2EE1A

Solution structures of the chromo domain of human chromodomain helicase-dna-binding protein 4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSSGSSGKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain helicase-DNA-binding protein 4
publication title Solution structures of the Chromo domain of human chromodomain helicase-DNA-binding protein 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 64
sequence length 64
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ee1A00
1NCVA 1SDFA 5EPJA 4CJ2C 1RODA 1U4PA 2FFKB 2VXWA 3I90A 1WTWA 1A15A 1HFGA 2K05A 4QUFA 4HAEA 1RJTA 1WTPA 1J9OA 1HUNA 1G91A 2L12A 1WTVA 2CVRA 2NWGA 3MWYW 1O7ZA 1E0BA 2K04A 1PDQA 3KUPA 2B2YC 1X3PA 2K1BA 3HP3A 1TVXA 1WD0A 1X32A 3KBXA 4IUUA 1ESRA 1DOKA 5CORA 1U4LA 4RWSC 1RHPA 3DEOA 2MPMA 4R8IA 1AP0A 3D6WA 4IUVA 1J8IA 1B4OA 2B2YA 4MHEA 5CBEE 1JICA 1U4MA 1ML0D 4U68A 1XX8A 1WVLA 1BBXC 3IFDA 1MSGA 1M8AA 2K28A 5E4XA 1HA6A 1XYIA 1HFNA 4OIKA 1B50A 2EPBA 1BO0A 2B2UC 2RSNA 4LMQD 1U4RA 3GV3A 1ILPA 1RTNA 4X3SA 2RSOA 4IURA 5T1IA 1IKMA 1PFBA 5DNFA 1X3QA 1WTOA 4RA8A 1AZPA 2B2UA 4ZK9B 1CM9A 2B2TA 2B2WC 1DOLA 1AZQA 1F9RA 1BF4A 1SAPA 5COYA 1LV9A 3QO2A 1F9PA 5D65A 5CBAE 4CJ1B 2HUGA 1EOTA 1QG7A 3F2UA 5E4WC 1WTRA 2BDNA 3DEPA 1ICWA 1O80A 3ONAB 4QUCA 2B2WA 1F9QA 2J7ZA 3LWEA 2B2VA 4OIJA 5EQ0A 1G2TA 1DONA 1SSOA 1HHVA 4IUQA 3TZDA 2DY8A 2KECA 4O42A 1JE4A 3TN2A 1B53A 1DOMA 2HCIA 2KEDA 2Q8TA 1HRJA 2X6GA 5T1GA 2L1BA 2B2TC 1CA6A 3MTSA 2FMMA 1B3AA 4ZKBB 4HEDA 2N88A 2HDMA 1MSHA 4ZAIA 1PFNA 1QE6A 1F2LA 2JYOA 2X6LA 3I91A 2MGSA 2HDLA 4HSVA 5JJZA 4XDXA 1G2SA 1WD1A 4HCSA 2FHTA 3G7LA 2DY7A 2MP1A 1GUWA 4XT1B 2RA4A 2R3ZA 1EL0A 4UAIA 1S4ZA 1DZ1A 2B2VC 1PLFA 1VMCA 1EIHA 1CA5A 2NYZD 1KNAA 1EIGA 1NR4A 2KEEA 4X3UA 1B2TA 3SVMA 2KUMA 5EPKA 5EKIA 2SDFA 2X69A 4R9WA 1G6ZA 2KVMA 3IL8A 2RVLA 1WTXA 4XT3B 4NW2A 3FPUB 3R93A 4CJ0B 1KNEA 2L4NA 1VMPA 5EJWA 5D14A 1F9SA 1HUMA 3N52A 2FJ2A 5EPLA 1IKLA 1WTQA 3H91A 2KOLA 1NR2A 4IUPA 5CMDA 1C8CA 1NAPA 2L9HA 2Q8RE 4MN3A 4RAUC 2EE1A 4DN4M 2NZ1D 2IL8A 2M2LA 3I8ZA 3Q6SA 5AFWA 3UI2A 1BNZA 4ZLTF 4X3KA 1MI2A 3FDTA 3I3CA 1O7YA 1PFMA 2HCCA 2XIWA 3DM1A 2JP1A 1MGSA 4IUTA 3P7JA 4ZKCB 1QNKA 2N55A 1RTOA 1EQTA 1ILQA 1Q3LA 2H1EA 2K03A 2K01A 4X3TA 2FINB 1IL8A 2MJ8A 2EOTA 2D9UA 3GV6A 1ZXTA 2L11A
chains in the Genus database with same CATH superfamily
4UP9A 4NDXA 1YI2A 3BS1A 1KL9A 1TWCB 4O1NA 1WTWA 3AEVA 1PH5A 1TWGH 4H13C 4A3GH 4ALPA 2SNMA 1RKNA 2K1BA 4X66L 2F0DA 4BY1G 1UE6A 4YIJA 1IBKQ 1GUGA 4DKAC 2HT1A 4DR1L 4NXNL 1PMRA 1K3BC 4WORA 1JC7A 1JR0D 3VA5A 5M5XB 1N32L 1IXRA 3BVZA 1EY4A 5EKLA 1IYJB 1UWVA 5BR8L 1WTOA 3KF6A 1L0XB 2B2TA 3D3RA 2XWBB 2Y0SE 2WFWA 2IWHA 1SAPA 3PV0A 2PW7A 4R1JA 1O80A 3F8TA 4K14A 2B2WA 5DLQE 5C6AA 1JOKA 2J7ZA 5DEHA 3K5LA 1YITA 1DONA 3ZJYC 2DJFC 1NY4A 4QGUA 2RF4A 4G7HC 3I4OA 2F4IA 4HEDA 2B8FA 1ZYRD 1TS4A 4X66Q 5KNCA 2JA5B 3JC66 4MTKA 4HCSA 4JI3L 4BBSB 3K7AB 2AWNA 1DZ1A 2B2VC 3I73A 2R93H 5IY0A 5HY6A 2L0CA 3QOLA 3A5UA 4DR1Q 4NXNQ 3MA2B 1DM0B 2X69A 1TWFB 4B9WA 2JEBI 4P71A 4A3DG 1LACA 1LLRD 2XN9C 4NW2A 4CJ0B 1QVGA 4RGOS 4RG1A 2R7ZG 1FJGL 1HTLD 3NELA 4IUPA 2MHVA 3GP7A 1TR5A 4LUZA 1H9SB 2G5DA 3AMUA 2HHHL 3AYHB 3BU2A 3UDFA 3EJIA 2UXBL 1X3GA 3U9OA 4A3JG 4QIWB 4IUTA 4OWTB 3J80i 2Y0SG 4EQ5A 1PH2A 5DM73 1ZEQX 3BVMA 2DGYA 2MJ8A 4JI8L 2EOTA 1FVIA 1UEBA 4KHVA 3RR5A 3GTKH 2FFKB 2VXWA 4JOIC 3RMHA 3SK5A 5IGBA 2K05A 2MUYA 4EVOA 1J9OA 1EWHA 3GTPH 3BVGA 2CFMA 1DYQA 4IOAA 5IT9E 3LWUA 1X3PA 4AIMA 3KBXA 3I4MH 1ESRA 3TZUA 5JVH3 1SYGA 3E6ZX 4DR3Q 3TRZA 4RCOA 1B4OA 3QOJA 1SE3A 3U4ZA 2VUMG 1U4MA 3RLNA 4PG3A 4AYBB 1FJGQ 4DGZA 3PIPA 2NN6I 3DXJC 3CMEA 3G6JB 1PVOA 4FP5D 1BO0A 4R4OA 3RZOH 2EJFC 1HH2P 5KYIA 1PH9A 4IJLA 4GLVB 4DR2L 3J81j 2A69D 4ULLA 4LAAA 1VQKA 3L7ZC 3A8KE 1LTLA 1LT6D 5D3DA 3W2DA 4KLKA 1BCPB 1YZ6A 1EU3A 1GD7A 4BBRB 1BOSA 2KECA 3TREA 4OGQC 1DOMA 2NBFA 3FVQA 3TP6A 4GOPA 2QW7A 2Q8TA 2AKWB 1HRJA 2L1BA 1M1KC 4N8FA 5FJ8H 1Y69U 3I91A 1WD1A 4C56C 3ND9A 4A3EB 2EYHA 2HQEA 2JQOA 4C3JG 5C3EG 1JMCA 3HG9A 3FHWA 1MHWC 3ULJA 2J4XA 1KNAA 3R3OA 3BDOA 1N34L 2J0TD 4G7OC 1GUOA 4HIDA 1M90C 5EKIA 1XNRL 4KV6A 2EY6A 3MXUA 5G3LF 5I6WA 1HNXQ 3GTOH 2VQEQ 1STBA 5IYBG 4DR2Q 2N78A 4GLXA 1VQMA 1B9NA 3EA6A 3FKIG 4FF1A 2KHJA 1VQ8A 1HTPA 2NB0A 2F0FA 1BVSA 2M2LA 1XMQL 4B3SL 1Q90A 5I9OA 3LGJA 4KY5A 2EY5A 1MGSA 4HTHA 3MFYA 5JEAG 4B3ML 3HKZB 4A3FG 1LT5D 5ISRA 3SXHA 3KF6B 5C3XA 3CRKC 4ABNA 4HN7A 4K6DA 1RD9D 3R2IA 1NCVA 2DJGC 2CWPA 3KF8A 1B1ZA 4OONA 1E2WA 5GAGC 1A15A 3D4DA 1E22A 4DR7Q 1LTID 5FLXE 3PQIA 3A7LA 4FVMA 1V1QA 1TWGB 2K32A 4A3GB 4K6LA 3FMCA 1KDAA 3NWSA 1AP0A 4POGA 3VR2A 1TQOA 1ML0D 2AQ3B 1D1KA 4F88A 4K0KL 4DPGA 2QA4A 1CUKA 1PHJA 2P5ZX 1DCZA 1XYIA 4OIKA 2CH4A 1VQIA 1SNDA 2RSNA 4ODGA 2YTYA 2KENA 2F0WA 2I0QA 4B3SQ 1HZBA 2F0VA 1EWIA 2NVQH 2YTXA 2E76C 3TSSA 5TSSA 4OL7A 1D2BA 4CGYB 2OCEA 4B3MQ 1F9RA 1HPCA 3BZDB 4OX9L 4FYDA 1LV9A 1RCVD 4C3JH 3KLSA 2SOBA 3J7A5 3ONAB 4HIMA 2OF1A 4A93H 4K5VA 1EOVA 4V0BA 4L6TB 3VA7A 3E5SA 1HQMC 4EGVA 2X6GA 1FYCA 1PH8A 3I55A 1QE6A 4QY7A 3CMAA 1DD2A 2HDLA 3NBIA 2I5LX 4LFBQ 5IIFA 2MP1A 3FKIH 2UXDL 2WAQE 2B63H 2NYZD 4P74A 1BDOA 1B2TA 3ER0A 3A74A 4K0KQ 2IY5B 2R93B 1TS3A 2XNAC 4ZUIA 2B3GA 4LFCL 2RVLA 4HJ9A 1I5FA 5D14A 3S1NH 5BN3A 2ALYB 2OTJA 4I7ZC 3CCVA 1EQVA 1S40A 2R61A 3CC2A 3K57A 4MIUA 1SXTA 1BCPF 1SMYD 3WDNA 4DN4M 4J15A 3PF4A 4OX9Q 4HJ8A 2F0KA 4KTAA 4DXGA 4RCNA 3W1BA 3J80c 1Y1WG 3OW2A 4MZ9A 5BN5A 1RTOA 4PNYA 1AE2A 4CKCA 4NB3A 2GVAA 2K6AA 3PO2H 1X54A 3TP8A 1VS0A 3GTKB 1L0WA 4L5RC 4BA1I 2L12A 2MO0A 4S3SA 2UXDQ 2LMCB 2PO4A 3KUPA 4GOPB 4JOIA 1LTRD 2EYJA 2BDOA 3PO3G 2E5LL 3I4MB 2MPMA 1FNWA 4JI1L 4LFCQ 2WAQG 3I4NG 4DV2L 3HOUH 3I2ZA 4BY7G 2QDLA 4DV1L 3VR6A 1H95A 4IFDI 1SR3A 3K81C 5M9OA 3TS2A 2WB1G 3RZOB 5FO7B 1F2YA 1I4RA 2BH2A 1EY7A 1ET9A 4HJAA 1AH9A 3CCSA 4OO1G 4J1MA 5EBCA 1CKNA 3KLRA 2F0QA 1E1TA 2ZXPA 2IHEA 3EVQA 1KDBA 2HUGA 1EOTA 1PZJD 4CKEA 2UXCL 2Q2UA 1D5XC 2PI2E 1LABA 1Y8OB 4IUQA 3PUVA 4LUVA 2DNCA 4P72A 2D0PA 5JJKA 2SEBD 2CCZA 2B2TC 5ELEA 1JWUD 1PFNA 3AFPA 1D8LA 4XDXA 1E3PA 2KCCA 2E5LQ 3NQTA 4JI1Q 2A73B 3KF8B 5AJ3L 4DV2Q 3QWNA 1JJCB 5EPKA 1Y1WH 2A6HC 4XT3B 1N36L 5HURA 2OTLA 5KIXA 3GTOB 4G7ZC 4A3IG 2JA9A 4KY7A 3WOFA 5G3LD 4KN7C 3I70A 1WJJA 4MN3A 4RAUC 1R4QB 5JPNC 3I72A 4C1NI 4LF4Q 3UI2A 4ZLTF 1WCMG 5KNDA 2HQLA 1O7YA 4LFAL 5IT9L 4XQNA 1IW7D 4DV0Q 1NBWA 4QF4A 3T16A 1PH3A 3A0JA 1ILQA 4LUOA 2K03A 3RD4A 2R7FA 3I4NH 4HMJA 3J7YW 4B08A 2L11A 3OOCA 1I6HH 5C5MA 4BY7H 2K33A 2VW9A 4A3BH 2VB3X 2A74C 4GKKL 3J81L 1G6PA 4CHTB 1D1IA 2N3SA 4JCVE 1O7ZA 2B2YC 4UHVA 3VYSA 4UY8C 1VDZA 3FP9A 4F87A 3U4VA 4K2LA 5M5WH 2AQ1B 1CI3M 1PYSB 3KFUA 1WTHA 1EYGA 2BA1A 2NZOA 4UP7A 5GADC 5J3BA 3S15B 3NK9A 1XPOA 4QCLA 3F2DA 1R9TH 5D3IB 2LXJA 1VQJA 3H94A 1V1PA 2IT1A 3HOZG 3D6CA 3T1YQ 4LFAQ 1AZPA 1CM9A 3OWEB 1DOLA 2NVQB 1K0SA 1A2UA 1ESFA 1B3QA 4DA2A 1PYBA 3E0EA 3IRBA 1A3TA 3K80C 2JXMB 3Q23A 2K5NA 4H7BA 1WTRA 1YNJD 4C3JB 2YU9H 1EZ6A 3V05A 4PZ8A 4DK0A 1C0AA 3DM3A 3MHBA 1AFPA 1D5ZC 1HHVA 1I3QH 2DY8A 1UNSA 4JBKA 2JE6I 4A93B 1VQOA 2EYMA 4GKKQ 4FXDA 2KCNA 2F0EA 5IGCA 4TSSA 5L37A 2UUAL 4ZKBB 4A3IH 5ELCA 1SN8A 1K8OA 1HNZL 4DNRB 3CRLC 3H0GH 1U5KA 2RA4A 5KEEA 1GHKA 3FKIB 5C0XJ 2GA4B 3OTOL 2B63B 1G8ZD 2KJXA 1IBML 4RMFA 3MXNB 2E2HH 1N33L 1UAPA 5I6YA 1VMPA 2HIXA 2Z0SA 1IHZA 3P20A 4A3MG 1IKLA 2L9HA 1IYUA 2RKSA 3EBEA 1L1OC 1OXTA 5IYDG 3CCUA 4DV4L 2IL8A 3CHBD 3J7ZC 1GHJA 5AFWA 1BNZA 2ZJRA 4ZUJA 4XQJA 3I3CA 4R4QA 1BCPD 3H15A 3CCQA 2N55A 4JI0L 2R6GA 2AWOA 5C4XH 1SNOA 2PPBC 1CKNB 4JI7Q 2JA8H 2UUAQ 4IN3A 2BE5C 4YWLA 4YCVA 2ICIA 2RDGA 3PO2B 4RKLA 3MXPA 3SGIA 2PZWA 3BYTB 3HOWG 2NWGA 3MWYW 5C5LA 4IUUA 4LJZC 3OTOQ 1F77A 2ZTCA 1RHPA 3DEOA 1IBMQ 1EIFA 4R8IA 1K8AC 3G4SA 4MHEA 4JC0A 1VQLA 1JICA 4AQYL 3M4OH 3CAMA 2K14A 4B9XA 2PI2A 4I65A 3HOUB 3CU7A 1HA6A 4EQPA 4JV5L 3HOYG 3L0OA 3BDCA 4A3KH 5IP7G 1OXUA 2ICEC 2WP8J 5LMUL 3SR1A 4LF7L 4JI0Q 2NZHA 4L63B 4BXXG 1ICWA 2QDBA 2PQAA 1SE4A 1KRSA 2RHQB 4PZ6A 4FF3A 1Q7YC 1JE4A 2FMCA 4Y52H 2HCIA 3X3NA 1CA6A 3D31A 2FMMA 5M3MH 1VQDA 4CJ2C 2AQ2B 4KHPL 2JYOA 5JJZA 2M00A 1U9RA 2SNSA 1GXDC 1Q8KA 4X65Q 3A54A 3KJOA 1PLFA 2PMZE 5CV9A 2KEEA 4AQYQ 2ES2A 3K6OA 3UE1A 2KUMA 1NUCA 3CQZH 4WFN3 3U50C 3K58A 1B44D 4JYAQ 1J5EL 1Y1WB 3OIQA 4TQUS 1PRTF 3MFGA 4JV5Q 2OQ0A 2IX0A 1LTSD 2F0GA 3MEHA 4M8AA 1Y1VH 3UDIA 3C2PA 4DV6L 5LMUQ 1XTDA 4LF7Q 2B39A 3HOWH 2O2LD 1D7QA 3RN5A 1B8AA 2F0NA 3SK4A 3ITPA 1QNKA 3KLSX 1Q3LA 2MNAA 2ATWA 2QEXA 1PRTC 1T5EA 1PV4A 1CZGA 4B3RL 1N32Q 1CHPD 1SDFA 5JPMC 5EPJA 4IO9A 