2EEFA

Solution structure of the cbm_21 domain from human protein phosphatase 1, regulatory (inhibitor) subunit 3b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
156
structure length
156
Chain Sequence
b'GSSGSSGAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 1, regulatory (Inhibitor) subunit 3B
publication title Solution structure of the CBM_21 domain from human protein phosphatase 1, regulatory (inhibitor) subunit 3B
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 15
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2eefA01
2M83A 2VQ4A 2EEFA 2DJMA 2V8MA 4BFOA 4EIBA 4BFNA 2V8LA
chains in the Genus database with same CATH superfamily
2HLEB 4TM9A 3APDA 3N1PC 4ZUWA 4RDBA 4JKMA 1R3HB 2X53A 3KGRA 1D7DA 2DQEL 4N0UE 4MZ2A 4G7YL 4H26B 2X28A 2VIRA 3OJ2C 1ORSA 2YD5A 5DZPA 2ZXDA 3BT0A 4L3EA 5LB1A 3TO4D 3L3HB 3KPRE 2DTML 2DEYX 2VL4A 1AR2A 1QOKA 1X5MA 2EYTA 4X6CB 2EH8H 4ONGL 1JWMB 2B15A 3EGSB 3O2VH 3VSTA 3WNPA 3PQYE 3SCMC 3CLEH 2D03H 1JP5A 2FD6H 4PJXB 4ZQKB 1HAUA 1HEZB 3MBEB 4AY0A 3P30H 5D1ZB 4M56A 1F58L 3PWPB 3SJVD 2JQAA 4IDLA 4W6XB 3LS5L 4K2UL 5EIIG 1KIRA 4D0DB 1E7VA 3F12B 3QUZB 5I0DA 1VADA 1RHHB 4AQZA 3K0WA 1T5WA 4IK7A 3AU1B 2CHNA 3HZVA 4X6CF 5I8EB 1M71B 4WIQA 5BXFB 4L1BA 4EVNA 5KW9L 1S5IH 2D4FA 4UIMA 3DUUA 4JHWH 2Z91B 5HHME 3W11D 2DJUA 3KPLA 5BW7C 2BJML 3OKEB 4K3HA 1AGBB 2QPEB 5CJQL 4Z5RB 3D39E 4L3CA 3I6GB 4HLJA 3SQOH 2X3BA 5CEXA 4D94A 3R18A 1TTAA 2XG4B 4NM8H 3WAJA 5DVLA 1KLGB 4UB0H 1G7JA 1CGYA 3QZWB 1U8IB 3ULUC 2HRLA 3HB3B 1BZ7A 4O02H 3UCQA 2WMPA 3FFCE 4UTBL 1GC1C 2DWSA 1TCRA 3LNEA 3QXAB 4KROC 1KGIA 4KVPA 4EI6A 1BSIA 3GRWA 1W91A 3QFJA 5BO1L 4HYTB 1RZIA 5IW6A 3DX6A 2MNWA 5DA0B 5F1NB 4DVBB 3BO8A 1XGZA 1G6VK 4EUPH 1K6QL 4OR1A 3BLKA 4FL4C 4H88L 1T0OA 2M2DA 4UF7C 3ZZ1A 2HRGA 3W0WD 1PW3A 1R9FA 2VL5B 3UYOD 1I8LC 1K8IB 4FRWA 4F1ZA 2ATPA 1T3FA 2BOCA 5T3XL 4HAKA 2VYRE 4HIXL 3C8DA 5FO2A 3UAJD 1KB5L 1OAXL 4PBXA 2WBWB 2AHIA 1I1FA 4JHZA 4NJ9L 5EU7C 3WFEL 3VD4A 2Q76A 1IGTA 1YMMA 3KYOB 3CSYB 1E27B 4OLYL 2C1PB 4NQCD 1USQA 1AJ7L 1M9WA 4FXGA 4HFWA 4ORGB 2YLKA 3MV8B 3KGTA 3HC0A 3QPXL 5I2IB 5MEQA 5T5FH 5I6MA 3W2DH 2WWNA 2CDGB 3EHBB 4Q58C 3KM1A 4S1DD 3S35L 3FSAA 4LCWA 4AVHA 2X89D 1MAML 3QXTA 4A1RA 1VAHA 1X7QA 1IAIL 3TCLB 4F58H 4GRLA 5EBMB 4ZFFA 4M8RA 4AM0B 5KBMA 1NJ9B 3H53A 5KOVC 2C9AA 4PGBB 2A74B 1MHHA 4PJHE 4P3CH 2ZKHH 3UOAB 2AS5M 1FNEA 3MOBL 1X9LA 4PJDF 4LVNC 3IKCB 1V5JA 2V5YA 4Y7OC 5FM8A 3MRLA 3VVVA 5JUEH 1N0LA 4Y4KC 3ZTNH 2EH7H 3Q1EA 1PZ5B 5DJ0B 4YK4B 3ZU8A 1R4XA 2K8MA 5I18L 3DBXA 3L9BA 2HFFB 5D7LE 5KSUA 5C0CE 1E5ZA 3X17A 5KYUA 2A9DA 2NXYB 4KKAC 3PXHA 4GXFA 1YPZB 1XSJA 2CUMA 1M7DA 1S78D 1KY7A 1OL0A 3V79C 3LSOB 4LCCA 5CJBA 4HX1B 3CAFA 4XI5C 2Q3XA 3OAYH 3ZSTA 3SKNB 2YN3A 2FO4B 2E27L 4Z7OF 3O6KH 2I7SA 4K5LA 4DQOH 3MO1A 3NSCA 4K7FA 3IT8D 1YEHH 2LTQC 4S2SA 3Q2NA 3BDXA 4MXVF 2F61A 1V3JA 3A4AA 4KC3B 1YPZF 1CC3A 3MI6A 2ZOUA 1UZGA 2Z92A 3POCA 4TQPA 3HMXA 2BSRB 1TUPA 3HJEA 5CU9A 3VXSA 2ITFA 1CTNA 2Y7SA 3V10A 1U8NB 1MVFA 3WIIL 2ADIA 12E8H 3OKMB 3KWXA 3UBFA 5BS0B 2WLIA 1NKGA 1ZTXL 2Y36L 3L4ZA 3P54A 5DJ8A 5ISZA 3MGOA 4ELKA 3H3KA 1R5VB 4N3TA 1NBYA 1MW1A 2OJEB 5D6DA 1J1XH 2ESVB 4LKXA 4M62H 3MFFB 1PY0A 1MRCH 2CAKA 2J43A 2XRAL 5J6GB 5I0YA 3MA9L 1ZS2A 3GXUB 3ROLA 2VDRL 1DZBA 2FVNA 1NIEA 1Y1DA 5A6MA 4PAZA 3EH5B 3SO3C 3VU1A 3KCWA 2DOCA 2XCMC 3T1FA 3UTSE 3CIQA 3LEXA 5FFLA 5F3BB 2AABL 4L8DB 4O2CA 1FBIL 3PFQA 5SWSA 4WW1A 3RKDC 1JMZA 3N85L 4PJAF 2DH3A 5CM1A 4XCYB 3O3DA 5SWZE 1WLHA 2Y5QA 4HK3J 3S5LA 1SMAA 4QYAA 4L8CA 2A7BA 2BIMA 3D08A 4HAFA 4AV0A 5DEGB 4WI2A 4HLEA 1B0GB 4NN7B 4XO9A 1YEFH 3OZKA 3PWVB 1G1OA 2DWDA 3H85A 3BDYH 3OG4B 1OO2A 4FERA 5G55A 5DVMA 4WSJA 1G6RA 4L9LA 3BEWB 3U0WL 1U3HB 5DLLA 2NR6C 5D7KE 2BVPA 1YEDA 1XR8B 4X8CA 4DN4H 2QZQA 1K2DA 5JW4N 5ESQB 4KO9A 3EYOA 1AS8A 3VB9A 1KELH 1QBBA 2DL9A 2Q9OA 5EH1A 1WA1X 5LJYH 3D8MA 2VDMH 1MIEH 1MQKH 3ISWA 3OHMB 4R2GB 3MJ8B 3EJZD 3TF7C 4MJIE 3UABA 4YDMA 2DWYA 1DBBH 5DJYB 2VMCA 5CD5D 1MFCH 5FFOA 3QEHA 3UTTB 5CSBA 4PI0A 1OCRB 3PNWA 3QUMA 1T5XA 1OZUA 4P49A 2AERT 4KO7A 2XWTB 1ASPA 1P7BA 1H0DB 1DBJH 3SD5A 3KL0A 2GK0A 4R3SA 1S7RB 2WIMA 1F4YL 1RI8A 4F8PA 2ZTBA 1CFNA 1T1ZB 4QXVA 3D09A 4P9MH 5TFSL 3IGAB 2DIEA 4C54A 4CJ0A 3E1ZA 3QO1A 3V8CA 1TYEB 3NCFB 3NGBB 4JCMA 1DR9A 4M3KB 3AFLA 5IY5B 3HR6A 4Q74A 4HJJH 3VQLA 5GRYA 1EFXA 2WUBL 2YBRB 3GRGA 4N5EC 1A66A 3GJEB 4OM0H 2OTUA 1FZKB 2XVBA 1J0KA 4WWID 3AS3A 1JD9A 4QHPA 4X4YA 3UFIA 1S7WB 1SJEA 2HKAA 2IBGA 3G5ZA 4IOIA 1KIPB 2AXWA 5F0JB 3TFKD 4KV5E 1SXZA 4YHPB 1I31A 5KSVB 4H0LC 2VDKH 1ANUA 1FZJB 1ZD6A 4NNYB 3DVIA 1UQSB 2YD7A 1TYJA 2CKBL 1BZQK 4L0YA 5B7FA 2DICA 3C8KB 1U8LB 2B0SH 3ZTJH 1FYTA 1ZHNB 2UVFA 1CCZA 3VGGA 4G83A 1UKTA 2YN5A 4IHBA 4DP7X 4I85A 3QUXC 3ZE1F 1L9OA 2Q20A 3CPUA 1OALA 5F7MC 4WO4D 4PRNB 2NXZB 2PW2B 1EZLA 2ICEB 3BVNA 4OUUB 4X0NA 1OP3H 3TFBA 2J25A 2RTTA 2E3VA 4URKA 4CAGA 5E9DB 5A40E 1A9BA 3GKZA 3NCEB 3PWLA 4WGKA 3KS0H 3ZK0A 2NY0C 3B43A 2H3NB 1O7DE 3SE8H 5GISH 5C97A 3TEYA 4JY6A 4DPRA 3IJHB 4ZXBC 2WANA 1XVSA 3FQTA 1TMQA 3GK8L 5CO1A 4NDMA 3ZZSA 3DRTA 3U79A 1JV2A 1EVUA 2CGZA 