2EEFA

Solution structure of the cbm_21 domain from human protein phosphatase 1, regulatory (inhibitor) subunit 3b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
156
structure length
156
Chain Sequence
GSSGSSGAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 1, regulatory (Inhibitor) subunit 3B
publication title Solution structure of the CBM_21 domain from human protein phosphatase 1, regulatory (inhibitor) subunit 3B
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 15
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03370 CBM_21 Carbohydrate/starch-binding module (family 21)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2440 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2eefA01
4BFNA 4EIBA 4BFOA 2M83A 2EEFA 2V8MA 2VQ4A 2V8LA 2DJMA
chains in the Genus database with same CATH superfamily
1NMAL 4Y4HC 3KYMB 1UA6L 2F54B 5GGQL 5TK4A 3PAZA 3U7YL 4LSQL 1GS7A 1E4KA 4L8BA 35C8H 5H8DA 3RJDA 3ZT5A 2XLLA 2DQTL 2F53E 1IM3A 3U2SA 5BZXA 4N3UA 2WGXA 1NSNH 4GXUM 3ARBA 2OSLA 2A77L 4Y19A 1ZA3A 4APQA 3L5XH 4G6KH 3FQYA 4CN1A 1YAZA 5FM5M 3V0WL 1LWJA 3LOWA 4NWTH 4Z7OF 5DEFA 4HJ0C 4IU2A 4HZLA 4F2EA 3NZ8B 4LO9A 1J1XH 4B0MB 4M1DL 2HTKC 5MENE 1KC5L 5KAQG 3MNZB 3HI5H 4KRNA 1NC4B 4OF6A 4PTTB 4X83A 2FH8A 5DJXB 5J0BA 2F9BT 2ZXWB 4LU5L 4NPJA 2WV3A 3QPKA 5TPWL 3IU4H 4DKEL 1TQVA 4U6VH 5HVGB 4Q0XH 3SE6A 1GYAA 5CR1A 1XV8A 2PYEB 4P3CH 1NJ9B 3HS9A 1JN6B 5DJYA 2QSVA 2CRIA 3K80A 1GYVA 4HIXL 3U0PA 1AGFB 2C1PA 2AJSL 4ZJ9A 5ISZA 1Q1JL 2H2PC 4R0LA 3NIFF 2J1ZA 2XVLA 3A6CH 2ADJB 2NY7H 1VSCA 3AXIA 4OGAD 1R3JB 4D9QD 4RGNB 4Y1AD 1YJDC 4LHJB 3I50H 4P4KD 2EE9A 4MS8D 1C5BL 4Q9RH 3KPMB 1DBBH 1KN2H 5JW4M 4WO4C 3FULA 2FECI 4PRIE 4A2MA 4G82A 3CVHH 2IFFL 5E08L 3S88L 2K1MA 5D5MB 4MNQD 4P59L 4U6XB 2QQLH 1EAQA 3TBYA 2Q3XA 15C8L 2VDPB 3FN3A 2FATL 4MA1B 4NGHL 3JVFC 5I1CL 2A0LD 3V5KB 4FNSA 3TL5A 1NC4A 5DMJB 5EC2B 2YD7A 3WXWL 2QMJA 1EZLA 1FGVL 1IAOA 4BCYA 4FLRA 4N86A 2HSIA 2ITDB 1A2YB 3P4NA 1KMGA 3KLAB 2CPCA 4NKIL 1SPDA 3I02A 1X5JA 1UJ3B 1IM9B 2A9AA 4JKKA 