 2C35B 3H3VH 4NP5A 5HURA 1KAWA 2B2WA 1U9RA 3QWNA 1X3GA 5A2QE 1PH7A 3DUZA 3GQBA 4NXML 2RF4A 4DR7Q 3MAQA 1JB3A 4A3JG 4DUYL 1WI5A 3ER0A 3RZOB 2XN9C 1S3OA 1YBYA 2L15A 4DV4L 3DM1A 2NYZD 2F0MA 4L5QA 4AQYL 1H9MA 3R8BA 1YZ6A 3TEHB 1E1OA 1N33Q 4A3KB 2L5TA 1PA6A 1ZYRC 3H3VC 2JEBI 1VQKA 3S17B 1VCIA 2E2IB 4L6TB 4B3MQ 3J81E 4IFDH 1YNND 4QIWB 4AYBB 1VQ9A 1EIGA 1Y8PB 3CCEA 3J7AV 1STYA 1TXYA 2ID0A 1L0YB 2F0NA 4QB4A 2NVQH 4C3HH 1I4PA 1DOKA 2LSSA 2NVTB 2A6HD 2ICIA 5IIFA 3M4OB 1HH2P 1SMYD 3SK6A 3HOXB 3NWSA 4DR6L 4A93H 4LFCL 1E3PA 3QOLA 3LWEA 4P2CB 1IYJB 1TWCB 2Z0SA 4FF1A 3HOZH 3E0JA 2VL6A 4DV5Q 4RHSA 5C4XG 4X6AH 4C2MH 2EYLA 5E4XA 1KXLA 1SR3A 3OPOA 1D5ZC 4IUTA 1N8RC 3X3NA 3SDZA 4DFAA 4RWSC 4CJ1B 4GLXA 3CCMA 1N32L 4YWLA 2N88A 2EYFA 5GAGC 3D4WA 1S4ZA 1VQAA 5I9PA 1R9TB 3RD4A 1KIXA 1KAAA 4UP8A 1EY6A 2JA8G 1IBMQ 2F0QA 4GS3A 2UXBL 5FO8B 1X9NA 3GTMB 1JWUD 3KLWA 3ULLA 1A15A 3M4PA 3T16A 1D1KA 2IWHA 2KEDA 4GOPC 4A3EG 1I3QB 2I5MX 1JMCA 1LT5D 2R92B 5FLXc 3VYTA 1S72A 5EBCA 2DJFC 1F77A 5M3FH 2Q8IB 2PMZE 1TWCH 1MI2A 1LTRD 3DWAA 2Q8TA 2JXMB 5H1SE 3N6RA 1I50B 3HKZE 3TZDA 4BBRB 5CBAE 2OTLA 1BO0A 1KNEA 2R92G 5KYLA 2Z8LA 2ZJRA 2ZJPA 1F9RA 1EYCA 2N8NA 5NUCA 2M00A 1BCPD 1Y1VB 4IN3A 3NWTA 3ONAB 2F0IA 5IP7H 4HIKA 2K5VA 3HOVB 2K33A 3G71A 1H9JA 4DV4Q 3WWVA 5IOCA 1TWGB 4HSVA 2KENA 1QNKA 3PMFA 1XPUA 4QUCA 1CT1D 1GUSA 1HNXQ 5ELOA 5K36H 4M8AA 1MKHA 4G7HC 1VQ7A 4XIGS 1SE3A 4CDCC 4WORA 4C3JB 4H13C 3J81i 4DV3L 1B7YB 1N33L 4Q0FA 3SVMA 3G6JB 5HGQA 2UXBQ 3OWEB 4FP5D 1VQHA 5I6WA 1Q90A 3ERQA 2IL8A 3MXNB 2WKDA 4S3SA 4JI6Q 4NMZA 1Q82C 2CKZB 2BA1A 4I7ZC 2DN8A 1FGUA 5M5WB 3HOZB 1KHIA 5C0XJ 4LF9L 2CWAA 4Q5VA 1UWVA 1F9QA 4F8MA 2PNHA 1K3RA 1K8GA 4RKBA 3SR1A 1TS2A 3K8AA 2JA7B 1JJGA 3HG9A 5IT9L 1ET9A 2RDGA 4ULLA 3Q24A 4OWXB 1SNOA 1WOCA 3H91A 2L11A 2H1EA 4A3DH 4B9XA 5M3MB 2HDLA 1FYCA 2EYMA 4B3RL 4XDXA 4QCLA 4K8IA 4C2MB 2EY6A 1EWHA 2N78A 4UP7A 1SNDA 4KY5A 3NE5B 1K0SA 3NK9A 1VMCA 3W2DA 1WD0A 2B2VA 1PTOF 1NR2A 5JPNC 4J1MA 1BCPF 3AFQA 2BDOA 1GKHA 1RIPA 2KUMA 1ZXTA 2LXKA 3ND8A 5L37A 5C4JH 1X32A 2NVTH 5M3FG 2BCOA 1HZBA 2F0TA 1W6KA 5BN4A 3K6OA 5IP9G 3RNUA 1PFSA 2B2YC 3ZJYC
chains in the Genus database with same CATH topology
1H9RA 3ND9A 1OXSC 2PO4A 1ZKOA 2FMMA 3O13A 3VR2A 5BN5A 2ICEC 1RTNA 3L9AX 2QKIC 2L55A 4RHRA 1GUGA 2AUJD 2L9HA 2M9VA 4C3JG 2XWBB 2KCCA 1SSOA 4OL7A 5DNFA 1DCZA 3NXWA 4K2LA 1IW7D 2ZXOA 3DWQA 5DEHA 3K5NA 2EJFC 2O4XA 3NPPA 2AWNA 4IQZA 2MJ8A 1KDAA 4DAVA 4ME5A 2XIWA 1Z6HA 4HTHA 2NTSA 3I3CA 2BE5D 4TQUS 2B8GA 4E6IA 1OXXK 4ZUJA 2FHTA 2AUKA 5FO7B 1XXGA 2YU9B 1VF7A 4CKBA 2B8FA 3R3OA 2LS01 1BF4A 2IX1A 3PUYA 4MN3A 3MWYW 2XRQD 4PMCA 2O5JC 2EY5A 1OXUA 4B9WA 2EJGC 3BDLA 1NAPA 3KUPA 1SEBD 1BCPB 1S5FD 3DMUA 3SXHA 3M4YA 1EY7A 3BYTB 5G3LF 3TMEA 1KABA 4UAIA 3DEOA 1BCPC 2L0CA 1HQRD 1JQYD 1V1PB 3D3RA 3TP6A 1HUMA 4H44C 1A2TA 4KD4A 2F0SA 4ILWA 1K8OA 2OXPA 1HFGA 2K5QA 3QIAA 2D62A 1FNWA 1EY5A 1XTCD 3K5OA 4FVMA 1TQOA 2PZWA 1MSHA 2SDFA 1EYAA 3I8ZA 4RGOS 1Y69U 3QO2A 5I6YA 5KNBA 2RSOA 2KA7A 2IX3A 4H7BA 3KLRA 5CV7A 2RSNA 1QJOA 5C3WA 3GTGB 3VYUA 4A3JB 2F03A 3I72A 3ITPA 1B50A 4EQNA 2TSSA 2RDHA 1S5DD 4KN4C 5C5LA 5EPLA 5EKLA 5C3EB 1VMPA 2F0EA 1GHKA 1PFMA 2EDGA 2EYJA 2VXWA 3I4NB 5IGFA 2I46A 2C9OA 5JPMC 1PMRA 3H6MA 3FRPB 3P20A 3Q23A 2SEBD 4HSPA 3HEJA 3MXUA 1EU3A 1TT2A 4C3IG 5C3XA 2QF7A 3DXJC 2B2TC 5D14A 5KEEA 3NSWA 2EYOA 3I91A 4KI0A 3K57A 4G4KA 4KJNA 1MGSA 4JBWA 5C6AA 5J39A 2JYOA 1IW7C 2NTTA 2PNRC 1O7YA 3X3MA 1Y8OB 3QJYA 1CQFA 2K28A 1F2MA 2L4NA 2G9HD 2X69A 1T5EA 1GOZA 4RGMA 3WOFA 2WB1B 4ZAIA 4CHTB 3D6WA 3OWFA 2K03A 2K5DA 2K1BA 2F3VA 3LX0A 1AZQA 5I2YA 4EGVA 1G2SA 2E76C 3HOYB 2JSOA 1ET6A 2Q8RE 5JAVA 1K8MA 2BA0A 5D3DA 4HN7A 2MP1A 1EQTA 1KDCA 5LHY1 1PTOD 5KYIA 1SYDA 3NTHA 2Z4IA 3S9WA 1CA6A 1BBXC 5AFWA 2E75C 3BVZA 1HXYD 2WACA 2CW0D 3MC0B 2JA5B 3NQTA 1F2LA 1V43A 1KLUD 4BY1B 2CVRA 3GO5A 3I73A 1PLFA 1DOMA 3FPUB 5CGKA 2HCIA 3BG3A 4G7OC 4IFDJ 4A3IB 1PZJD 4DAPA 2KCNA 2KEEA 3CKIB 1G6ZA 4CKEA 1QCBD 2A68C 4FXDA 2SOBA 4R9WA 5JOBA 2R6GA 3MFGA 1PFBA 3NTIA 1A2UA 1B2TA 4NDXA 3HOUB 3TBIB 3T53B 3C46A 1R4QB 3W3AA 5DM73 4Y7NB 1FR3A 1JR0D 1FGBD 1PRTC 4ID6A 2XWJB 3IL8A 1STHA 4CJ2C 2F0HA 4BA1I 3BDOA 2NVQB 3SEBA 5FO9B 1PZID 1LTID 5IGEA 4OHJA 2IPKD 4F88A 5LL6S 1CZGA 4BWGB 1JWMD 3VYRA 2IJ0A 5LL6X 1CQVA 1HTLD 4GZYC 3T13A 4RA8A 1CK1A 1HUNA 1LACA 4N9TA 1SNQA 3RMHA 1D2BA 3EROA 4LAAA 1D6EC 1TU2B 1OO9B 4PMWA 2B39A 1EFID 3OSOA 4RFBA 5FLXL 1JC7A 3PUZA 3V2TA 2NN6G 2E2HB 2XRSD 4RCOA 1ESFA 4HCSA 3H09A 2J7ZA 2EZVA 1SYCA 5CMDA 1NCVA 5T1GA 1DD2A 2HQEA 1U4MA 3D6CA 5BN3A 3BS1A 2JA6B 2KQ3A 3MVVA 2EPBA 5D3IB 2EYPA 3VA7A 2OT2A 3T56B 3TDQA 1A3VA 4EQPA 1QNUA 1ZYRD 1ENAA 3CQZB 2RBMA 1U4LA 3D31A 1ML0D 2EE1A 4NW2A 3S15B 1EWCA 1LTAD 1OXTA 1QWYA 2Y0SB 3FPPA 2RQXA 3K5LA 3QG1A 3IKJA 1EQVA 3ZYYX 3S1NB 1NUCA 3WOEA 1BOSA 3A7AB 4K5XA 1RTOA 2IT1A 1JOOA 1FNUA 1B3AA 3GTJB 3BVGA 4XYQA 2QCPX 3TZUA 2R7ZB 2B2YA 5C4ZA 1RF2D 4KKTA 3S1MB 1I4HA 3S16B 5CBEE 1X3PA 5M9OA 2NVXB 4DK1A 5ELCA 4G7ZC 1JICA 1AP0A 2QDBA 1SNMA 2DY8A 2WP8J 4ZYSA 4WRDA 2A69D 3GP7A 3J80E 1KLGD 1F2ZA 2MGSA 3A55A 1X3QA 2FINB 1YNJC 2F0UA 3D8GA 4A3EB 1PRTF 5CC4A 2F0GA 3KK7A 4OGQC 1Q1EA 4KTAA 2LFNA 4K6LA 1Z47A 1IYVA 1SFOB 3S2DB 5JVH3 1IL8A 3GV3A 4XQQA 4N9PA 2JA8B 3OIPA 5T1IA 1DOLA 2EY1A 1S5BD 3SK4A 5K5PA 2PYKA 1AEXA 4DU9A 4KKUA 1B1ZA 2ZXPA 1J8IA 1BDOA 1CHPD 1HRJA 1JE4A 2VUMB 1FNVA 3HKZB 5CV5A 4OIKA 3MXPA 2K04A 3I4MB 3MTSA 4ZRZA 1SYEA 2F0KA 1SJED 1LTBD 2A69C 4C1NI 2WIIB 3A7LA 3URYA 2JE6I 3GTLB 1LABA 4ZUIA 1EZ6A 1O7ZA 2QILA 5CV4A 4L8JA 2HCCA 1KDBA 4XXEA 5C5MA 2J4XA 4L63B 3NBIA 4X3SA 3MXNA 1BR9A 1V8QA 1ONLA 4OIJA 2D5DA 3WDNA 3PUXA 2C5CA 1I4QA 1EEFD 4CJ0B 2A6ED 1RHPA 2IX0A 2K32A 4X3TA 5TSSA 2OF1A 4A3BB 1TWAB 5IT9E 3D4DA 3KLSX 5E3FA 1V1OA 4KHVA 5D65A 1B53A 1TWFB 2AQ3B 4Z9CB 3HRZC 2A73B 2KVMA 1Q1BA 4WFN3 1WCMB 4HMIA 1B9MA 2RKSA 3MA2B 4DGZA 4HR7B 4RGTA 2BOSA 5DAUA 3HGBA 5ELFA 4OO1G 1Q8IA 3OMGA 5ELBA 2FMCA 1AW7A 1I4GA 2HDMA 3DEPA 3HZXA 3J7YW 1SE2A 1SXTA 1UEAB 1XYIA 5M5XB 1HQMC 4ZKBB 5C0XI 3V05A 3MZ5A 1WTOA 2J0TD 1TY2A 1YNNC 1PTOH 3PO3B 1HFNA 5CV8A 1H9SA 3C1EA 4IALA 2K5WA 2RA4A 4ZKCB 1Y8NB 2MUYA 3TP5A 5CV6A 1EYDA 3A8JE 4F7XA 2TMPA 1IYUA 4RKLA 5EQ0A 4QUFA 5IGGA 2AQ1B 2JEAI 2NBFA 5CV9A 1J9OA 4K5WA 1GUOA 2FFKB 1G291 5IGDA 1QILA 3QOJA 2PQEA 1PTOC 1TVXA 1EL0A 1SJHD 3BYYB 4FO2A 3PIO3 3J81L 3A8KE 1O80A 1LTTD 5G3LD 5JJZA 2R93B 2D2CC 5A35A 1AN8A 3R2IA 3MXGA 5E4WC 4KMUC 5EGTA 3AMUA 2Z4HA 4V190 3LNNA 1F2YA 2CHBD 3S1RB 2WV6D 3KBGA 