3I4NB 4BY7B 1XPRA 3PMFA 5BR8Q 4A3BB 1WTPA 4FF4A 2NN6G 2IW3A 2WB1B 1MJEA 5LMNL 4JI2L 3MEFA 4N9PA 2B2YA 5M5WB 4BY1H 5ELOA 4U68A 4XXEA 2F0OA 2CH4W 4BXXH 1Q82C 1I50H 1HZAA 3J7AV 1KD1C 2OEOA 3D8GA 1B9MA 3VDYA 1R9TB 2A68D 4DV6Q 3S1QH 1ILPA 5IWAL 3DWQA 1QUQB 2RCFA 4JI3Q 1A8VA 3PF5A 1I4XA 1SMXA 1CKMA 1SNCA 2A6EC 1GUNA 5COYA 4CJ1B 2OWOA 4EQNA 1S5BD 2K7VA 3SHLA 1QG7A 3T51B 3RNUA 3GTMH 4QUCA 4A75A 1EFWA 4HIOA 4C2MH 1FL0A 4I7AA 2YU9B 3CCRA 2EXZA 5CV4A 2CKZB 2O4XA 1HR0L 1I3QB 4N9TA 5T1GA 1C48A 3MAQA 1K73C 1GO3E 4FXGC 3TS0A 2HHHQ 5CC4A 5LMNQ 2UXBQ 4TVAB 3MXGA 4DAMA 4DUYL 3PIP3 3ZYYX 4IUNA 5C44G 1OXSC 3H0GB 1GVPA 3SVMA 4JI8Q 2G9DA 3T56B 2GN5A 4GNXB 4DR4L 2JJQA 4EX5A 2I46A 2L15A 2E2HB 3N52A 3M4QA 4A3DH 1V1OA 3PUYA 2K5QA 2R7ZH 4NKLA 1VQCA 3NPPA 4B3TL 2NN6H 2O5JC 2KHIA 2BE5D 1JJGA 1L1OA 3J7AF 2XRSD 2KQ3A 4A3JH 1HR0Q 4K5WA 4KK7A 5IE8A 2D9UA 5J22A 4IUVA 2ZTDA 5C4XB 1RODA 3J81i 3JAME 5IP9G 2JA8B 3CPFA 5ELNA 1A3VA 3BZCA 3FEWX 5GAEC 2EQSA 2Q8IB 2CVRA 2K04A 4Y7NH 2HD3A 4BWGB 3PIOA 1QCBD 3UDGA 1KIXA 1GKHA 4RFBA 3D6WA 4LW1A 2KCTA 3R2TA 1TY2A 4FDBA 4RGTA 1JOQA 3PIO3 3M4OB 2VUMH 4DAYA 1VCIA 4PMWA 2K5WA 1RTNA 4X6AH 1IKMA 3HOVG 4B3TQ 2ZXOA 3S14H 3AB9A 2RDFA 5ELDA 5ELFA 4A3KB 1N34Q 1Q1EA 4P2CB 1CTMA 1YNNC 5E4WC 3F2UA 5C44H 3W1GA 1XNRQ 3QG1A 1F9QA 3LWEA 3H3VC 1WYDA 2ZXRA 2Z4IA 4NP5A 1JOOA 1BKBA 1TU2B 2NTTA 1TXYA 3DUZA 2TMPA 3H6MA 5JOBA 1XMQQ 3S17H 3BYYB 4JI5L 4IPGA 5M3MB 3V96A 1VQGA 1EYCA 5FOBB 1AE3A 2F0TA 3RZDH 2R3ZA 4UAIA 3U58A 1VMCA 4KD4A 4KJNA 5HGQA 1EIGA 4X3UA 5C3EH 1J6QA 1JWSD 3K0XA 2MFIA 3SDZA 1NTGA 3CQZB 4GKJL 4LF8L 2E2JH 5K5PA 1QILA 1DJRD 5EKKA 3HFZB 2WINB 1OXXK 2EY1A 3T4AC 4G57A 1C9OA 3VR4A 5IYBH 3CPWA 4KMUC 4H0LC 1YHBA 1Y1VB 1K0RA 1KHIA 4PMCA 1KDCA 3NTKA 3A56A 1VQBA 4CDDC 3OWFA 4QMGA 1EQTA 5C4JH 3CW2C 1FNVA 2VB2X 5JEAH 3GTGH 4A3FH 2YTVA 3I4LA 3D0FA 3QB3A 1YVCA 3ULLA 1P16A 2F0HA 4IFDG 1WTVA 3STBC 4X62L 5FLMG 1GJXA 1TVXA 1XMOL 1U4LA 5DM63 4KKTA 4IJHA 4C1NK 4GKJQ 1Z6HA 2ZT9C 2NTSA 2ZJPA 4BY1B 5KYLA 2A8VA 2Z4HA 2GVBA 4DNIA 3GD7A 4QIWE 3PCOB 2B2UC 3TMEA 1I50B 2L55A 2RBMA 3C1EA 2QF7A 2R7DA 4LF6L 3S1QB 2E75C 2JEAI 4ZK9B 2Z6BA 2YV5A 3GTPB 2K52A 3N6RA 4JW0A 2I07B 4RGNA 3ND8A 1H9MA 2BDNA 2A5HA 1JJ2A 2K4KA 3NTHA 4IPDA 4FNFA 4C2MB 1QNUA 3TN2A 1EZ8A 2BA0A 5CV6A 3C46A 1L1OB 4FO2A 3I7FA 4LK1C 1EQQA 4BBSG 1VQFA 4RHSA 1KC8C 4KD3A 4L5SA 2O5IC 2E2IH 4KKUA 2X6LA 4AYBE 2MGSA 3CF5A 1XWEA 4RKBA 1DGSA 4GN4B 1GUSA 4ZYSA 1T5XD 1Q46A 1ZKOA 1STYA 4YY3L 3GDEA 2UU9L 4K5XA 1E2VA 4WJWA 1G6ZA 3FPUB 3R93A 4WRDA 1XPUA 2ENBA 1HNWL 2OT2A 4X64L 4EQOA 1EEFD 3K0YA 2VY3A 3E3XA 1NR2A 3H91A 4LF6Q 1SYCA 1VQPA 4A3DB 2Q8RE 2K5HA 1F2ZA 3S24A 2R7ZB 1F2MA 1UUPA 1XJVA 3QIAA 3GTLH 5LL6X 1I94L 4RGMA 3MVVA 4DAYB 4DR5L 3NBHA 3G48A 3P7JA 2QILA 3VYUA 4Q0FA 4DV1Q 2KHSA 3A55A 4A3JB 4L5TA 1JB7A 2RCNA 3IFTA 2Z9HA 3M7NA 3J81c 2Y0SB 1NSNS 1LO5D 3G71A 2MQHA 3RLFA 1HFGA 2E2DC 3D4WA 5LMNW 1BQQT 1RJTA 5E7NA 5CV5A 1P8LA 5C0XI 3H3VH 1X32A 4Y7NB 4AYBG 4CBVA 4YY3Q 4GN5A 2UU9Q 2UXCQ 4H44C 1J8IA 2R92G 3PO3H 1XNQL 2KCMA 1WVLA 1K83H 4DU9A 1MSGA 2K28A 4OWWB 5F2DA 1SYBA 3OIPA 2L5TA 2CWAA 1ENCA 1HCZA 2VUMB 3HKZE 5KNBA 2OXPA 1FGBD 1NJIC 3HS0C 1SNPA 1JB3A 1FNUA 1XXGA 1PFBA 3K7AH 1I94Q 4DR5Q 4O0AA 1UE5A 1V43A 2F3WA 3S14B 5AJ3Q 4O2DA 4BBRG 2YYZA 3QO2A 1IBLL 3AQQA 3M7GA 5FK9C 4OO1H 1CFMA 4OEMB 1HR0W 1A3UA 4GLAC 1BUVT 2B8GA 5C44B 5K36G 4UDUC 1N36Q 1S5ED 2EYLA 4O42A 3KYHC 4DK3C 1S3OA 1TWAH 1FD7D 1L0YB 4A3EG 3FRPB 1KLGD 3PGZA 3URYA 5FO8B 4A76A 3MTSA 1B3AA 1OO9B 5CR3A 2MO1A 1I4QA 4HSVA 3DWAA 3L9AX 3S17B 4YWKA 1SE2A 3KDFA 4FF2A 5FKAC 1PRTB 1HJPA 3RZDB 2OQKA 4PQXA 1XNQQ 1FR3A 2UUCL 4ZRZA 4XYOA 4R9WA 5C3EB 5C4ZA 3K5MA 3TQYA 1MJCA 1BXTA 5IYCG 1CT1D 1XTCD 2RQXA 2F0IA 4P75A 1QVCA 4G4KA 3ERSX 2ZJQA 1I4GA 1CHQD 1IYVA 1WTQA 2JA7G 1LT4D 1Q12A 2KOLA 1ASYA 2E2JB 5CMDA 1VF5C 2VS1A 3JAML 2EDGA 2EE1A 3T13A 3ERQA 4A3CG 3S1RH 1QVFA 3Q0AA 1IBLQ 3CXCA 5E3FA 2D62A 5M5YH 2XIWA 1Q86C 2JP1A 4Q5VA 2LS01 1WCMH 1VQAA 2D5DA 1N8RC 1I4PA 1JT8A 3M4PA 2K01A 1ICFB 2FINB 3S16H 1ET6A 2R92H 3VR5A 2RHSB 2IJ0A 4QJFA 5C4JB 3OHXC 3GTGB 4A3FB 4A3GG 1KAWA 3R8BA 4QUFA 1HXYD 3S1NB 1JORA 2C9OA 3NUCA 3IAYA 4L8JA 2WKCA 3HP3A 5FLXL 4K8JA 3GTQH 4RWSC 2K50A 2NVTH 2VL6A 1II3A 5IOCA 3CCEA 1VQNA 2A69C 1Q1BA 5J1ZA 4V190 5I9PA 5K36H 1EY6A 4JI6L 3WOEA 1HNZQ 4IURA 4A3EH 1GM5A 3TEHB 2B2UA 2ID0A 3HOZH 2CHBD 1SE8A 3V2TA 1TS2A 2JSOA 4KN4C 1F9PA 4Z9CB 3I56A 5LHY1 4C3IG 5H1SE 4JBWA 1IBKL 1N33Q 4OIJA 2UUBL 3W3AA 2G9HD 2RDHA 1A0IA 3NBHB 1YEZA 1STHA 5EGTA 1SROA 1SRUA 1S5CD 4DV4Q 1CQFA 3B6YA 3PUXA 2JA7H 2HIVA 1RL2A 2EYFA 3BZKA 3CCMA 2QEJC 2E2IB 1YHQA 1GUWA 3WWVA 1PTOF 1SYFA 2BCOA 2C5CA 1S4ZA 4A3CH 4QB4A 1EIHA 3E0JA 4GS3A 2DNEA 4BS9A 1MKHA 2EJMA 4J8QA 3PSIA 1KQSA 3P75A 1PA6A 5EAYA 3CCLA 4LF9L 1CZWA 2PZUA 5EJWA 1IZ6A 4L5QA 1E1OA 1E2ZA 4ZCKA 3K59A 4A3MH 1PTOC 2A6HD 3EQLC 5JJLA 3Q6SA 3VYTA 5IYDH 1MI2A 1DXMA 1E7ZA 1KAAA 1PFMA 3BDLA 3O13A 4JBMA 4DV5L 3GTLB 3OSOA 3F2BA 2UUBQ 1H9JA 1TIID 1NMFA 5IODA 2F4VL 4JPBW 1A63A 3PUZA 1ZXTA 4MTNA 4APVA 1W2BA 1QZGA 3NEMA 1VQ5A 3I90A 1MD2D 4A4IA 1KLUD 4ID6A 3HOXG 2F52A 3I4MG 4UPAA 1G51A 1WOCA 5CORA 4R4CA 4DNTB 4NXML 3J80E 2E8GA 2EXDA 2LSSA 3HZXA 3EROA 1V1PB 3ULPA 3M9BA 4LF9Q 2EVBA 1BR9A 3TP7A 3GTJH 2ZM6L 2LKVA 4C3IH 3PO3B 3KDFB 3DWPA 1HFNA 1KABA 3CC7A 1K83B 2EPBA 2WAQB 3KJPA 1U4RA 4KHPQ 2M9VA 1I6HB 1VQ6A 1L2FA 4OHJA 4DV5Q 3CC4A 3HOYH 4BA2I 3RUZA 5IP7H 5D65A 2F4VQ 3UDXA 1EYAA 1WFQA 4DR3L 2NVXH 4XIGS 1J5EQ 1E24A 1JQYD 4N8X1 1K8GA 1BBWA 5FJ8G 4F7XA 3GO5A 1TS5A 1TWAB 1I6VC 1W3SA 1B7YB 1UEAB 2Q2HA 2XVSA 1W6KA 2JA6G 3HKSA 1F2LA 2B29A 1R4PB 2F3IA 4NXMQ 2FHTA 3NENA 1EL0A 3SE0A 5CYUA 5JVG3 1CA5A 5JAVA 1M4VA 2ZM6Q 5M3FG 3CKIB 4JBJA 4DFAA 1SMYC 5A2QE 2F0JA 4LWCA 4B3RQ 1LTTD 3SEBA 4F8MA 5LL6S 3CD6A 4CDEC 1C8CA 2TSSA 3NQIA 1LT3D 1C7YA 3QJYA 2NZ1D 3TBIB 1O7LA 3HOXH 4A3IB 4JI2Q 2C35B 4OWXB 3S1RB 1PH6A 4FXKC 3RN2A 5M5YB 3OMGA 1X3FA 1WCMB 4GZYC 2WACA 1EY5A 1IL8A 3OPOA 1EY9A 1SYEA 1V9PA 3BJUA 3S16B 3HGBA 1X3EA 3J81E 1HNXL 4A3LG 4C3HG 2R92B 2VQEL 5IWAQ 3E9IA 1CSPA 3C1FA 4HAEA 1G91A 4YHHL 2I5MX 1D6EC 1CKOA 4JG2A 4K8IA 3DHQA 3K7UC 5EBDA 1RIPA 4E6IA 2H5XA 2IX1A 3GTQB 4YCUA 1PFSA 1Y8NB 2NVTB 4XQQA 3IFDA 5A35A 4RHRA 2KA7A 1SBBB 2AUKA 2F0UA 2RSOA 2Q2IA 3IKJA 4CDFC 3Q22A 3T53B 1MIUA 2PQAB 4DUYQ 3SK6A 4DR7L 4OELB 3F2CA 2JA6H 3S2HH 4WJ3M 2Z6KA 4JK1C 3S9WA 2EYPA 4A93G 3HOZB 1VQ9A 3DEPA 4ME5A 4DR4Q 2WIIB 1U0LA 2QKIC 1CSQA 5M3FH 2WV6D 1PXUA 1PTOH 3NXWA 1B53A 1Y14B 4K2KA 1C4QA 4XYQA 4LF5L 1YHAA 4YHHQ 2N88A 2DUDA 3LX0A 3NWTA 3PUWA 4ZAIA 4HR7B 2B63G 4KHZA 2DY7A 4KJOA 2JA7B 1YBYA 4HCEA 5IGDA 5GQOA 1EU4A 5ELBA 4IZ8A 5IGGA 1A2TA 4AH6A 1PTOD 1B70B 4DR6L 4DK6C 1SJHD 1KNEA 1GUTA 2LY7A 2D2CC 2F0PA 4LNQA 1IW7C 3JAMi 4A3LH 4C3HH 1NAPA 3S1MH 1T9HA 5CGKA 3I8ZA 4KI0A 3EFXD 2K5VA 4A3MB 4LFBL 3KK7A 1IL2A 2CQOA 4UP8A 1ONLA 3S15H 1H9RA 2N8NA 2XSCA 3LNNA 1ASZA 3PO2G 4LF5Q 4PV1C 2PQEA 2A19A 2Z1CA 1BF4A 3NHHA 2WKDA 5JJIA 1Z47A 2XWJB 3BG3A 4PMBA 5CV7A 1K9MC 1EFID 1UE1A 4NMZA 1PRTD 2AHOB 4R4TA 5IP9H 3OMCA 1PDQA 2F0LA 1AN8A 4CDCC 2IX3A 1VQ4A 1A6XA 3ICEA 4KY6A 3HOUG 4RH6A 4MNOA 1O7IA 3HOWB 4DR6Q 4CKBA 5IGFA 3QR8A 4YCWA 5J39A 2NUCA 2VQFL 3NSWA 1EEID 1K28A 1KRTA 3GTJB 1M8AA 4R4IA 1B50A 4C3IB 1SNMA 5HGTA 4JI5Q 1YNJC 3GQBA 1O78A 3VYRA 5GAHC 5C3WA 1X6OA 1FGUA 3A8JE 4RA8A 1Z7TA 2E74C 1Q8IA 1PH4A 1OTCA 3HOVH 4QQBX 2CW0C 3M3YH 1ENAA 3HOYB 1TWHH 2B2VA 1CK1A 2A1AA 4LF8Q 2XTIA 2NVXB 2WB1E 3HRZC 3L3OC 2IPKD 1X65A 2A6ED 2JK8A 2KEDA 3A8IE 1JE5A 2EY2A 1STEA 1TKWB 2HDMA 1MSHA 2NVYH 1EY8A 4ME3A 5CV8A 3M4YA 4PZ7A 1QZHA 2Q2TA 3UE0A 1QB5D 2EYOA 3W5OA 1KTKA 2VQFQ 5KGUA 2ASBA 1STAA 3HEJA 2VNUD 1LTBD 1JCKB 1WTXA 3GTMB 3MZ5A 1EY0A 1V8QA 3T1HL 1SFOH 4ILWA 1F9SA 1HUMA 2JA5G 1YJNA 5BN4A 4GNXC 3K5NA 1QJOA 1BCPC 2F3VA 5NUCA 4DXFA 3FPPA 4X62Q 2KBNA 3MXNA 4WJ4A 1X55A 2H4OA 1XMOQ 2ZTEA 1YJWA 4X3KA 4HIKA 3C3LA 2HCCA 3HOXB 3CCJA 5JEAJ 1HZCA 5C0XG 3S2DH 1YIJA 1JWMD 3J80L 4HJ7A 5KRUA 4A3BG 1W6JA 3X3MA 1LUZA 1TWCH 5IGEA 2DN8A 3K8AA 3E9HA 5DAUA 2PNRC 1HUNA 4OXPA 1E0BA 5IT9c 2AMCB 4POFA 1DOKA 4LF4L 4IFDH 2CQAA 5FLMH 4DV3L 2PCFB 5CBEE 4DV0L 4DV7L 1Z9FA 4DF7A 3T1HQ 2BOSA 1CQVA 3H3VI 5E4XA 5M5XH 4U673 1EWCA 4IQZA 3U9SA 4LMQD 3GV3A 3SK8A 2PMZB 1ENFA 1WI5A 1VQEA 4NPSA 5DNFA 1X3QA 2F1MA 2B2WC 2Z8LA 1LTGD 1PH7A 1STNA 3OW7A 2JA6B 3S2HB 1AEXA 4IPCA 5I2XA 1PH1A 2PYKA 5EQ0A 1SYDA 2F0MA 1HNWQ 1G2TA 4X64Q 1VQHA 3TZDA 1RDPD 4TKOB 3D4RA 4QL5A 5A2QL 5M3FB 1RF2D 1PTOB 4OO1I 4KKSA 3A5ZB 1YNND 2JA5H 4DUZL 1QOHA 3H0GG 2IHFA 4BBSH 1G2SA 4XTCS 3Q24A 3G7LA 3T1YL 4XT1B 4DV3Q 4DV7Q 1NR4A 2EZVA 1TWFH 4JVZA 1ZYRC 2KVMA 3IL8A 1Y8PB 2QCPX 5C0XH 3TDQA 3KBGA 3JAMc 3MC0B 2XGTA 2LXKA 3A7AB 4IFDJ 4C3HB 3S1MB 1UE7A 2V1CC 4IPHA 2F03A 3DM1A 5C4HA 2EIFA 4ZKCB 2I5HA 5C4XG 1PZKD 4TRDA 2JA8G 4X3TA 1D5MC 1GOZA 2QGQA 3L2PA 3AU7A 3K5OA 1VF7A 3M85A 3EN2A 4DUZQ 1BBUA 1U4PA 2XRQD 1LYLA 1TY0A 1NMGA 1S5DD 2AUJD 3RLOA 5FLXc 4JI4L 3HKZG 1WD0A 1TT2A 2V4DA 3DMUA 3F1ZA 1N9WA 1HQRD 1VQ7A 2A68C 2D0OA 1SJED 1LTAD 1SNQA 5FO9B 1LM0A 3Q8DA 4IALA 1H9SA 3AFQA 1XX8A 3STBD 1YJ9A 1BBXC 3CP0A 2BH8A 2CW0D 1HA5A 1K3RA 1KXLA 1STGA 1EUJA 4A3KG 4JI7L 1EQRA 4ZQ3A 2F0SA 4X3SA 1PYWD 5T1IA 5I4DA 4M1UB 1S72A 1EYDA 1PZID 3KLWA 2N49A 1AZQA 1X56A 4H02A 4YWMA 5CBAE 2UUCQ 1AW7A 5GROA 3HOVB 4GOPC 3M3YB 3VR3A 1QUQA 4BBRH 2K75A 2LFNA 3P1HA 4HMIA 2FXQA 3H09A 3NE5B 3G6EA 3NP8A 1SSOA 1X9NA 1TWHB 3OYYA 5M3MG 1A62A 1I4HA 3EIVA 1QWYA 1K8MA 5I2YA 4JI4Q 3NTIA 1SLJA 2Z6KC 4HJ5A 2VZAA 2NVYB 5E1FA 2K5DA 3DLLA 1G291 4IOCA 2PZTA 2SDFA 1NE3A 2L4NA 4P73A 1Y1VG 1H9KA 2FJ2A 5EPLA 1SFOB 4R8NA 5IYCH 1MBYA 2EJGC 4HSPA 4GN3B 1HZ9A 3TP5A 4GNXA 2R93G 3FDTA 1OXVA 1SEBD 1YNXA 2PW5A 2PNHA 4X65L 4DAVA 1NNXA 4DAPA 1EIYB 2H1EA 4J6HA 1S5FD 3S2DB 2JN4A 4DK1A 3KOJA 1Q81C 4JI6Q 3GV6A 4JYAL