2WXGA 3C8HA 3QJTB 1KJ3H 1UEMA 1BAGA 1DQJA 1MI5B 1P0SE 4Y5VB 2K9FB 3KNBB 2R2BA 2DQCH 2BNQE 1ADQL 5CLZA 4MA1B 3QZOA 1LMKA 3EOYG 3WEMA 3ARPA 2IIJA 4MNGB 1LP9A 5D1ZD 5JW5B 3RNKA 3PWPD 1AGEB 3LZPA 1OPGL 4F15B 2V33A 3FDWA 3MRDB 5DI8A 3RFZC 3PCYA 4ILDA 3UJJH 3M1BA 1HIMH 1UACH 5F1IA 1BVNT 5KANI 3JBG7 3L95A 5CD3A 1RVFH 3IDIA 3V4PB 3ZL1A 3EJCA 3Q5OA 3WEBA 1HZKA 1S7XA 5DHVB 4EOWH 4NERA 4UBDC 4AYGA 2IH3A 3AJ7A 3OGOE 4AX3A 1JWSA 3PV6B 5B1JA 3KGUA 3U46B 3MXVL 4XR8C 2J8UB 3ARDD 4G8GA 2XTJB 3RPIA 4CW1A 1FZMB 1DZ0A 2DDQH 2R9HD 3SPVA 3L4WA 2Q7YA 3MRCA 3CZNA 3INOA 4YX2H 3SGEI 5I1HL 3N0PB 2YPKA 3IXTA 5K59E 3CCHB 3SEPA 1JNNL 3Q43A 3EBAA 2VXUL 1MLBA 4UI2A 1J8RA 3PGCA 1ZGLP 1FUNA 4PJBF 5C3LD 4ZMQA 4B97A 5GRUH 3KLHD 5DHMC 5T1DH 3F7YB 2XQYA 3HB3D 4EXPX 4WKZB 2E9BA 4GAYA 5D4HA 2OXHA 3AMLA 4KRNA 4LPYA 2R0ZH 2WC7A 5DJAA 4LOUD 2XX1A 4JFEA 4ZUWB 4O00A 2CUIA 4POUB 3H3PL 3ESNA 4P3DA 1T04A 2ZKMX 1RY7B 2VXQH 1OWWA 3H6AA 1MKFA 2DM3A 3NJJA 2J1XA 5HDLA 1SLVA 4Q6YA 3MJWA 3UO8B 2WLZA 5D4JA 3EDEA 3FONB 1TZGL 3I6KA 3BVTA 1H3WM 4AV5A 4E42A 1T1YA 3K7UA 4LCVA 2OZ4A 2R69L 4KQ3H 3KW7A 4JX0A 3LIZL 4HKBA 2H1XA 1U91B 1FNFA 1T5WB 3MV8D 1N5AA 2DPKA 1WZLA 3HZVB 5JIDA 4HWZA 1Q9WA 2CG9X 3AC0A 3DX8B 4LGPB 5HI3D 4JPWL 4P5TC 4QY8B 4OZHE 4TLSA 3NK4A 4UIMB 3NIDE 4OZ4A 3MRPA 4FCHA 3KPLB 4XNYL 3WMSA 1HCFX 3D7PA 3TA3A 1ITBB 1R19A 2A9CA 3A67L 1I3RB 3GSQA 3M7FB 5C6WH 1O6SA 3L16A 5BRZA 1MCJA 5AVYB 3GXTA 3VFUA 1U2CA 5KZCD 5KYYA 2IF7A 1HHGA 4KNUA 4OY9A 3SGDI 3PWNA 1RUKL 1DJSA 3MLTA 1BF2A 5TE7L 5CGTA 2IANE 2N7SA 4MJ6A 4GQ9H 2Z4QA 5IB4B 1ZEAL 2H7WA 2JWYA 2ZOOA 4WU5A 3IWUA 4TSAH 1OARL 1BZ7B 1FGNH 1PKQB 3KPPB 4AE0A 3MLYL 1HHIA 4G9DB 5IWLA 1TCRB 4DP8X 1LK3H 4A2HA 3CHRA 4DK5A 5I15H 4BQ8A 2C34A 4UINH 4HUVA 5IW6B 1RZIB 3NA9L 3L3JA 3HE6D 1GVIA 3OMNB 1WH0A 4BKLA 3QEQB 3BO8B 3ZHDA 3BUDA 1K5WA 4JKNA 5D70H 3VXOA 1BYNA 4LFHD 2UXGA 4P2OA 3ZQWA 4NRXA 5L4FA 1BBJA 2EXYC 1A22B 4HUUA 3INUH 2BZ7A 4KUZH 4Q2ZA 4DO4A 4N2MA 4BJLA 1GTNA 3VO0A 1OF2A 3QW9A 4LKCA 2W0FA 1EO5A 5IMOA 4AGQA 3SJVE 1I1FB 1RUPH 1SEQH 2H32H 1X6LA 5CP7A 4WF7A 4ZD3H 4CC4A 2Q76B 1IGTB 1YMMB 2AW2A 1H3UA 1IBYA 1ZHLA 4CU8A 1U3YA 2NY1B 4NWTH 4FXGB 2Q87A 1HXYA 3RWFB 3U36A 4BE6A 4HWEH 4X98A 3HC0B 5BS0D 2PW1A 3F6JA 3FUJA 5IMMB 5E1AB 1AC6A 1OT4A 4GJTB 1B2WH 1UZ8A 5IF0B 2AJSL 3EYFA 4TSCH 1QNIA 3E8VA 2KT6A 3BIAX 2ESVD 4OTXH 4RRPA 1HTYA 5DT1H 3ZY7A 4ZFFB 1IQWH 3O6ML 4O02A 4QNPE 5GZNA 1TKWA 4WI3A 1JVLA 3ZYIA 2FX9H 4JO3L 3UGEA 1B88A 1IAKA 2ZPKH 3I74A 3VQ2C 3ZUCA 1IC1A 3FC8A 2ITDA 4NWUH 4P46C 4KOCA 5MP6H 4EAEA 4M5SA 5KJRH 4RAVA 4UT9H 4X7EC 1YVLA 4A68A 5IHWA 1N0LB 1Z5HA 1KBGH 3HNTL 4WHTA 1TJIL 4L8SC 5KVEH 1GY2A 1VPOL 4N8CL 3GJFK 5BVPH 2TRHA 3DBXB 4I0PD 5KUKA 1NMCB 4POZC 5FYKU 4LAQL 3PHOB 3RIKA 1EXUA 1KLUB 4XN8A 5HDQH 5KYUB 1JFQL 3GXPA 1AS6A 2YAMA 1QG3A 1M7DB 3RX9A 2P8PA 1CI5A 4LCCB 4DGYH 3DETD 3WFBH 3CSGA 2F58L 1SYSA 4U1KA 5JNYB 4KDTC 1LWRA 4KJYA 4Z7UF 1VFUA 4OJFH 4R96A 5E2TL 4K7FB 4MXQD 3O0RL 4PJFA 4S2SB 1WDAA 4OFIA 1MXGA 5EOCJ 3GMOB 3H9ZA 5T5FA 1MCBA 4RX4D 4HIJB 3VFRA 1HH9A 4GUQA 2Z92B 4HC1H 3M6DA 4JG1H 2PO6C 5I17A 3O9WD 4NQCE 1QSFA 5KVFH 5L6YH 3BGAA 1ORQA 3T0EA 4R2GD 2OYKA 1H19A 2WJ5A 3VU2A 4KTYA 2C9XA 1NCGA 3FRPA 3E3QC 4HQQH 3S37L 3VM5A 4AIOA 4ZYKA 2BXYA 1SN0A 1MHEA 4RWHA 2FX8H 1FNHA 2A6KB 1HN1A 3QZLA 4QRPE 4YDKL 1KB5B 3HKZA 2F74A 5D9SA 5DJ8B 3UTTD 3X1NA 5ISZB 1CLOL 2JJTA 4HGKC 3L2NA 1OCZB 2F8OA 1F18A 4GUPA 3NZSA 4ELKB 5I75C 2OYPA 1NBYB 2CIKB 3APMA 3QIWA 2CGRH 2KBGA 4B41A 4FFYA 3ZDXE 1VZIA 3ARBA 4QRQA 2PP9A 2XQYK 1HL4A 4GRWE 4ICWA 1MCWW 1K4DA 1EUUA 1Y6NR 2GJZB 3JTTB 4XCCH 4OZFA 1X5LA 1KJMB 1JFHA 4K8RC 3GMQA 2YARA 5HGBB 3K6IA 2EYSA 1XF5A 2P80D 4E9WA 2A5UA 1A5FH 2QEJA 4HHAB 1N67A 1O9ZA 3IGKA 2YAEA 3MRRA 4LDEB 4M7ZC 2VJXA 4NUMA 2XQYG 1C1EL 1ZA3B 3DPBB 4MQXC 4L8CB 3KPNA 1M7UA 1OAYL 3WN5A 4KK8C 5I76A 4G11A 3DO7A 4N3UA 5IFHH 3ARFD 1SOXA 2K70A 1G6RB 3U4EB 4RMQA 1C08B 1LE9A 4CBZA 2FT6A 5DJDA 1OW0A 3GS4A 4LCUB 3RI5K 4ZTOL 3AXHA 4KRPB 4BSJA 4PV1C 3Q05A 5CR1A 35C8H 2X70B 1BEYL 4ZPTA 3T6QC 2BWIA 3UZQB 1UUNA 4I3RH 5EU5A 4KNSA 4XMWA 3P73A 4Z7VF 1VZHA 3PP3K 2YPVH 3V6OE 2DKUA 3HS0A 1J5OL 2NY6C 4XVTL 2H0EA 4UNUA 4JZOA 1UKSA 3DIFA 3LQAC 4RRPM 5A7EA 5B1KA 4OZGF 2YZ1A 3PABB 3VXRD 5CJ5A 2WQXA 1TZOA 3HI1A 3TJHD 1NOLA 3R06A 1L9RA 5DRZB 5E70A 3QUMB 1T5XB 2AVGA 4FXTA 4FG4A 3VFSB 2QVIA 4LSDA 3VD2A 2UWEE 4YSCA 1EUTA 4C4UA 3EH2A 3S36H 2PXYD 4FMKA 1JHKL 4AJ0A 2IVFC 1A9VA 3FO1A 2PYFA 1CFNB 4ZG1A 1E4HA 4I48A 1DBMH 2HRPH 5F7UA 3H42H 4ZMPA 1PJ9A 1E30A 3D2UA 3FT2B 5GRJH 1KN4H 1EFXB 1NOAA 2EYRA 1NGYA 3TN0C 2B16A 3BP7B 2PPEA 4A2EA 4P57A 5LNEA 5DHEA 1IJNA 2ENYA 3S3BB 4H8QA 2OTUB 4KMTH 4M03A 4ABWA 5F1KC 2WGXA 5FYJL 2BOLA 5D8JL 4G6KH 1AXSB 1UWGL 3G5ZB 3ULUL 2QV4A 1XIWA 5C9KA 4QF1A 1FC1A 4JQVA 1BLNA 4U6HB 1GC1L 4PP1C 4PRPD 4FG6C 3SDXB 2XTJD 1QKZL 2X05A 3U2JA 4GG6E 4OJAA 4YDVA 4YPJA 2Y23A 1SJVA 1WE5A 4N28A 5AYUH 4LXFA 2FUQA 4GMTL 4PY8J 3OHXC 3NCCB 2Z6FA 3VWKD 3F58L 3UCRA 2B1HL 1T6BX 4AUYA 2CGYA 3GIZL 4AKQA 4A7TA 1KEMH 4U1HA 3BPOB 3G6JB 3N6YA 2EE9A 5GGVL 4IMLB 4M48L 2XKUA 5AZEH 4PRHA 4YQXL 3WFZA 2R7EA 1VGEL 