1STGA 4BS9A 5IGBA 5ISRA 2DY7A 5I4DA 5JEAH 1ENFA 5ELEA 4WJWA 3GTOB 3R93A 1GXDC 3LWUA 1DJRD 4TRDA 2GA4B 3H0GB 1WTWA 3VR5A 5ELDA 3P1HA 1I6HB 4K6DA 3GV6A 4MHEA 1Z7TA 5EKIA 2F0WA 4XQNA 1HPCA 2M2LA 1HCZA 5F2DA 1ESRA 1PRTB 2SNSA 5CORA 1D5MC 5FK9C 2I07B 2PZTA 1SNCA 2PW5A 2NB0A 4FF2A 4X3UA 2B2UC 1SNPA 1AZPA 1C8CA 1JOKA 1E0BA 3G7LA 3S1QB 1T5XD 2DNCA 4ZQ3A 3OW7A 3H94A 1ENCA 1QE6A 1A3TA 4RCNA 3EQLC 5KIXA 1CI3M 5KRUA 3L7ZC 3NBHA 4DXFA 1RKNA 5EBDA 4IFDI 2NZ1D 1U4PA 2LY7A 4XT1B 1E2VA 2K01A 4H0LC 3TSSA 3NUCA 4LK1C 1B4OA 1CA5A 5C44B 1SYGA 1O78A 1TIID 1PTOB 4KY7A 1E2WA 1BNZA 3KBXA 1LTSD 1IKLA 3K5MA 5C4XB 4A93B 2F0FA 4K2KA 1TS3A 2IW3A 4M1UB 1C4QA 3IAYA 4K14A 4DA2A 1RCVD 2A6EC 4PV1C 3FVQA 1VDZA 1HA5A 4MIUA 3K58A 1EY9A 1EOTA 2F0VA 4IURA 1I6VC 4FXGC 1PDQA 3PUWA 2VNUD 3J7AF 1EY0A 1A6XA 3JAME 1UAPA 1WD1A 2WKCA 1G8ZD 4KJOA 4DF7A 1LTGD 4ODGA 4OO1I 2DNEA 2A68D 2EOTA 3I90A 4TSSA 4EVOA 5I9OA 1M8AA 3CRLC 3OIQA 3C2PA 2AQ2B 5EPJA 2KOLA 1STEA 2K7VA 3JAML 1K83B 4HCEA 3I70A 4FF3A 3D4RA 1WTRA 1A3UA 4OO1H 4QMGA 3VR4A 1SDFA 2A5HA 5IGCA 5FKAC 3MHBA 1LV9A 3M7NA 4FYDA 4IUVA 3TP8A 4JK1C 3U9OA 1R4PB 2NN6H 4KY6A 3R2TA 3RUZA 4FXKC 1STNA 1Y1WB 4LJZC 3V96A 4DXGA 2B2TA 3PIP3 3TN2A 2F3WA 3PUVA 2F0LA 1RODA 4C56C 2MHVA 2JP1A 3CU7A 1EZ8A 1LLRD 1E2ZA 5FLXE 1QB5D 2NVYB 4XT3B 1BXTA 4XQJA 4C3HG 4C1NK 3A54A 2B2VC 2K6AA 4CBVA 5K36G 3J80L 4C3IB 2BDNA 1WTXA 4IUQA 3NHHA 1JOQA 2VB3X 1H9KA 4O1NA 1V1PA 1ICWA 3MEHA 1PYWD 2N55A 3P7JA 2RDFA 3NTKA 1PXUA 5FOBB 3C3LA 1XX8A 4IUUA 4EQOA 4U673 2O5IC 3NP8A 1F9SA 1HA6A 3A8IE 1EY4A 3SK8A 2FJ2A 1AFPA 3UI2A 3EA6A 3GD7A 1GUNA 2G9DA 4A3MB 3HOWB 3Q0AA 4BBSB 1HTPA 3CRKC 1RJTA 4C3HB 5DM63 1TY0A 4O42A 5EKKA 2A6HC 4A3DB 3FEWX 5JEAG 1JCKB 2EXZA 3OOCA 5J1ZA 4ZK9B 3TP7A 2BE5C 1PZKD 1LT4D 2HUGA 1JWSD 5E1FA 4KKSA 2K05A 1ZEQX 2F0JA 4IZ8A 4NKLA 1TKWB 2ENBA 5HGTA 4A3GB 5M5YB 2SNMA 3FMCA 4DNTB 3Q22A 4V0BA 5C0XH 2ZXRA 5A2QL 5EJWA 4BA2I 1WTPA 1CFMA 3K7AB 4RGNA 4FNFA 4PQXA 4UDUC 1W6JA 1B44D 2KHSA 3P75A 1ILQA 2H4OA 5KNCA 4G57A 3T4AC 2KJXA 2LMCB 4LMQD 3FKIB 4CKCA 2E2JB 1MBYA 1G91A 3S14B 2R61A 3K0YA 3C1FA 4HMJA 1SAPA 2WAQB 4YIJA 4F87A 3M85A 3PO2B 5J22A 4DN4M 1RDPD 1I4RA 4ZLTF 5CYUA 1JORA 3T51B 3BZDB 4ABNA 2XVSA 4K8JA 4KD3A 2RVLA 3AU7A 2VB2X 5C4HA 1D1IA 2NWGA 4PNYA 3GTPB 2CQAA 2E2DC 1LO5D 3N52A 1DZ1A 3RZDB 2V4DA 2XNAC 4HAEA 2WINB 1KTKA 5COYA 2PPBC 3L3OC 4J6HA 3IFDA 2AWOA 2B63B 2PMZB 1U4RA 1IKMA 3SE0A 3A56A 2L12A 1LT3D 2F1MA 1RD9D 1BUVT 1GUWA 1SYBA 2OEOA 2F0DA 3AB9A 1G2TA 3HP3A 5C0XG 3K59A 4DK0A 1LT6D 4J8QA 2EY2A 1WTVA 3VR3A 1NR4A 1DYQA 2O2LD 2E74C 4R8IA 1UNSA 3SHLA 1CM9A 2F0PA 4KN7C 4XYOA 1D5XC 2Z1CA 3E5SA 3QB3A 2LKVA 2EJMA 3EJIA 3M7GA 3U9SA 3M3YB 5KGUA 4HEDA 3EVQA 2MPMA 4I65A 4PMBA 1ILPA 3VR6A 1TS4A 1MD2D 5JVG3 4BY7B 2B2UA 3E6ZX 2KECA 1TR5A 3MFYA 3KLSA 5M3FB 4IUNA 1DONA 1NSNS 2NUCA 2EYHA 4DAYA 2XSCA 3OMCA 3S2HB 4IFDG 1O7LA 3VA5A 1F9PA 3FDTA 1GJXA 1EU4A 1EY8A 3GTKB 4XTCS 1PRTD 1SE4A 3PV0A 1STAA 1XWEA 3BDCA 1BQQT 3KF8A 2NN6I 1II3A 3F2UA 4K5VA 1FD7D 4A3FB 1TWHB 3RLFA 1SMYC 2YYZA 1C48A 4QF4A 4FF4A 5JEAJ 4DNRB 2X6LA 1OXVA 3SK5A 3CHBD 4X3KA 1CTMA 5KNDA 4U68A 3Q6SA 1DM0B 3NQIA 1PFNA 4R8NA 2PZUA 2A74C 3EFXD 1GHJA 1WVLA 1S5ED 3IFTA 2L1BA 1IHZA 2CW0C 4KK7A 4B08A 1KNAA 4KHZA 3DWPA 1QOHA 1EIHA 1YNJD 1CZWA 5IODA 4IUPA 5C4JB 4KV6A 4TKOB 1Q3LA 1QG7A 2PCFB 1CHQD 1STBA 2B2WC 3OHXC 1Q12A 1GUTA 3DHQA 1B9NA 3VYSA 1TS5A 4CGYB 1VF5C 1H9SB 2D9UA 1DXMA 1MSGA 5EPKA 2X6GA 2PW7A 2ZT9C 2F4IA 2R3ZA 5CR3A 1I4XA 1UUPA 2QEJC 3BVMA 1EEID 3I4LA 1L0XB 1M4VA 1S5CD 1WTQA 4RH6A 3GTQB 2EVBA 5I2XA 1SYFA 1HHVA 4RAUC 2F0OA 1SBBB 3HS0C 4NP5A 5HURA 2B2WA 1U9RA 3QWNA 5A2QE 3DUZA 3GQBA 3MAQA 1JB3A 3RZOB 2XN9C 3DM1A 2NYZD 2F0MA 1H9MA 3R8BA 4A3KB 2L5TA 1ZYRC 3H3VC 2JEBI 3S17B 1VCIA 2E2IB 4L6TB 3J81E 4IFDH 1YNND 4QIWB 4AYBB 1EIGA 1Y8PB 3J7AV 1STYA 2ID0A 1L0YB 2F0NA 4QB4A 1I4PA 1DOKA 2NVTB 2A6HD 2ICIA 5IIFA 3M4OB 1SMYD 3SK6A 3HOXB 3NWSA 3QOLA 3LWEA 4P2CB 1TWCB 4FF1A 3E0JA 4RHSA 2EYLA 5E4XA 3OPOA 1D5ZC 4IUTA 3X3NA 3SDZA 4DFAA 4RWSC 4CJ1B 2N88A 2EYFA 3D4WA 1S4ZA 5I9PA 1R9TB 3RD4A 1KAAA 1EY6A 2F0QA 5FO8B 3GTMB 1JWUD 1A15A 3T16A 1D1KA 2IWHA 2KEDA 1I3QB 1LT5D 2R92B 3VYTA 5EBCA 1F77A 2Q8IB 1MI2A 1LTRD 3DWAA 2Q8TA 2JXMB 3N6RA 1I50B 3TZDA 4BBRB 5CBAE 1BO0A 1KNEA 5KYLA 2Z8LA 1F9RA 1EYCA 5NUCA 2M00A 1BCPD 1Y1VB 4IN3A 3NWTA 3ONAB 2F0IA 3HOVB 2K33A 1H9JA 5IOCA 1TWGB 4HSVA 1QNKA 3PMFA 4QUCA 1CT1D 1GUSA 5K36H 4M8AA 4G7HC 4XIGS 1SE3A 4WORA 4C3JB 4H13C 4Q0FA 3SVMA 3G6JB 3OWEB 4FP5D 5I6WA 1Q90A 3ERQA 2IL8A 2WKDA 4S3SA 4NMZA 2BA1A 4I7ZC 2DN8A 5M5WB 3HOZB 5C0XJ 4Q5VA 1F9QA 4F8MA 4RKBA 3SR1A 1TS2A 2JA7B 3HG9A 5IT9L 1ET9A 2RDGA 4ULLA 3Q24A 1SNOA 3H91A 2L11A 2H1EA 4B9XA 5M3MB 2HDLA 1FYCA 2EYMA 4XDXA 4QCLA 4K8IA 4C2MB 2EY6A 1EWHA 1SNDA 4KY5A 3NE5B 3NK9A 1VMCA 3W2DA 1WD0A 2B2VA 1PTOF 1NR2A 5JPNC 4J1MA 1BCPF 2BDOA 2KUMA 1ZXTA 3ND8A 1X32A 2BCOA 2F0TA 1W6KA 5BN4A 3K6OA 2B2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3A A;  1G91 A;  3GV6 A;  4IUR A;  1CM9 A;  1F2L A;  4RA8 A;  4X3K A;  2N55 A;  4MHE A;  3P7J A;  1O7Z A;  1PDQ A;  1NAP A;  1F9R A;  2B2Y A;  3KUP A;  4U68 A;  5EKI A;  1HFN A;  3Q6S A;  1HUN A;  2B2T C;  2HCC A;  1PFN A;  2CVR A;  4HED A;  1XX8 A;  4IUU A;  2FMM A;  3ONA B;  5D14 A;  2MPM A;  2M2L A;  5CBE E;  2RA4 A;  1WD1 A;  1PLF A;  1X3P A;  1DOM A;  1SAP A;  3FPU B;  4ZKC B;  3I91 A;  1ILP A;  1F9S A;  4X3S A;  1ESR A;  5COR A;  1HA6 A;  4HSV A;  2HCI A;  1QNK A;  1WVL A;  4QUC A;  1JIC A;  4OIJ A;  1AP0 A;  1MGS A;  4UAI A;  4DN4 M;  1EIG A;  2B2U A;  1RTN A;  2FJ2 A;  3DEO A;  2KEC A;  2DY8 A;  2JYO A;  2L1B A;  3UI2 A;  4ZLT F;  5EQ0 A;  4X3U A;  4QUF A;  4CJ0 B;  1RHP A;  1KNA A;  1O7Y A;  2B2U C;  2EOT A;  1DOK A;  4X3T A;  3I90 A;  1DON A;  1EIH A;  2K28 A;  2KEE A;  1HUM A;  1J9O A;  1AZP A;  2L9H A;  1M8A A;  1C8C A;  2MGS A;  4HCS A;  1X3Q A;  1G6Z A;  1E0B A;  3G7L A;  2J7Z A;  4IUP A;  5CMD A;  1SSO A;  1NCV A;  2FIN B;  5T1G A;  5EPJ A;  2L4N A;  2KOL A;  1RJT A;  1U4M A;  5DNF A;  2X69 A;  2FFK B;  1HFG A;  3SVM A;  1Q3L A;  3LWE A;  2RVL A;  1QG7 A;  1B53 A;  4O42 A;  4R9W A;  5D65 A;  2EPB A;  2IL8 A;  1WTR A;  1QE6 A;  1PFB A;  1F9P A;  2NWG A;  4ZAI A;  1TVX A;  1SDF A;  1EL0 A;  3FDT A;  3D6W A;  1LV9 A;  2K03 A;  1B2T A;  5E4X A;  1MSH A;  2K1B A;  2B2W C;  4IUV A;  1O80 A;  2KVM A;  4ZK9 B;  4IUT A;  2SDF A;  3I8Z A;  2NZ1 D;  1F9Q A;  2HUG A;  2MJ8 A;  1U4P A;  5JJZ A;  3N52 A;  3QO2 A;  4RWS