chains in the Genus database with same CATH topology
4NDXA 3BS1A 1TWCB 4O1NA 1WTWA 4H13C 2SNMA 1RKNA 2K1BA 2F0DA 4YIJA 1GUGA 1PMRA 4WORA 1JC7A 1JR0D 3VA5A 5M5XB 3BVZA 1EY4A 5EKLA 1WTOA 1L0XB 2B2TA 3D3RA 2XWBB 2IWHA 1SAPA 3PV0A 2PW7A 1O80A 4K14A 2B2WA 5C6AA 1JOKA 2J7ZA 5DEHA 3K5LA 1DONA 4G7HC 2F4IA 4HEDA 2B8FA 1ZYRD 1TS4A 5KNCA 2JA5B 4HCSA 4BBSB 3K7AB 2AWNA 1DZ1A 2B2VC 3I73A 2L0CA 3QOLA 3MA2B 1DM0B 2X69A 1TWFB 4B9WA 2JEBI 1LACA 1LLRD 2XN9C 4NW2A 4CJ0B 4RGOS 1HTLD 4IUPA 2MHVA 3GP7A 1TR5A 1H9SB 3AMUA 3EJIA 3U9OA 4QIWB 4IUTA 5DM73 1ZEQX 3BVMA 2MJ8A 2EOTA 4KHVA 2FFKB 2VXWA 3RMHA 3SK5A 5IGBA 2K05A 2MUYA 4EVOA 1J9OA 1EWHA 3BVGA 1DYQA 5IT9E 3LWUA 1X3PA 3KBXA 1ESRA 3TZUA 5JVH3 1SYGA 3E6ZX 4RCOA 1B4OA 3QOJA 1SE3A 1U4MA 4AYBB 4DGZA 2NN6I 3DXJC 3G6JB 4FP5D 1BO0A 2EJFC 5KYIA 2A69D 4ULLA 4LAAA 3L7ZC 3A8KE 1LT6D 5D3DA 3W2DA 1BCPB 1EU3A 4BBRB 1BOSA 2KECA 4OGQC 1DOMA 2NBFA 3FVQA 3TP6A 2Q8TA 1HRJA 2L1BA 1Y69U 3I91A 1WD1A 4C56C 3ND9A 4A3EB 2EYHA 2HQEA 4C3JG 3HG9A 2J4XA 1KNAA 3R3OA 3BDOA 2J0TD 4G7OC 1GUOA 5EKIA 4KV6A 2EY6A 3MXUA 5G3LF 5I6WA 1STBA 1B9NA 3EA6A 4FF1A 1HTPA 2NB0A 2F0FA 2M2LA 1Q90A 5I9OA 4KY5A 2EY5A 1MGSA 4HTHA 3MFYA 5JEAG 3HKZB 1LT5D 5ISRA 3SXHA 5C3XA 3CRKC 4ABNA 4HN7A 4K6DA 1RD9D 3R2IA 1NCVA 3KF8A 1B1ZA 1E2WA 1A15A 3D4DA 1LTID 5FLXE 3A7LA 4FVMA 1TWGB 2K32A 4A3GB 4K6LA 3FMCA 1KDAA 3NWSA 1AP0A 3VR2A 1TQOA 1ML0D 2AQ3B 1D1KA 4F88A 1XYIA 1DCZA 4OIKA 1SNDA 2RSNA 4ODGA 2F0WA 2F0VA 2E76C 3TSSA 5TSSA 4OL7A 1D2BA 4CGYB 1F9RA 1HPCA 3BZDB 4FYDA 1LV9A 1RCVD 3KLSA 2SOBA 3ONAB 2OF1A 4K5VA 4V0BA 4L6TB 3VA7A 3E5SA 1HQMC 4EGVA 2X6GA 1FYCA 1QE6A 1DD2A 2HDLA 3NBIA 5IIFA 2MP1A 2NYZD 1BDOA 1B2TA 2R93B 1TS3A 2XNAC 4ZUIA 2RVLA 5D14A 5BN3A 4I7ZC 1EQVA 2R61A 3K57A 4MIUA 1SXTA 1BCPF 1SMYD 3WDNA 4DN4M 2F0KA 4KTAA 4DXGA 4RCNA 5BN5A 1RTOA 4PNYA 4CKCA 2K6AA 3TP8A 3GTKB 4BA1I 2L12A 4S3SA 2LMCB 2PO4A 3KUPA 1LTRD 2EYJA 2BDOA 3I4MB 2MPMA 1FNWA 3VR6A 4IFDI 5M9OA 3RZOB 5FO7B 1F2YA 1I4RA 1EY7A 1ET9A 4OO1G 4J1MA 5EBCA 3KLRA 2F0QA 2ZXPA 3EVQA 1KDBA 2HUGA 1EOTA 1PZJD 4CKEA 1D5XC 1LABA 1Y8OB 4IUQA 3PUVA 2DNCA 2SEBD 2B2TC 5ELEA 1JWUD 1PFNA 4XDXA 2KCCA 3NQTA 2A73B 3QWNA 5EPKA 2A6HC 4XT3B 5HURA 5KIXA 3GTOB 4G7ZC 4KY7A 3WOFA 5G3LD 4KN7C 3I70A 4MN3A 4RAUC 1R4QB 5JPNC 3I72A 4C1NI 3UI2A 4ZLTF 5KNDA 1O7YA 5IT9L 4XQNA 1IW7D 4QF4A 3T16A 1ILQA 2K03A 3RD4A 4HMJA 3J7YW 4B08A 2L11A 3OOCA 5C5MA 2K33A 2VB3X 2A74C 3J81L 4CHTB 1D1IA 1O7ZA 2B2YC 3VYSA 1VDZA 4F87A 4K2LA 2AQ1B 1CI3M 2BA1A 3S15B 3NK9A 4QCLA 5D3IB 3H94A 1V1PA 2IT1A 3D6CA 1AZPA 1CM9A 3OWEB 1DOLA 2NVQB 1A2UA 1ESFA 4DA2A 1A3TA 2JXMB 3Q23A 4H7BA 1WTRA 1YNJD 4C3JB 1EZ6A 3V05A 4DK0A 3MHBA 1AFPA 1D5ZC 1HHVA 2DY8A 1UNSA 2JE6I 4A93B 2EYMA 4FXDA 2KCNA 2F0EA 5IGCA 4TSSA 4ZKBB 5ELCA 1K8OA 4DNRB 3CRLC 2RA4A 5KEEA 1GHKA 3FKIB 5C0XJ 2GA4B 2B63B 1G8ZD 2KJXA 1UAPA 5I6YA 1VMPA 1IHZA 3P20A 1IKLA 2L9HA 1IYUA 2RKSA 1OXTA 2IL8A 3CHBD 1GHJA 5AFWA 1BNZA 4ZUJA 4XQJA 3I3CA 1BCPD 2N55A 2R6GA 2AWOA 1SNOA 2PPBC 4IN3A 2BE5C 2ICIA 2RDGA 3PO2B 4RKLA 3MXPA 2PZWA 3BYTB 2NWGA 3MWYW 5C5LA 4IUUA 4LJZC 1F77A 1RHPA 3DEOA 4R8IA 4MHEA 1JICA 4B9XA 4I65A 3HOUB 3CU7A 1HA6A 4EQPA 3BDCA 1OXUA 2ICEC 2WP8J 3SR1A 4L63B 1ICWA 2QDBA 1SE4A 4FF3A 1JE4A 2FMCA 2HCIA 3X3NA 1CA6A 3D31A 2FMMA 4CJ2C 2AQ2B 2JYOA 5JJZA 2M00A 1U9RA 2SNSA 1GXDC 3A54A 1PLFA 5CV9A 2KEEA 3K6OA 2KUMA 1NUCA 4WFN3 3K58A 1B44D 1Y1WB 3OIQA 4TQUS 1PRTF 3MFGA 2IX0A 1LTSD 2F0GA 3MEHA 4M8AA 3C2PA 2B39A 2O2LD 2F0NA 3SK4A 3ITPA 1QNKA 3KLSX 1Q3LA 1PRTC 1T5EA 1CZGA 1CHPD 1SDFA 5JPMC 5EPJA 3I4NB 4BY7B 3PMFA 4A3BB 1WTPA 4FF4A 2NN6G 2IW3A 2WB1B 4N9PA 2B2YA 5M5WB 4U68A 4XXEA 2F0OA 3J7AV 2OEOA 3D8GA 1B9MA 1R9TB 2A68D 1ILPA 3DWQA 1I4XA 1SNCA 2A6EC 1GUNA 5COYA 4CJ1B 4EQNA 1S5BD 2K7VA 3SHLA 1QG7A 3T51B 4QUCA 2YU9B 2EXZA 5CV4A 2O4XA 1I3QB 4N9TA 5T1GA 1C48A 3MAQA 4FXGC 5CC4A 3MXGA 3PIP3 3ZYYX 4IUNA 1OXSC 3H0GB 3SVMA 2G9DA 3T56B 2I46A 2E2HB 3N52A 1V1OA 3PUYA 2K5QA 4NKLA 3NPPA 2NN6H 2O5JC 2BE5D 3J7AF 2XRSD 2KQ3A 4K5WA 4KK7A 2D9UA 5J22A 4IUVA 5C4XB 1RODA 3JAME 2JA8B 1A3VA 3FEWX 2Q8IB 2CVRA 2K04A 4BWGB 1QCBD 4RFBA 3D6WA 3R2TA 1TY2A 4RGTA 1JOQA 3PIO3 3M4OB 4DAYA 1VCIA 4PMWA 2K5WA 1RTNA 1IKMA 2ZXOA 3AB9A 2RDFA 5ELDA 5ELFA 4A3KB 1Q1EA 4P2CB 1CTMA 1YNNC 5E4WC 3F2UA 3QG1A 1F9QA 3LWEA 3H3VC 2ZXRA 2Z4IA 4NP5A 1JOOA 1TU2B 2NTTA 3DUZA 2TMPA 3H6MA 5JOBA 3BYYB 5M3MB 3V96A 1EYCA 5FOBB 2F0TA 2R3ZA 4UAIA 1VMCA 4KD4A 4KJNA 1EIGA 4X3UA 1JWSD 3SDZA 3CQZB 5K5PA 1QILA 1DJRD 5EKKA 2WINB 1OXXK 2EY1A 3T4AC 4G57A 3VR4A 4KMUC 4H0LC 1Y1VB 4PMCA 1KDCA 3NTKA 3A56A 3OWFA 4QMGA 1EQTA 1FNVA 2VB2X 5JEAH 3I4LA 3QB3A 2F0HA 4IFDG 1WTVA 1GJXA 1TVXA 1U4LA 5DM63 4KKTA 4C1NK 1Z6HA 2ZT9C 2NTSA 4BY1B 5KYLA 2Z4HA 3GD7A 2B2UC 3TMEA 1I50B 2L55A 2RBMA 3C1EA 2QF7A 3S1QB 2E75C 2JEAI 4ZK9B 3GTPB 3N6RA 2I07B 4RGNA 3ND8A 1H9MA 2BDNA 2A5HA 3NTHA 4FNFA 4C2MB 1QNUA 3TN2A 1EZ8A 2BA0A 5CV6A 3C46A 4FO2A 4LK1C 4RHSA 4KD3A 2O5IC 4KKUA 2X6LA 2MGSA 1XWEA 4RKBA 1GUSA 4ZYSA 1T5XD 1ZKOA 1STYA 4K5XA 1E2VA 4WJWA 1G6ZA 3FPUB 3R93A 4WRDA 2ENBA 2OT2A 4EQOA 1EEFD 3K0YA 3H91A 1NR2A 1SYCA 4A3DB 2Q8RE 1F2ZA 2R7ZB 1F2MA 1UUPA 3QIAA 5LL6X 4RGMA 3MVVA 3NBHA 3P7JA 2QILA 3VYUA 4Q0FA 2KHSA 3A55A 4A3JB 3IFTA 3M7NA 2Y0SB 1NSNS 1LO5D 3RLFA 1HFGA 2E2DC 3D4WA 1BQQT 1RJTA 5CV5A 5C0XI 1X32A 4Y7NB 4CBVA 4H44C 1J8IA 1WVLA 4DU9A 1MSGA 2K28A 5F2DA 1SYBA 3OIPA 2L5TA 1ENCA 1HCZA 2VUMB 5KNBA 2OXPA 1FGBD 3HS0C 1SNPA 1JB3A 1FNUA 1XXGA 1PFBA 1V43A 2F3WA 3S14B 2YYZA 3QO2A 3M7GA 5FK9C 4OO1H 1CFMA 1A3UA 1BUVT 2B8GA 5C44B 5K36G 4UDUC 1S5ED 2EYLA 4O42A 1FD7D 1L0YB 3FRPB 1KLGD 3URYA 5FO8B 3MTSA 1B3AA 1OO9B 5CR3A 1I4QA 4HSVA 3DWAA 3L9AX 3S17B 1SE2A 4FF2A 5FKAC 1PRTB 3RZDB 4PQXA 1FR3A 4ZRZA 4XYOA 4R9WA 5C3EB 5C4ZA 3K5MA 1BXTA 1CT1D 1XTCD 2RQXA 2F0IA 4G4KA 1I4GA 1CHQD 1IYVA 1WTQA 1LT4D 1Q12A 2KOLA 2E2JB 5CMDA 1VF5C 3JAML 2EDGA 2EE1A 3T13A 3ERQA 3Q0AA 5E3FA 2D62A 2XIWA 2JP1A 4Q5VA 2LS01 2D5DA 1I4PA 2K01A 2FINB 1ET6A 3VR5A 5C4JB 2IJ0A 3OHXC 3GTGB 4A3FB 3R8BA 4QUFA 1HXYD 3S1NB 1JORA 2C9OA 3NUCA 3IAYA 4L8JA 2WKCA 3HP3A 5FLXL 4K8JA 4RWSC 1II3A 5IOCA 2A69C 1Q1BA 5J1ZA 4V190 5I9PA 5K36H 1EY6A 3WOEA 4IURA 2B2UA 2ID0A 2CHBD 3V2TA 1TS2A 2JSOA 4KN4C 1F9PA 4Z9CB 5LHY1 4C3IG 4JBWA 4OIJA 3W3AA 2G9HD 2RDHA 1STHA 5EGTA 1S5CD 1CQFA 3PUXA 2EYFA 2QEJC 2E2IB 1GUWA 1PTOF 1SYFA 2BCOA 2C5CA 1S4ZA 4QB4A 1EIHA 3E0JA 2DNEA 4BS9A 2EJMA 4J8QA 3P75A 1CZWA 2PZUA 5EJWA 1E2ZA 3K59A 1PTOC 2A6HD 3EQLC 3Q6SA 3VYTA 1MI2A 1DXMA 1KAAA 1PFMA 3BDLA 3O13A 3GTLB 3OSOA 1H9JA 1TIID 5IODA 3PUZA 1ZXTA 3I90A 1MD2D 1KLUD 4ID6A 5CORA 4DNTB 3J80E 3HZXA 3EROA 1V1PB 2EVBA 1BR9A 3TP7A 2LKVA 3PO3B 3DWPA 1HFNA 1KABA 1K83B 2EPBA 2WAQB 1U4RA 2M9VA 1I6HB 4OHJA 4BA2I 3RUZA 5D65A 1EYAA 4XIGS 1JQYD 4F7XA 3GO5A 1TS5A 1TWAB 1I6VC 1UEAB 2XVSA 1W6KA 1F2LA 1R4PB 2FHTA 1EL0A 3SE0A 5CYUA 5JVG3 1CA5A 5JAVA 1M4VA 3CKIB 4DFAA 1SMYC 5A2QE 2F0JA 1LTTD 3SEBA 4F8MA 5LL6S 1C8CA 2TSSA 3NQIA 1LT3D 3QJYA 2NZ1D 3TBIB 1O7LA 4A3IB 3S1RB 4FXKC 5M5YB 3OMGA 1WCMB 4GZYC 2WACA 1EY5A 1IL8A 3OPOA 1EY9A 1SYEA 3S16B 3HGBA 3J81E 2R92B 4C3HG 3C1FA 4HAEA 1G91A 1D6EC 4K8IA 3DHQA 5EBDA 4E6IA 2IX1A 3GTQB 1Y8NB 2NVTB 4XQQA 3IFDA 5A35A 4RHRA 2KA7A 1SBBB 2AUKA 2F0UA 2RSOA 3IKJA 3Q22A 3T53B 3SK6A 4JK1C 3S9WA 2EYPA 3HOZB 3DEPA 