3GXFA 4NN5C 4HEME 4POYA 1A9BB 5E99H 1E5UI 3PWLB 2WWOA 3DSFL 4TRPH 3HHMA 5DQDH 3QFDB 4BFGA 4EPSA 3U7WH 2Z65C 5FHAL 4JY6B 1SY6H 2YAHA 3I85A 1AQMA 3GJFB 1XX9C 2AQ1A 3GXMA 3FQTB 4YO0A 3OJDA 3QBTB 2E7LA 4NDMB 3LN5A 3TT3L 4ISVA 1OTSD 1JV2B 5KS9E 4OLWL 4KTEH 5AWNH 1KB9J 4JFOA 3S34H 3LZFH 2R2BB 4MDRA 3RGVD 1NFKA 2RAMA 4AYEC 4RRPG 1J11A 3BKJH 3K8MA 5B4MD 4YHLL 4DF9A 4WY7H 5B1BB 2WCPA 3QJXA 4JFQA 3NTCL 3TV3H 4JFDD 5DI8B 3SE3C 3VG9C 3WLWC 5F1IB 2Z35B 4MDJA 4L18A 3L95B 4GAGH 5CD3B 3W38A 1Z9PA 2XI9A 3IDIB 4LASL 5CFAA 5IV2B 2Z93B 4YR6A 5T33L 3ZL4H 4PRID 4TTDC 2YD4A 2RGSA 1KNOA 2VR6A 3DJTA 5DO8A 4QLWA 2YUVA 5HVHB 4E68A 1F6FB 2HH0H 2VISA 3HE7D 2P28B 3Q8FA 5FYKD 4FYTA 1SF3A 3C5ZC 5F0LB 4G8GB 5CEZH 4CW1B 2VZSA 3CPLA 4IBQA 4M93C 4PJEE 3AADB 5C08E 3FTSA 5L4MA 3CZSA 3IXTB 3LEYL 3UJTL 2YJLA 4KX9A 5FUZH 1MLBB 1T0NA 4UWQB 1F45A 1DVXA 3PGCB 1P84J 3COOA 5K93A 3T8XA 1H6UA 1L5GA 2NCMA 3FQNA 3FT4A 1ZHKB 4AYID 5BV7H 3EJYD 1D6VL 4JLRB 3ARGB 2CKBB 1IZJA 2C26A 1DBAH 3ZKXB 4ZO7A 2P9RA 3H8NA 4HGMA 2QKIA 2X42A 3V9EA 4PRAB 2NY2D 4Y4FA 1GS7A 1FG9C 3EZJB 2FUTA 2ZNXA 4WUKH 5FKPA 5I8OL 2AJYH 2DKSA 5F7BA 3U48A 2VLRB 2B5IC 4JFZL 4QRRD 5L0QC 4JFEB 2CO3A 2G9HB 2IOMA 3PE9A 3QEQD 3IU4H 3TBYA 3EOAA 4QEGA 3FRPG 4P2QB 3HS9A 2DQHL 4QRBA 2X09A 4UUJB 4KK5C 4X6CE 15C8L 5CJOL 1A7QH 1ACYH 1EANA 3QQ3A 2E4FA 1GJWA 4K9JA 4LAJH 1S7UA 3I6KB 3OAYK 1INEL 3X2QB 3BQUA 7FABL 4PJXE 1Q0XH 5ILTH 4LVHC 4WLCA 3ZMEA 3PWPE 3CVHH 3MA7A 4MJHA 5I1CH 3FCGA 2GYSA 4FNTA 4OCLC 5E5MB 3BGFC 3MBWA 3RL2B 1TNMA 1AOZA 3C09C 4UTAH 3U7AA 4OZFG 2NY1D 1A3RL 3ZDYB 2BSSB 5IQLA 4PVMA 1SM3H 3QDAA 3GINA 4TULH 2P7TA 4NPJA 3D25A 3SKOB 2X6AA 4PJGF 3WFCL 3QJFA 1IJ9A 1M1XB 2VITA 3T3MB 4AYMC 2LLNA 3QDHA 4KOBA 5AW5B 4FA6A 1OGAA 3ABZA 3Q13A 3TA3B 5D4QA 4MVBD 4TQIA 2OMXB 5EULV 3GSQB 1UXSB 3W56A 3SBPA 3IAGC 5IWLC 3VFUB 5BRZB 2X40A 5C70A 2VW7A 4BCXA 2HFEA 3IS1X 3S5YA 5KYYB 1NEUA 3O81A 5DMYA 1VERA 1KDJA 1FFPA 4P9HL 5IG7B 2KPNA 3MLTB 4W9CC 2J12B 3T3MF 2R4RL 1CYXA 4MJ6B 5EC1A 1A6AA 4WU5B 1P7QA 1RLWA 1O9VA 2WKLA 4FFZL 3QAQA 4PGCB 5HD8D 1YG9A 5IHHA 4P2OC 1T7WA 1MCPL 2VXQA 3LKQA 5IIEB 1JGIA 2GSIA 1DO5A 4UZGA 4F80A 4GB9A 2TSBA 4BXSV 4KKLC 3U4BL 2CRYA 3FQUA 4EI5C 2HLAA 3CN0A 2H5UA 3L3JB 3L81A 3V0JA 1KC5H 5AVVB 5ITFB 4HU8A 4P23A 5IJCC 1DANU 3VXOB 4XBGA 3T4AB 2WXIA 3CZGA 3K5RA 1ODAA 4KKPA 2FATH 4KU1A 4R0LA 3ZE2B 4NUJA 1M57B 3GMPA 4HUUB 3RNQB 4PJ9B 3E0GA 2AGJH 4FHJA 3SDDC 3LDBB 5I1KL 2ZWSA 3K0YA 4DEPB 1P9MA 4FD0A 1OF2B 4LVOB 4YDLC 5IMOB 5GQBA 3Q3GB 3UIZA 5CP7B 3WE1A 1A3LH 1MRDL 3C6LA 2G0LA 4O4YL 3MV8E 4JREC 4WEEA 4F9LA 1Q9LA 4UM9A 4JKLA 1YEGL 3CDYA 1NBZB 2VLJD 5T3XD 4BQ6A 4JR9H 1OAKH 3WNLA 1ZE3C 4MCNA 5DRXA 3PIQB 4XWOC 4FNLH 2BNRB 4GXVH 4YZFF 5C86A 1ZIAA 3A21A 4E41D 2X4SA 1F11B 4TSBH 2EDRA 3HC3L 3KL3A 3RHWK 5CLXA 4Z7WF 1IKNC 5IB5B 1MRFL 3PWUB 1UD4A 1ZT7B 5JW4R 4OQTL 2IJ0C 2HA1A 2WK2A 5B39A 5BCAA 1TYRA 1I8KA 5AL8A 5FW7A 1ILUA 5E6YA 4YNYA 5EUOB 2XWBA 1MVUB 4HWNA 2GVYA 2GK2A 1KXTA 3VFWB 3VFTA 2DZEA 1EXHA 3AT0A 1BG9A 4XWGH 4WHTB 5AOKA 4JO2L 3NFNB 1OSZA 5DJCB 4F3FA 2FHFA 1QAWA 4J6RL 1NEZB 2QHRL 4MXVE 5DJ2B 4KZEH 4LPTA 5MI0B 2J8OA 2ZF8A 5KVDE 1YPZE 1G1YA 3LX9A 3VRJB 1NAKH 4G6JH 2BSCA 2R56L 4I3SH 4XBEL 4ZMYA 2DQDH 3IK2A 4FOMA 5AAWC 2X4OA 3MUGA 3EFOA 1JF1B 1UM6H 4AGOA 4R96B 1UXLA 4C83B 1NMAH 4PJFB 4G7QB 4S1QL 1Q9KB 5JR1L 2G4EA 1N10A 1EXGA 4AIZB 3ABLB 1K5NA 2OMVB 5ERWA 2OSXA 4P4KB 3HMWL 5AOJA 3VFRB 5F9AC 3N1GC 2WN2A 4V2CB 4WCYL 2JLLA 3K8LA 4KRMB 5I17B 2BWDA 1ORQB 3SQBB 5A2AA 2CBQA 1L7IL 4FHBD 3WCYA 4AK2A 4K9EH 1PYWA 5BS0E 3P2TA 2ADGA 4FGMA 1MHEB 1BVNP 2Y22A 1U9KA 3FT9A 3QDGA 5D9SB 2F74B 5TPWL 1OP3K 1F2QA 2YD3A 3VI3F 3BPLC 5G2NA 1UYWH 4PJCA 2W9LA 2N7BA 2ESVE 2RQEA 4UT9A 5EEWA 1WRFA 3B9DA 5DHXB 1GZHA 3ZTJG 3QQ4A 2BRRL 1CDCA 4IDJH 3FT0A 2QMKA 3IF1B 2ZUQB 2MNJB 2VDNL 5AOZA 1DQIA 3M1CA 5ICZA 4PBWD 1AIFA 4OZFB 3QJZA 1QSEB 2HT4D 5LCVL 4WHCA 2R0KL 3O2WL 1OE1A 3WN5C 4X50A 3GMNB 2RFXA 4PI2A 4C47A 4IGBC 4ZT1A 3FCBA 2APSA 3EDKA 3EOTH 5J9PB 2EYSB 5MHSE 4ONHB 2YK1L 3CQQA 3V0HA 1M4KA 1YYCA 2QSCH 1JI1A 2W92A 2DYPD 4RFNC 2FAUA 4XC3H 4XX5A 2JJWA 3KPNB 3HFFA 3WFDH 4D3CL 3KHQA 1DSFL 4XVJL 4LQFL 4XTRC 4R6UA 3MVSA 2VZTA 4MD5B 2MCMA 4IS6B 3TXAA 5D2LA 1DBKH 2N0KA 1MJJA 3ECVA 4HC1A 1LILA 3HS0C 3Q6FA 5IK3A 3VJ6A 4GRMA 2XOTA 3WL9A 1LE9B 4RMBA 5DFVC 1UXMA 4LF3A 1RZ7L 5FCUH 4ZPVB 4NO2A 3NIFB 3QIUD 2A1WH 3LV3A 4M1GH 2Y07H 3D69B 1IBBA 4L4JA 4M1DH 1Q0YL 1SOQA 3I2CH 1QSZA 1SN5A 3P73B 3CV5A 3HI6L 1AG0A 5FECB 4MZRA 2B39A 1A7NL 2FLMA 5F3FA 3TP4A 2PETA 1IBDA 3SDYL 2IBZX 4LSSH 2D7PA 4J3UA 1EEYA 4U1IA 3UTTE 5DA4A 4ELDA 4GO6B 3MLWL 3SE4A 2IWEA 3QCUL 1DFBL 5EZPA 3RBSA 3HI1B 5DS1A 1WP6A 2IG2H 2EIEA 3KE0A 2Z1KA 2GHZA 1BV8A 2D2OA 4R4NC 3K2UH 1DJZA 3LB6C 1FDLH 1QLEH 2XIIA 4PW9A 5GGUA 3E6HB 5IBTL 1SBSH 3FO1B 2ENPA 4S1SL 4N2FA 4MD0B 1IGMH 4Q0XL 4AITA 2GSMB 4X42A 2QGCA 1MDAA 3QB7C 4UT6H 3CLFH 5DQJB 2E9GA 4LSUH 3HNVH 3KPTA 2C8NA 4K71C 5CZVH 1NGYB 4HS8L 4J27A 3UPAA 1S7QA 1OCCB 1QPXA 4HUCA 4Y5XC 2DQJL 2X10A 4S0TD 2IGFH 4M6MH 4XZ4A 4FCAA 1RZPA 2E46A 2FBJL 2OMZA 4QF1B 3OKKA 1HHJA 4Z0BH 5IT2H 2P8LA 4U1MA 1PZDA 