C;  4CJ1 B;  2RSO A;  1AZQ A;  1DZ1 A;  2N88 A;  1G2S A;  4XT1 B;  2K01 A;  4HAE A;  1S4Z A;  5E4W C;  1U4L A;  2XIW A;  1IL8 A;  5COY A;  2D9U A;  2K05 A;  1ML0 D;  1MSG A;  2RSN A;  3GV3 A;  3IFD A;  5EPK A;  2B2T A;  3I3C A;  3TN2 A;  5T1I A;  2EE1 A;  1DOL A;  1IKM A;  1U4R A;  2Q8R E;  2X6G A;  1B4O A;  1CA5 A;  3H91 A;  1ROD A;  4NW2 A;  1B50 A;  2JP1 A;  2L11 A;  2H1E A;  2R3Z A;  2MP1 A;  3IL8 A;  1EQT A;  2HDL A;  2L12 A;  1J8I A;  4XDX A;  4CJ2 C;  1A15 A;  5EJW A;  5EPL A;  1BNZ A;  2FHT A;  3KBX A;  1HRJ A;  1JE4 A;  1WTP A;  2KED A;  1IKL A;  3F2U A;  4XT3 B;  1VMP A;  1WTQ A;  1VMC A;  1WD0 A;  1GUW A;  1CA6 A;  4OIK A;  1G2T A;  2B2V A;  2K04 A;  2DY7 A;  1BBX C;  1PFM A;  3HP3 A;  3MTS A;  5AFW A;  1NR2 A;  2B2V C;  2VXW A;  1HHV A;  4RAU C;  2BDN A;  1WTX A;  1BF4 A;  1MI2 A;  4IUQ A;  1ILQ A;  3DEP A;  2HDM A;  3R93 A;  1WTV A;  2B2W A;  2Q8T A;  2KUM A;  4LMQ D;  1ZXT A;  1XYI A;  1NR4 A;  1RTO A;  4MN3 A;  1WTW A;  4ZKB B;  1X32 A;  1EOT A;  3MWY W;  2X6L A;  3TZD A;  4R8I A;  5CBA E;  3DM1 A;  2NYZ D;  1BO0 A;  1KNE A;  2B2Y C;  1WTO A;  1ICW A; 
#chains in the Genus database with same CATH topology
 1H9R A;  3ND9 A;  4QJF A;  5LMN W;  1LTL A;  1OXS C;  3G4S A;  2PO4 A;  1SFO H;  2JA6 H;  1ZKO A;  2FMM A;  3O13 A;  3VR2 A;  5BN5 A;  4RG1 A;  2ICE C;  3UDF A;  1RTN A;  3L9A X;  3GTO H;  2QKI C;  2B63 G;  2L55 A;  3BJU A;  4RHR A;  2RHQ B;  2AMC B;  3OYY A;  1GUG A;  1A62 A;  4C3I H;  2AUJ D;  2L9H A;  2M9V A;  3E9H A;  4C3J G;  2XWB B;  2KCC A;  1SSO A;  4OL7 A;  5DNF A;  1PH3 A;  2Z9H A;  3HFZ B;  1DCZ A;  3NXW A;  4K2L A;  1IW7 D;  2ZXO A;  3DWQ A;  5DEH A;  3K5N A;  2EJF C;  2O4X A;  1ICF B;  4OEL B;  3NPP A;  1K0R A;  4IJL A;  4GKJ L;  2KCT A;  2AWN A;  4IQZ A;  3M3Y H;  2MJ8 A;  1VQ5 A;  1KDA A;  1KQS A;  4DAV A;  4ME5 A;  2XIW A;  1Z6H A;  4PG3 A;  4HTH A;  2NTS A;  4JBK A;  3I3C A;  2BE5 D;  4DNI A;  4TQU S;  5IYB G;  2B8G A;  1JB7 A;  1X3F A;  4E6I A;  1OXX K;  2DGY A;  4HIM A;  2E2I H;  4ZUJ A;  2FHT A;  1UE6 A;  4A3L H;  2AUK A;  5FO7 B;  1MJE A;  3STB C;  1B3Q A;  1XXG A;  2YU9 B;  2ATW A;  2UXD Q;  1VF7 A;  1LYL A;  4CKB A;  2B8F A;  2RHS B;  4JI0 Q;  3R3O A;  2LS0 1;  1BF4 A;  2UXD L;  2IX1 A;  4DR4 L;  3PUY A;  4JYA Q;  1XNR Q;  4MN3 A;  2JQO A;  3MWY W;  3S15 H;  2XRQ D;  4JVZ A;  3HOX G;  4PMC A;  2O5J C;  1XMQ Q;  2EY5 A;  1OXU A;  3GTM H;  4B9W A;  2EJG C;  3BDL A;  1NAP A;  3KUP A;  1YI2 A;  1SEB D;  4OWT B;  1BCP B;  1S5F D;  3DMU A;  3HOX H;  3SXH A;  3M4Y A;  1EY7 A;  5GQO A;  2KHJ A;  3BYT B;  4IJH A;  4QGU A;  3KF6 B;  1PH2 A;  5G3L F;  4I7A A;  3TME A;  1NMG A;  1KAB A;  4UAI A;  3DEO A;  1BCP C;  2L0C A;  2VS1 A;  2NZO A;  1HQR D;  1N34 Q;  1JQY D;  1V1P B;  3D3R A;  3G48 A;  3TP6 A;  1HUM A;  2Q2I A;  4DV0 L;  4H44 C;  1A2T A;  3CF5 A;  4KD4 A;  4JCV E;  2Y0S G;  5DLQ E;  2F0S A;  4ILW A;  4X65 L;  1MHW C;  2OXP A;  1K8O A;  1HFG A;  2K5Q A;  3UDG A;  5FJ8 H;  1I50 H;  1QVF A;  3QIA A;  2D62 A;  3PO2 H;  1FNW A;  1EY5 A;  1XTC D;  3K5O A;  4FVM A;  4YCV A;  3CPF A;  3RZO H;  1SLJ A;  1TQO A;  4B3T L;  3HOW H;  2PZW A;  1MSH A;  3KOJ A;  1VQO A;  3VDY A;  2SDF A;  1EYA A;  3I8Z A;  4RGO S;  3QO2 A;  5I6Y A;  5KNB A;  1Y69 U;  1EUJ A;  2RSO A;  2R92 H;  2KA7 A;  2IX3 A;  4OX9 Q;  3HKZ G;  4H7B A;  2ZM6 Q;  4BY7 G;  4BXX H;  3KLR A;  5CV7 A;  4DR4 Q;  2RSN A;  1QJO A;  3NBH B;  5C3W A;  3GTG B;  3VYU A;  4A3J B;  2F03 A;  3HOY G;  4CDF C;  3I72 A;  3ITP A;  1B50 A;  1VQ6 A;  2TSS A;  4EQN A;  3ERS X;  4BY7 H;  2RDH A;  1S5D D;  4KN4 C;  5C5L A;  3CP0 A;  5EPL A;  5EKL A;  5HY6 A;  5C3E B;  2D0O A;  1VMP A;  2F0E A;  3H3V I;  1GHK A;  3RN5 A;  1PFM A;  2EDG A;  2EYJ A;  2VXW A;  3I4N B;  3L2P A;  5IGF A;  1X56 A;  2I46 A;  2C9O A;  5JPM C;  1PMR A;  3H6M A;  3FRP B;  3P20 A;  4BBR H;  1JJC B;  4JV5 L;  4HJA A;  3Q23 A;  4PZ7 A;  2SEB D;  4HJ9 A;  4LFA L;  2WB1 E;  4HSP A;  3HEJ A;  4DV0 Q;  3MXU A;  4YWK A;  1EU3 A;  1TT2 A;  1Y1V G;  3BZC A;  5C44 G;  4C3I G;  5C3X A;  2QF7 A;  5M5Y H;  5FLM H;  3DXJ C;  2B2T C;  5D14 A;  5KEE A;  3NSW A;  2EYO A;  3I91 A;  4KI0 A;  4GOP A;  4LFB Q;  3K57 A;  1WCM H;  4G4K A;  4B3T Q;  4KJN A;  1MGS A;  4JBW A;  5C6A A;  2Q2T A;  4A93 G;  5J39 A;  2JYO A;  1IW7 C;  2K52 A;  2NTT A;  2PNR C;  2BH8 A;  1O7Y A;  3X3M A;  1Y8O B;  4P74 A;  3QJY A;  1CQF A;  2K28 A;  1K3B C;  1BBW A;  1E24 A;  2K5H A;  1UEB A;  1F2M A;  2L4N A;  1E22 A;  3CMA A;  2G9H D;  2X69 A;  4GLA C;  3S1R H;  1T5E A;  5IYD G;  5C3E G;  1GOZ A;  4RGM A;  3WOF A;  2WB1 B;  4QIW E;  2GVB A;  4ZAI A;  4CHT B;  3W1B A;  3D6W A;  4A3B G;  3OWF A;  1HZA A;  5E7N A;  2K03 A;  2K5D A;  2K1B A;  2F3V A;  4B3S L;  3PIO A;  2UUB Q;  3LX0 A;  1D8L A;  4JI2 Q;  3K80 C;  1AZQ A;  5I2Y A;  4EGV A;  1PH1 A;  1G2S A;  2E76 C;  5GRO A;  1TWA H;  1D7Q A;  3HOY B;  2JSO A;  4QL5 A;  1ET6 A;  4LF9 Q;  2Q8R E;  5JAV A;  2JA5 H;  1K8M A;  4KHP Q;  2BA0 A;  2UXC Q;  5D3D A;  4HN7 A;  2MP1 A;  1EQT A;  1LUZ A;  1KDC A;  5LHY 1;  1VQ8 A;  1VQ4 A;  2E5L Q;  2NZH A;  1PTO D;  5KYI A;  1SYD A;  3NTH A;  2Z4I A;  4JI0 L;  3S9W A;  1CA6 A;  1BBX C;  5AFW A;  2E75 C;  1CKO A;  1TWG H;  3ICE A;  3CQZ H;  5LMN L;  1WCM G;  3BVZ A;  3J81 c;  1SRO A;  1HXY D;  2WAC A;  2CW0 D;  3MC0 B;  2JA5 B;  2VQF L;  4B3M L;  3NQT A;  2JA6 G;  1VS0 A;  1F2L A;  1V43 A;  1KLU D;  1CSQ A;  4BY1 B;  2F52 A;  2CVR A;  3GO5 A;  3K7A H;  3I73 A;  1P16 A;  1PLF A;  1DOM A;  3FPU B;  5CGK A;  2JA8 H;  3CD6 A;  3H0G H;  2HCI A;  3BG3 A;  3GTK H;  4G7O C;  3KYH C;  4IFD J;  1H95 A;  4JV5 Q;  4A3I B;  1I3Q H;  1PZJ D;  1P8L A;  1YJW A;  4DAP A;  2KCN A;  2KEE A;  4LF6 L;  3CKI B;  2JK8 A;  3NEL A;  1G6Z A;  4CKE A;  1QCB D;  1QZG A;  2A68 C;  4FXD A;  2SOB A;  4R9W A;  3MFG A;  2R6G A;  5JOB A;  4X66 L;  1Q81 C;  1PFB A;  2ZTD A;  1NMF A;  1G6P A;  4YCW A;  3NTI A;  1A2U A;  1B2T A;  1PYB A;  4NDX A;  3HOU B;  1VQP A;  5GAE C;  3S16 H;  3TBI B;  3T53 B;  3C46 A;  4A3E H;  1A8V A;  1R4Q B;  4R4T A;  3W3A A;  3GTL H;  5DM7 3;  4Y7N B;  1FR3 A;  1JR0 D;  2ES2 A;  3TQY A;  4MNO A;  1FGB D;  1PRT C;  4ID6 A;  3I4M G;  2XWJ B;  2R93 H;  4N8X 1;  3IL8 A;  1STH A;  1C0A A;  4DPG A;  4CJ2 C;  2F0H A;  4POG A;  4BA1 I;  3BDO A;  2NVQ B;  2YTX A;  3CC7 A;  1EOV A;  3SEB A;  4LF7 Q;  5C4X H;  2R7F A;  2HD3 A;  4J15 A;  3KJP A;  4A3B H;  