4ME5A 2WIIB 2QKIC 2WV6D 1PXUA 1PTOH 3NXWA 1B53A 4K2KA 1C4QA 4XYQA 2N88A 3NWTA 3LX0A 3PUWA 4ZAIA 4HR7B 4KHZA 2DY7A 4KJOA 2JA7B 4HCEA 5IGDA 1EU4A 5ELBA 4IZ8A 5IGGA 1A2TA 1PTOD 1SJHD 1KNEA 1GUTA 2LY7A 2D2CC 2F0PA 1IW7C 1NAPA 5CGKA 3I8ZA 4KI0A 3EFXD 4A3MB 3KK7A 1ONLA 1H9RA 2XSCA 3LNNA 4PV1C 2PQEA 2Z1CA 1BF4A 3NHHA 2WKDA 1Z47A 2XWJB 3BG3A 4PMBA 5CV7A 1EFID 4NMZA 1PRTD 3OMCA 1PDQA 2F0LA 1AN8A 2IX3A 1A6XA 4KY6A 4RH6A 3HOWB 4CKBA 5IGFA 5J39A 2NUCA 3NSWA 1EEID 3GTJB 1M8AA 1B50A 4C3IB 1SNMA 5HGTA 1YNJC 3GQBA 1O78A 3VYRA 5C3WA 3A8JE 4RA8A 1Z7TA 2E74C 1Q8IA 2CW0C 1ENAA 3HOYB 2B2VA 1CK1A 2NVXB 3HRZC 3L3OC 2IPKD 2A6ED 2KEDA 3A8IE 2EY2A 1STEA 1TKWB 2HDMA 1MSHA 1EY8A 5CV8A 3M4YA 1QB5D 2EYOA 1KTKA 5KGUA 1STAA 3HEJA 2VNUD 1LTBD 1JCKB 1WTXA 3GTMB 3MZ5A 1EY0A 1V8QA 4ILWA 1F9SA 1HUMA 5BN4A 3K5NA 1QJOA 1BCPC 2F3VA 5NUCA 4DXFA 3FPPA 3MXNA 2H4OA 4X3KA 3C3LA 2HCCA 3HOXB 5JEAJ 5C0XG 1JWMD 3J80L 5KRUA 1W6JA 3X3MA 5IGEA 2DN8A 5DAUA 2PNRC 1HUNA 1E0BA 1DOKA 4IFDH 2CQAA 2PCFB 5CBEE 4DF7A 2BOSA 1CQVA 5E4XA 4U673 1EWCA 4IQZA 3U9SA 4LMQD 3GV3A 3SK8A 2PMZB 1ENFA 5DNFA 1X3QA 2F1MA 2B2WC 2Z8LA 1LTGD 1STNA 3OW7A 2JA6B 3S2HB 1AEXA 5I2XA 2PYKA 5EQ0A 1SYDA 2F0MA 1G2TA 3TZDA 1RDPD 4TKOB 3D4RA 5A2QL 5M3FB 1RF2D 1PTOB 4OO1I 4KKSA 1YNND 1QOHA 1G2SA 4XTCS 3Q24A 3G7LA 4XT1B 1NR4A 2EZVA 1ZYRC 2KVMA 3IL8A 1Y8PB 2QCPX 5C0XH 3TDQA 3KBGA 3MC0B 3A7AB 4IFDJ 4C3HB 3S1MB 2F03A 3DM1A 5C4HA 4ZKCB 1PZKD 4TRDA 4X3TA 1D5MC 1GOZA 3AU7A 3K5OA 1VF7A 3M85A 1U4PA 2XRQD 1TY0A 1S5DD 2AUJD 1WD0A 1TT2A 2V4DA 3DMUA 1HQRD 2A68C 1SJED 1LTAD 1SNQA 5FO9B 4IALA 1H9SA 1XX8A 1BBXC 2CW0D 1HA5A 1STGA 4ZQ3A 2F0SA 4X3SA 1PYWD 5T1IA 5I4DA 4M1UB 1EYDA 1PZID 1AZQA 5CBAE 1AW7A 3HOVB 3M3YB 3VR3A 2LFNA 3P1HA 4HMIA 3H09A 3NE5B 3NP8A 1SSOA 1TWHB 1I4HA 1QWYA 1K8MA 5I2YA 3NTIA 2NVYB 5E1FA 2K5DA 1G291 2PZTA 2SDFA 2L4NA 1H9KA 2FJ2A 5EPLA 1SFOB 4R8NA 1MBYA 2EJGC 4HSPA 3TP5A 3FDTA 1OXVA 1SEBD 2PW5A 4DAVA 4DAPA 2H1EA 4J6HA 1S5FD 3S2DB 4DK1A 3GV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCV A;  1SDF A;  5EPJ A;  4CJ2 C;  1ROD A;  1U4P A;  2FFK B;  2VXW A;  3I90 A;  1WTW A;  1A15 A;  1HFG A;  2K05 A;  4QUF A;  4HAE A;  1RJT A;  1WTP A;  1J9O A;  1HUN A;  1G91 A;  2L12 A;  1WTV A;  2CVR A;  2NWG A;  3MWY W;  1O7Z A;  1E0B A;  2K04 A;  1PDQ A;  3KUP A;  2B2Y C;  1X3P A;  2K1B A;  3HP3 A;  1TVX A;  1WD0 A;  1X32 A;  3KBX A;  4IUU A;  1ESR A;  1DOK A;  5COR A;  1U4L A;  4RWS C;  1RHP A;  3DEO A;  2MPM A;  4R8I A;  1AP0 A;  3D6W A;  4IUV A;  1J8I A;  1B4O A;  2B2Y A;  4MHE A;  5CBE E;  1JIC A;  1U4M A;  1ML0 D;  4U68 A;  1XX8 A;  1WVL A;  1BBX C;  3IFD A;  1MSG A;  1M8A A;  2K28 A;  5E4X A;  1HA6 A;  1XYI A;  1HFN A;  4OIK A;  1B50 A;  2EPB A;  1BO0 A;  2B2U C;  2RSN A;  4LMQ D;  1U4R A;  3GV3 A;  1ILP A;  1RTN A;  4X3S A;  2RSO A;  4IUR A;  5T1I A;  1IKM A;  1PFB A;  5DNF A;  1X3Q A;  1WTO A;  4RA8 A;  1AZP A;  2B2U A;  4ZK9 B;  1CM9 A;  2B2T A;  2B2W C;  1DOL A;  1AZQ A;  1F9R A;  1BF4 A;  1SAP A;  5COY A;  1LV9 A;  3QO2 A;  1F9P A;  5D65 A;  5CBA E;  4CJ1 B;  2HUG A;  1EOT A;  1QG7 A;  3F2U A;  5E4W C;  1WTR A;  2BDN A;  3DEP A;  1ICW A;  1O80 A;  3ONA B;  4QUC A;  2B2W A;  1F9Q A;  2J7Z A;  3LWE A;  2B2V A;  4OIJ A;  5EQ0 A;  1G2T A;  1DON A;  1SSO A;  1HHV A;  4IUQ A;  3TZD A;  2DY8 A;  2KEC A;  4O42 A;  1JE4 A;  3TN2 A;  1B53 A;  1DOM A;  2HCI A;  2KED A;  2Q8T A;  1HRJ A;  2X6G A;  5T1G A;  2L1B A;  2B2T C;  1CA6 A;  3MTS A;  2FMM A;  1B3A A;  4ZKB B;  4HED A;  2N88 A;  2HDM A;  1MSH A;  4ZAI A;  1PFN A;  1QE6 A;  1F2L A;  2JYO A;  2X6L A;  3I91 A;  2MGS A;  2HDL A;  4HSV A;  5JJZ A;  4XDX A;  1G2S A;  1WD1 A;  4HCS A;  2FHT A;  3G7L A;  2DY7 A;  2MP1 A;  1GUW A;  4XT1 B;  2RA4 A;  2R3Z A;  1EL0 A;  4UAI A;  1S4Z A;  1DZ1 A;  2B2V C;  1PLF A;  1VMC A;  1EIH A;  1CA5 A;  2NYZ D;  1KNA A;  1EIG A;  1NR4 A;  2KEE A;  4X3U A;  1B2T A;  3SVM A;  2KUM A;  5EPK A;  5EKI A;  2SDF A;  2X69 A;  4R9W A;  1G6Z A;  2KVM A;  3IL8 A;  2RVL A;  1WTX A;  4XT3 B;  4NW2 A;  3FPU B;  3R93 A;  4CJ0 B;  1KNE A;  2L4N A;  1VMP A;  5EJW A;  5D14 A;  1F9S A;  1HUM A;  3N52 A;  2FJ2 A;  5EPL A;  1IKL A;  1WTQ A;  3H91 A;  2KOL A;  1NR2 A;  4IUP A;  5CMD A;  1C8C A;  1NAP A;  2L9H A;  2Q8R E;  4MN3 A;  4RAU C;  2EE1 A;  4DN4 M;  2NZ1 D;  2IL8 A;  2M2L A;  3I8Z A;  3Q6S A;  5AFW A;  3UI2 A;  1BNZ A;  4ZLT F;  4X3K A;  1MI2 A;  3FDT A;  3I3C A;  1O7Y A;  1PFM A;  2HCC A;  2XIW A;  3DM1 A;  2JP1 A;  1MGS A;  4IUT A;  3P7J A;  4ZKC B;  1QNK A;  2N55 A;  1RTO A;  1EQT A;  1ILQ A;  1Q3L A;  2H1E A;  2K03 A;  2K01 A;  4X3T A;  2FIN B;  1IL8 A;  2MJ8 A;  2EOT A;  2D9U A;  3GV6 A;  1ZXT A;  2L11 A; 
#chains in the Genus database with same CATH topology
 4UP9 A;  4NDX A;  1YI2 A;  3BS1 A;  1KL9 A;  1TWC B;  4O1N A;  1WTW A;  3AEV A;  1PH5 A;  1TWG H;  4H13 C;  4A3G H;  4ALP A;  2SNM A;  1RKN A;  2K1B A;  4X66 L;  2F0D A;  4BY1 G;  1UE6 A;  4YIJ A;  1IBK Q;  1GUG A;  4DKA C;  2HT1 A;  4DR1 L;  4NXN L;  1PMR A;  1K3B C;  4WOR A;  1JC7 A;  1JR0 D;  3VA5 A;  5M5X B;  1N32 L;  1IXR A;  3BVZ A;  1EY4 A;  5EKL A;  1IYJ B;  1UWV A;  5BR8 L;  1WTO A;  3KF6 A;  1L0X B;  2B2T A;  3D3R A;  2XWB B;  2Y0S E;  2WFW A;  2IWH A;  1SAP A;  3PV0 A;  2PW7 A;  4R1J A;  1O80 A;  3F8T A;  4K14 A;  2B2W A;  5DLQ E;  5C6A A;  1JOK A;  2J7Z A;  5DEH A;  3K5L A;  1YIT A;  1DON A;  3ZJY C;  2DJF C;  1NY4 A;  4QGU A;  2RF4 A;  4G7H C;  3I4O A;  2F4I A;  4HED A;  2B8F A;  1ZYR D;  1TS4 A;  4X66 Q;  5KNC A;  2JA5 B;  3JC6 6;  4MTK A;  4HCS A;  4JI3 L;  4BBS B;  3K7A B;  2AWN A;  1DZ1 A;  2B2V C;  3I73 A;  2R93 H;  5IY0 A;  5HY6 A;  2L0C A;  3QOL A;  3A5U A;  4DR1 Q;  4NXN Q;  3MA2 B;  1DM0 B;  2X69 A;  1TWF B;  4B9W A;  2JEB I;  4P71 A;  4A3D G;  1LAC A;  1LLR D;  2XN9 C;  4NW2 A;  4CJ0 B;  1QVG A;  4RGO S;  4RG1 A;  2R7Z G;  1FJG L;  1HTL D;  3NEL A;  4IUP A;  2MHV A;  3GP7 A;  1TR5 A;  4LUZ A;  1H9S B;  2G5D A;  3AMU A;  2HHH L;  3AYH B;  3BU2 A;  3UDF A;  3EJI A;  2UXB L;  1X3G A;  3U9O A;  4A3J G;  4QIW B;  4IUT A;  4OWT B;  3J80 i;  2Y0S G;  4EQ5 A;  1PH2 A;  5DM7 3;  1ZEQ X;  3BVM A;  2DGY A;  2MJ8 A;  4JI8 L;  2EOT A;  1FVI A;  1UEB A;  4KHV A;  3RR5 A;  3GTK H;  2FFK B;  2VXW A;  4JOI C;  3RMH A;  3SK5 A;  5IGB A;  2K05 A;  2MUY A;  4EVO A;  1J9O A;  1EWH A;  3GTP H;  3BVG A;  2CFM A;  1DYQ A;  4IOA A;  5IT9 E;  3LWU A;  1X3P A;  4AIM A;  3KBX A;  3I4M H;  1ESR A;  3TZU A;  5JVH 3;  1SYG A;  3E6Z X;  4DR3 Q;  3TRZ A;  4RCO A;  1B4O A;  3QOJ A;  1SE3 A;  3U4Z A;  2VUM G;  1U4M A;  3RLN A;  4PG3 A;  4AYB B;  1FJG Q;  4DGZ A;  3PIP A;  2NN6 I;  3DXJ C;  3CME A;  3G6J B;  1PVO A;  4FP5 D;  1BO0 A;  4R4O A;  3RZO H;  2EJF C;  1HH2 P;  5KYI A;  1PH9 A;  4IJL A;  4GLV B;  4DR2 L;  3J81 j;  2A69 D;  4ULL A;  4LAA A;  1VQK A;  3L7Z C;  3A8K E;  1LTL A;  1LT6 D;  5D3D A;  3W2D A;  4KLK A;  1BCP B;  1YZ6 A;  1EU3 A;  1GD7 A;  4BBR B;  1BOS A;  2KEC A;  3TRE A;  4OGQ C;  1DOM A;  2NBF A;  3FVQ A;  3TP6 A;  4GOP A;  2QW7 A;  2Q8T A;  2AKW B;  1HRJ A;  2L1B A;  1M1K C;  4N8F A;  5FJ8 H;  1Y69 U;  3I91 A;  1WD1 A;  4C56 C;  3ND9 A;  4A3E B;  2EYH A;  2HQE A;  2JQO A;  4C3J G;  5C3E G;  1JMC A;  3HG9 A;  3FHW A;  1MHW C;  3ULJ A;  2J4X A;  1KNA A;  3R3O A;  3BDO A;  1N34 L;  2J0T D;  4G7O C;  1GUO A;  4HID A;  1M90 C;  5EKI A;  1XNR L;  4KV6 A;  2EY6 A;  3MXU A;  5G3L F;  5I6W A;  1HNX Q;  3GTO H;  2VQE Q;  1STB A;  5IYB G;  4DR2 Q;  2N78 A;  4GLX A;  1VQM A;  1B9N A;  3EA6 A;  3FKI G;  4FF1 A;  2KHJ A;  1VQ8 A;  1HTP A;  2NB0 A;  2F0F A;  1BVS A;  2M2L A;  1XMQ L;  4B3S L;  1Q90 A;  5I9O A;  3LGJ A;  4KY5 A;  2EY5 A;  1MGS A;  4HTH A;  3MFY A;  5JEA G;  4B3M L;  3HKZ B;  4A3F G;  1LT5 D;  5ISR A;  3SXH A;  3KF6 B;  5C3X A;  3CRK C;  4ABN A;  4HN7 A;  4K6D A;  1RD9 D;  3R2I A;  1NCV A;  2DJG C;  2CWP A;  3KF8 A;  1B1Z A;  4OON A;  1E2W A;  5GAG C;  1A15 A;  3D4D A;  1E22 A;  4DR7 Q;  1LTI D;  5FLX E;  3PQI A;  3A7L A;  4FVM A;  1V1Q A;  1TWG B;  2K32 A;  4A3G B;  4K6L A;  3FMC A;  1KDA A;  3NWS A;  1AP0 A;  4POG A;  3VR2 A;  1TQO A;  1ML0 D;  2AQ3 B;  1D1K A;  4F88 A;  4K0K L;  4DPG A;  2QA4 A;  1CUK A;  1PHJ A;  2P5Z X;  1DCZ A;  1XYI A;  4OIK A;  2CH4 A;  1VQI A;  1SND A;  2RSN A;  4ODG A;  2YTY A;  2KEN A;  2F0W A;  2I0Q A;  4B3S Q;  1HZB A;  2F0V A;  1EWI A;  2NVQ H;  2YTX A;  2E76 C;  3TSS A;  5TSS A;  4OL7 A;  1D2B A;  4CGY B;  