2LR4A 5I1IL 1HYSD 3O4LD 2XG5A 2QQLL 1DCEA 1WTLA 1FNLA 5L2KB 1Z6JT 2YPVA 1NWOA 4UTCA 1TQWA 5D5MB 4IIQA 4AEHL 4HUXB 4OD3L 4X7TA 5FV1L 3PNRB 2HB0A 4LLMB 5EBGA 4ZOAA 4WEBL 1O5DT 1KXVA 5KBLA 4I0KA 1KBBA 2A73A 3KEDA 1IC5H 3M07A 4IJTA 3TWCH 2E8YA 2FH6A 3VTAA 1SXBA 2YEVB 5TQ0L 2MFNA 3EH4B 4S0SD 3X3GL 5E9DE 1AYOA 3QHZH 2BLFA 1RJLA 2Y7OA 2P44B 4YDJA 2JTDA 5EU3A 4Y0GA 1WAAF 2OR9L 1MWOA 3NSDA 4G6AD 2WBKA 1AVAA 4R26H 2VLRD 1DVFA 5ESVA 2IPTL 3V7AG 2B4CC 5FS5A 1EJFA 1UGNA 2KQNA 4D0CB 4YXLL 1NBVL 3CWGA 3OJDB 5I16B 3GSRA 4EN3C 4P2QD 3LN5B 4XN5A 2CBTA 3V0VA 4ISVB 4F2FA 3SCMB 5GZOA 3UGUA 2DTSA 3D85A 4J3VA 4JFOB 4IBVA 2VR8A 1WBZA 4CDGC 1WFMA 2NZ1A 4LP5A 1UXWA 4MNGE 4ZMZA 2FL5B 2ZAIA 1L3WA 3RWIB 1JOIA 4YIQA 4V33A 3D48R 3KGSA 2YWZA 5B39G 3RY6A 3P02A 1WFJA 1KZQA 5AB0A 4XCNB 2FHBA 5IEHA 4RGNB 1J88A 1ZPUA 2Q3AA 4KXCA 1I1RA 4PVNA 4OGYL 4PJBE 2YA0A 4XC1H 5DD5H 1HEHC 2NZ9C 3AY4A 5EZIH 5J89A 3IU3B 4HSAC 4XGZB 4CGTA 4LSRL 3ASWA 2YPLD 2J8UE 1JYVA 2XTJE 4LEXL 3RWDA 5FFGA 1XF4B 4GS7C 4PB9H 3VVWA 2KERA 1TIUA 4G9FA 3TO2B 1UTDA 1E8XA 1S7VA 4XODA 4CUCA 4NUGL 5IEKA 3SGJC 4PYHA 4A2FA 5E4AA 4BGLA 4Y4HD 3GHBH 1LD9B 3KDPB 5JQ6L 5DLMH 2F19L 5SWQA 2GIXA 4I77L 3T8XB 4XOCA 4DW2L 2DBJA 1AI1H 3MLUH 2WSPA 2I69A 4NSKA 1SY6A 2ITCA 2CNZA 5ADOL 4HCRH 2QKIB 4YHKL 1HXMB 2HSIA 4KJQD 1MWAH 1DJGA 1SXCA 1G7MA 2ZF9A 2EECA 2OM5A 3EYUL 4JB9H 5FKPB 3BSZH 4FL4B 3C12A 4I5BB 3REVB 4JE0A 3F7LA 3RZCC 1CE1H 4GP5B 1IFRA 1HE8A 3DARA 1AO7D 3QXDA 2FE0A 4K3GA 3V4VL 5C6TL 1JPST 1BGXH 1XAKA 5LWYL 4M6OH 4Z3HA 4DP9X 5JOPD 3QQ3B 2Z7ZA 3QUKB 1JPTL 3TYFA 4OV6F 3LRKA 1S7UB 3V0IA 3MLPA 4JPKH 5JXEA 3NCYP 4M1CC 4KVCL 3UYPA 3D9AL 1KCWA 3MLRH 4OF3A 1B0IA 2GFBA 3V5KA 2HT3D 5JHDA 2V37A 3ILDA 2C9UA 4JFDE 1XD1A 2HMIC 2H6UA 4CVXA 3NCJH 3BKMH 1M2VA 3GLEA 2BCMA 3O41A 1JXFA 5H4YA 4K8RL 3GBNL 2RACA 1NGQH 3R7RA 1X9RA 2PR4H 4BFRA 4E9QA 3TEZA 3EYVB 2BS71 2P7TB 4H2CA 3D25B 2BNRD 1IGCH 2BVUA 3Q0HA 3O2DA 2VITB 1A64A 1FSKC 3NPSC 3QORC 4J28A 2VO8A 4MWFB 2Z8WC 2WZ0A 3GLZA 4GLRH 3D1MC 3NJIA 4LVNB 3VGDA 2JQZA 3HRZA 1IT9H 5AW6B 3RE0A 4U7MA 4Y4KB 4J4PA 5G5DA 1JPGA 4ZW6A 3I9GH 3QK0A 1FFPB 1IC4L 1PLGL 2WPGA 4JCWA 2IQ9H 5IR1A 1PKQE 5EC1B 4RMWA 1DUYA 4EI0A 5EU4A 4GKZA 4CU6A 5HDRA 4HCGA 5LO7A 4L4VD 1CFQB 3HRPA 3LKQB 4YGVA 5PAZA 2W91A 2GSIB 4W9DC 1Z9LA 5T3ZH 3HR5B 2DM2A 4JRXA 3FQUB 4QRRE 2B9AA 2HJLA 2HLAB 5FYJU 3MX0B 1CD0A 1RZGB 1UA6H 3QEQE 4MCZA 4ZMLA 1HS6A 3LQAL 2HJKA 2XZCH 2FEDD 4X7SL 3N9GL 1AQKL 1RUAH 3OL2A 4P23B 3TM6A 5HHPA 3CVHA 3BKYL 3CK0H 5IB3B 5ITBL 2QKSA 4XBGB 5KBPA 1LO0H 1N64L 3GO1H 4ONFH 3SBWA 4Q97A 5B38B 1MNUL 1FJ1A 2L7EA 4R0LB 4UTAA 3AGWA 4NUJB 3PHAA 1OP5K 5HHVL 5I1EH 3ZKMC 1QLFA 3L4YA 5CUSL 4P4KD 2VCOA 5FW6A 3P3SA 3TPKA 1KCVH 2CO7A 1YMME 4U33A 3WKQA 3UO1L 3QT2A 1T66D 3KYMB 3C6LB 2P5EB 3WGUB 1ROCA 1Q9LB 3C2AH 2NLJA 2ROXA 1MCHA 2DWEA 1U0QA 2QMJA 3NJGA 3OLGA 5HY9A 4Q6IA 1YNLL 2OJZH 1UD6A 2X4NA 4Q4EA 5DRXB 5IOPB 5D1QC 1QPKA 2H47C 2PUQT 4TUJA 1D5ZA 2X3CA 3KCPA 3S2AA 2Y2YA 4G2AA 4L4TD 5GXBB 1NKOA 3LMJL 25C8H 4P8QA 4P07A 1D6EA 1BFOB 1EHKB 4Y16C 3TEUA 3BESR 3OPZL 1AY1H 4UZSA 1I8KB 2G2RA 3PU7A 4KVNL 4RAUB 4YNYB 3HZKB 3SSGA 2XWBB 1IBZA 4PWHA 4B9ZA 3MJ9H 5KTEL 4HCIA 4NJAL 4Z7UE 1N3NA 4HZLB 3ZOAA 4NBZB 4BFIA 3N50A 4FF9A 4K3EL 5F8RC 4NO3A 5C1MB 4G42B 2RH0A 2XLLA 3FFDB 3B9KA 4NAQA 4K3DL 3LRSA 1DANT 3RA7L 2Z8SA 3DV4B 4P2AA 4X4ZA 1D5IH 4N2CA 5A3IC 3BUYB 4XN2A 1O75A 4PW4A 2JCCB 1RZFL 1JRHH 1NDMA 1JHLL 4J3OH 2HX7A 1CICA 4PW3A 1BF5A 2XV3A 3P9LA 4OCYH 3I02A 1K5NB 5CINH 4YPGA 1EJOH 3IAQA 2EC9U 5C9JB 3JXAA 4PJIB 2B2XH 2FTAA 5DRNA 4XP1H 4CADA 3H6JA 2JCCF 1EAJA 1RMFL 2F53A 3NH7L 5LXVA 1S9YA 3DMMC 1LEKB 3NFSH 4AQEB 3B6SB 3X13B 5I8CA 3VGAC 5ISZE 5D6CA 3D0VA 1UASA 1QFOA 5GSRA 3FB8A 3D3VB 4E41E 4HUWB 4JJHA 1NCAH 1WZ1L 1LGVA 3KPQA 1E8YA 1J05A 4HKJB 1RPUA 1O5PA 3QQ4B 5HVGB 2I27N 2NZIA 1G7LA 2DQ6A 4XO5A 1MG2C 4YUEL 4ANXA 1IGFL 5DMGD 4U2ZA 1CDGA 4HMCA 1WV7T 2GBAA 2G3ZA 3OXSA 1AIFB 1WFOA 1PLCA 1Z0MA 3GXDA 2VMFA 4YBQC 1MELA 2RFXB 3IYLW 1HCYA 3RVXC 4Z3JA 1LM8V 1RIVL 5C07D 2CMRL 3CUPA 4IBWA 3KVPA 4DP4X 2I32A 2E86A 4BELD 2E6PA 1NGZA 1T83A 5J1AA 1A9EA 1QASA 5F7EH 3GD1C 2WHVA 4XMLL 1GGYA 2BDNH 3O6LL 4P48A 5AOIA 3VWJA 2HVJB 5HHOA 1NC4A 4F9PA 1E4KA 1JZ3A 4AC4A 3KLDA 4A7QA 1WFNA 4H4NA 4QGTA 3U83A 5D2LB 1WWCA 2GTZA 5GJSL 1MJJB 5IK3B 3VJ6B 1MFDH 5L2KD 4KY1H 3DO4A 4GRMB 4KKCC 4KZ0A 4O5LL 4OZGE 2WKOF 1SFDA 1IBGH 5J6HB 1A7RL 4PJ7A 2OP4H 2YKLH 4HIPA 3O6FB 1I7RB 5AAMC 5JZ7D 1CS6A 4OV5A 5I82A 4NO2B 3GWJA 4GP4B 1DJIA 4KJPD 3IPFA 3DUHA 4MQSB 4N68A 1AGDB 5E1HB 2GB2A 5ABAA 4DPCX 1XCQA 2AEPH 3GBEA 2YMXL 5B39B 5DJ6B 1CDJA 3LNFA 3JWDH 3L9RA 1TVBA 1A1OA 1CF1A 2XFXA 4RGMC 1JGUL 3PXLA 1EMTH 4RA0C 4O58H 4DKAA 1G7HA 3NEXA 1KULA 5LAXB 1OE3A 1Q1PA 2JKRM 4IOSA 4OLZL 1MFUA 1EEYB 1QFWH 1XGYH 2IDTA 4NP4H 3UTOA 2CO2A 1UWFA 4APQC 2BY3A 3RX8A 3MJ7A 2O61A 3L3GB 1PIFA 4N1EA 3KR3L 4AMWA 2RR3A 3NACH 2X4TA 3SCMD 1QABA 4K5MA 5I1JL 1B3JA 2XXGA 5KSBF 1JN6A 3BXNA 3ZMRA 5GGUB 1ZTXE 4ZUSA 4OM1H 5L7XH 5MEND 1LO3L 3GMLA 3GNMH 4WWOA 3RFZB 5G4OA 5MEPB 1P5UC 4Q52A 4DCQA 4DJMA 4P05A 4KTDH 3IXAA 2CA3A 3FB5A 5FGBC 1VEOA 