4JI2 L;  5FO9 B;  1PZI D;  1LTI D;  5IGE A;  4OHJ A;  2IPK D;  4F88 A;  5LL6 S;  1CZG A;  4NB3 A;  4BWG B;  1JWM D;  1Q7Y C;  3VYR A;  2IJ0 A;  3KDF A;  5LL6 X;  1CQV A;  1HTL D;  4GZY C;  3S2D H;  3T13 A;  4RA8 A;  1CK1 A;  1HUN A;  1LAC A;  4N9T A;  3PO3 H;  1SNQ A;  3RMH A;  3RR5 A;  3HOU G;  1K73 C;  1E1T A;  1D2B A;  3ERO A;  4LAA A;  4JBM A;  3BU2 A;  1GD7 A;  1D6E C;  1QUQ B;  1TU2 B;  1OO9 B;  2MO1 A;  4PMW A;  2B39 A;  1EFI D;  3OSO A;  2OQK A;  4RFB A;  5FLX L;  1JC7 A;  3NEN A;  3PUZ A;  3V2T A;  1V9P A;  4C3J H;  2NN6 G;  2N49 A;  2E2H B;  2XRS D;  1PYS B;  1Y1V H;  4RCO A;  1ESF A;  4HCS A;  4DAM A;  3H09 A;  2J7Z A;  2EZV A;  1SYC A;  5CMD A;  1NCV A;  5T1G A;  4LF4 Q;  2GVA A;  1DD2 A;  2HQE A;  1U4M A;  1VQM A;  3D6C A;  1CKN A;  4R4C A;  5BN3 A;  3BS1 A;  4LF8 L;  1XNQ L;  2JA6 B;  3S14 H;  2KQ3 A;  3MVV A;  2EPB A;  4DUZ Q;  4LF6 Q;  2DUD A;  5D3I B;  2R7Z G;  3TRZ A;  2EYP A;  3VA7 A;  4BXX G;  1QZH A;  3PIP A;  3F8T A;  2OT2 A;  2EIF A;  3T56 B;  3TDQ A;  1A3V A;  2MQH A;  4EQP A;  1QNU A;  2WAQ G;  1ZYR D;  2YTV A;  1ENA A;  3CQZ B;  2RBM A;  4A4I A;  1U4L A;  3D31 A;  1I6H H;  1ML0 D;  3U58 A;  2HQL A;  1JT8 A;  3T1Y Q;  2EE1 A;  1X65 A;  3PF5 A;  3L0O A;  4NW2 A;  3S15 B;  1EWC A;  1LTA D;  1Q46 A;  1OXT A;  2QGQ A;  3S1N H;  4R4O A;  1QWY A;  3DLL A;  2Y0S B;  1Q8K A;  3FPP A;  2RQX A;  3M9B A;  3RZD H;  4L5S A;  1EQR A;  3K5L A;  3QG1 A;  4QY7 A;  3IKJ A;  1EQV A;  3ZYY X;  3S1N B;  4GKJ Q;  4DR1 L;  1PH8 A;  1FVI A;  1NUC A;  3WOE A;  1BOS A;  3A7A B;  4O2D A;  4K5X A;  1RTO A;  2IT1 A;  4L5R C;  4P73 A;  1JOO A;  1FNU A;  2NVX H;  1B3A A;  2RCF A;  3GTJ B;  3BVG A;  2R7D A;  4XYQ A;  2QCP X;  3I4O A;  3TZU A;  2R7Z B;  2B2Y A;  1UE5 A;  5C4Z A;  5BR8 Q;  1RF2 D;  4KKT A;  3S1M B;  1I4H A;  1XNQ Q;  3S16 B;  5CBE E;  1X3P A;  2VQE L;  5IE8 A;  1XPR A;  5M9O A;  2NVX B;  4DK1 A;  3CC2 A;  5ELC A;  1PH4 A;  1JJ2 A;  1WJJ A;  4RMF A;  1X3E A;  1JIC A;  4G7Z C;  1AP0 A;  2QDB A;  3S1M H;  1SNM A;  2DY8 A;  1S40 A;  2WP8 J;  4ZYS A;  4WRD A;  2A69 D;  3GP7 A;  4IO9 A;  3IRB A;  2F3I A;  3J80 E;  1KLG D;  1F2Z A;  2MGS A;  3A55 A;  3F1Z A;  1X3Q A;  4DR2 L;  1IZ6 A;  2FIN B;  1YNJ C;  3PCO B;  2YTY A;  1CKM A;  2F0U A;  3I4M H;  3D8G A;  4A3E B;  1SE8 A;  4X62 L;  1PRT F;  1X55 A;  2VUM H;  2G5D A;  2F0G A;  3KK7 A;  4OGQ C;  5CC4 A;  1Q1E A;  4KTA A;  2LFN A;  3GTQ H;  2F4V Q;  4K6L A;  1Z47 A;  1IYV A;  4BY1 H;  1SFO B;  3S2D B;  2K5N A;  5JVH 3;  2QW7 A;  5GAH C;  1L2F A;  1IL8 A;  3GV3 A;  4LF5 Q;  4XQQ A;  4N9P A;  2JA8 B;  3OIP A;  5T1I A;  1DOL A;  2EY1 A;  4LF8 Q;  1S5B D;  3SK4 A;  5K5P A;  2PYK A;  1AEX A;  4DU9 A;  4KKU A;  5IP7 G;  1B1Z A;  2ZXP A;  1J8I A;  4A3I H;  1BDO A;  5JJI A;  1CHP D;  1L1O A;  1HRJ A;  1JE4 A;  2VUM B;  1FNV A;  1HNW Q;  3HKZ B;  5CV5 A;  4OIK A;  3MXP A;  3OTO L;  2K04 A;  3I4M B;  3MTS A;  4LUO A;  4R4Q A;  2LXJ A;  4ZRZ A;  2CH4 W;  3NEM A;  4DV2 Q;  1SYE A;  2F0K A;  1SJE D;  1LTB D;  2A69 C;  4C1N I;  2XGT A;  2WII B;  3A7L A;  3URY A;  4NPS A;  3EIV A;  3FKI H;  1L1O C;  2JE6 I;  3GTL B;  1LAB A;  4DR1 Q;  4ZUI A;  1EZ6 A;  1O7Z A;  2QIL A;  5CV4 A;  2I5H A;  4ZCK A;  4L8J A;  2HCC A;  1KDB A;  4XXE A;  5C5M A;  2J4X A;  4L63 B;  1HJP A;  3AFP A;  3NBI A;  3UE1 A;  4X3S A;  2CFM A;  1WTH A;  4IPD A;  3HOY H;  1XMO L;  4A3F G;  3MXN A;  1BR9 A;  1V8Q A;  1ONL A;  4OIJ A;  2D5D A;  3WDN A;  3PUX A;  2C5C A;  4DR3 L;  1N36 L;  3E0E A;  1I4Q A;  4JI5 L;  1EEF D;  4CJ0 B;  2A6E D;  1RHP A;  4LW1 A;  2IX0 A;  2K32 A;  4X3T A;  1YIT A;  5TSS A;  4YY3 Q;  1TWF H;  2OF1 A;  4A3B B;  3CAM A;  4IPH A;  1UE7 A;  1TWA B;  5IT9 E;  3D4D A;  3A0J A;  3KLS X;  5E3F A;  1V1O A;  4KHV A;  3CCJ A;  2UU9 Q;  4A75 A;  5D65 A;  1B53 A;  4N8F A;  5FJ8 G;  2K4K A;  1TWF B;  2AQ3 B;  3J80 i;  4Z9C B;  1XJV A;  4IPC A;  1WYD A;  3HRZ C;  2A73 B;  4AH6 A;  2KVM A;  1TWH H;  4JYA L;  2A19 A;  1Q1B A;  1I5F A;  4WFN 3;  1IL2 A;  1WCM B;  4HMI A;  4A3D G;  1B9M A;  3RLN A;  2CWP A;  2RKS A;  3MA2 B;  4DGZ A;  1KL9 A;  1CUK A;  2UUC Q;  1YHB A;  3PO3 G;  4HR7 B;  4DV1 L;  4RGT A;  2BOS A;  2UUC L;  4LF5 L;  1IBL Q;  5JJL A;  5DAU A;  3HGB A;  1IBK Q;  4DAY B;  5IWA Q;  5EAY A;  1GM5 A;  1VQN A;  1FJG Q;  5ELF A;  3TS2 A;  1IBL L;  4OO1 G;  1CKN B;  1Q8I A;  1XMO Q;  1PV4 A;  4X64 Q;  3OMG A;  2FMC A;  1I4G A;  1AW7 A;  2HDM A;  3DEP A;  5ELB A;  3HZX A;  3J7Y W;  1SE2 A;  1SXT A;  1UEA B;  1XYI A;  2K50 A;  5M5X B;  1HQM C;  1RL2 A;  4ZKB B;  5C0X I;  4K0K Q;  1W3S A;  3V05 A;  3MZ5 A;  1WTO A;  2J0T D;  1TY2 A;  1YNN C;  1PTO H;  3PO3 B;  5M5W H;  4X66 Q;  1HFN A;  4KLK A;  5CV8 A;  1H9S A;  3C1E A;  4IAL A;  1HZC A;  2K5W A;  2RA4 A;  4ZKC B;  1PHJ A;  1Y8N B;  2MUY A;  3TP5 A;  3GTG H;  2KCM A;  5CV6 A;  4NXN L;  1EYD A;  5C3E H;  3A8J E;  4F7X A;  1L1O B;  2TMP A;  1IYU A;  2GN5 A;  2Q2H A;  3FP9 A;  4RKL A;  5EQ0 A;  4QUF A;  5IYC G;  5IGG A;  3TS0 A;  3PGZ A;  2AQ1 B;  4DR2 Q;  2JEA I;  4DV6 Q;  3K81 C;  1BBU A;  1E7Z A;  2NBF A;  5CV9 A;  2RCN A;  1J9O A;  4K5W A;  1GUO A;  1Y1W H;  1C9O A;  4AIM A;  2FFK B;  2R7Z H;  1G29 1;  1YEZ A;  3S1Q H;  4YHH Q;  5IGD A;  1QIL A;  3QOJ A;  2PQE A;  1PTO C;  1TVX A;  1EL0 A;  1SJH D;  3BYY B;  2AKW B;  2YV5 A;  4FO2 A;  3PIO 3;  3J81 L;  3U4Z A;  1BKB A;  3A8K E;  1O80 A;  1LTT D;  2HIX A;  5G3L D;  5JJZ A;  2R93 B;  2D2C C;  5A35 A;  1AN8 A;  4GKK L;  3R2I A;  3MXG A;  5E4W C;  4KMU C;  5EGT A;  3AMU A;  3EBE A;  4O0A A;  2OCE A;  4HJ7 A;  3H0G G;  1YJ9 A;  2Z4H A;  4V19 0;  2IY5 B;  4BBS H;  3LNN A;  1F2Y A;  2QDL A;  3GDE A;  4JW0 A;  2PI2 E;  2CHB D;  3S1R B;  2WV6 D;  3KBG A;  1STG A;  1M90 C;  1O7I A;  2DJG C;  4BS9 A;  1PH5 A;  4MTN A;  5IGB A;  5ISR A;  2DY7 A;  4MTK A;  5I4D A;  5JEA H;  1SMX A;  2IHE A;  1ENF A;  5ELE A;  2EXD A;  4WJW A;  4EX5 A;  3GTO B;  5LMU Q;  3R93 A;  1GXD C;  1K9M C;  3LWU A;  1DJR D;  4TRD A;  2H5X A;  4AYB G;  2GA4 B;  3H0G B;  1C7Y A;  1WTW A;  3VR5 A;  5ELD A;  3M4Q A;  3P1H A;  1I6H B;  4K6D A;  3GV6 A;  3I7F A;  4A3G G;  4MHE A;  1Z7T A;  5EKI A;  2F0W A;  2NVY H;  4XQN A;  1HPC A;  2M2L A;  1HCZ A;  5F2D A;  2R93 G;  3HOZ G;  5AJ3 L;  1FJG L;  1ESR A;  1PRT B;  2SNS A;  5COR A;  1D5M C;  3ULP A;  1PVO A;  1VQE A;  5FK9 C;  2I07 B;  2PZT A;  1SNC A;  4GLV B;  3T1H Q;  2PW5 A;  2NB0 A;  1HR0 L;  