2OCE A;  4B3M Q;  1F9R A;  1HPC A;  3BZD B;  4OX9 L;  4FYD A;  1LV9 A;  1RCV D;  4C3J H;  3KLS A;  2SOB A;  3J7A 5;  3ONA B;  4HIM A;  2OF1 A;  4A93 H;  4K5V A;  1EOV A;  4V0B A;  4L6T B;  3VA7 A;  3E5S A;  1HQM C;  4EGV A;  2X6G A;  1FYC A;  1PH8 A;  3I55 A;  1QE6 A;  4QY7 A;  3CMA A;  1DD2 A;  2HDL A;  3NBI A;  2I5L X;  4LFB Q;  5IIF A;  2MP1 A;  3FKI H;  2UXD L;  2WAQ E;  2B63 H;  2NYZ D;  4P74 A;  1BDO A;  1B2T A;  3ER0 A;  3A74 A;  4K0K Q;  2IY5 B;  2R93 B;  1TS3 A;  2XNA C;  4ZUI A;  2B3G A;  4LFC L;  2RVL A;  4HJ9 A;  1I5F A;  5D14 A;  3S1N H;  5BN3 A;  2ALY B;  2OTJ A;  4I7Z C;  3CCV A;  1EQV A;  1S40 A;  2R61 A;  3CC2 A;  3K57 A;  4MIU A;  1SXT A;  1BCP F;  1SMY D;  3WDN A;  4DN4 M;  4J15 A;  3PF4 A;  4OX9 Q;  4HJ8 A;  2F0K A;  4KTA A;  4DXG A;  4RCN A;  3W1B A;  3J80 c;  1Y1W G;  3OW2 A;  4MZ9 A;  5BN5 A;  1RTO A;  4PNY A;  1AE2 A;  4CKC A;  4NB3 A;  2GVA A;  2K6A A;  3PO2 H;  1X54 A;  3TP8 A;  1VS0 A;  3GTK B;  1L0W A;  4L5R C;  4BA1 I;  2L12 A;  2MO0 A;  4S3S A;  2UXD Q;  2LMC B;  2PO4 A;  3KUP A;  4GOP B;  4JOI A;  1LTR D;  2EYJ A;  2BDO A;  3PO3 G;  2E5L L;  3I4M B;  2MPM A;  1FNW A;  4JI1 L;  4LFC Q;  2WAQ G;  3I4N G;  4DV2 L;  3HOU H;  3I2Z A;  4BY7 G;  2QDL A;  4DV1 L;  3VR6 A;  1H95 A;  4IFD I;  1SR3 A;  3K81 C;  5M9O A;  3TS2 A;  2WB1 G;  3RZO B;  5FO7 B;  1F2Y A;  1I4R A;  2BH2 A;  1EY7 A;  1ET9 A;  4HJA A;  1AH9 A;  3CCS A;  4OO1 G;  4J1M A;  5EBC A;  1CKN A;  3KLR A;  2F0Q A;  1E1T A;  2ZXP A;  2IHE A;  3EVQ A;  1KDB A;  2HUG A;  1EOT A;  1PZJ D;  4CKE A;  2UXC L;  2Q2U A;  1D5X C;  2PI2 E;  1LAB A;  1Y8O B;  4IUQ A;  3PUV A;  4LUV A;  2DNC A;  4P72 A;  2D0P A;  5JJK A;  2SEB D;  2CCZ A;  2B2T C;  5ELE A;  1JWU D;  1PFN A;  3AFP A;  1D8L A;  4XDX A;  1E3P A;  2KCC A;  2E5L Q;  3NQT A;  4JI1 Q;  2A73 B;  3KF8 B;  5AJ3 L;  4DV2 Q;  3QWN A;  1JJC B;  5EPK A;  1Y1W H;  2A6H C;  4XT3 B;  1N36 L;  5HUR A;  2OTL A;  5KIX A;  3GTO B;  4G7Z C;  4A3I G;  2JA9 A;  4KY7 A;  3WOF A;  5G3L D;  4KN7 C;  3I70 A;  1WJJ A;  4MN3 A;  4RAU C;  1R4Q B;  5JPN C;  3I72 A;  4C1N I;  4LF4 Q;  3UI2 A;  4ZLT F;  1WCM G;  5KND A;  2HQL A;  1O7Y A;  4LFA L;  5IT9 L;  4XQN A;  1IW7 D;  4DV0 Q;  1NBW A;  4QF4 A;  3T16 A;  1PH3 A;  3A0J A;  1ILQ A;  4LUO A;  2K03 A;  3RD4 A;  2R7F A;  3I4N H;  4HMJ A;  3J7Y W;  4B08 A;  2L11 A;  3OOC A;  1I6H H;  5C5M A;  4BY7 H;  2K33 A;  2VW9 A;  4A3B H;  2VB3 X;  2A74 C;  4GKK L;  3J81 L;  1G6P A;  4CHT B;  1D1I A;  2N3S A;  4JCV E;  1O7Z A;  2B2Y C;  4UHV A;  3VYS A;  4UY8 C;  1VDZ A;  3FP9 A;  4F87 A;  3U4V A;  4K2L A;  5M5W H;  2AQ1 B;  1CI3 M;  1PYS B;  3KFU A;  1WTH A;  1EYG A;  2BA1 A;  2NZO A;  4UP7 A;  5GAD C;  5J3B A;  3S15 B;  3NK9 A;  1XPO A;  4QCL A;  3F2D A;  1R9T H;  5D3I B;  2LXJ A;  1VQJ A;  3H94 A;  1V1P A;  2IT1 A;  3HOZ G;  3D6C A;  3T1Y Q;  4LFA Q;  1AZP A;  1CM9 A;  3OWE B;  1DOL A;  2NVQ B;  1K0S A;  1A2U A;  1ESF A;  1B3Q A;  4DA2 A;  1PYB A;  3E0E A;  3IRB A;  1A3T A;  3K80 C;  2JXM B;  3Q23 A;  2K5N A;  4H7B A;  1WTR A;  1YNJ D;  4C3J B;  2YU9 H;  1EZ6 A;  3V05 A;  4PZ8 A;  4DK0 A;  1C0A A;  3DM3 A;  3MHB A;  1AFP A;  1D5Z C;  1HHV A;  1I3Q H;  2DY8 A;  1UNS A;  4JBK A;  2JE6 I;  4A93 B;  1VQO A;  2EYM A;  4GKK Q;  4FXD A;  2KCN A;  2F0E A;  5IGC A;  4TSS A;  5L37 A;  2UUA L;  4ZKB B;  4A3I H;  5ELC A;  1SN8 A;  1K8O A;  1HNZ L;  4DNR B;  3CRL C;  3H0G H;  1U5K A;  2RA4 A;  5KEE A;  1GHK A;  3FKI B;  5C0X J;  2GA4 B;  3OTO L;  2B63 B;  1G8Z D;  2KJX A;  1IBM L;  4RMF A;  3MXN B;  2E2H H;  1N33 L;  1UAP A;  5I6Y A;  1VMP A;  2HIX A;  2Z0S A;  1IHZ A;  3P20 A;  4A3M G;  1IKL A;  2L9H A;  1IYU A;  2RKS A;  3EBE A;  1L1O C;  1OXT A;  5IYD G;  3CCU A;  4DV4 L;  2IL8 A;  3CHB D;  3J7Z C;  1GHJ A;  5AFW A;  1BNZ A;  2ZJR A;  4ZUJ A;  4XQJ A;  3I3C A;  4R4Q A;  1BCP D;  3H15 A;  3CCQ A;  2N55 A;  4JI0 L;  2R6G A;  2AWO A;  5C4X H;  1SNO A;  2PPB C;  1CKN B;  4JI7 Q;  2JA8 H;  2UUA Q;  4IN3 A;  2BE5 C;  4YWL A;  4YCV A;  2ICI A;  2RDG A;  3PO2 B;  4RKL A;  3MXP A;  3SGI A;  2PZW A;  3BYT B;  3HOW G;  2NWG A;  3MWY W;  5C5L A;  4IUU A;  4LJZ C;  3OTO Q;  1F77 A;  2ZTC A;  1RHP A;  3DEO A;  1IBM Q;  1EIF A;  4R8I A;  1K8A C;  3G4S A;  4MHE A;  4JC0 A;  1VQL A;  1JIC A;  4AQY L;  3M4O H;  3CAM A;  2K14 A;  4B9X A;  2PI2 A;  4I65 A;  3HOU B;  3CU7 A;  1HA6 A;  4EQP A;  4JV5 L;  3HOY G;  3L0O A;  3BDC A;  4A3K H;  5IP7 G;  1OXU A;  2ICE C;  2WP8 J;  5LMU L;  3SR1 A;  4LF7 L;  4JI0 Q;  2NZH A;  4L63 B;  4BXX G;  1ICW A;  2QDB A;  2PQA A;  1SE4 A;  1KRS A;  2RHQ B;  4PZ6 A;  4FF3 A;  1Q7Y C;  1JE4 A;  2FMC A;  4Y52 H;  2HCI A;  3X3N A;  1CA6 A;  3D31 A;  2FMM A;  5M3M H;  1VQD A;  4CJ2 C;  2AQ2 B;  4KHP L;  2JYO A;  5JJZ A;  2M00 A;  1U9R A;  2SNS A;  1GXD C;  1Q8K A;  4X65 Q;  3A54 A;  3KJO A;  1PLF A;  2PMZ E;  5CV9 A;  2KEE A;  4AQY Q;  2ES2 A;  3K6O A;  3UE1 A;  2KUM A;  1NUC A;  3CQZ H;  4WFN 3;  3U50 C;  3K58 A;  1B44 D;  4JYA Q;  1J5E L;  1Y1W B;  3OIQ A;  4TQU S;  1PRT F;  3MFG A;  4JV5 Q;  2OQ0 A;  2IX0 A;  1LTS D;  2F0G A;  3MEH A;  4M8A A;  1Y1V H;  3UDI A;  3C2P A;  4DV6 L;  5LMU Q;  1XTD A;  4LF7 Q;  2B39 A;  3HOW H;  2O2L D;  1D7Q A;  3RN5 A;  1B8A A;  2F0N A;  3SK4 A;  3ITP A;  1QNK A;  3KLS X;  1Q3L A;  2MNA A;  2ATW A;  2QEX A;  1PRT C;  1T5E A;  1PV4 A;  1CZG A;  4B3R L;  1N32 Q;  1CHP D;  1SDF A;  5JPM C;  5EPJ A;  4IO9 A;  3I4N B;  4BY7 B;  1XPR A;  3PMF A;  5BR8 Q;  4A3B B;  1WTP A;  4FF4 A;  2NN6 G;  2IW3 A;  2WB1 B;  1MJE A;  5LMN L;  4JI2 L;  3MEF A;  4N9P A;  2B2Y A;  5M5W B;  4BY1 H;  5ELO A;  4U68 A;  4XXE A;  2F0O A;  2CH4 W;  4BXX H;  1Q82 C;  1I50 H;  1HZA A;  3J7A V;  1KD1 C;  2OEO A;  3D8G A;  1B9M A;  3VDY A;  1R9T B;  2A68 D;  4DV6 Q;  3S1Q H;  1ILP A;  5IWA L;  3DWQ A;  1QUQ B;  2RCF A;  4JI3 Q;  1A8V A;  3PF5 A;  1I4X A;  1SMX A;  1CKM A;  1SNC A;  2A6E C;  1GUN A;  5COY A;  4CJ1 B;  2OWO A;  4EQN A;  1S5B D;  2K7V A;  3SHL A;  1QG7 A;  3T51 B;  3RNU A;  3GTM H;  4QUC A;  4A75 A;  1EFW A;  4HIO A;  4C2M H;  1FL0 A;  4I7A A;  2YU9 B;  3CCR A;  2EXZ A;  5CV4 A;  2CKZ B;  2O4X A;  1HR0 L;  1I3Q B;  4N9T A;  5T1G A;  1C48 A;  3MAQ A;  1K73 C;  1GO3 E;  4FXG C;  3TS0 A;  2HHH Q;  5CC4 A;  5LMN Q;  2UXB Q;  4TVA B;  3MXG A;  4DAM A;  4DUY L;  3PIP 3;  3ZYY X;  4IUN A;  5C44 G;  1OXS C;  3H0G B;  1GVP A;  3SVM A;  4JI8 Q;  2G9D A;  3T56 B;  2GN5 A;  4GNX B;  4DR4 L;  2JJQ A;  4EX5 A;  2I46 A;  2L15 A;  2E2H B;  3N52 A;  3M4Q A;  4A3D H;  1V1O A;  3PUY A;  2K5Q A;  2R7Z H;  4NKL A;  1VQC A;  3NPP A;  4B3T L;  2NN6 H;  2O5J C;  2KHI A;  2BE5 D;  1JJG A;  1L1O A;  3J7A F;  2XRS D;  2KQ3 A;  4A3J H;  1HR0 Q;  4K5W A;  4KK7 A;  5IE8 A;  2D9U A;  5J22 A;  4IUV A;  2ZTD A;  5C4X B;  1ROD A;  3J81 i;  3JAM E;  5IP9 G;  2JA8 B;  3CPF A;  5ELN A;  1A3V A;  3BZC A;  3FEW X;  5GAE C;  2EQS A;  2Q8I B;  2CVR A;  2K04 A;  4Y7N H;  2HD3 A;  4BWG B;  3PIO A;  1QCB D;  3UDG A;  1KIX A;  1GKH A;  4RFB A;  3D6W A;  4LW1 A;  2KCT A;  3R2T A;  1TY2 A;  4FDB A;  4RGT A;  1JOQ A;  3PIO 3;  3M4O B;  2VUM H;  4DAY A;  1VCI A;  4PMW A;  2K5W A;  1RTN A;  4X6A H;  1IKM A;  3HOV G;  4B3T Q;  2ZXO A;  3S14 H;  3AB9 A;  2RDF A;  5ELD A;  5ELF A;  4A3K B;  1N34 Q;  1Q1E A;  4P2C B;  1CTM A;  1YNN C;  5E4W C;  3F2U A;  5C44 H;  3W1G A;  1XNR Q;  3QG1 A;  1F9Q A;  3LWE A;  3H3V C;  1WYD A;  2ZXR A;  2Z4I A;  4NP5 A;  1JOO A;  1BKB A;  1TU2 B;  2NTT A;  1TXY A;  3DUZ A;  2TMP A;  3H6M A;  5JOB A;  1XMQ Q;  3S17 H;  3BYY B;  4JI5 L;  4IPG A;  5M3M B;  3V96 A;  1VQG A;  1EYC A;  5FOB B;  1AE3 A;  2F0T A;  3RZD H;  2R3Z A;  4UAI A;  3U58 A;  1VMC A;  4KD4 A;  4KJN A;  5HGQ A;  1EIG A;  4X3U A;  5C3E H;  1J6Q A;  1JWS D;  3K0X A;  2MFI A;  3SDZ A;  1NTG A;  3CQZ B;  4GKJ L;  4LF8 L;  2E2J H;  5K5P A;  1QIL A;  1DJR D;  5EKK A;  3HFZ B;  2WIN B;  1OXX K;  2EY1 A;  3T4A C;  4G57 A;  1C9O A;  3VR4 A;  5IYB H;  3CPW A;  4KMU C;  4H0L C;  1YHB A;  1Y1V B;  1K0R A;  1KHI A;  4PMC A;  1KDC A;  3NTK A;  3A56 A;  1VQB A;  4CDD C;  3OWF A;  4QMG A;  1EQT A;  5C4J H;  3CW2 C;  1FNV A;  2VB2 X;  5JEA H;  3GTG H;  4A3F H;  2YTV A;  3I4L A;  3D0F A;  3QB3 A;  1YVC A;  3ULL A;  1P16 A;  2F0H A;  4IFD G;  1WTV A;  3STB C;  4X62 L;  5FLM G;  1GJX A;  1TVX A;  1XMO L;  1U4L A;  5DM6 3;  4KKT A;  4IJH A;  4C1N K;  4GKJ Q;  1Z6H A;  2ZT9 C;  2NTS A;  2ZJP A;  4BY1 B;  5KYL