4QHUA 4NRYA 3TVMB 1S7QB 4RH4A 5BJTB 2N56A 4X8JA 5B3JE 4PS7A 1U93B 2H2SC 4IEFA 2DD8H 4RMRA 4UILH 3WV0A 1GYWA 3SDXE 4X80H 1L7TH 4G6ML 2P8LB 2FJGA 4U1MB 3X3FL 3N3EA 2YXMA 1Q4NX 1U8PA 3KYNA 1I7UB 4XO4A 2IH9A 5GGVY 5FYJD 1MY5A 1AQHA 4HIQA 3ARUA 3ULUD 1S5IL 3IFOA 5D7IA 1W0WA 3D07A 1NUDA 3AACA 3ASOB 3G6JE 4O51A 4YS4A 3LXBA 3RIAK 3JWNE 1DUZB 1IBFA 4CDHA 5C0GB 4KROD 4XPAH 2VSCA 3HCVA 5CCKH 4LOEA 2WWMC 1XR9A 1DVZA 2CE6A 4ELMB 3T3PF 1INQA 1RJLB 4PU2A 1MCSA 2UXVA 5EU3B 3P0YL 4PJ5B 4QCIB 3WS6A 2A3TA 4M5YH 2WBJC 2M26A 2UZIL 3QJUB 4DEWA 1DVFB 1SYVA 2PWDA 5DUJA 5GRVL 1NANH 3T77A 5C2UB 5HDBB 2HTLC 2NSMA 3S2CA 1JK9A 1CT8B 4JRYB 4MB5A 3NJMA 5IGXH 1FN4A 3D85B 2IAMA 4B9PA 1PS3A 1XGPA 3U6RB 4R84A 4IBLT 5DMKB 4JN2B 3GHPA 1UXWB 2XPYA 5FM4A 3W9EB 2V6HA 2O6CA 1KF9B 1RFDH 1SJXA 1P6WA 1XEDA 4QGYA 4YIQB 5HDBF 5IBUG 4AQOA 5AKSA 3ALXA 2CXGA 3RWJA 3ZPDA 3DX0A 3BEVA 5ICUA 4KHTL 4ZFOL 4U3CA 1E4WL 4X8GA 3W9DB 2MHAA 4KGLA 5KSAA 2J88H 2EUWA 4PTUA 1G0YR 1S3KL 1XGTB 3RDJA 3QHFH 5EZJA 4Y2OA 2BSEA 4N2NA 4Q8BA 3EJQA 5EOCH 4G8GE 1RIUL 3RWDB 2ZOLA 4GG8A 3UADA 5GGRB 4G9FB 2ED8A 2EDJA 4QRTA 4X4XA 2ZONA 4XMPH 1MPAH 4OD1L 3IKKA 4Y4KD 1RSFA 1WCQA 4YEEA 4Z8FL 3ZW3A 4HJ1A 4HUNB 5C0AD 1OZTG 4ANUA 2EJ1A 2KKQA 5JOFA 2J1KA 3HW7A 2XKNA 4WZ9A 1KV7A 5GS0C 3ECWA 4L37A 2ITCB 5CP3H 1ZGLA 5DD3L 3UJIL 4KKAD 1A02N 1RKRA 2Q0ZX 1I1AA 1HYRC 4JMXA 4Y9GA 4XI5D 1S7SB 2VLRE 5ABZA 4UANA 1TJXA 4JFEE 1X9QA 3ALWA 3DRQA 5DK2A 3US9A 3MRQA 4G59C 5GS3A 5JUEL 4N0UA 4PCSA 2G75A 4QMEA 1FNSL 1T4KA 4LPWA 4P2QE 1RJZA 3TBTA 3MROA 3SYPA 4CC0A 2WY3B 3KPRA 4YVUA 4ODVH 4TVUA 2NOYA 1E4XI 4HFUH 4HD5A 5E2VL 3TYFB 1TU2A 3DJZA 1IILE 4PJGE 1NCOA 2I85A 4FQJH 3V5KB 2GFBB 3BJLA 1PG7X 5ELIA 4G8FA 1HINH 2E47A 4NRZA 5EUKA 4BK8A 1B6DA 2BHZA 1J9SA 2P5ED 3RWEA 3ZDYE 4CVXB 5LDSA 1M2VB 4YSOA 1QD0A 3O41B 2VZ3A 2ZAHA 3VYOA 4NUPA 1OIOA 2X4PA 2APWA 4LBEA 4ZAKA 2XZQL 3ME0B 4R97C 2FSEA 3T3ME 3CX2A 4NQDD 2ALWA 1XZWA 1WD8A 4WI7A 4X4KA 3X1GA 4ZZFA 2CDEB 2ZXCA 2D31A 5GGSB 3QQXA 2PNDA 2WQAA 2FWOB 2GI0A 1EHNA 2QQKH 3DBSA 5BRZE 5BV7B 1SUJA 1G9NC 4P46B 3D39A 1TJHL 4N1CA 4HCRA 2BMKA 4XN4A 1A4KB 3VG0L 2OK0L 1ZRUA 3RKDD 1K8DB 4FQ2L 1MWAA 1MIML 1JPGB 1SXNA 3E2HC 5FYLL 5D7JC 4Q9QL 3BSZA 3UIYA 2ISDA 5IB2A 4X6FB 5IR1B 2DV6A 3WE6A 5EU4B 1NCWL 3C08L 2W5PA 3FFCA 4GKZB 2QSTA 4H0GA 4M4PA 5AZUA 5FDWA 4C4KT 2HAZA 4RQQA 4APXA 1T2QH 5LBSH 1ROWA 4JRXB 1OM3H 4ENEC 4M7KH 2HJLB 2UV3A 5M94B 1JZ4A 2OBGA 2NR6D 3PUUA 1W72L 1IKFL 3LH9A 1IKOP 2GQHA 3CXHK 5E7FA 5HHPB 2LU7A 4I18C 4ZFZA 3CVHB 1AOHA 3ZE2E 1S9VA 1WAPA 3HFML 4GMSH 5C0NC 3FU7A 1J7VR 2O6FA 5B7EA 5JDJA 1CBJA 1AMXA 2VDLH 3CMOL 3U7YH 5A1AA 3W37A 1RIHH 2PO6B 1DVTA 1H6EA 3EF4A 3G6DL 5TF1H 1QLFB 4PV8A 2A6IB 3BDYL 1QTPA 1TPXC 5T5NF 3FUNA 1HL9A 2ZOKA 2GITA 4GI6A 4BZ2H 4Z7WE 1P2CA 4LEEA 1CBVH 1I9EA 1NMBH 1BJ8A 4NC1E 2R23B 3V4VB 4HP5A 1X5AA 3DVNA 3OF6D 3WXWH 4OD2A 1GAFL 4JO4L 1F42A 2NLJB 5I75B 1JNHA 3WSQL 4XMZA 5HY9B 2BNRE 1T1XB 5K1JA 1UCTA 4NZUL 4X6EB 4YFDB 3K4DA 3H7BB 3BJ91 4YL4A 3FUDA 4FQXC 2V8LA 4N2GA 1CFVH 4HK0A 4F33A 1RULL 3OKNB 4XN1A 1U92A 5EB9A 3QQDA 3SD2A 3US0A 3HZMA 1A3QA 4PJHA 4U1SA 4MMXA 3MNZA 4Y19D 1D6EB 1JF5A 3D18A 5EUOE 4N5ED 1Q94B 3VFVA 3NT0A 2G2RB 3NBNA 1NL0H 3PY9A 2W0KA 2VUOA 1R3KA 2GY5A 3DJ9A 1KJ2L 4L0PB 3B7TA 2XNAA 1HVXA 1WBYB 6FABH 3WIHH 4P9ML 5D7LA 1ID2A 4XVSH 3VXTB 5C0CA 1IC7L 4LRNH 1EQWA 4NO3B 4K15A 2YAOA 4Y2DC 5AVWB 5M7QA 3UBGA 1CICC 4FYQA 4MKTA 3E1F1 4MD4A 4EBQL 1WA2X 2AVFA 3FS9A 3UYRH 3GSVB 5I1GL 5JIQA 4HF5H 4DZBA 4BWTA 2FDBP 5DD6B 3F7VA 4KDVA 1J10A 1QI3A 3D4YA 3WJJA 4OGQC 1BQLL 4YHZL 3FO0H 4R90H 3QUXD 2OW6A 2B4CL 3GUTA 4RFOH 1OOAA 1NAMH 3OJVC 1DTUA 3AG4B 2HFGL 2NY6B 2H8PA 4JBSA 2GC7C 1BQSA 1TSHA 4P4RA 3B7SA 1CZ8L 3WEXB 1V05A 4YPGB 1IL1A 3RJQB 1YMHA 2VTFA 3QI9A 2MJWA 4CADB 2NY0D 5L88H 1AFVL 1BYPA 2JMRA 1KCRL 4XPBL 5FUCE 4ZXBD 4LLUA 5I8CB 1FH2A 2A77H 2VRKA 5D6CB 5EG6C 4AJVA 1N6QL 4QHKI 2C4FU 1EZUA 5GSRB 1KCUH 1CN4A 4AGPA 2GIMA 2OMWA 4CN1A 2X9XA 4R4FL 4PRDA 3U2SA 3SE9H 2QPDB 3R1GL 3OKLB 3THML 3BE1L 5TK2A 5F7NC 3FMGL 3HTLX 3MJ9A 3ZT7A 1SVCP 4TQ8A 1S6NA 3AXIA 3WDIA 1QSEE 5FO7A 4HS3B 1GIGH 5IW3A 1F1GA 3TN0B 3HC2A 4GKOA 4IMKA 2WTPA 5LNGA 4F9PC 1YUKB 1QWUA 3BI9X 2J1WA 3RUGF 2LAGB 1P1ZA 4JY5H 1KTBA 5EPMA 3G5XA 3LKOA 4A7SA 4K94C 4TQEL 5CWSA 2IDSA 4UBDD 4JG0H 3VSUA 2FH8A 1RK1A 3GMMA 1KGUA 5DC2A 4HMDA 1KPUB 5JW3H 3S5ZA 1K9TA 4ZJ9A 1UB6A 1NC4B 1TQUA 1H5BA 3ECBA 1IM3B 3MNVA 4ODXA 4PIBA 4HT1H 4PGZA 3F2LA 2GTZB 3OHXB 3UJJL 1HIML 5E8OA 3AWEA 2ZCKL 5GRVK 4ETYA 3WGVB 4PFEA 1CK0H 1RVFL 3NIFE 5H2BA 4G3YH 3WS3A 3DX7A 4W4OA 2AJ3B 1AQDA 4OV5B 3UZVB 2EDXA 2N0MA 3B56A 4AQAA 2YD8A 2F5AL 3D30A 2EC9T 4TMPA 3ZIYA 1Q72L 4L3ED 5BQ7B 1R33A 3O8XA 2QADC 2AFNA 4BM7A 5AVUB 1KTLA 3B2XA 4DETA 1GCFA 2CCLA 2F15A 2DDQL 1CLYH 3L9RB 4DEUA 1YNKH 1DHKA 1A1OB 3NZ8B 2L3BA 2P42B 5FB8A 1YY9C 3KWVA 4MJIA 2PCXA 4XCEA 5HHQB 4PJ5D 3WG7B 4MYPA 5LXGH 4EIZC 1TSRA 3RIFK 3B1UA 4UOQA 1QHOA 2I5YL 5AVZB 2EUZA 1QFUH 2O61B 2GKIA 1D5BA 3JVFC 4JFHE 1ACZA 3OTTA 3P0VL 3QIBA 1N4XH 5C0EA 1NIFA 4JRYD 4AJWA 2X2UA 3CN3A 2DMGA 4L5FL 3RJDA 5I30L 1JN6B 1KZYA 4LRIA 4JVUA 