4FF2 A;  4YY3 L;  3HKS A;  4X3U A;  4LWC A;  2XTI A;  2B2U C;  1J5E Q;  2BH2 A;  1YNX A;  1SNP A;  1AZP A;  4KHP L;  2UXC L;  1C8C A;  4NXM Q;  1JOK A;  1E0B A;  3G7L A;  1J5E L;  1I94 Q;  2UUA L;  2VUM G;  1N9W A;  3HOV H;  3S1Q B;  3EN2 A;  1T5X D;  2PQA A;  5IT9 c;  2DNC A;  4ALP A;  1KD1 C;  4ZQ3 A;  1K28 A;  4AQY Q;  3W5O A;  3OW7 A;  3H94 A;  4JI7 L;  1ENC A;  1QE6 A;  2ZM6 L;  1A3T A;  4RCN A;  3EQL C;  5KIX A;  3HOV G;  4JI3 Q;  4P71 A;  1CI3 M;  2OTJ A;  5KRU A;  1Z9F A;  4OXP A;  3L7Z C;  1VQI A;  3NBH A;  4DXF A;  1RKN A;  1VQJ A;  5EBD A;  4IFD I;  3CW2 C;  2NZ1 D;  2E2J H;  1U4P A;  1EQQ A;  2LY7 A;  2WB1 G;  4XT1 B;  1E2V A;  3AQQ A;  2K01 A;  4X62 Q;  4WJ3 M;  4H0L C;  1YIJ A;  3TSS A;  4WJ4 A;  2VW9 A;  3UE0 A;  4AYB E;  3NUC A;  4LK1 C;  2QEX A;  1B4O A;  1CA5 A;  5C44 B;  1SYG A;  3UDI A;  1LM0 A;  4EQ5 A;  1A0I A;  1O78 A;  1TII D;  1PTO B;  4KY7 A;  1E2W A;  1BNZ A;  3KBX A;  1LTS D;  1IKL A;  3K5M A;  5C4X B;  4A93 B;  2F0F A;  4K2K A;  3CCR A;  1TS3 A;  2IW3 A;  4M1U B;  1C4Q A;  1MJC A;  3IAY A;  4DK3 C;  3I4N G;  4K14 A;  4DA2 A;  1RCV D;  2A6E C;  4PV1 C;  4OX9 L;  1NY4 A;  3FVQ A;  1VDZ A;  1HA5 A;  3J7A 5;  4MIU A;  3K58 A;  1EY9 A;  4DR5 Q;  1EOT A;  3BZK A;  3QR8 A;  2F0V A;  4Y7N H;  1Y1W G;  4IUR A;  3CME A;  1I6V C;  4FXG C;  1MIU A;  1PDQ A;  3PUW A;  2VNU D;  3J7A F;  1EY0 A;  1A6X A;  3JAM E;  1T9H A;  1UAP A;  2MO0 A;  4JBJ A;  1WD1 A;  1HNX L;  4A3F H;  2WKC A;  1U0L A;  1G8Z D;  3K7U C;  3KJO A;  1CSP A;  2JA7 H;  4KJO A;  4HID A;  4DF7 A;  1LTG D;  3HOU H;  4JI8 Q;  2Y0S E;  4A3M H;  3I4N H;  2HT1 A;  4ODG A;  4OO1 I;  2DNE A;  2A68 D;  2EOT A;  3CPW A;  3I90 A;  4TSS A;  4OON A;  4EVO A;  4JI8 L;  1VQB A;  5I9O A;  1M8A A;  3CRL C;  4LNQ A;  3OIQ A;  3C2P A;  3OW2 A;  2AQ2 B;  5IP9 H;  4YHH L;  5EPJ A;  2KOL A;  1EIY B;  1STE A;  2K7V A;  4JI6 L;  3JAM L;  1X6O A;  2UUB L;  1K83 B;  4DK6 C;  4HCE A;  3CCU A;  3I70 A;  4FF3 A;  3D4R A;  1WTR A;  5M5X H;  1J6Q A;  1ASY A;  1A3U A;  3UDX A;  4OO1 H;  4PZ6 A;  4QMG A;  3VR4 A;  1SDF A;  2A5H A;  3SGI A;  5IGC A;  5FKA C;  3MHB A;  1LV9 A;  3M7N A;  4FYD A;  4IUV A;  3TP8 A;  2WFW A;  2ASB A;  4JK1 C;  4L5T A;  4NXN Q;  3U9O A;  1R4P B;  2NN6 H;  4IOA A;  4KY6 A;  3R2T A;  3RUZ A;  4FXK C;  1STN A;  1Y1W B;  4LJZ C;  3V96 A;  4DXG A;  2B2T A;  3PIP 3;  3TN2 A;  4DR5 L;  2F3W A;  3PUV A;  5GAD C;  2F0L A;  1ROD A;  2MHV A;  4C56 C;  2JP1 A;  3CU7 A;  1FL0 A;  1EZ8 A;  2AHO B;  1LLR D;  1E2Z A;  4A3C G;  5FLX E;  3FHW A;  1QB5 D;  2NVY B;  4XT3 B;  3A5U A;  4R1J A;  5J3B A;  1BXT A;  4XQJ A;  4C3H G;  3A74 A;  4DR3 Q;  4C1N K;  3A54 A;  2B2V C;  2K6A A;  4CBV A;  3B6Y A;  5K36 G;  3J80 L;  4JPB W;  4C3I B;  4LF7 L;  2BDN A;  3F2C A;  1WTX A;  2JA7 G;  4IUQ A;  5BR8 L;  3NHH A;  1JOQ A;  2VB3 X;  4DR6 Q;  4GNX C;  1H9K A;  4HIO A;  1BVS A;  2E2H H;  1K83 H;  1V1P A;  4O1N A;  3RLO A;  1ICW A;  3U50 C;  3MEH A;  1PYW D;  2N55 A;  3P7J A;  2RDF A;  3J80 c;  2VY3 A;  3NTK A;  1PXU A;  4JI1 L;  5FOB B;  2A8V A;  3C3L A;  1XX8 A;  3J81 j;  4IUU A;  1HR0 W;  3S2H H;  4EQO A;  4U67 3;  2ZJQ A;  2O5I C;  3GTP H;  3NP8 A;  4A3J H;  1JE5 A;  1F9S A;  4GN5 A;  1HA6 A;  1B8A A;  3A8I E;  1EY4 A;  2E8G A;  3SK8 A;  1W2B A;  1NJI C;  1HNW L;  2FJ2 A;  1NE3 A;  3CCQ A;  1AFP A;  3UI2 A;  1EWI A;  3EA6 A;  1YVC A;  1KC8 C;  3GD7 A;  1GUN A;  3T1Y L;  2G9D A;  5LMU L;  4A3M B;  3HOW B;  1Q86 C;  3Q0A A;  4BBS B;  1HTP A;  3CRK C;  2B29 A;  1RJT A;  4JI7 Q;  3STB D;  4C3H B;  2JJQ A;  5DM6 3;  3GTJ H;  1TY0 A;  4HJ5 A;  3RN2 A;  1Y14 B;  3A5Z B;  4O42 A;  5EKK A;  2Z6K C;  2A6H C;  4A3D B;  3FEW X;  5JEA G;  1JCK B;  4A76 A;  2EXZ A;  3OOC A;  5J1Z A;  3TP7 A;  4ZK9 B;  3S17 H;  2BE5 C;  1PZK D;  1LT4 D;  3E9I A;  2HUG A;  1JWS D;  3T1H L;  5E1F A;  1M1K C;  4KKS A;  3I2Z A;  2K05 A;  1ZEQ X;  2F0J A;  4IZ8 A;  3CCV A;  1AE2 A;  4X65 Q;  4NKL A;  1TKW B;  2ENB A;  3JC6 6;  5HGT A;  1K8A C;  4A3G B;  4PZ8 A;  5M3M G;  2SNM A;  4TVA B;  4LFA Q;  3FMC A;  2CCZ A;  5M5Y B;  4DNT B;  3Q22 A;  4V0B A;  4OWW B;  4JOI A;  1V1Q A;  5C0X H;  2ZXR A;  3ULJ A;  5EJW A;  5A2Q L;  4Y52 H;  4BA2 I;  4UPA A;  1WTP A;  1CFM A;  4DUY Q;  4JI4 L;  3K7A B;  4RGN A;  4FNF A;  4PQX A;  4UDU C;  3CC4 A;  1W6J A;  1B44 D;  2Z6B A;  4CDD C;  4LFB L;  2K14 A;  2KHS A;  4DV6 L;  3P75 A;  2ZTC A;  1ILQ A;  2H4O A;  4G57 A;  5KNC A;  1YHQ A;  3T4A C;  2KJX A;  2LMC B;  4LMQ D;  3FKI B;  1EYG A;  4CKC A;  4YWM A;  2E2J B;  4JC0 A;  1MBY A;  1G91 A;  3S14 B;  2R61 A;  4A3K G;  2ZTE A;  1N36 Q;  3F2B A;  5ELN A;  4IOC A;  4JOI C;  3K0Y A;  2VZA A;  3I55 A;  3C1F A;  1A63 A;  4HMJ A;  1SAP A;  2WAQ B;  3JAM c;  4YIJ A;  4GNX B;  4F87 A;  2JA5 G;  3M85 A;  3LGJ A;  4DUZ L;  3PO2 B;  5J22 A;  1N34 L;  4MZ9 A;  4DN4 M;  4GKK Q;  3H15 A;  1RDP D;  4LUV A;  1I4R A;  4ZLT F;  4IPG A;  2B3G A;  5CYU A;  1JOR A;  3T51 B;  4X64 L;  3BZD B;  4ABN A;  4A3G H;  2XVS A;  4K8J A;  4A3L G;  1VQC A;  4KD3 A;  4JI1 Q;  3G6E A;  5JJK A;  2A1A A;  2Z6K A;  3D0F A;  5M3M H;  2RVL A;  4DV7 L;  3AU7 A;  2VB2 X;  3W1G A;  5C4H A;  1D1I A;  2NWG A;  1SN8 A;  2P5Z X;  4PNY A;  3GTP B;  2CQA A;  1G51 A;  2E2D C;  1LO5 D;  3JAM i;  3N52 A;  1DZ1 A;  3RZD B;  2V4D A;  5LMN Q;  2XNA C;  1NNX A;  2WIN B;  4HAE A;  1KTK A;  5COY A;  4DKA C;  2PPB C;  3L3O C;  4J6H A;  4BBR G;  3IFD A;  2AWO A;  1QUQ A;  2B63 B;  2PMZ B;  1U4R A;  1IKM A;  1R9T H;  3SE0 A;  4CDE C;  3A56 A;  1X54 A;  2OWO A;  3AYH B;  2L12 A;  1EIF A;  3KFU A;  1LT3 D;  2JA9 A;  4GN4 B;  2F1M A;  1RD9 D;  2KHI A;  1BUV T;  2YU9 H;  1GUW A;  1NTG A;  1SYB A;  2OEO A;  2F0D A;  3AB9 A;  3KDF B;  1G2T A;  3HP3 A;  5C0X G;  3K59 A;  4DK0 A;  1LT6 D;  4J8Q A;  2E5L L;  2EY2 A;  1WTV A;  3VR3 A;  1NR4 A;  1DYQ A;  1I94 L;  2UUA Q;  4JG2 A;  2O2L D;  2E74 C;  4R8I A;  1UNS A;  3SHL A;  1SRU A;  4GNX A;  1CM9 A;  4HJ8 A;  2F0P A;  4KN7 C;  4XYO A;  1D5X C;  2Z1C A;  3E5S A;  3QB3 A;  2LKV A;  2EJM A;  3EJI A;  3M7G A;  3U9S A;  3J7Z C;  3M3Y B;  5KGU A;  4HED A;  1UE1 A;  2K75 A;  3EVQ A;  2MPM A;  4I65 A;  4PMB A;  2IHF A;  3PO2 G;  1ILP A;  3VR6 A;  1TS4 A;  1GO3 E;  1B70 B;  1MD2 D;  5JVG 3;  4DV3 Q;  4BY7 B;  2B2U A;  3E6Z X;  2KEC A;  1TR5 A;  4UHV A;  3MFY A;  3KLS A;  5M3F B;  2F4V L;  4IUN A;  3PQI A;  2VQF Q;  1DON A;  1NSN S;  2HIV A;  2NUC A;  