A;  2A8V A;  2Z4H A;  2GVB A;  4DNI A;  3GD7 A;  4QIW E;  3PCO B;  2B2U C;  3TME A;  1I50 B;  2L55 A;  2RBM A;  3C1E A;  2QF7 A;  2R7D A;  4LF6 L;  3S1Q B;  2E75 C;  2JEA I;  4ZK9 B;  2Z6B A;  2YV5 A;  3GTP B;  2K52 A;  3N6R A;  4JW0 A;  2I07 B;  4RGN A;  3ND8 A;  1H9M A;  2BDN A;  2A5H A;  1JJ2 A;  2K4K A;  3NTH A;  4IPD A;  4FNF A;  4C2M B;  1QNU A;  3TN2 A;  1EZ8 A;  2BA0 A;  5CV6 A;  3C46 A;  1L1O B;  4FO2 A;  3I7F A;  4LK1 C;  1EQQ A;  4BBS G;  1VQF A;  4RHS A;  1KC8 C;  4KD3 A;  4L5S A;  2O5I C;  2E2I H;  4KKU A;  2X6L A;  4AYB E;  2MGS A;  3CF5 A;  1XWE A;  4RKB A;  1DGS A;  4GN4 B;  1GUS A;  4ZYS A;  1T5X D;  1Q46 A;  1ZKO A;  1STY A;  4YY3 L;  3GDE A;  2UU9 L;  4K5X A;  1E2V A;  4WJW A;  1G6Z A;  3FPU B;  3R93 A;  4WRD A;  1XPU A;  2ENB A;  1HNW L;  2OT2 A;  4X64 L;  4EQO A;  1EEF D;  3K0Y A;  2VY3 A;  3E3X A;  1NR2 A;  3H91 A;  4LF6 Q;  1SYC A;  1VQP A;  4A3D B;  2Q8R E;  2K5H A;  1F2Z A;  3S24 A;  2R7Z B;  1F2M A;  1UUP A;  1XJV A;  3QIA A;  3GTL H;  5LL6 X;  1I94 L;  4RGM A;  3MVV A;  4DAY B;  4DR5 L;  3NBH A;  3G48 A;  3P7J A;  2QIL A;  3VYU A;  4Q0F A;  4DV1 Q;  2KHS A;  3A55 A;  4A3J B;  4L5T A;  1JB7 A;  2RCN A;  3IFT A;  2Z9H A;  3M7N A;  3J81 c;  2Y0S B;  1NSN S;  1LO5 D;  3G71 A;  2MQH A;  3RLF A;  1HFG A;  2E2D C;  3D4W A;  5LMN W;  1BQQ T;  1RJT A;  5E7N A;  5CV5 A;  1P8L A;  5C0X I;  3H3V H;  1X32 A;  4Y7N B;  4AYB G;  4CBV A;  4YY3 Q;  4GN5 A;  2UU9 Q;  2UXC Q;  4H44 C;  1J8I A;  2R92 G;  3PO3 H;  1XNQ L;  2KCM A;  1WVL A;  1K83 H;  4DU9 A;  1MSG A;  2K28 A;  4OWW B;  5F2D A;  1SYB A;  3OIP A;  2L5T A;  2CWA A;  1ENC A;  1HCZ A;  2VUM B;  3HKZ E;  5KNB A;  2OXP A;  1FGB D;  1NJI C;  3HS0 C;  1SNP A;  1JB3 A;  1FNU A;  1XXG A;  1PFB A;  3K7A H;  1I94 Q;  4DR5 Q;  4O0A A;  1UE5 A;  1V43 A;  2F3W A;  3S14 B;  5AJ3 Q;  4O2D A;  4BBR G;  2YYZ A;  3QO2 A;  1IBL L;  3AQQ A;  3M7G A;  5FK9 C;  4OO1 H;  1CFM A;  4OEM B;  1HR0 W;  1A3U A;  4GLA C;  1BUV T;  2B8G A;  5C44 B;  5K36 G;  4UDU C;  1N36 Q;  1S5E D;  2EYL A;  4O42 A;  3KYH C;  4DK3 C;  1S3O A;  1TWA H;  1FD7 D;  1L0Y B;  4A3E G;  3FRP B;  1KLG D;  3PGZ A;  3URY A;  5FO8 B;  4A76 A;  3MTS A;  1B3A A;  1OO9 B;  5CR3 A;  2MO1 A;  1I4Q A;  4HSV A;  3DWA A;  3L9A X;  3S17 B;  4YWK A;  1SE2 A;  3KDF A;  4FF2 A;  5FKA C;  1PRT B;  1HJP A;  3RZD B;  2OQK A;  4PQX A;  1XNQ Q;  1FR3 A;  2UUC L;  4ZRZ A;  4XYO A;  4R9W A;  5C3E B;  5C4Z A;  3K5M A;  3TQY A;  1MJC A;  1BXT A;  5IYC G;  1CT1 D;  1XTC D;  2RQX A;  2F0I A;  4P75 A;  1QVC A;  4G4K A;  3ERS X;  2ZJQ A;  1I4G A;  1CHQ D;  1IYV A;  1WTQ A;  2JA7 G;  1LT4 D;  1Q12 A;  2KOL A;  1ASY A;  2E2J B;  5CMD A;  1VF5 C;  2VS1 A;  3JAM L;  2EDG A;  2EE1 A;  3T13 A;  3ERQ A;  4A3C G;  3S1R H;  1QVF A;  3Q0A A;  1IBL Q;  3CXC A;  5E3F A;  2D62 A;  5M5Y H;  2XIW A;  1Q86 C;  2JP1 A;  4Q5V A;  2LS0 1;  1WCM H;  1VQA A;  2D5D A;  1N8R C;  1I4P A;  1JT8 A;  3M4P A;  2K01 A;  1ICF B;  2FIN B;  3S16 H;  1ET6 A;  2R92 H;  3VR5 A;  2RHS B;  2IJ0 A;  4QJF A;  5C4J B;  3OHX C;  3GTG B;  4A3F B;  4A3G G;  1KAW A;  3R8B A;  4QUF A;  1HXY D;  3S1N B;  1JOR A;  2C9O A;  3NUC A;  3IAY A;  4L8J A;  2WKC A;  3HP3 A;  5FLX L;  4K8J A;  3GTQ H;  4RWS C;  2K50 A;  2NVT H;  2VL6 A;  1II3 A;  5IOC A;  3CCE A;  1VQN A;  2A69 C;  1Q1B A;  5J1Z A;  4V19 0;  5I9P A;  5K36 H;  1EY6 A;  4JI6 L;  3WOE A;  1HNZ Q;  4IUR A;  4A3E H;  1GM5 A;  3TEH B;  2B2U A;  2ID0 A;  3HOZ H;  2CHB D;  1SE8 A;  3V2T A;  1TS2 A;  2JSO A;  4KN4 C;  1F9P A;  4Z9C B;  3I56 A;  5LHY 1;  4C3I G;  5H1S E;  4JBW A;  1IBK L;  1N33 Q;  4OIJ A;  2UUB L;  3W3A A;  2G9H D;  2RDH A;  1A0I A;  3NBH B;  1YEZ A;  1STH A;  5EGT A;  1SRO A;  1SRU A;  1S5C D;  4DV4 Q;  1CQF A;  3B6Y A;  3PUX A;  2JA7 H;  2HIV A;  1RL2 A;  2EYF A;  3BZK A;  3CCM A;  2QEJ C;  2E2I B;  1YHQ A;  1GUW A;  3WWV A;  1PTO F;  1SYF A;  2BCO A;  2C5C A;  1S4Z A;  4A3C H;  4QB4 A;  1EIH A;  3E0J A;  4GS3 A;  2DNE A;  4BS9 A;  1MKH A;  2EJM A;  4J8Q A;  3PSI A;  1KQS A;  3P75 A;  1PA6 A;  5EAY A;  3CCL A;  4LF9 L;  1CZW A;  2PZU A;  5EJW A;  1IZ6 A;  4L5Q A;  1E1O A;  1E2Z A;  4ZCK A;  3K59 A;  4A3M H;  1PTO C;  2A6H D;  3EQL C;  5JJL A;  3Q6S A;  3VYT A;  5IYD H;  1MI2 A;  1DXM A;  1E7Z A;  1KAA A;  1PFM A;  3BDL A;  3O13 A;  4JBM A;  4DV5 L;  3GTL B;  3OSO A;  3F2B A;  2UUB Q;  1H9J A;  1TII D;  1NMF A;  5IOD A;  2F4V L;  4JPB W;  1A63 A;  3PUZ A;  1ZXT A;  4MTN A;  4APV A;  1W2B A;  1QZG A;  3NEM A;  1VQ5 A;  3I90 A;  1MD2 D;  4A4I A;  1KLU D;  4ID6 A;  3HOX G;  2F52 A;  3I4M G;  4UPA A;  1G51 A;  1WOC A;  5COR A;  4R4C A;  4DNT B;  4NXM L;  3J80 E;  2E8G A;  2EXD A;  2LSS A;  3HZX A;  3ERO A;  1V1P B;  3ULP A;  3M9B A;  4LF9 Q;  2EVB A;  1BR9 A;  3TP7 A;  3GTJ H;  2ZM6 L;  2LKV A;  4C3I H;  3PO3 B;  3KDF B;  3DWP A;  1HFN A;  1KAB A;  3CC7 A;  1K83 B;  2EPB A;  2WAQ B;  3KJP A;  1U4R A;  4KHP Q;  2M9V A;  1I6H B;  1VQ6 A;  1L2F A;  4OHJ A;  4DV5 Q;  3CC4 A;  3HOY H;  4BA2 I;  3RUZ A;  5IP7 H;  5D65 A;  2F4V Q;  3UDX A;  1EYA A;  1WFQ A;  4DR3 L;  2NVX H;  4XIG S;  1J5E Q;  1E24 A;  1JQY D;  4N8X 1;  1K8G A;  1BBW A;  5FJ8 G;  4F7X A;  3GO5 A;  1TS5 A;  1TWA B;  1I6V C;  1W3S A;  1B7Y B;  1UEA B;  2Q2H A;  2XVS A;  1W6K A;  2JA6 G;  3HKS A;  1F2L A;  2B29 A;  1R4P B;  2F3I A;  4NXM Q;  2FHT A;  3NEN A;  1EL0 A;  3SE0 A;  5CYU A;  5JVG 3;  1CA5 A;  5JAV A;  1M4V A;  2ZM6 Q;  5M3F G;  3CKI B;  4JBJ A;  4DFA A;  1SMY C;  5A2Q E;  2F0J A;  4LWC A;  4B3R Q;  1LTT D;  3SEB A;  4F8M A;  5LL6 S;  3CD6 A;  4CDE C;  1C8C A;  2TSS A;  3NQI A;  1LT3 D;  1C7Y A;  3QJY A;  2NZ1 D;  3TBI B;  1O7L A;  3HOX H;  4A3I B;  4JI2 Q;  2C35 B;  4OWX B;  3S1R B;  1PH6 A;  4FXK C;  3RN2 A;  5M5Y B;  3OMG A;  1X3F A;  1WCM B;  4GZY C;  2WAC A;  1EY5 A;  1IL8 A;  3OPO A;  1EY9 A;  1SYE A;  1V9P A;  3BJU A;  3S16 B;  3HGB A;  1X3E A;  3J81 E;  1HNX L;  4A3L G;  4C3H G;  2R92 B;  2VQE L;  5IWA Q;  3E9I A;  1CSP A;  3C1F A;  4HAE A;  1G91 A;  4YHH L;  2I5M X;  1D6E C;  1CKO A;  4JG2 A;  4K8I A;  3DHQ A;  3K7U C;  5EBD A;  1RIP A;  4E6I A;  2H5X A;  2IX1 A;  3GTQ B;  4YCU A;  1PFS A;  1Y8N B;  2NVT B;  4XQQ A;  3IFD A;  5A35 A;  4RHR A;  2KA7 A;  1SBB B;  2AUK A;  2F0U A;  2RSO A;  2Q2I A;  3IKJ A;  4CDF C;  3Q22 A;  3T53 B;  1MIU A;  2PQA B;  4DUY Q;  3SK6 A;  4DR7 L;  4OEL B;  3F2C A;  2JA6 H;  3S2H H;  4WJ3 M;  2Z6K A;  4JK1 C;  3S9W A;  2EYP A;  4A93 G;  3HOZ B;  1VQ9 A;  3DEP A;  4ME5 A;  4DR4 Q;  2WII B;  1U0L A;  2QKI C;  1CSQ A;  5M3F H;  2WV6 D;  1PXU A;  1PTO H;  3NXW A;  1B53 A;  1Y14 B;  4K2K A;  1C4Q A;  4XYQ A;  4LF5 L;  1YHA A;  4YHH Q;  2N88 A;  2DUD A;  3LX0 A;  3NWT A;  3PUW A;  4ZAI A;  4HR7 B;  2B63 G;  4KHZ A;  2DY7 A;  4KJO A;  2JA7 B;  1YBY A;  4HCE A;  5IGD A;  5GQO A;  1EU4 A;  5ELB A;  4IZ8 A;  5IGG A;  1A2T A;  4AH6 A;  1PTO D;  1B70 B;  4DR6 L;  4DK6 C;  1SJH D;  1KNE A;  1GUT A;  2LY7 A;  2D2C C;  2F0P A;  4LNQ A;  1IW7 C;  3JAM i;  4A3L H;  4C3H H;  1NAP A;  3S1M H;  1T9H A;  5CGK A;  3I8Z A;  4KI0 A;  3EFX D;  2K5V A;  4A3M B;  4LFB L;  3KK7 A;  1IL2 A;  2CQO A;  4UP8 A;  1ONL A;  3S15 H;  1H9R A;  2N8N A;  2XSC A;  3LNN A;  1ASZ A;  3PO2 G;  4LF5 Q;  4PV1 C;  2PQE A;  2A19 A;  2Z1C A;  1BF4 A;  3NHH A;  2WKD A;  5JJI A;  1Z47 A;  2XWJ B;  3BG3 A;  4PMB A;  5CV7 A;  1K9M C;  1EFI D;  1UE1 A;  4NMZ A;  1PRT D;  2AHO B;  4R4T A;  5IP9 H;  3OMC A;  1PDQ A;  2F0L A;  1AN8 A;  4CDC C;  2IX3 A;  1VQ4 A;  1A6X A;  3ICE A;  4KY6 A;  3HOU G;  4RH6 A;  4MNO A;  1O7I A;  3HOW B;  4DR6 Q;  4CKB A;  5IGF A;  3QR8 A;  4YCW A;  5J39 A;  2NUC A;  2VQF L;  3NSW A;  1EEI D;  1K28 A;  1KRT A;  3GTJ B;  1M8A A;  4R4I A;  1B50 A;  4C3I B;  1SNM A;  5HGT A;  4JI5 Q;  1YNJ C;  3GQB A;  1O78 A;  3VYR A;  5GAH C;  5C3W A;  1X6O A;  1FGU A;  3A8J E;  4RA8 A;  1Z7T A;  2E74 C;  1Q8I A;  1PH4 A;  1OTC A;  3HOV H;  4QQB X;  2CW0 C;  3M3Y H;  1ENA A;  3HOY B;  1TWH H;  2B2V A;  1CK1 A;  2A1A A;  4LF8 Q;  2XTI A;  2NVX B;  2WB1 E;  3HRZ C;  3L3O C;  2IPK D;  1X65 A;  2A6E D;  2JK8 A;  2KED A;  3A8I E;  1JE5 A;  2EY2 A;  1STE A;  1TKW B;  2HDM A;  1MSH A;  2NVY H;  1EY8 A;  4ME3 A;  5CV8 A;  3M4Y A;  4PZ7 A;  1QZH A;  2Q2T A;  3UE0 A;  1QB5 D;  2EYO A;  3W5O A;  1KTK A;  2VQF Q;  5KGU A;  2ASB A;  1STA A;  3HEJ A;  2VNU D;  1LTB D;  1JCK B;  1WTX A;  3GTM B;  3MZ5 A;  1EY0 A;  1V8Q A;  3T1H