3MBXL 4DGVL 1NCBH 2CO6A 2J3SA 4YHML 5GGRY 3E9UA 1DJWA 4EEEA 1MFAL 4DP1X 4NQTA 4ZMXA 3WHXB 4DP0X 1JDAA 3IXAB 2ZUUA 1E4XL 1MW0A 3EFFA 3VD5A 2JQMA 4NRYB 2XSKA 2YC1A 4P5TD 1TVDA 3MRIA 4F93B 2HXAA 5IHBA 4RDQG 1BXUA 4X8JB 2DQTL 1SN2A 3T2LA 4XT1C 1QW9A 1KYDA 3C5ZB 4H0HB 1NGPL 1ZDSA 4OGAC 5DYOA 3UPRB 1JPFA 1XMEB 3L3OC 4GIOA 4L23A 2QR0A 1FH5H 5L2KE 2XY1A 5CSGA 1U8PB 5D5ME 3NFPB 3G5VA 3MKKA 3KYNB 3EDJA 7PAZA 2P3YA 3EYSL 3K46A 3B7RL 4DN3H 3WTWA 1F90H 3CZLA 3E7JA 1AXIB 1TDQA 3CDGA 5F7YC 5GGTH 5D7IB 3BPCA 3LAFA 4GW5A 3ZZQA 3K6SA 3TYGH 3L3IB 4O51B 2HN7B 5I74C 2MNUA 4GOSA 3E38A 4G1EA 2APXA 3DGDA 3BZFB 5CILL 5LN8A 3ZR5A 2EC8A 3FQXA 2A6JB 1XR9B 4GYBA 4X6DB 2B5IB 3STBA 3A22A 4BZ1H 5L0QB 1SUHA 3JUYA 3VSVA 5DD0H 2O5YH 2A0LC 4Y8AA 5L2JB 5DHYB 1RJYA 4QYOA 4EKXA 1SJMA 3NIGF 1YQVH 3M8OL 3CGTA 2C3VB 1JV5B 2EXYD 2VRAA 5BVJA 1FGVL 3U1SH 4N4YB 2VSMB 1ZT4B 2GEEA 2Y4SA 1JDDA 4HPOL 1NFDF 1R5IA 4QHMB 1QFPA 4LCWD 2YSSB 3LPPA 4LVHB 5FOJA 1MFBL 3Q6GH 5GGSY 2BX5A 3LD8C 4ZSOB 2ZWLT 4J12A 4OCXL 2D8KA 4GH7B 1J5CA 1E6JH 1F56A 3BP5B 4BRJA 5CSZA 1I8UA 2AXJA 3RWJB 4RGNE 4AVKA 3GEWB 4IRZH 1JZFA 3QDMD 2MHAB 5TDNA 2JELH 5KSAB 3TPUA 4HMEA 4M4RA 2B20A 4X5XA 1AP2A 5I6KA 2EDBA 1BYOA 3RU8L 4HIIB 1XBRA 4B60A 1RUPL 5EZJB 2NX5D 4Y2OB 5GS1A 1P4BH 4JFFB 5IVOA 4YXKL 4Q9CA 4IRSA 3DYPA 3IAPA 2ZOLB 1AANA 4PVLA 3MNWA 4UIKH 5FYJE 3V5DA 4NWTL 2JKXA 3MV7B 1P4IL 3MR9B 5BPPA 1URZA 4QRTB 4U6VL 3WFHB 2QPFA 4X4XB 3UZEA 3ULUE 2AMUA 4HS6A 4R4BA 1BOGA 2G5BA 3HEIB 5DD1L 3RTQC 5JOFB 2GUOA 5KAQG 3BVDB 4GEIA 4POZD 3VNZA 1CL7I 3CFMA 1IQDB 1KFGA 5JPMA 1ZGLB 1G0XA 3RDTC 4L29A 5IHUL 2MPAL 3SPGA 3GSWB 3IJEA 5FR3A 1FIGL 4PRBB 2IAAC 2X87A 1GY1A 1BIIA 4B95C 3CH8A 3MV11 4NWUL 4JG9A 3R7QA 2UZXA 3DRQB 1ZJAA 4LLVA 5DK2B 1OAUL 2ZWYA 4Y5YC 4P2CG 1JIBA 2XPZA 3MLZH 5TH2A 2A4CA 1GGIL 2AMGA 1ED3A 2MTPA 2V17L 3D52A 3GIVA 4HJGA 5KVEL 1JAEA 3U82B 4LLWB 2IH1B 4ANVA 3KXFB 3WJLA 3SDDB 4M7LT 5CJXC 4DKEL 3H9HB 2R8SL 2F54B 4EZJA 5C09B 4PQXA 2HCZX 5EORL 5EU7E 5SX4I 4M61B 4YDLB 1FVEA 1A7OH 4OFKA 2PO6D 2R27A 4YFEA 1BIHA 4JREB 4YBHA 4F37F 2R2CA 3IN0A 3QHTC 4JNXA 3ROOA 3ZL2A 1XTMA 4HXAH 4S1RH 4XBPB 3CHQA 4G8FB 2NUTB 4EQ2A 4D9LH 4F7CA 3OGCA 4XBMA 1SEBB 1ZS8A 4PD4J 4WEMB 5F9OH 5ETUA 4KK9C 1TTGA 1UWXH 5KN5A 3MRMA 4KGJA 4J1UA 4FE9A 3NABH 4LB8A 4X99B 4B6ZA 4LBEB 5GPRA 1JMXA 4OZHA 3TTSA 2V7NA 4LMQI 2MTAA 2WJ7A 1ETA1 4JG1L 1NC2A 4JUTA 3SDAA 5LG6A 4I0CC 2XWZA 2HKHL 1QLRA 1E28B 1QFWM 2PTUA 2EKSB 1C8PA 1QZ1A 3K1KC 2J57A 3OMZA 3MXWH 5FA3A 3IFNL 2GI7A 4XRCA 4J3OG 3U25A 3EJTA 4HQQL 3E8UH 5CP3A 5AW4B 4YSQA 3ENEA 4K8RD 4TOYH 1ACCA 1ZJBA 5F9WB 3FCSB 1A4JA 2EDTA 4WV1C 4JE4B 4LK4A 1WBXA 1JE6A 2VH5H 2IANA 4FTDA 1JK8B 5B3NA 5DUMH 4ACTA 3B8SA 2J6WA 2PP8A 1HCVA 3HI5L 4YHIB 2FRGP 1EAOA 1E2WA 2COVD 3KJ4B 4PPTA 4BXVA 1MCDA 4FFWC 4MQXD 1MHCA 1D9KA 5PCYA 3BIBX 3S7GA 5IJKC 2WQWA 3A4DA 4Z3TA 4KK8D 4MLSA 3T2NL 5JHBA 2R29L 4RQQB 1FPTH 4MASA 2ZXGA 2KZKA 3UBXA 1U4FA 3S4SA 3CDCA 1Q38A 4FLOA 1HQ4B 1NA8A 4PY7A 4H25A 4YDIL 2GCYA 3BFWA 1FV1B 1ZWIA 2OQJA 2XV2A 3TO4A 1A5FL 4ZFZB 4L8BA 4X7DC 1WWWX 1PBYA 1IGYA 2HUHA 3MMEA 4DO6A 5KVDH 3ZRSA 4JZJC 4ODUA 1O9WA 5FLVA 4OZIB 2NY6D 2XBZA 3KH4A 4JPQA 3GTTA 5IROC 5F3HA 3KDMA 3H4HA 3TIDB 2WVSA 5TDPA 3SJVA 3VYNA 4AE1A 1BZDA 1SBBA 3PFUA 3V7AE 1U58B 2P5EE 3H9SB 2IFFH 4OJDH 4FQCL 5C0FA 1L0QA 1CLZL 3FJTA 2I24N 1FAIH 5DMIL 1K85A 4MX7B 4OD2B 4BKTC 4HLZH 1FRGL 2VM9A 35C8L 3BPLB 3VW3H 1JNHB 4OZIF 5LQBH 5EEXA 5A6LA 2NY7H 2DI7A 1A21A 4PJ8C 4F2ME 2XN1A 5D96C 2YBGA 4HK0B 1IX2A 1EHAA 4PGJA 1HI6B 5SV3A 3DUSA 4K0OA 4I87A 1U92B 4GBXC 3HZMB 2YFOA 4HOXA 4WI5A 1KYUA 1A25A 4IGBB 4U1SB 3Q9QA 3D18B 3TN0D 4AL8H 3VFVB 5LBSA 2FCBA 4LCIL 3P77A 5IFAH 2ED9A 1R3KB 2Q86B 5IBLC 4MZIA 4A2GA 4MNQD 1FYTD 3FT3A 2XNAB 1ASOA 3RVVC 3SY0B 1EAPA 3DTXA 3VXQA 1QX1A 3AU0A 3FF8A 4ZBJA 1QEWB 3ESOA 4PP1D 1PJWA 2JKTM 1MQ8A 3P2BA 2AANA 3CE1A 4QXUH 5L4IA 5DJZA 3J07A 1N5YH 4FN0A 2AXHA 2E7BA 1QBLH 3DURA 5LNDA 3EO0B 1IM3D 5IW1A 2X38A 2JCCE 1QACA 4FYSA 3W0WA 3QNFA 4BZ2A 4OBSA 1RUQL 5KOMC 1KN2L 1T20B 4IRJC 5ES4B 1H3XA 2BSBA 3SBQA 4MAUH 2BC4A 3GUTB 4UQ9A 1A0QH 3UAJA 3VXNA 4Q7DA 3RFRA 2DM7A 1EZVX 4QTIL 4PJIE 4M7JH 1W72B 4U1LA 3IPBA 1M05A 2E7CA 3VX0A 4WFFD 3V52H 3K8KA 3F64A 2OR8A 2VZ1A 4NQCA 4X0KB 2HJFB 3QI9B 4R7DA 4TKWA 1JUFA 3DX9B 4JM2C 4O2FA 1ID5I 3G9VA 3DGGB 3BWAB 2X89A 4Y1AB 3D3VE 4FAAB 4JPIB 4FNSA 1Y6MR 3VTTA 2Q2EB 3AXLA 2MCPL 1E42A 1YY8A 3R8QA 3TNMA 4QXGL 3OLEA 5F7WC 4LU5H 2XICA 5IJBC 3NESA 4NPKA 4WTZA 1UCBH 5AW2B 1YN6A 1CXIA 3QXVA 4RMVA 1MW3A 3WIHA 4AH2A 2Q8AL 4J5VA 1V3KA 2ALAA 1HQRB 3WLWD 3FQWA 3MRHB 1AH1A 1A7PH 4Y5XB 4A67A 1SPDA 2BHFA 1IVTA 1INDL 1C5BH 2FYYA 1EHXA 2CU9A 3K2IA 3T0XA 2I25N 5C7XH 3LKOB 5CWSB 2WKGA 4TTDD 3TASA 1C16A 1B4JL 2Y5TA 1U3ZA 1MN4A 1RK1B 3BUBA 5GS0L 4M43H 5B21A 1QUNB 3C5ZD 4XNZB 5K5YA 4M8UA 2XWXA 1UADC 2XZAL 3TV3L 5BMFH 2V9QA 1KJ2B 4XXCA 5E51A 2K7QA 4ODXB 5F7FA 4Z3FA 4MA8H 4B50A 4D7PA 5KVFE 2EVHA 2K0RA 5GIRA 2NT0A 1H3PL 3APFA 2XQBL 2NYZA 2ZUYA 4AEIL 3RX7A 1PG7L 4AQAB 5KBNC 1E8WA 1Y1UA 1BFTA 3AREB 4JHAH 3C6SA 1UJ3A 3O8XB 4YWGH 4PH8A 1KTLB 3FHEA 2APFA 2AQRA 2DKMA 3V6OA 