2EYH A;  4DAY A;  5IYC H;  1U5K A;  3FKI G;  2XSC A;  1QVG A;  3OMC A;  4LF4 L;  3S2H B;  4IFD G;  2VQE Q;  2QA4 A;  5IYD H;  1O7L A;  4H02 A;  2EQS A;  3VA5 A;  2HHH Q;  1WFQ A;  1F9P A;  4B3S Q;  1PH9 A;  3FDT A;  4BY1 G;  2HHH L;  5AJ3 Q;  1GJX A;  1YHA A;  1XPO A;  1EU4 A;  1EY8 A;  1XNR L;  1VQG A;  3GTK B;  1VQL A;  1HZ9 A;  4DV7 Q;  4XTC S;  3CCL A;  4A3C H;  3MEF A;  4DR7 L;  1PRT D;  1SE4 A;  1XMQ L;  3PV0 A;  2FXQ A;  1STA A;  1XWE A;  4R4I A;  4UP9 A;  1GVP A;  3BDC A;  3DM3 A;  1BQQ T;  3KF8 A;  1KRS A;  1XTD A;  2NN6 I;  5FLM G;  1QVC A;  1II3 A;  3F2U A;  3M4O H;  4K5V A;  1FD7 D;  4A3F B;  1TWH B;  4APV A;  3KF8 B;  2I5L X;  3RLF A;  1SMY C;  2YYZ A;  1C48 A;  4QF4 A;  2V1C C;  5IYB H;  4FF4 A;  2OQ0 A;  5JEA J;  5IWA L;  4DNR B;  2I0Q A;  1HNZ L;  3CXC A;  2N3S A;  2PI2 A;  2X6L A;  3S24 A;  4P75 A;  3AEV A;  1DGS A;  5IY0 A;  1OXV A;  3SK5 A;  1L0W A;  3CHB D;  4X3K A;  1CTM A;  5KND A;  4A3K H;  4ME3 A;  4GOP B;  3K0X A;  4POF A;  4U68 A;  1HR0 Q;  3TRE A;  3I56 A;  3Q6S A;  1DM0 B;  3NQI A;  4JI5 Q;  1PFN A;  1YJN A;  3PSI A;  4LFC Q;  4QQB X;  4R8N A;  2PZU A;  1PH6 A;  2A74 C;  1KRT A;  4DV5 L;  3EFX D;  1GHJ A;  4GN3 B;  1WVL A;  4JI4 Q;  1S5E D;  3IFT A;  2L1B A;  1IHZ A;  4KK7 A;  2CW0 C;  2PQA B;  4B08 A;  1KNA A;  4UY8 C;  4KHZ A;  3DWP A;  2WAQ E;  4LUZ A;  1QOH A;  1EIH A;  1YNJ D;  5C44 H;  1CZW A;  1VQF A;  1AE3 A;  3HOW G;  4JI3 L;  5IOD A;  3F2D A;  4B3R Q;  2B63 H;  4A3M G;  4IUP A;  5C4J B;  4KV6 A;  1EFW A;  4BBS G;  1IBM L;  4TKO B;  1Q3L A;  2ALY B;  1N32 Q;  2KBN A;  1QG7 A;  2D0P A;  2PCF B;  4OEM B;  1CHQ D;  2CH4 A;  1STB A;  2B2W C;  1IBK L;  3OHX C;  1Q12 A;  1GUT A;  3DHQ A;  1B9N A;  3VYS A;  1TS5 A;  4CGY B;  1VF5 C;  1H9S B;  4DV1 Q;  2D9U A;  1DXM A;  1MSG A;  1HNZ Q;  1VQD A;  2JN4 A;  5EPK A;  2CQO A;  2X6G A;  2MFI A;  3KF6 A;  2PW7 A;  2ZT9 C;  2F4I A;  2R3Z A;  5CR3 A;  3U4V A;  2UU9 L;  1NBW A;  1I4X A;  1UUP A;  2QEJ C;  3BVM A;  3CCS A;  1OTC A;  3E3X A;  2Q2U A;  1EEI D;  3I4L A;  3PF4 A;  4FDB A;  1IXR A;  4YCU A;  4P72 A;  3OTO Q;  1L0X B;  1M4V A;  1S5C D;  2MNA A;  1WTQ A;  4RH6 A;  4DV2 L;  4K0K L;  3GTQ B;  2EVB A;  5I2X A;  1SYF A;  4A3I G;  1AH9 A;  1HHV A;  3Q8D A;  4RAU C;  2F0O A;  1SBB B;  3HS0 C;  1ASZ A;  2C35 B;  3H3V H;  4NP5 A;  5HUR A;  1KAW A;  2B2W A;  1U9R A;  3QWN A;  1X3G A;  5A2Q E;  1PH7 A;  3DUZ A;  3GQB A;  4NXM L;  2RF4 A;  4DR7 Q;  3MAQ A;  1JB3 A;  4A3J G;  4DUY L;  1WI5 A;  3ER0 A;  3RZO B;  2XN9 C;  1S3O A;  1YBY A;  2L15 A;  4DV4 L;  3DM1 A;  2NYZ D;  2F0M A;  4L5Q A;  4AQY L;  1H9M A;  3R8B A;  1YZ6 A;  3TEH B;  1E1O A;  1N33 Q;  4A3K B;  2L5T A;  1PA6 A;  1ZYR C;  3H3V C;  2JEB I;  1VQK A;  3S17 B;  1VCI A;  2E2I B;  4L6T B;  4B3M Q;  3J81 E;  4IFD H;  1YNN D;  4QIW B;  4AYB B;  1VQ9 A;  1EIG A;  1Y8P B;  3CCE A;  3J7A V;  1STY A;  1TXY A;  2ID0 A;  1L0Y B;  2F0N A;  4QB4 A;  2NVQ H;  4C3H H;  1I4P A;  1DOK A;  2LSS A;  2NVT B;  2A6H D;  2ICI A;  5IIF A;  3M4O B;  1HH2 P;  1SMY D;  3SK6 A;  3HOX B;  3NWS A;  4DR6 L;  4A93 H;  4LFC L;  1E3P A;  3QOL A;  3LWE A;  4P2C B;  1IYJ B;  1TWC B;  2Z0S A;  4FF1 A;  3HOZ H;  3E0J A;  2VL6 A;  4DV5 Q;  4RHS A;  5C4X G;  4X6A H;  4C2M H;  2EYL A;  5E4X A;  1KXL A;  1SR3 A;  3OPO A;  1D5Z C;  4IUT A;  1N8R C;  3X3N A;  3SDZ A;  4DFA A;  4RWS C;  4CJ1 B;  4GLX A;  3CCM A;  1N32 L;  4YWL A;  2N88 A;  2EYF A;  5GAG C;  3D4W A;  1S4Z A;  1VQA A;  5I9P A;  1R9T B;  3RD4 A;  1KIX A;  1KAA A;  4UP8 A;  1EY6 A;  2JA8 G;  1IBM Q;  2F0Q A;  4GS3 A;  2UXB L;  5FO8 B;  1X9N A;  3GTM B;  1JWU D;  3KLW A;  3ULL A;  1A15 A;  3M4P A;  3T16 A;  1D1K A;  2IWH A;  2KED A;  4GOP C;  4A3E G;  1I3Q B;  2I5M X;  1JMC A;  1LT5 D;  2R92 B;  5FLX c;  3VYT A;  1S72 A;  5EBC A;  2DJF C;  1F77 A;  5M3F H;  2Q8I B;  2PMZ E;  1TWC H;  1MI2 A;  1LTR D;  3DWA A;  2Q8T A;  2JXM B;  5H1S E;  3N6R A;  1I50 B;  3HKZ E;  3TZD A;  4BBR B;  5CBA E;  2OTL A;  1BO0 A;  1KNE A;  2R92 G;  5KYL A;  2Z8L A;  2ZJR A;  2ZJP A;  1F9R A;  1EYC A;  2N8N A;  5NUC A;  2M00 A;  1BCP D;  1Y1V B;  4IN3 A;  3NWT A;  3ONA B;  2F0I A;  5IP7 H;  4HIK A;  2K5V A;  3HOV B;  2K33 A;  3G71 A;  1H9J A;  4DV4 Q;  3WWV A;  5IOC A;  1TWG B;  4HSV A;  2KEN A;  1QNK A;  3PMF A;  1XPU A;  4QUC A;  1CT1 D;  1GUS A;  1HNX Q;  5ELO A;  5K36 H;  4M8A A;  1MKH A;  4G7H C;  1VQ7 A;  4XIG S;  1SE3 A;  4CDC C;  4WOR A;  4C3J B;  4H13 C;  3J81 i;  4DV3 L;  1B7Y B;  1N33 L;  4Q0F A;  3SVM A;  3G6J B;  5HGQ A;  2UXB Q;  3OWE B;  4FP5 D;  1VQH A;  5I6W A;  1Q90 A;  3ERQ A;  2IL8 A;  3MXN B;  2WKD A;  4S3S A;  4JI6 Q;  4NMZ A;  1Q82 C;  2CKZ B;  2BA1 A;  4I7Z C;  2DN8 A;  1FGU A;  5M5W B;  3HOZ B;  1KHI A;  5C0X J;  4LF9 L;  2CWA A;  4Q5V A;  1UWV A;  1F9Q A;  4F8M A;  2PNH A;  1K3R A;  1K8G A;  4RKB A;  3SR1 A;  1TS2 A;  3K8A A;  2JA7 B;  1JJG A;  3HG9 A;  5IT9 L;  1ET9 A;  2RDG A;  4ULL A;  3Q24 A;  4OWX B;  1SNO A;  1WOC A;  3H91 A;  2L11 A;  2H1E A;  4A3D H;  4B9X A;  5M3M B;  2HDL A;  1FYC A;  2EYM A;  4B3R L;  4XDX A;  4QCL A;  4K8I A;  4C2M B;  2EY6 A;  1EWH A;  2N78 A;  4UP7 A;  1SND A;  4KY5 A;  3NE5 B;  1K0S A;  3NK9 A;  1VMC A;  3W2D A;  1WD0 A;  2B2V A;  1PTO F;  1NR2 A;  5JPN C;  4J1M A;  1BCP F;  3AFQ A;  2BDO A;  1GKH A;  1RIP A;  2KUM A;  1ZXT A;  2LXK A;  3ND8 A;  5L37 A;  5C4J H;  1X32 A;  2NVT H;  5M3F G;  2BCO A;  1HZB A;  2F0T A;  1W6K A;  5BN4 A;  3K6O A;  5IP9 G;  3RNU A;  1PFS A;  2B2Y C;  3ZJY C; 
#chains in the Genus database with same CATH homology