L;  1SFO H;  4ILW A;  1F9S A;  1HUM A;  2JA5 G;  1YJN A;  5BN4 A;  4GNX C;  3K5N A;  1QJO A;  1BCP C;  2F3V A;  5NUC A;  4DXF A;  3FPP A;  4X62 Q;  2KBN A;  3MXN A;  4WJ4 A;  1X55 A;  2H4O A;  1XMO Q;  2ZTE A;  1YJW A;  4X3K A;  4HIK A;  3C3L A;  2HCC A;  3HOX B;  3CCJ A;  5JEA J;  1HZC A;  5C0X G;  3S2D H;  1YIJ A;  1JWM D;  3J80 L;  4HJ7 A;  5KRU A;  4A3B G;  1W6J A;  3X3M A;  1LUZ A;  1TWC H;  5IGE A;  2DN8 A;  3K8A A;  3E9H A;  5DAU A;  2PNR C;  1HUN A;  4OXP A;  1E0B A;  5IT9 c;  2AMC B;  4POF A;  1DOK A;  4LF4 L;  4IFD H;  2CQA A;  5FLM H;  4DV3 L;  2PCF B;  5CBE E;  4DV0 L;  4DV7 L;  1Z9F A;  4DF7 A;  3T1H Q;  2BOS A;  1CQV A;  3H3V I;  5E4X A;  5M5X H;  4U67 3;  1EWC A;  4IQZ A;  3U9S A;  4LMQ D;  3GV3 A;  3SK8 A;  2PMZ B;  1ENF A;  1WI5 A;  1VQE A;  4NPS A;  5DNF A;  1X3Q A;  2F1M A;  2B2W C;  2Z8L A;  1LTG D;  1PH7 A;  1STN A;  3OW7 A;  2JA6 B;  3S2H B;  1AEX A;  4IPC A;  5I2X A;  1PH1 A;  2PYK A;  5EQ0 A;  1SYD A;  2F0M A;  1HNW Q;  1G2T A;  4X64 Q;  1VQH A;  3TZD A;  1RDP D;  4TKO B;  3D4R A;  4QL5 A;  5A2Q L;  5M3F B;  1RF2 D;  1PTO B;  4OO1 I;  4KKS A;  3A5Z B;  1YNN D;  2JA5 H;  4DUZ L;  1QOH A;  3H0G G;  2IHF A;  4BBS H;  1G2S A;  4XTC S;  3Q24 A;  3G7L A;  3T1Y L;  4XT1 B;  4DV3 Q;  4DV7 Q;  1NR4 A;  2EZV A;  1TWF H;  4JVZ A;  1ZYR C;  2KVM A;  3IL8 A;  1Y8P B;  2QCP X;  5C0X H;  3TDQ A;  3KBG A;  3JAM c;  3MC0 B;  2XGT A;  2LXK A;  3A7A B;  4IFD J;  4C3H B;  3S1M B;  1UE7 A;  2V1C C;  4IPH A;  2F03 A;  3DM1 A;  5C4H A;  2EIF A;  4ZKC B;  2I5H A;  5C4X G;  1PZK D;  4TRD A;  2JA8 G;  4X3T A;  1D5M C;  1GOZ A;  2QGQ A;  3L2P A;  3AU7 A;  3K5O A;  1VF7 A;  3M85 A;  3EN2 A;  4DUZ Q;  1BBU A;  1U4P A;  2XRQ D;  1LYL A;  1TY0 A;  1NMG A;  1S5D D;  2AUJ D;  3RLO A;  5FLX c;  4JI4 L;  3HKZ G;  1WD0 A;  1TT2 A;  2V4D A;  3DMU A;  3F1Z A;  1N9W A;  1HQR D;  1VQ7 A;  2A68 C;  2D0O A;  1SJE D;  1LTA D;  1SNQ A;  5FO9 B;  1LM0 A;  3Q8D A;  4IAL A;  1H9S A;  3AFQ A;  1XX8 A;  3STB D;  1YJ9 A;  1BBX C;  3CP0 A;  2BH8 A;  2CW0 D;  1HA5 A;  1K3R A;  1KXL A;  1STG A;  1EUJ A;  4A3K G;  4JI7 L;  1EQR A;  4ZQ3 A;  2F0S A;  4X3S A;  1PYW D;  5T1I A;  5I4D A;  4M1U B;  1S72 A;  1EYD A;  1PZI D;  3KLW A;  2N49 A;  1AZQ A;  1X56 A;  4H02 A;  4YWM A;  5CBA E;  2UUC Q;  1AW7 A;  5GRO A;  3HOV B;  4GOP C;  3M3Y B;  3VR3 A;  1QUQ A;  4BBR H;  2K75 A;  2LFN A;  3P1H A;  4HMI A;  2FXQ A;  3H09 A;  3NE5 B;  3G6E A;  3NP8 A;  1SSO A;  1X9N A;  1TWH B;  3OYY A;  5M3M G;  1A62 A;  1I4H A;  3EIV A;  1QWY A;  1K8M A;  5I2Y A;  4JI4 Q;  3NTI A;  1SLJ A;  2Z6K C;  4HJ5 A;  2VZA A;  2NVY B;  5E1F A;  2K5D A;  3DLL A;  1G29 1;  4IOC A;  2PZT A;  2SDF A;  1NE3 A;  2L4N A;  4P73 A;  1Y1V G;  1H9K A;  2FJ2 A;  5EPL A;  1SFO B;  4R8N A;  5IYC H;  1MBY A;  2EJG C;  4HSP A;  4GN3 B;  1HZ9 A;  3TP5 A;  4GNX A;  2R93 G;  3FDT A;  1OXV A;  1SEB D;  1YNX A;  2PW5 A;  2PNH A;  4X65 L;  4DAV A;  1NNX A;  4DAP A;  1EIY B;  2H1E A;  4J6H A;  1S5F D;  3S2D B;  2JN4 A;  4DK1 A;  3KOJ A;  1Q81 C;  4JI6 Q;  3GV6 A;  4JYA L; 
#chains in the Genus database with same CATH homology
 4NDX A;  3BS1 A;  1TWC B;  4O1N A;  1WTW A;  4H13 C;  2SNM A;  1RKN A;  2K1B A;  2F0D A;  4YIJ A;  1GUG A;  1PMR A;  4WOR A;  1JC7 A;  1JR0 D;  3VA5 A;  5M5X B;  3BVZ A;  1EY4 A;  5EKL A;  1WTO A;  1L0X B;  2B2T A;  3D3R A;  2XWB B;  2IWH A;  1SAP A;  3PV0 A;  2PW7 A;  1O80 A;  4K14 A;  2B2W A;  5C6A A;  1JOK A;  2J7Z A;  5DEH A;  3K5L A;  1DON A;  4G7H C;  2F4I A;  4HED A;  2B8F A;  1ZYR D;  1TS4 A;  5KNC A;  2JA5 B;  4HCS A;  4BBS B;  3K7A B;  2AWN A;  1DZ1 A;  2B2V C;  3I73 A;  2L0C A;  3QOL A;  3MA2 B;  1DM0 B;  2X69 A;  1TWF B;  4B9W A;  2JEB I;  1LAC A;  1LLR D;  2XN9 C;  4NW2 A;  4CJ0 B;  4RGO S;  1HTL D;  4IUP A;  2MHV A;  3GP7 A;  1TR5 A;  1H9S B;  3AMU A;  3EJI A;  3U9O A;  4QIW B;  4IUT A;  5DM7 3;  1ZEQ X;  3BVM A;  2MJ8 A;  2EOT A;  4KHV A;  2FFK B;  2VXW A;  3RMH A;  3SK5 A;  5IGB A;  2K05 A;  2MUY A;  4EVO A;  1J9O A;  1EWH A;  3BVG A;  1DYQ A;  5IT9 E;  3LWU A;  1X3P A;  3KBX A;  1ESR A;  3TZU A;  5JVH 3;  1SYG A;  3E6Z X;  4RCO A;  1B4O A;  3QOJ A;  1SE3 A;  1U4M A;  4AYB B;  4DGZ A;  2NN6 I;  3DXJ C;  3G6J B;  4FP5 D;  1BO0 A;  2EJF C;  5KYI A;  2A69 D;  4ULL A;  4LAA A;  3L7Z C;  3A8K E;  1LT6 D;  5D3D A;  3W2D A;  1BCP B;  1EU3 A;  4BBR B;  1BOS A;  2KEC A;  4OGQ C;  1DOM A;  2NBF A;  3FVQ A;  3TP6 A;  2Q8T A;  1HRJ A;  2L1B A;  1Y69 U;  3I91 A;  1WD1 A;  4C56 C;  3ND9 A;  4A3E B;  2EYH A;  2HQE A;  4C3J G;  3HG9 A;  2J4X A;  1KNA A;  3R3O A;  3BDO A;  2J0T D;  4G7O C;  1GUO A;  5EKI A;  4KV6 A;  2EY6 A;  3MXU A;  5G3L F;  5I6W A;  1STB A;  1B9N A;  3EA6 A;  4FF1 A;  1HTP A;  2NB0 A;  2F0F A;  2M2L A;  1Q90 A;  5I9O A;  4KY5 A;  2EY5 A;  1MGS A;  4HTH A;  3MFY A;  5JEA G;  3HKZ B;  1LT5 D;  5ISR A;  3SXH A;  5C3X A;  3CRK C;  4ABN A;  4HN7 A;  4K6D A;  1RD9 D;  3R2I A;  1NCV A;  3KF8 A;  1B1Z A;  1E2W A;  1A15 A;  3D4D A;  1LTI D;  5FLX E;  3A7L A;  4FVM A;  1TWG B;  2K32 A;  4A3G B;  4K6L A;  3FMC A;  1KDA A;  3NWS A;  1AP0 A;  3VR2 A;  1TQO A;  1ML0 D;  2AQ3 B;  1D1K A;  4F88 A;  1XYI A;  1DCZ A;  4OIK A;  1SND A;  2RSN A;  4ODG A;  2F0W A;  2F0V A;  2E76 C;  3TSS A;  5TSS A;  4OL7 A;  1D2B A;  4CGY B;  1F9R A;  1HPC A;  3BZD B;  4FYD A;  1LV9 A;  1RCV D;  3KLS A;  2SOB A;  3ONA B;  2OF1 A;  4K5V A;  4V0B A;  4L6T B;  3VA7 A;  3E5S A;  1HQM C;  4EGV A;  2X6G A;  1FYC A;  1QE6 A;  1DD2 A;  2HDL A;  3NBI A;  5IIF A;  2MP1 A;  2NYZ D;  1BDO A;  1B2T A;  2R93 B;  1TS3 A;  2XNA C;  4ZUI A;  2RVL A;  5D14 A;  5BN3 A;  4I7Z C;  1EQV A;  2R61 A;  3K57 A;  4MIU A;  1SXT A;  1BCP F;  1SMY D;  3WDN A;  4DN4 M;  2F0K A;  4KTA A;  4DXG A;  4RCN A;  5BN5 A;  1RTO A;  4PNY A;  4CKC A;  2K6A A;  3TP8 A;  3GTK B;  4BA1 I;  2L12 A;  4S3S A;  2LMC B;  2PO4 A;  3KUP A;  1LTR D;  2EYJ A;  2BDO A;  3I4M B;  2MPM A;  1FNW A;  3VR6 A;  4IFD I;  5M9O A;  3RZO B;  5FO7 B;  1F2Y A;  1I4R A;  1EY7 A;  1ET9 A;  4OO1 G;  4J1M A;  5EBC A;  3KLR A;  2F0Q A;  2ZXP A;  3EVQ A;  1KDB A;  2HUG A;  1EOT A;  1PZJ D;  4CKE A;  1D5X C;  1LAB A;  1Y8O B;  4IUQ A;  3PUV A;  2DNC A;  2SEB D;  2B2T C;  5ELE A;  1JWU D;  1PFN A;  4XDX A;  2KCC A;  3NQT A;  2A73 B;  3QWN A;  5EPK A;  2A6H C;  4XT3 B;  5HUR A;  5KIX A;  3GTO B;  4G7Z C;  4KY7 A;  3WOF A;  5G3L D;  4KN7 C;  3I70 A;  4MN3 A;  4RAU C;  1R4Q B;  5JPN C;  3I72 A;  4C1N I;  3UI2 A;  4ZLT F;  5KND A;  1O7Y A;  5IT9 L;  4XQN A;  1IW7 D;  4QF4 A;  3T16 A;  1ILQ A;  2K03 A;  3RD4 A;  4HMJ A;  3J7Y W;  4B08 A;  2L11 A;  3OOC A;  5C5M A;  2K33 A;  2VB3 X;  2A74 C;  3J81 L;  4CHT B;  1D1I A;  1O7Z A;  2B2Y C;  3VYS A;  1VDZ A;  4F87 A;  4K2L A;  2AQ1 B;  1CI3 M;  2BA1 A;  3S15 B;  3NK9 A;  4QCL A;  5D3I B;  3H94 A;  1V1P A;  2IT1 A;  3D6C A;  1AZP A;  1CM9 A;  3OWE B;  1DOL A;  2NVQ B;  1A2U A;  1ESF A;  4DA2 A;  1A3T A;  2JXM B;  3Q23 A;  4H7B A;  1WTR A;  1YNJ D;  4C3J B;  1EZ6 A;  3V05 A;  4DK0 A;  3MHB A;  1AFP A;  1D5Z C;  1HHV A;  2DY8 A;  1UNS A;  2JE6 I;  4A93 B;  2EYM A;  4FXD A;  2KCN A;  2F0E A;  5IGC A;  4TSS A;  4ZKB B;  5ELC A;  1K8O A;  4DNR B;  3CRL C;  2RA4 A;  5KEE A;  1GHK A;  3FKI B;  5C0X J;  2GA4 B;  2B63 B;  1G8Z D;  2KJX A;  1UAP A;  5I6Y A;  1VMP A;  1IHZ A;  3P20 A;  1IKL A;  2L9H A;  1IYU A;  2RKS A;  1OXT A;  2IL8 A;  3CHB D;  1GHJ A;  5AFW A;  1BNZ A;  4ZUJ A;  4XQJ A;  3I3C A;  1BCP D;  2N55 A;  2R6G A;  2AWO A;  1SNO A;  2PPB C;  4IN3 A;  2BE5 C;  2ICI A;  2RDG A;  3PO2 B;  4RKL A;  3MXP A;  2PZW A;  3BYT B;  2NWG A;  3MWY W;  5C5L A;  4IUU A;  4LJZ C;  1F77 A;  1RHP A;  3DEO A;  4R8I A;  4MHE A;  1JIC A;  4B9X A;  4I65 A;  3HOU B;  3CU7 A;  1HA6 A;  4EQP A;  3BDC A;  1OXU A;  2ICE C;  2WP8 J;  3SR1 A;  4L63 B;  1ICW A;  2QDB A;  1SE4 A;  4FF3 A;  1JE4 A;  2FMC A;  2HCI A;  3X3N A;  1CA6 A;  3D31 A;  2FMM A;  4CJ2 C;  2AQ2 B;  2JYO A;  5JJZ A;  2M00 A;  1U9R A;  2SNS A;  1GXD C;  3A54 A;  1PLF A;  5CV9 A;  2KEE A;  3K6O A;  2KUM A;  1NUC A;  4WFN 3;  3K58 A;  1B44 D;  1Y1W B;  3OIQ A;  4TQU S;  1PRT F;  3MFG A;  2IX0 A;  1LTS D;  2F0G A;  3MEH A;  4M8A A;  3C2P A;  2B39 A;  2O2L D;  2F0N A;  3SK4 A;  3ITP A;  1QNK A;  3KLS X;  1Q3L A;  1PRT C;  1T5E A;  1CZG A;  1CHP D;  1SDF A;  5JPM C;  5EPJ A;  3I4N B;  4BY7 B;  3PMF A;  4A3B B;  1WTP A;  4FF4 A;  2NN6 G;  2IW3 A;  2WB1 B;  4N9P