4OKVA 4OFVA 2E56A 4JM4H 3CZFA 4AYBA 5BO0D 3OQRA 2TSAA 3VMOA 4BV1A 4XCEB 4Z7QB 5K69A 3P4MA 3BT2L 4R8WL 1GYVA 4R5XA 4EN3B 1CL7L 1JTPA 2W9EH 3B2DC 3OKDB 3PP4L 2CALA 3QUYC 1S46A 1DBAL 4XH2A 2UWEA 5K9JH 3QIBB 3EBIA 3WELA 4D9RD 2PCPA 1GMIA 1KCLA 1MAJA 2XJKA 4NCDA 8FABB 4RWYH 2Y7LA 1FA4A 4IYKA 3QO0A 3Q9PA 4Z7QF 2ADFH 4PWEA 2L8AA 5FHBH 3G7TA 5T1LD 3II1A 2UZYA 3O3UN 2COQA 3SDCC 4JK0D 4PHXA 5IVZB 4E5XB 1SHWA 1G9NL 2VSDA 1MJ8L 3GI9H 2DBLL 2F7QA 3A5VA 3DSNA 5H8DA 4DK3A 2Y7QA 3VFGH 3EFFB 3NCYS 1C7TA 4F20A 2YC1B 4Z7NB 1C12A 2YJQA 3JWDC 3OAUL 3RBGA 4AIEA 5IVXB 3UTQA 3VE0A 3PL6C 5ILTL 3ZKSD 4LNRA 5I1CL 2CK0L 5DYOB 1LE5B 4MYWB 2PR9A 1JPFB 3S35X 3JWOH 1UA7A 2QR0B 3CN2A 5E00B 5ICYA 2O5NA 2X6UA 3V4PH 4TYUA 3UBXG 1S8DA 3S4SG 3GUFA 3Q8BA 3WMQA 4GG6A 1MCKA 5DHVH 2WXKA 4E9YA 4O2EB 2XXMB 3I9IA 5EZOH 1BMWA 5C0RH 3EYQC 3IFLL 1D2PA 1I3GH 4PG2C 4P2OD 4Q9RH 1YEJL 2IWFA 4XPTL 4KKLD 1U8JA 1B9ZA 4G1EB 1BLIA 1F4WH 3ELQA 5C8JB 4EI5D 4ZUVA 4ELME 1B4LA 5T1KB 5I5MA 4HEMA 2OMYA 3DVGB 3MTXA 1R34A 4PJ5E 4NKOA 3TIEB 4XOAA 3HNSL 4JFWA 3RZCB 1KXQE 1DL7H 4ADJA 4WWKC 4QYOB 1S2EA 2Y69B 4XMKH 5E08L 3NSFA 5E94B 1R3IL 5HDBE 2WZPD 2VMJA 5E6ZA 3WNJA 4DKDC 5J12B 3N42B 2L7UA 2WP3T 4JRYE 1G5AA 3KXFD 4IK6A 3SDDD 3ABKB 1DVSA 1YHPA 2EIZA 4UDTA 1E90A 2IADA 2Q8BH 5KS9A 1ILSA 4G6FB 4LDLB 1ZSDA 2ZWZA 4G7VL 5ACLA 1M7IB 4J8RA 4WW2B 4BFOA 3PJNA 5KYXB 5B8CA 3LH2H 1KBWA 3EW3B 2ZNWA 1ONQB 2FQDA 5CNHA 5GJTH 1CGSL 2BW5A 4XWOD 5IJVB 3AM8C 2ZYRA 1WWAX 2VLKD 3BUIA 5T8IA 2E0PA 4N26A 4U49A 3NPSB 1VKXB 1AP2B 4PUBH 2XACC 3T6ZA 4KPHL 5GGTA 1PEZA 3VI4B 3BZEA 4JMNA 2X1PA 2F68X 4IHOA 4GSRA 4IRSB 2A6DA 4G9FE 5ALCH 1U21A 1I8IA 3O4OC 4WRLA 2VLMD 3O45A 4FFVC 4PJEA 3TZVC 2HPTA 5CZRA 2EIMB 3QCVL 1OAKL 4JR9L 5C08A 1RAMA 4BZ1A 3QQ9C 3QWRD 4HS6B 4HWBA 1HSBA 5TDOA 1BOGB 3EG9A 1FL5B 2G5BB 3Q2CA 4TPRH 2IC2A 4YDZA 1WT5C 4WO4A 4TSBL 2OJ1A 5EF3A 2CM5A 2GUOB 2BZDA 4N86A 5H94A 4WTXA 4XAWL 4N90E 2K4AA 1BP3B 5ANHA 1N6UA 2DW5A 1V7MH 3IDNA 3K2MC 1IEBA 4RGOH 1FI8C 1IUZA 2OTPA 3EUDA 5F9JB 1BIIB 2VXSH 3GZKA 4J3TA 1DQKA 1IBHA 1TQBB 5AD0B 2DMCA 4H26A 2MOQA 1EGJH 1SXSA 1N7MH 5DJXB 5TH2B 4DUWA 4PR5B 1OD7A 2X0UA 3PDDA 3L3HA 3FUMA 3IRZA 1TEYA 5C0BB 4YSUA 1ERNA 4X7CC 4PGDB 4X6CA 2VR3A 4ZDHA 2CNYA 4E36A 1JWMA 3Q7JA 3EGSA 4MHHI 4IRZA 1KB9K 1FVEB 3OC5A 2WW8A 4PJXA 4W9LC 1HEZA 1A6VL 5D1ZA 4WTZG 1F4XH 3GLAA 3PWPA 3STLB 3K91A 4CJ1A 3QYNA 3H9SD 1RHHA 3RVTC 2YD1A 1Q1JL 1ZS8B 3AU1A 1QTSA 1NGWB 2E9IA 5D1QB 4PVBA 1M71A 4F57H 5BXFA 2H41A 4LSQH 4PTTB 2DQEH 4G7YH 3AG1B 2UZPA 2Z91A 5BZZA 4C56B 4N0CC 1NC2B 3SDAB 4M8QA 2DTMH 4FXKC 4K94L 3OKEA 4Z23A 3ARDA 1AGBA 1Y18A 4Z5RA 4AXWB 4ONGH 4Y16B 3CFQA 1NCNA 3MLXL 3FOLB 2IBZY 4GLRI 4XMXA 2D2CC 2VLLA 5DUBB 3E6FB 4IGBD 3GSXA 1KLGA 4F8OA 1F58H 1A4JB 3H1ZA 4JFVA 2QGEA 3LS5H 1E9PA 4K2UH 4BSVB 2XPGA 3QZWA 1U8IA 2MQ0A 1C5DA 4GQPH 3GHEL 2E6QA 3H0TA 4HHGA 2PYED 1MFMA 1GZQB 4U1JA 1MHCB 4M6AA 5KW9H 3HN3A 3CVIL 1UM5L 4JRXE 4XTRD 2PPAA 2HWZL 1KSRA 4GFTB 4XN7A 5CKGA 3Q8AA 5CCJA 2BJMH 1HJCA 3S4SB 4DVBA 2VE6B 5FYLD 2KHAA 5HHXL 2IWGA 1ZWIB 5DFVD 5E8DL 3SYOA 1EK3A 1KV3A 4H20L 3CFEB 3P9MB 1BQ5A 4TNWK 2LOEA 2VL5A 3KPSB 4AQ1B 1UKQA 4XC3L 3BAXA 2Y72A 1FQ9C 1XD0A 3ESMA 2JV6A 4PMEA 4HOWA 5T1JA 7CGTA 3DK0A 4XE5B 4UTBH 2CLVA 3VGHA 1BZEA 5F3HB 3E3QE 3CFUA 3M45A 3CSYA 5C92A 2D7NA 4JFUA 1E65A 4YXHL 3VGAB 5C0FB 1FLRL 3MV8A 3ML8A 3P11L 3UP1A 3AGVA 5FM5M 4TVPL 2QPUA 5HYJB 3MUJA 2WUCL 3EBGA 2CDGA 3I6LE 4IBTA 1K6QH 4PJDA 1EIBA 3A6OA 4R4ND 4H88H 5IMKA 3IDGA 3LB6D 3DC0A 4UQ3A 1XBDA 1R0AL 4RFEB 5A2FA 2DJSA 4FQLL 4AM0A 5I9QC 1NJ9A 4MFHA 5IVNA 5T3XH 3DUSB 3FOMA 4PGBA 2EUXA 1KB5H 1OAXH 2FBOJ 1EZSA 3LPWA 4KQ4L 3WFEH 2H45A 3VXMD 1U8HA 2OULB 3PG2A 4OLYH 4AM0Q 4NI3A 1AJ7H 1PZ5A 3U30B 2ILLA 3HBPA 1X9UA 3QPXH 3QRFM 1V55B 4ZMWA 3MV01 1EAPB 1MFEL 3WKMH 3DTXB 3VXQB 3JV6B 4RLDA 5AKRA 4DKFL 1SHSA 1TEGA 1MAMH 4PWGA 2YUWA 4FADA 1YPZA 4L48A 4UT6L 1IAIH 3HE6A 4F5CE 3S8FB 2Q2LA 4HX1A 3IJ8A 4YZWA 4HXBH 4UCFA 2FO4A 2EDLA 2YUXA 5H37H 1KGWA 2CCVA 5AZ2L 2Z7WA 3W0WB 2EABA 1GCYA 3EFDL 3MOBH 2VZVA 4FQIL 4N9OB 4BK5C 1XCTB 4BUHA 3MGTA 1ACXA 1OCOB 4MJJA 1JRHI 2BC4B 3MV9D 1BAFL 1SVBA 2YLHA 3VAEA 1G7IB 2YIHA 4G1MB 3JZYA 1G6RH 1XSIA 5TTRA 5I18H 2BSRA 3HKFA 4FA8A 4UZUA 5BRQA 1I1CA 1JGVL 2GJPA 1H9VA 4NQCB 4AGMA 1LK2B 1RHFA 5I8KL 5I1LB 4KQ0A 1JUFB 2VAAB 4HALA 2BP8A 5BS0A 4BK4A 4HJEA 2R1YB 2NY4C 1MOEA 1JZHA 4EN3D 4YN3A 2VNCA 3TWCL 1R5VA 2E27H 4XPFH 2OJEA 3X14B 3AXLB 4M02A 5D2NA 1YY8B 4RX4A 2ESVA 4HBQA 4UYQA 2ARWA 2NY5C 4CC1A 2WLLB 2YXFA 3AAZA 3LYRA 3FTGB 3TT1H 3AG3B 4WTQA 4MAYC 1P5UB 5ANMB 3EJJX 4EXKA 1I3VA 1BBDL 4AH2B 3V7MA 2OMUB 1EERB 4YGAB 3RZWA 5F3BA 3DTUB 3FQWB 3JV5A 4L8DA 1SOSA 1TENA 3WIIH 5HHNB 2OCFD 4W9KC 2WLJA 2FYYB 2P1YA 3LZNA 3FAXA 1ZTXH 2Y36H 4XCYA 5HI5C 2NZ9D 4PREA 4QLRA 1HH6B 3WENA 1IM9B 2R2EA 4ZODA 2FJUB 4OU3A 1A4AA 5DEGA 5L8KB 2YA1A 3ZLQC 5K1NA 3PUCA 1B0GA 3SKMA 1FFNA 3PWVA 4BKSC 2XRAH 2C3XA 3KZ8A 3NSJA 4FI7A 1OCWL 4TNGA 2VDRH 3QDJD 2BIHA 4U3XA 2FEDC 4NXKA 5GIRB 1MY7A 5HXMA 2CPCA 1HT6A 2AABH 1U33A 5DD5L 2NW3B 1XH1A 1FBIH 2KMWA 1BOYA 1XGRB 2V5RA 3FB6B 1UHVA 1AC0A 4OUOA 4OJYA 