 1H9R A;  3ND9 A;  1OXS C;  2PO4 A;  1ZKO A;  2FMM A;  3O13 A;  3VR2 A;  5BN5 A;  2ICE C;  1RTN A;  3L9A X;  2QKI C;  2L55 A;  4RHR A;  1GUG A;  2AUJ D;  2L9H A;  2M9V A;  4C3J G;  2XWB B;  2KCC A;  1SSO A;  4OL7 A;  5DNF A;  1DCZ A;  3NXW A;  4K2L A;  1IW7 D;  2ZXO A;  3DWQ A;  5DEH A;  3K5N A;  2EJF C;  2O4X A;  3NPP A;  2AWN A;  4IQZ A;  2MJ8 A;  1KDA A;  4DAV A;  4ME5 A;  2XIW A;  1Z6H A;  4HTH A;  2NTS A;  3I3C A;  2BE5 D;  4TQU S;  2B8G A;  4E6I A;  1OXX K;  4ZUJ A;  2FHT A;  2AUK A;  5FO7 B;  1XXG A;  2YU9 B;  1VF7 A;  4CKB A;  2B8F A;  3R3O A;  2LS0 1;  1BF4 A;  2IX1 A;  3PUY A;  4MN3 A;  3MWY W;  2XRQ D;  4PMC A;  2O5J C;  2EY5 A;  1OXU A;  4B9W A;  2EJG C;  3BDL A;  1NAP A;  3KUP A;  1SEB D;  1BCP B;  1S5F D;  3DMU A;  3SXH A;  3M4Y A;  1EY7 A;  3BYT B;  5G3L F;  3TME A;  1KAB A;  4UAI A;  3DEO A;  1BCP C;  2L0C A;  1HQR D;  1JQY D;  1V1P B;  3D3R A;  3TP6 A;  1HUM A;  4H44 C;  1A2T A;  4KD4 A;  2F0S A;  4ILW A;  1K8O A;  2OXP A;  1HFG A;  2K5Q A;  3QIA A;  2D62 A;  1FNW A;  1EY5 A;  1XTC D;  3K5O A;  4FVM A;  1TQO A;  2PZW A;  1MSH A;  2SDF A;  1EYA A;  3I8Z A;  4RGO S;  1Y69 U;  3QO2 A;  5I6Y A;  5KNB A;  2RSO A;  2KA7 A;  2IX3 A;  4H7B A;  3KLR A;  5CV7 A;  2RSN A;  1QJO A;  5C3W A;  3GTG B;  3VYU A;  4A3J B;  2F03 A;  3I72 A;  3ITP A;  1B50 A;  4EQN A;  2TSS A;  2RDH A;  1S5D D;  4KN4 C;  5C5L A;  5EPL A;  5EKL A;  5C3E B;  1VMP A;  2F0E A;  1GHK A;  1PFM A;  2EDG A;  2EYJ A;  2VXW A;  3I4N B;  5IGF A;  2I46 A;  2C9O A;  5JPM C;  1PMR A;  3H6M A;  3FRP B;  3P20 A;  3Q23 A;  2SEB D;  4HSP A;  3HEJ A;  3MXU A;  1EU3 A;  1TT2 A;  4C3I G;  5C3X A;  2QF7 A;  3DXJ C;  2B2T C;  5D14 A;  5KEE A;  3NSW A;  2EYO A;  3I91 A;  4KI0 A;  3K57 A;  4G4K A;  4KJN A;  1MGS A;  4JBW A;  5C6A A;  5J39 A;  2JYO A;  1IW7 C;  2NTT A;  2PNR C;  1O7Y A;  3X3M A;  1Y8O B;  3QJY A;  1CQF A;  2K28 A;  1F2M A;  2L4N A;  2G9H D;  2X69 A;  1T5E A;  1GOZ A;  4RGM A;  3WOF A;  2WB1 B;  4ZAI A;  4CHT B;  3D6W A;  3OWF A;  2K03 A;  2K5D A;  2K1B A;  2F3V A;  3LX0 A;  1AZQ A;  5I2Y A;  4EGV A;  1G2S A;  2E76 C;  3HOY B;  2JSO A;  1ET6 A;  2Q8R E;  5JAV A;  1K8M A;  2BA0 A;  5D3D A;  4HN7 A;  2MP1 A;  1EQT A;  1KDC A;  5LHY 1;  1PTO D;  5KYI A;  1SYD A;  3NTH A;  2Z4I A;  3S9W A;  1CA6 A;  1BBX C;  5AFW A;  2E75 C;  3BVZ A;  1HXY D;  2WAC A;  2CW0 D;  3MC0 B;  2JA5 B;  3NQT A;  1F2L A;  1V43 A;  1KLU D;  4BY1 B;  2CVR A;  3GO5 A;  3I73 A;  1PLF A;  1DOM A;  3FPU B;  5CGK A;  2HCI A;  3BG3 A;  4G7O C;  4IFD J;  4A3I B;  1PZJ D;  4DAP A;  2KCN A;  2KEE A;  3CKI B;  1G6Z A;  4CKE A;  1QCB D;  2A68 C;  4FXD A;  2SOB A;  4R9W A;  5JOB A;  2R6G A;  3MFG A;  1PFB A;  3NTI A;  1A2U A;  1B2T A;  4NDX A;  3HOU B;  3TBI B;  3T53 B;  3C46 A;  1R4Q B;  3W3A A;  5DM7 3;  4Y7N B;  1FR3 A;  1JR0 D;  1FGB D;  1PRT C;  4ID6 A;  2XWJ B;  3IL8 A;  1STH A;  4CJ2 C;  2F0H A;  4BA1 I;  3BDO A;  2NVQ B;  3SEB A;  5FO9 B;  1PZI D;  1LTI D;  5IGE A;  4OHJ A;  2IPK D;  4F88 A;  5LL6 S;  1CZG A;  4BWG B;  1JWM D;  3VYR A;  2IJ0 A;  5LL6 X;  1CQV A;  1HTL D;  4GZY C;  3T13 A;  4RA8 A;  1CK1 A;  1HUN A;  1LAC A;  4N9T A;  1SNQ A;  3RMH A;  1D2B A;  3ERO A;  4LAA A;  1D6E C;  1TU2 B;  1OO9 B;  4PMW A;  2B39 A;  1EFI D;  3OSO A;  4RFB A;  5FLX L;  1JC7 A;  3PUZ A;  3V2T A;  2NN6 G;  2E2H B;  2XRS D;  4RCO A;  1ESF A;  4HCS A;  3H09 A;  2J7Z A;  2EZV A;  1SYC A;  5CMD A;  1NCV A;  5T1G A;  1DD2 A;  2HQE A;  1U4M A;  3D6C A;  5BN3 A;  3BS1 A;  2JA6 B;  2KQ3 A;  3MVV A;  2EPB A;  5D3I B;  2EYP A;  3VA7 A;  2OT2 A;  3T56 B;  3TDQ A;  1A3V A;  4EQP A;  1QNU A;  1ZYR D;  1ENA A;  3CQZ B;  2RBM A;  1U4L A;  3D31 A;  1ML0 D;  2EE1 A;  4NW2 A;  3S15 B;  1EWC A;  1LTA D;  1OXT A;  1QWY A;  2Y0S B;  3FPP A;  2RQX A;  3K5L A;  3QG1 A;  3IKJ A;  1EQV A;  3ZYY X;  3S1N B;  1NUC A;  3WOE A;  1BOS A;  3A7A B;  4K5X A;  1RTO A;  2IT1 A;  1JOO A;  1FNU A;  1B3A A;  3GTJ B;  3BVG A;  4XYQ A;  2QCP X;  3TZU A;  2R7Z B;  2B2Y A;  5C4Z A;  1RF2 D;  4KKT A;  3S1M B;  1I4H A;  3S16 B;  5CBE E;  1X3P A;  5M9O A;  2NVX B;  4DK1 A;  5ELC A;  4G7Z C;  1JIC A;  1AP0 A;  2QDB A;  1SNM A;  2DY8 A;  2WP8 J;  4ZYS A;  4WRD A;  2A69 D;  3GP7 A;  3J80 E;  1KLG D;  1F2Z A;  2MGS A;  3A55 A;  1X3Q A;  2FIN B;  1YNJ C;  2F0U A;  3D8G A;  4A3E B;  1PRT F;  5CC4 A;  2F0G A;  3KK7 A;  4OGQ C;  1Q1E A;  4KTA A;  2LFN A;  4K6L A;  1Z47 A;  1IYV A;  1SFO B;  3S2D B;  5JVH 3;  1IL8 A;  3GV3 A;  4XQQ A;  4N9P A;  2JA8 B;  3OIP A;  5T1I A;  1DOL A;  2EY1 A;  1S5B D;  3SK4 A;  5K5P A;  2PYK A;  1AEX A;  4DU9 A;  4KKU A;  1B1Z A;  2ZXP A;  1J8I A;  1BDO A;  1CHP D;  1HRJ A;  1JE4 A;  2VUM B;  1FNV A;  3HKZ B;  5CV5 A;  4OIK A;  3MXP A;  2K04 A;  3I4M B;  3MTS A;  4ZRZ A;  1SYE A;  2F0K A;  1SJE D;  1LTB D;  2A69 C;  4C1N I;  2WII B;  3A7L A;  3URY A;  2JE6 I;  3GTL B;  1LAB A;  4ZUI A;  1EZ6 A;  1O7Z A;  2QIL A;  5CV4 A;  4L8J A;  2HCC A;  1KDB A;  4XXE A;  5C5M A;  2J4X A;  4L63 B;  3NBI A;  4X3S A;  3MXN A;  1BR9 A;  1V8Q A;  1ONL A;  4OIJ A;  2D5D A;  3WDN A;  3PUX A;  2C5C A;  1I4Q A;  1EEF D;  4CJ0 B;  2A6E D;  1RHP A;  2IX0 A;  2K32 A;  4X3T A;  5TSS A;  2OF1 A;  4A3B B;  1TWA B;  5IT9 E;  3D4D A;  3KLS X;  5E3F A;  1V1O A;  4KHV A;  5D65 A;  1B53 A;  1TWF B;  2AQ3 B;  4Z9C B;  3HRZ C;  2A73 B;  2KVM A;  1Q1B A;  4WFN 3;  1WCM B;  4HMI A;  1B9M A;  2RKS A;  3MA2 B;  4DGZ A;  4HR7 B;  4RGT A;  2BOS A;  5DAU A;  3HGB A;  5ELF A;  4OO1 G;  1Q8I A;  3OMG A;  5ELB A;  2FMC A;  1AW7 A;  1I4G A;  2HDM A;  3DEP A;  3HZX A;  3J7Y W;  1SE2 A;  1SXT A;  1UEA B;  1XYI A;  5M5X B;  1HQM C;  4ZKB B;  5C0X I;  3V05 A;  3MZ5 A;  1WTO A;  2J0T D;  1TY2 A;  1YNN C;  1PTO H;  3PO3 B;  1HFN A;  5CV8 A;  1H9S A;  3C1E A;  4IAL A;  2K5W A;  2RA4 A;  4ZKC B;  1Y8N B;  2MUY A;  3TP5 A;  5CV6 A;  1EYD A;  3A8J E;  4F7X A;  2TMP A;  1IYU A;  4RKL A;  5EQ0 A;  4QUF A;  5IGG A;  2AQ1 B;  2JEA I;  2NBF A;  5CV9 A;  1J9O A;  4K5W A;  1GUO A;  2FFK B;  1G29 1;  5IGD A;  1QIL A;  3QOJ A;  2PQE A;  1PTO C;  1TVX A;  1EL0 A;  1SJH D;  3BYY B;  4FO2 A;  3PIO 3;  3J81 L;  3A8K E;  1O80 A;  1LTT D;  5G3L D;  5JJZ A;  2R93 B;  2D2C C;  5A35 A;  1AN8 A;  3R2I A;  3MXG A;  5E4W C;  4KMU C;  5EGT A;  3AMU A;  2Z4H A;  4V19 0;  3LNN A;  1F2Y A;  2CHB D;  3S1R B;  2WV6 D;  3KBG A;  1STG A;  4BS9 A;  5IGB A;  5ISR A;  2DY7 A;  5I4D A;  5JEA H;  1ENF A;  5ELE A;  4WJW A;  3GTO B;  3R93 A;  1GXD C;  3LWU A;  1DJR D;  4TRD A;  2GA4 B;  3H0G B;  1WTW A;  3VR5 A;  5ELD A;  3P1H A;  1I6H B;  4K6D A;  3GV6 A;  4MHE A;  1Z7T A;  5EKI A;  2F0W A;  4XQN A;  1HPC A;  2M2L A;  1HCZ A;  5F2D A;  1ESR A;  1PRT B;  2SNS A;  5COR A;  1D5M C;  5FK9 C;  2I07 B;  2PZT A;  1SNC A;  2PW5 A;  2NB0 A;  4FF2 A;  4X3U A;  2B2U C;  1SNP A;  1AZP A;  1C8C A;  1JOK A;  1E0B A;  3G7L A;  3S1Q B;  1T5X D;  2DNC A;  4ZQ3 A;  3OW7 A;  3H94 A;  1ENC A;  1QE6 A;  1A3T A;  4RCN A;  3EQL C;  5KIX A;  1CI3 M;  5KRU A;  3L7Z C;  3NBH A;  4DXF A;  1RKN A;  5EBD A;  4IFD I;  2NZ1 D;  1U4P A;  2LY7 A;  4XT1 B;  1E2V A;  2K01 A;  4H0L C;  3TSS A;  3NUC A;  4LK1 C;  1B4O A;  1CA5 A;  5C44 B;  1SYG A;  1O78 A;  1TII D;  1PTO B;  4KY7 A;  1E2W A;  1BNZ A;  3KBX A;  1LTS D;  1IKL A;  3K5M