A;  2B2Y A;  5M5W B;  4U68 A;  4XXE A;  2F0O A;  3J7A V;  2OEO A;  3D8G A;  1B9M A;  1R9T B;  2A68 D;  1ILP A;  3DWQ A;  1I4X A;  1SNC A;  2A6E C;  1GUN A;  5COY A;  4CJ1 B;  4EQN A;  1S5B D;  2K7V A;  3SHL A;  1QG7 A;  3T51 B;  4QUC A;  2YU9 B;  2EXZ A;  5CV4 A;  2O4X A;  1I3Q B;  4N9T A;  5T1G A;  1C48 A;  3MAQ A;  4FXG C;  5CC4 A;  3MXG A;  3PIP 3;  3ZYY X;  4IUN A;  1OXS C;  3H0G B;  3SVM A;  2G9D A;  3T56 B;  2I46 A;  2E2H B;  3N52 A;  1V1O A;  3PUY A;  2K5Q A;  4NKL A;  3NPP A;  2NN6 H;  2O5J C;  2BE5 D;  3J7A F;  2XRS D;  2KQ3 A;  4K5W A;  4KK7 A;  2D9U A;  5J22 A;  4IUV A;  5C4X B;  1ROD A;  3JAM E;  2JA8 B;  1A3V A;  3FEW X;  2Q8I B;  2CVR A;  2K04 A;  4BWG B;  1QCB D;  4RFB A;  3D6W A;  3R2T A;  1TY2 A;  4RGT A;  1JOQ A;  3PIO 3;  3M4O B;  4DAY A;  1VCI A;  4PMW A;  2K5W A;  1RTN A;  1IKM A;  2ZXO A;  3AB9 A;  2RDF A;  5ELD A;  5ELF A;  4A3K B;  1Q1E A;  4P2C B;  1CTM A;  1YNN C;  5E4W C;  3F2U A;  3QG1 A;  1F9Q A;  3LWE A;  3H3V C;  2ZXR A;  2Z4I A;  4NP5 A;  1JOO A;  1TU2 B;  2NTT A;  3DUZ A;  2TMP A;  3H6M A;  5JOB A;  3BYY B;  5M3M B;  3V96 A;  1EYC A;  5FOB B;  2F0T A;  2R3Z A;  4UAI A;  1VMC A;  4KD4 A;  4KJN A;  1EIG A;  4X3U A;  1JWS D;  3SDZ A;  3CQZ B;  5K5P A;  1QIL A;  1DJR D;  5EKK A;  2WIN B;  1OXX K;  2EY1 A;  3T4A C;  4G57 A;  3VR4 A;  4KMU C;  4H0L C;  1Y1V B;  4PMC A;  1KDC A;  3NTK A;  3A56 A;  3OWF A;  4QMG A;  1EQT A;  1FNV A;  2VB2 X;  5JEA H;  3I4L A;  3QB3 A;  2F0H A;  4IFD G;  1WTV A;  1GJX A;  1TVX A;  1U4L A;  5DM6 3;  4KKT A;  4C1N K;  1Z6H A;  2ZT9 C;  2NTS A;  4BY1 B;  5KYL A;  2Z4H A;  3GD7 A;  2B2U C;  3TME A;  1I50 B;  2L55 A;  2RBM A;  3C1E A;  2QF7 A;  3S1Q B;  2E75 C;  2JEA I;  4ZK9 B;  3GTP B;  3N6R A;  2I07 B;  4RGN A;  3ND8 A;  1H9M A;  2BDN A;  2A5H A;  3NTH A;  4FNF A;  4C2M B;  1QNU A;  3TN2 A;  1EZ8 A;  2BA0 A;  5CV6 A;  3C46 A;  4FO2 A;  4LK1 C;  4RHS A;  4KD3 A;  2O5I C;  4KKU A;  2X6L A;  2MGS A;  1XWE A;  4RKB A;  1GUS A;  4ZYS A;  1T5X D;  1ZKO A;  1STY A;  4K5X A;  1E2V A;  4WJW A;  1G6Z A;  3FPU B;  3R93 A;  4WRD A;  2ENB A;  2OT2 A;  4EQO A;  1EEF D;  3K0Y A;  3H91 A;  1NR2 A;  1SYC A;  4A3D B;  2Q8R E;  1F2Z A;  2R7Z B;  1F2M A;  1UUP A;  3QIA A;  5LL6 X;  4RGM A;  3MVV A;  3NBH A;  3P7J A;  2QIL A;  3VYU A;  4Q0F A;  2KHS A;  3A55 A;  4A3J B;  3IFT A;  3M7N A;  2Y0S B;  1NSN S;  1LO5 D;  3RLF A;  1HFG A;  2E2D C;  3D4W A;  1BQQ T;  1RJT A;  5CV5 A;  5C0X I;  1X32 A;  4Y7N B;  4CBV A;  4H44 C;  1J8I A;  1WVL A;  4DU9 A;  1MSG A;  2K28 A;  5F2D A;  1SYB A;  3OIP A;  2L5T A;  1ENC A;  1HCZ A;  2VUM B;  5KNB A;  2OXP A;  1FGB D;  3HS0 C;  1SNP A;  1JB3 A;  1FNU A;  1XXG A;  1PFB A;  1V43 A;  2F3W A;  3S14 B;  2YYZ A;  3QO2 A;  3M7G A;  5FK9 C;  4OO1 H;  1CFM A;  1A3U A;  1BUV T;  2B8G A;  5C44 B;  5K36 G;  4UDU C;  1S5E D;  2EYL A;  4O42 A;  1FD7 D;  1L0Y B;  3FRP B;  1KLG D;  3URY A;  5FO8 B;  3MTS A;  1B3A A;  1OO9 B;  5CR3 A;  1I4Q A;  4HSV A;  3DWA A;  3L9A X;  3S17 B;  1SE2 A;  4FF2 A;  5FKA C;  1PRT B;  3RZD B;  4PQX A;  1FR3 A;  4ZRZ A;  4XYO A;  4R9W A;  5C3E B;  5C4Z A;  3K5M A;  1BXT A;  1CT1 D;  1XTC D;  2RQX A;  2F0I A;  4G4K A;  1I4G A;  1CHQ D;  1IYV A;  1WTQ A;  1LT4 D;  1Q12 A;  2KOL A;  2E2J B;  5CMD A;  1VF5 C;  3JAM L;  2EDG A;  2EE1 A;  3T13 A;  3ERQ A;  3Q0A A;  5E3F A;  2D62 A;  2XIW A;  2JP1 A;  4Q5V A;  2LS0 1;  2D5D A;  1I4P A;  2K01 A;  2FIN B;  1ET6 A;  3VR5 A;  5C4J B;  2IJ0 A;  3OHX C;  3GTG B;  4A3F B;  3R8B A;  4QUF A;  1HXY D;  3S1N B;  1JOR A;  2C9O A;  3NUC A;  3IAY A;  4L8J A;  2WKC A;  3HP3 A;  5FLX L;  4K8J A;  4RWS C;  1II3 A;  5IOC A;  2A69 C;  1Q1B A;  5J1Z A;  4V19 0;  5I9P A;  5K36 H;  1EY6 A;  3WOE A;  4IUR A;  2B2U A;  2ID0 A;  2CHB D;  3V2T A;  1TS2 A;  2JSO A;  4KN4 C;  1F9P A;  4Z9C B;  5LHY 1;  4C3I G;  4JBW A;  4OIJ A;  3W3A A;  2G9H D;  2RDH A;  1STH A;  5EGT A;  1S5C D;  1CQF A;  3PUX A;  2EYF A;  2QEJ C;  2E2I B;  1GUW A;  1PTO F;  1SYF A;  2BCO A;  2C5C A;  1S4Z A;  4QB4 A;  1EIH A;  3E0J A;  2DNE A;  4BS9 A;  2EJM A;  4J8Q A;  3P75 A;  1CZW A;  2PZU A;  5EJW A;  1E2Z A;  3K59 A;  1PTO C;  2A6H D;  3EQL C;  3Q6S A;  3VYT A;  1MI2 A;  1DXM A;  1KAA A;  1PFM A;  3BDL A;  3O13 A;  3GTL B;  3OSO A;  1H9J A;  1TII D;  5IOD A;  3PUZ A;  1ZXT A;  3I90 A;  1MD2 D;  1KLU D;  4ID6 A;  5COR A;  4DNT B;  3J80 E;  3HZX A;  3ERO A;  1V1P B;  2EVB A;  1BR9 A;  3TP7 A;  2LKV A;  3PO3 B;  3DWP A;  1HFN A;  1KAB A;  1K83 B;  2EPB A;  2WAQ B;  1U4R A;  2M9V A;  1I6H B;  4OHJ A;  4BA2 I;  3RUZ A;  5D65 A;  1EYA A;  4XIG S;  1JQY D;  4F7X A;  3GO5 A;  1TS5 A;  1TWA B;  1I6V C;  1UEA B;  2XVS A;  1W6K A;  1F2L A;  1R4P B;  2FHT A;  1EL0 A;  3SE0 A;  5CYU A;  5JVG 3;  1CA5 A;  5JAV A;  1M4V A;  3CKI B;  4DFA A;  1SMY C;  5A2Q E;  2F0J A;  1LTT D;  3SEB A;  4F8M A;  5LL6 S;  1C8C A;  2TSS A;  3NQI A;  1LT3 D;  3QJY A;  2NZ1 D;  3TBI B;  1O7L A;  4A3I B;  3S1R B;  4FXK C;  5M5Y B;  3OMG A;  1WCM B;  4GZY C;  2WAC A;  1EY5 A;  1IL8 A;  3OPO A;  1EY9 A;  1SYE A;  3S16 B;  3HGB A;  3J81 E;  2R92 B;  4C3H G;  3C1F A;  4HAE A;  1G91 A;  1D6E C;  4K8I A;  3DHQ A;  5EBD A;  4E6I A;  2IX1 A;  3GTQ B;  1Y8N B;  2NVT B;  4XQQ A;  3IFD A;  5A35 A;  4RHR A;  2KA7 A;  1SBB B;  2AUK A;  2F0U A;  2RSO A;  3IKJ A;  3Q22 A;  3T53 B;  3SK6 A;  4JK1 C;  3S9W A;  2EYP A;  3HOZ B;  3DEP A;  4ME5 A;  2WII B;  2QKI C;  2WV6 D;  1PXU A;  1PTO H;  3NXW A;  1B53 A;  4K2K A;  1C4Q A;  4XYQ A;  2N88 A;  3NWT A;  3LX0 A;  3PUW A;  4ZAI A;  4HR7 B;  4KHZ A;  2DY7 A;  4KJO A;  2JA7 B;  4HCE A;  5IGD A;  1EU4 A;  5ELB A;  4IZ8 A;  5IGG A;  1A2T A;  1PTO D;  1SJH D;  1KNE A;  1GUT A;  2LY7 A;  2D2C C;  2F0P A;  1IW7 C;  1NAP A;  5CGK A;  3I8Z A;  4KI0 A;  3EFX D;  4A3M B;  3KK7 A;  1ONL A;  1H9R A;  2XSC A;  3LNN A;  4PV1 C;  2PQE A;  2Z1C A;  1BF4 A;  3NHH A;  2WKD A;  1Z47 A;  2XWJ B;  3BG3 A;  4PMB A;  5CV7 A;  1EFI D;  4NMZ A;  1PRT D;  3OMC A;  1PDQ A;  2F0L A;  1AN8 A;  2IX3 A;  1A6X A;  4KY6 A;  4RH6 A;  3HOW B;  4CKB A;  5IGF A;  5J39 A;  2NUC A;  3NSW A;  1EEI D;  3GTJ B;  1M8A A;  1B50 A;  4C3I B;  1SNM A;  5HGT A;  1YNJ C;  3GQB A;  1O78 A;  3VYR A;  5C3W A;  3A8J E;  4RA8 A;  1Z7T A;  2E74 C;  1Q8I A;  2CW0 C;  1ENA A;  3HOY B;  2B2V A;  1CK1 A;  2NVX B;  3HRZ C;  3L3O C;  2IPK D;  2A6E D;  2KED A;  3A8I E;  2EY2 A;  1STE A;  1TKW B;  2HDM A;  1MSH A;  1EY8 A;  5CV8 A;  3M4Y A;  1QB5 D;  2EYO A;  1KTK A;  5KGU A;  1STA A;  3HEJ A;  2VNU D;  1LTB D;  1JCK B;  1WTX A;  3GTM B;  3MZ5 A;  1EY0 A;  1V8Q A;  4ILW A;  1F9S A;  1HUM A;  5BN4 A;  3K5N A;  1QJO A;  1BCP C;  2F3V A;  5NUC A;  4DXF A;  3FPP A;  3MXN A;  2H4O A;  4X3K A;  3C3L A;  2HCC A;  3HOX B;  5JEA J;  5C0X G;  1JWM D;  3J80 L;  5KRU A;  1W6J A;  3X3M A;  5IGE A;  2DN8 A;  5DAU A;  2PNR C;  1HUN A;  1E0B A;  1DOK A;  4IFD H;  2CQA A;  2PCF B;  5CBE E;  4DF7 A;  2BOS A;  1CQV A;  5E4X A;  4U67 3;  1EWC A;  4IQZ A;  3U9S A;  4LMQ D;  3GV3 A;  3SK8 A;  2PMZ B;  1ENF A;  5DNF A;  1X3Q A;  2F1M A;  2B2W C;  2Z8L A;  1LTG D;  1STN A;  3OW7 A;  2JA6 B;  3S2H B;  1AEX A;  5I2X A;  2PYK A;  5EQ0 A;  1SYD A;  2F0M A;  1G2T A;  3TZD A;  1RDP D;  4TKO B;  3D4R A;  5A2Q L;  5M3F B;  1RF2 D;  1PTO B;  4OO1 I;  4KKS A;  1YNN D;  1QOH A;  1G2S A;  4XTC S;  3Q24 A;  3G7L A;  4XT1 B;  1NR4 A;  2EZV A;  1ZYR C;  2KVM A;  3IL8 A;  1Y8P B;  2QCP X;  5C0X H;  3TDQ A;  3KBG A;  3MC0 B;  3A7A B;  4IFD J;  4C3H B;  3S1M B;  2F03 A;  3DM1 A;  5C4H A;  4ZKC B;  1PZK D;  4TRD A;  4X3T A;  1D5M C;  1GOZ A;  3AU7 A;  3K5O A;  1VF7 A;  3M85 A;  1U4P A;  2XRQ D;  1TY0 A;  1S5D D;  2AUJ D;  1WD0 A;  1TT2 A;  2V4D A;  3DMU A;  1HQR D;  2A68 C;  1SJE D;  1LTA D;  1SNQ A;  5FO9 B;  4IAL A;  1H9S A;  1XX8 A;  1BBX C;  2CW0 D;  1HA5 A;  1STG A;  4ZQ3 A;  2F0S A;  4X3S A;  1PYW D;  5T1I A;  5I4D A;  4M1U B;  1EYD A;  1PZI D;  1AZQ A;  5CBA E;  1AW7 A;  3HOV B;  3M3Y B;  3VR3 A;  2LFN A;  3P1H A;  4HMI A;  3H09 A;  3NE5 B;  3NP8 A;  1SSO A;  1TWH B;  1I4H A;  1QWY A;  1K8M A;  5I2Y A;  3NTI A;  2NVY B;  5E1F A;  2K5D A;  1G29 1;  2PZT A;  2SDF A;  2L4N A;  1H9K A;  2FJ2 A;  5EPL A;  1SFO B;  4R8N A;  1MBY A;  2EJG C;  4HSP A;  3TP5 A;  3FDT A;  1OXV A;  1SEB D;  2PW5 A;  4DAV A;  4DAP A;  2H1E A;  4J6H A;  1S5F D;  3S2D B;  4DK1 A;  3GV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...