4N9GA 3N85H 3DGCR 4WFFE 4G8EB 3O9WA 4QO1A 3L08A 2PCYA 2P46B 3FSWA 5HVFB 3MJ8A 4HEPA 1W6LA 4FQ1L 5T1KD 1BQHA 5DJYA 4AIXA 3RZCD 4PP2A 1T66C 5DLML 4CMHB 1FFQA 4RNRB 1UUSA 3UTTA 1XGUA 3P4MB 3JWNH 1KWKA 3S8GB 4OSUL 3VCLB 3U0WH 2ORBL 3TF4A 1DJHA 1H0DA 5D93C 2V4LA 2QQQA 1WYJA 4BUGA 1S9XB 2NT1A 4IOFD 3US1A 4LP4A 4YC2C 1S7RA 1QBAA 1QWHA 4M1CD 3N04A 2W9DL 1HZHH 4G6FD 5E5RB 4GKLA 3QO0B 1H8SA 3GJFH 2HMID 1LEGA 1AR1C 3GI8H 1MF2L 1WO2A 1L6ZA 3I50L 3IWVA 4EQ3A 2O6EA 2YBRA 3RAJH 2P80A 2LE9A 1FZKA 2Y7QB 1CF8L 2WVTA 3MZTA 1MJ7L 1C12B 4BSWB 5IESL 1TG8A 1KIPA 3QZWG 1PAMA 4U1NB 4JGNA 5EIVA 2VXVL 1G7QB 3IMRA 3UTQB 3VE0B 3QORD 2WVVB 3FF7A 3B83A 1P7QD 4K23L 4NNXA 4YHPA 2EXTA 5KSVA 1PX3A 3LZRA 4LNRB 1FZJA 2WB7A 1UQSA 4YBLC 1UWXK 1F4YH 4DUVA 1BQUA 5TFSH 3NJNA 3I3BA 1ZHNA 1KPRA 1PMYA 1CD1B 2PR4L 3CFKB 3KLSA 2WXLA 3T65B 2NTSP 2SEBB 5D7IE 2ZP9A 3IDXL 3NIGE 1IGCL 2NTFA 2WUBH 5FO9B 4Q89A 4PRNA 2PW2A 2ICEA 4BDVA 4GW1A 4X6DE 1NFDE 2OL3A 2BW4A 2WXQA 3VXRA 3QISA 5LGJA 2ZXQA 2H3NA 3LH8A 3I9GL 1FO0L 1LO4L 1DQDL 2IQ9L 2X5PA 2XXCB 3IJHA 4UAOC 2CKBH 4IJ3C 3H2QA 2X2YA 5E8NA 1ZV2A 2O5ZL 1PGRB 2PXYA 2HG5B 5KBKA 3GSNA 5C0BD 4OGXH 3ZKMD 4XB3A 3JQOB 3Q2VA 4OCRL 2GJRA 4XVUC 2EIZB 4UDTB 5KS9B 2CXKA 4Y5VA 1LWJA 3KNBA 3RGBA 5ICXA 4ZSOE 2QELA 5JYLA 1BEXA 1ZSDB 4NNPH 1UA6L 3SYQA 2UY6B 4MNGA 1ZA6A 4RA3A 5JW5A 4H8HA 3P4OB 3CC1A 1RUAL 5FDYA 1AGEA 1JZGA 3MRDA 3LS4L 3JT2A 2WP3O 2XIDA 1J8HD 4AVIA 5AB2A 4R97B 5FUOL 5D1QD 3DKHA 3V4PA 3K2KA 4IKIA 4HDIB 1ZV9A 3VYPA 4HG4K 5A7BA 1FC2D 5EN2B 2VR5A 5DHVA 3BISA 5IQ9A 4PJBA 3GK8H 2EADA 2UX7A 3FQYA 1HC1A 4JFFE 1UD8A 4PRPA 5E6IC 4KI5E 3PV6A 4L1LA 1P5VA 3U46A 1IV8A 1N8OE 1UZ6F 3II2A 5EEVA 3BZEB 5J8OA 2IDUA 5DEFA 4ZNCD 3MV7E 1THCA 2YRPA 2YWYA 4MMZC 4Y16D 1T6WA 1ADQH 3JZ7A 2WXHA 1I8IB 1ZMYA 3CZEA 1ULVA 3N06B 5D7JB 3O45B 3FTZA 4PJEB 2MMXA 4N2HA 5I0VA 2OJZL 3VWKA 4HIHA 3G5WA 4LFHG 1HSBB 1ZV5A 3DK2A 2G60L 1OPGH 4AOFA 3F7YA 4TL5A 4WO4B 3BDBA 4DAGL 4WKZA 2ZT9C 2K6ZA 1J1PL 1MW2A 4JDZB 4UQEA 5E4OA 2XVKA 4HLZG 4MMYB 3HG1B 25C8L 2MOVA 3IDNB 1CIDA 1IEBB 1T7YA 2HLFC 2GT9A 4JO1L 5A3ID 3MXVH 4ZFGL 1LVEA 2BCKB 3MBEC 4F27A 3IDUA 3CXHJ 3KXFE 2Y24A 5C6PB 5I1HH 1YYML 3QUZC 4X8XA 1JNNH 2F54E 2VXUH 3KPSD 5C09E 4OJCA 1NFAA 3FONA 1TPXB 3M86A 1FFRA 3CBJB 4MGXA 4ZDHB 3RGVA 1I8MB 3MLVL 4NIKB 2VABB 1JWUA 1KFAL 2E6JA 2BP0A 1PL3A 4RISH 3DMMD 2RBLA 4JFDA 3DHPA 1IU1A 4UMSA 1U91A 4MRCA 3DWTA 2XTLA 5IMLB 3IFPB 5HYJD 3ILPA 3DX8A 3ARRA 4QY8A 3RPKA 2Y06L 5IQ7L 1XSKA 4PRIA 5DO2C 5ESAA 4JRLA 1G5GA 3MLSL 4S0HA 2EDKA 1CLVA 3HE7A 4M8QB 3ARDB 1I3RA 1Y18B 5FGRA 3FZUC 3KYKL 2VLME 1TZGH 2YQBA 1AHKA 4WVRA 1XF2B 4N0FB 5L9DH 1WWBX 5AW1B 3RP1A 4TTGA 4RZCB 3B34A 4YBQD 5EO1A 1S5HB 3SGKA 2WZ5A 3N44F 4N2DA 2VLLB 1PY4A 3RVXD 3ULVC 3GSXB 4EE2A 4XVOA 3QYCA 3ZKQD 2BERA 2FX7H 2FJHB 5AQ0A 5IB4A 1E9PB 3LIZH 5TQ2L 2XPGB 1C5DB 1PKQA 3KPPA 1EGJA 4QXTA 3H0TB 4Y2DB 4G9DA 4JPWH 2CH8A 4U1JB 4LGSB 4GPVA 4NN6C 4XXDA 2QLVB 4OB5L 1X5JA 3TEWA 2LFGA 4QRRA 3HBGA 3ZE0B 4KNQA 3BVVA 3QEQA 1IIIA 4HEPG 5E5UB 4KKCD 1E8ZA 3A67H 1BQHG 1CTMA 3T6WA 2CRMA 1R3JA 2AAAA 5DYFA 2W80C 3V2AR 2Q7AA 2XWJA 1ZLWK 1NLBH 5JPNC 1FORH 1EX0A 2DM4A 1CFTB 1NIAA 4OZIE 3EHBC 1ZEAH 5JIKA 3WO4B 3ZE0F 4JPVL 1OARH 5JIIA 4ALAH 5C2BL 1XDTT 2CLVB 4CNIA 5MERB 3MLYH 3P3TA 5JHAA 3H9SE 1S9KC 1GOHA 1MREL 3MREB 4DHLA 2R4SL 2ADJB 2ZSWB 3D51A 3RWFA 4AQ8C 2APTA 7TAAA 3KEHA 1LL1A 5EO9B 1VCBC 3NA9H 4MA7L 3T0AA 2A74C 2NQ3A 4UAHA 2DQIH 4APQD 2IV8A 1AHWA 3CFIC 4HKZB 5IMMA 1QA9B 1YYLL 5E1AA 4B9FA 4PJDB 1KGCD 2VC2L 5IF0A 5IMKB 3IDGB 4UQ3B 2VDQL 1E9QB 1GOGA 4PLNC 5EDXA 4YK4C 1EMTL 3CFBB 4JRWA 3FOMB 2VWEC 5KZCB 4CL7A 2BWQA 5D7SL 5T3ZE 2NXYC 2IV9A 4JQXA 1LDPH 4NT6B 1ITCA 1UJTA 1U8HB 4I4WA 4LEOB 4FABL 4FFYH 3CHSA 4G7SB 1A8JH 4Z7OB 2H2SD 4MS6A 4Z7UA 4AV4A 4KMQA 3VUAA 1BCIA 4OM1L 4OZFH 1URLA 3PHOA 1SDDB 1KLUA 1IM9D 1XEUA 5L8LB 1UH2A 5FYLE 4JKPH 2AJSH 1BJMA 5IP4A 3HE6B 2YD9A 2W88A 5I6XB 4NZJA 1NIDA 2L0DA 1WK0A 3O6MH 4RIRB 3NRPA 4UTBA 4PJ7F 1JPSL 5JNYA 3W81A 2C9PA 4JO3H 1I8AA 4BFFA 1P6AB 2B8OT 3LKRB 3OG6B 3QR1A 3WN6A 3GB7B 1LHZA 5CMAB 5HJBA 2JK5B 3MGTB 3GMOA 3EO1B 2J55A 4FQHB 3HNTH 2WWMD 4HIJA 4BIKA 2DQGL 1NOFA 3OLDA 4WNJA 4DVRL 4NHUA 1VPOH 4N8CH 1J8KA 1QYGL 1DQML 3SBRA 3CXDL 1HNYA 5FIEA 2PPFA 3GSUB 4LAQH 1T6VN 1VENA 3ARYA 2WBJD 4AGLA 3SOBL 4ZW7A 4B7LA 3AY2A 1FNGA 2W60B 2D7TL 1BPVA 2OMTB 2VLJA 2R59A 2A6KA 2BP8B 3DOHA 4Y1AE 2HTLD 1KB5A 2WYZA 4LZKA 3SZ6A 5HPOA 1JD7A 2F58H 2YGQA 1N8ZB 4E41A 4XPAL 2CIKA 3C60C 1U3JA 5D2NB 5E2TH 1MVYA 2QHLA 3L4VA 3UDWA 3CFCL 4Q56A 4PJAB 3AAZB 4ABVA 3L48A 1FFOB 3JTTA 1GGBH 2GJZA 4AEFA 1KJMA 4KO6A 3VXME 1N59B 4NN7C 3WXVL 5E24E 1SJHB 3C5JB 4KITB 3WAKA 2J5LB 5HGBA 1M56B 5J11B 1U3HC 4W9EC 3S37H 2VB5A 4TL4A 4HHAA 4X5LA 2YQ3A 3BSHA 4Z3GA 3VDBA 5H37A 4I0PB 1S9WB 4W6WB 4M5TA 4K73A 2VR9A 4H0IA 4PREB 4YDKH 1CLOH 1BMGA 3DPBA 1ZA3A 3L3OB 2R2EB 4M5ZL 3ARSA 3BPNC 4CVZA 3BP6B 4WFHE 3SKMB 1FFNB 2TRYA 5F6IB 2XWDA 3BAKA 3CFTA 1T7XA 3U4EA 1G94A 2IGTA 3BVUA 4X9HA 4GKNA 5DWUL 1C08A 2NYKA 1EEUA 4CMMA 4LNVA 3L45A 4LCUA 3K6OA 4OZGA 1P6FA 1VF5C 1Z9NA 4OI8A 5I74B 1WIOA 2X70A 5TE6H 5AALA