A;  5C4X B;  4A93 B;  2F0F A;  4K2K A;  1TS3 A;  2IW3 A;  4M1U B;  1C4Q A;  3IAY A;  4K14 A;  4DA2 A;  1RCV D;  2A6E C;  4PV1 C;  3FVQ A;  1VDZ A;  1HA5 A;  4MIU A;  3K58 A;  1EY9 A;  1EOT A;  2F0V A;  4IUR A;  1I6V C;  4FXG C;  1PDQ A;  3PUW A;  2VNU D;  3J7A F;  1EY0 A;  1A6X A;  3JAM E;  1UAP A;  1WD1 A;  2WKC A;  1G8Z D;  4KJO A;  4DF7 A;  1LTG D;  4ODG A;  4OO1 I;  2DNE A;  2A68 D;  2EOT A;  3I90 A;  4TSS A;  4EVO A;  5I9O A;  1M8A A;  3CRL C;  3OIQ A;  3C2P A;  2AQ2 B;  5EPJ A;  2KOL A;  1STE A;  2K7V A;  3JAM L;  1K83 B;  4HCE A;  3I70 A;  4FF3 A;  3D4R A;  1WTR A;  1A3U A;  4OO1 H;  4QMG A;  3VR4 A;  1SDF A;  2A5H A;  5IGC A;  5FKA C;  3MHB A;  1LV9 A;  3M7N A;  4FYD A;  4IUV A;  3TP8 A;  4JK1 C;  3U9O A;  1R4P B;  2NN6 H;  4KY6 A;  3R2T A;  3RUZ A;  4FXK C;  1STN A;  1Y1W B;  4LJZ C;  3V96 A;  4DXG A;  2B2T A;  3PIP 3;  3TN2 A;  2F3W A;  3PUV A;  2F0L A;  1ROD A;  4C56 C;  2MHV A;  2JP1 A;  3CU7 A;  1EZ8 A;  1LLR D;  1E2Z A;  5FLX E;  1QB5 D;  2NVY B;  4XT3 B;  1BXT A;  4XQJ A;  4C3H G;  4C1N K;  3A54 A;  2B2V C;  2K6A A;  4CBV A;  5K36 G;  3J80 L;  4C3I B;  2BDN A;  1WTX A;  4IUQ A;  3NHH A;  1JOQ A;  2VB3 X;  1H9K A;  4O1N A;  1V1P A;  1ICW A;  3MEH A;  1PYW D;  2N55 A;  3P7J A;  2RDF A;  3NTK A;  1PXU A;  5FOB B;  3C3L A;  1XX8 A;  4IUU A;  4EQO A;  4U67 3;  2O5I C;  3NP8 A;  1F9S A;  1HA6 A;  3A8I E;  1EY4 A;  3SK8 A;  2FJ2 A;  1AFP A;  3UI2 A;  3EA6 A;  3GD7 A;  1GUN A;  2G9D A;  4A3M B;  3HOW B;  3Q0A A;  4BBS B;  1HTP A;  3CRK C;  1RJT A;  4C3H B;  5DM6 3;  1TY0 A;  4O42 A;  5EKK A;  2A6H C;  4A3D B;  3FEW X;  5JEA G;  1JCK B;  2EXZ A;  3OOC A;  5J1Z A;  4ZK9 B;  3TP7 A;  2BE5 C;  1PZK D;  1LT4 D;  2HUG A;  1JWS D;  5E1F A;  4KKS A;  2K05 A;  1ZEQ X;  2F0J A;  4IZ8 A;  4NKL A;  1TKW B;  2ENB A;  5HGT A;  4A3G B;  5M5Y B;  2SNM A;  3FMC A;  4DNT B;  3Q22 A;  4V0B A;  5C0X H;  2ZXR A;  5A2Q L;  5EJW A;  4BA2 I;  1WTP A;  1CFM A;  3K7A B;  4RGN A;  4FNF A;  4PQX A;  4UDU C;  1W6J A;  1B44 D;  2KHS A;  3P75 A;  1ILQ A;  2H4O A;  5KNC A;  4G57 A;  3T4A C;  2KJX A;  2LMC B;  4LMQ D;  3FKI B;  4CKC A;  2E2J B;  1MBY A;  1G91 A;  3S14 B;  2R61 A;  3K0Y A;  3C1F A;  4HMJ A;  1SAP A;  2WAQ B;  4YIJ A;  4F87 A;  3M85 A;  3PO2 B;  5J22 A;  4DN4 M;  1RDP D;  1I4R A;  4ZLT F;  5CYU A;  1JOR A;  3T51 B;  3BZD B;  4ABN A;  2XVS A;  4K8J A;  4KD3 A;  2RVL A;  3AU7 A;  2VB2 X;  5C4H A;  1D1I A;  2NWG A;  4PNY A;  3GTP B;  2CQA A;  2E2D C;  1LO5 D;  3N52 A;  1DZ1 A;  3RZD B;  2V4D A;  2XNA C;  4HAE A;  2WIN B;  1KTK A;  5COY A;  2PPB C;  3L3O C;  4J6H A;  3IFD A;  2AWO A;  2B63 B;  2PMZ B;  1U4R A;  1IKM A;  3SE0 A;  3A56 A;  2L12 A;  1LT3 D;  2F1M A;  1RD9 D;  1BUV T;  1GUW A;  1SYB A;  2OEO A;  2F0D A;  3AB9 A;  1G2T A;  3HP3 A;  5C0X G;  3K59 A;  4DK0 A;  1LT6 D;  4J8Q A;  2EY2 A;  1WTV A;  3VR3 A;  1NR4 A;  1DYQ A;  2O2L D;  2E74 C;  4R8I A;  1UNS A;  3SHL A;  1CM9 A;  2F0P A;  4KN7 C;  4XYO A;  1D5X C;  2Z1C A;  3E5S A;  3QB3 A;  2LKV A;  2EJM A;  3EJI A;  3M7G A;  3U9S A;  3M3Y B;  5KGU A;  4HED A;  3EVQ A;  2MPM A;  4I65 A;  4PMB A;  1ILP A;  3VR6 A;  1TS4 A;  1MD2 D;  5JVG 3;  4BY7 B;  2B2U A;  3E6Z X;  2KEC A;  1TR5 A;  3MFY A;  3KLS A;  5M3F B;  4IUN A;  1DON A;  1NSN S;  2NUC A;  2EYH A;  4DAY A;  2XSC A;  3OMC A;  3S2H B;  4IFD G;  1O7L A;  3VA5 A;  1F9P A;  3FDT A;  1GJX A;  1EU4 A;  1EY8 A;  3GTK B;  4XTC S;  1PRT D;  1SE4 A;  3PV0 A;  1STA A;  1XWE A;  3BDC A;  1BQQ T;  3KF8 A;  2NN6 I;  1II3 A;  3F2U A;  4K5V A;  1FD7 D;  4A3F B;  1TWH B;  3RLF A;  1SMY C;  2YYZ A;  1C48 A;  4QF4 A;  4FF4 A;  5JEA J;  4DNR B;  2X6L A;  1OXV A;  3SK5 A;  3CHB D;  4X3K A;  1CTM A;  5KND A;  4U68 A;  3Q6S A;  1DM0 B;  3NQI A;  1PFN A;  4R8N A;  2PZU A;  2A74 C;  3EFX D;  1GHJ A;  1WVL A;  1S5E D;  3IFT A;  2L1B A;  1IHZ A;  2CW0 C;  4KK7 A;  4B08 A;  1KNA A;  4KHZ A;  3DWP A;  1QOH A;  1EIH A;  1YNJ D;  1CZW A;  5IOD A;  4IUP A;  5C4J B;  4KV6 A;  4TKO B;  1Q3L A;  1QG7 A;  2PCF B;  1CHQ D;  1STB A;  2B2W C;  3OHX C;  1Q12 A;  1GUT A;  3DHQ A;  1B9N A;  3VYS A;  1TS5 A;  4CGY B;  1VF5 C;  1H9S B;  2D9U A;  1DXM A;  1MSG A;  5EPK A;  2X6G A;  2PW7 A;  2ZT9 C;  2F4I A;  2R3Z A;  5CR3 A;  1I4X A;  1UUP A;  2QEJ C;  3BVM A;  1EEI D;  3I4L A;  1L0X B;  1M4V A;  1S5C D;  1WTQ A;  4RH6 A;  3GTQ B;  2EVB A;  5I2X A;  1SYF A;  1HHV A;  4RAU C;  2F0O A;  1SBB B;  3HS0 C;  4NP5 A;  5HUR A;  2B2W A;  1U9R A;  3QWN A;  5A2Q E;  3DUZ A;  3GQB A;  3MAQ A;  1JB3 A;  3RZO B;  2XN9 C;  3DM1 A;  2NYZ D;  2F0M A;  1H9M A;  3R8B A;  4A3K B;  2L5T A;  1ZYR C;  3H3V C;  2JEB I;  3S17 B;  1VCI A;  2E2I B;  4L6T B;  3J81 E;  4IFD H;  1YNN D;  4QIW B;  4AYB B;  1EIG A;  1Y8P B;  3J7A V;  1STY A;  2ID0 A;  1L0Y B;  2F0N A;  4QB4 A;  1I4P A;  1DOK A;  2NVT B;  2A6H D;  2ICI A;  5IIF A;  3M4O B;  1SMY D;  3SK6 A;  3HOX B;  3NWS A;  3QOL A;  3LWE A;  4P2C B;  1TWC B;  4FF1 A;  3E0J A;  4RHS A;  2EYL A;  5E4X A;  3OPO A;  1D5Z C;  4IUT A;  3X3N A;  3SDZ A;  4DFA A;  4RWS C;  4CJ1 B;  2N88 A;  2EYF A;  3D4W A;  1S4Z A;  5I9P A;  1R9T B;  3RD4 A;  1KAA A;  1EY6 A;  2F0Q A;  5FO8 B;  3GTM B;  1JWU D;  1A15 A;  3T16 A;  1D1K A;  2IWH A;  2KED A;  1I3Q B;  1LT5 D;  2R92 B;  3VYT A;  5EBC A;  1F77 A;  2Q8I B;  1MI2 A;  1LTR D;  3DWA A;  2Q8T A;  2JXM B;  3N6R A;  1I50 B;  3TZD A;  4BBR B;  5CBA E;  1BO0 A;  1KNE A;  5KYL A;  2Z8L A;  1F9R A;  1EYC A;  5NUC A;  2M00 A;  1BCP D;  1Y1V B;  4IN3 A;  3NWT A;  3ONA B;  2F0I A;  3HOV B;  2K33 A;  1H9J A;  5IOC A;  1TWG B;  4HSV A;  1QNK A;  3PMF A;  4QUC A;  1CT1 D;  1GUS A;  5K36 H;  4M8A A;  4G7H C;  4XIG S;  1SE3 A;  4WOR A;  4C3J B;  4H13 C;  4Q0F A;  3SVM A;  3G6J B;  3OWE B;  4FP5 D;  5I6W A;  1Q90 A;  3ERQ A;  2IL8 A;  2WKD A;  4S3S A;  4NMZ A;  2BA1 A;  4I7Z C;  2DN8 A;  5M5W B;  3HOZ B;  5C0X J;  4Q5V A;  1F9Q A;  4F8M A;  4RKB A;  3SR1 A;  1TS2 A;  2JA7 B;  3HG9 A;  5IT9 L;  1ET9 A;  2RDG A;  4ULL A;  3Q24 A;  1SNO A;  3H91 A;  2L11 A;  2H1E A;  4B9X A;  5M3M B;  2HDL A;  1FYC A;  2EYM A;  4XDX A;  4QCL A;  4K8I A;  4C2M B;  2EY6 A;  1EWH A;  1SND A;  4KY5 A;  3NE5 B;  3NK9 A;  1VMC A;  3W2D A;  1WD0 A;  2B2V A;  1PTO F;  1NR2 A;  5JPN C;  4J1M A;  1BCP F;  2BDO A;  2KUM A;  1ZXT A;  3ND8 A;  1X32 A;  2BCO A;  2F0T A;  1W6K A;  5BN4 A;  3K6O A;  2B2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...