5E9DE 3CUPB 3S34L 3DUSB 3KPPB 3D9AH 1EDYA 4TQ8A 3IRPX 5EC1B 2IMNA 3RDTC 5A2BA 4KQ0A 2Z1KA 5F7KC 4B27A 1E90A 3WTXA 4P23B 3GMNB 1W0WA 3E2HC 3VB9A 4I9XA 5ITFB 3QUGA 1MWAB 2O6FA 2H26B 1DLFL 3TT1L 5B38B 1NUFA 1BFVL 5HYQA 1A6VH 1QR1B 1BAFL 1RZGB 3QDAA 2A9BA 5MERA 1N7ML 1WWAX 4GKNA 1AR1B 1NAMH 5CINL 4FAAB 4JZNB 1XGYL 2B5IB 3CWGA 4HOXA 2VZVA 2NZ1A 2B39A 2NYYC 3N91A 3B8YA 1LWHA 1PQZB 2BVQB 2Q5BA 2QLVB 3M8OL 4OD1H 3ZKSD 3O4OC 3GDBA 4P5RA 3SGKC 5HYFA 5IFAH 3V5KA 3QJSB 2HFEB 1Q72L 4HV8B 1FHGA 4XBGA 1N0XH 4U6HB 4EUPG 2BNUA 1MFEH 4L1DA 5D5MF 3FONA 4W9GC 2CNYA 3FSOA 5J12B 3VO0A 4AITA 3GSQA 1D5XB 2VLKD 1UJ3A 2D31A 4UQ2B 1URLA 1IM9A 2NX5B 3S3DB 2J5WA 4ODTL 1I1FB 4CMMB 4YX2H 1XF3B 4PJ9D 3LZLA 3Q1SH 1C5DB 3CZLA 4IJTA 4PJXB 4QT5B 4R97C 2AV1B 5FUOL 4KO7A 3DJTA 2PP7A 4TUOB 4N2LA 3GMNA 3Q6FB 1UXLA 3V5HB 3GBNH 5KSAB 2VZ1A 2ZWLT 4OKVA 2Y6TE 4HC1A 1MWAA 3MXWH 5B38A 1IFHL 4QF1B 3P4OA 2BHUA 3ABKB 3NJIA 2C34A 1RZGA 5D7KE 2A2QT 4UIKL 4NI6A 3L9RA 1A4KA 4DFHA 4HCGA 1U8KA 3EFFA 2R0WH 5BZDB 1JNLL 4G5ZH 2CIKA 1PQZA 1KBKA 1E4WL 2BVQA 2KZ1B 1TQBC 4KNUA 1LK3H 4KROB 5I1HH 3WLWC 4KJWC 1JK8B 4DGIL 4NXSA 4L1BA 4WCYH 4Y5YC 3SOTA 4HV8A 5F7LB 1CWVA 1XBDA 3BZDA 4KKLC 1G7QB 3SDAA 3FRPB 4HGWB 4WEBH 2VN3A 4A39A 2OX5A 1EEZB 4JE4B 5T1MA 4UQ2A 1CI5A 4P46D 1K4CB 4NBYB 4WQOA 1I1FA 2W9DL 2DQCL 4NZFA 3Q06A 1KF9B 1KIRB 1OP4A 3DXAE 1JMXA 4MLSA 1BQLH 4LL4A 4TTDD 2XZAH 3AWGA 1N67A 2WTRA 3ZJAA 4L4VD 5B1BB 4TUOA 5IJKA 4OIIH 2BPBA 5CJOL 3V5HA 1WITA 5KSAA 1CGSL 2VSDA 5A2KH 1TJIH 1QPXA 2D3LA 3FFCE 4CDHA 4XP1H 4NQEA 5KVEE 4XNZB 4QF1A 5EBWB 3KPNA 1NINA 4L3CB 2YSSB 4NQCD 2BNRB 4JHZA 2R69H 3O9WA 4PJXF 1GZPA 3JYBA 5CU9A 1H9DA 4HCRL 1PZ5B 3GHEL 4PFEA 3K0YA 3ENEA 2N0MA 1FYTE 1M56B 1IC4L 3VWJA 1I3GH 1NGPH 4WFFD 4OKDA 1Z9MA 4YBLB 1JHLL 3KPRB 1O5PA 7FABL 2H6PA 1ZT4B 4K2UH 3LV3B 1SN5A 1FV1A 2HX8A 4LSPH 1G7QA 1SN2A 3FN0L 3QQ3A 4IOFC 4URKA 3ZTJH 2GUYA 5DS1A 3TYGH 2FX9H 2JELL 1AC6A 1DVFB 4YGAB 1K4CA 2JTDA 4LEXH 1ZANL 3BDBA 4G7VL 4PBVC 2HKHL 3OG6B 1QFOA 1KIRA 4Y4FC 1QOKA 2BRRH 3ZYJA 5DYOA 1A7RL 2IDFA 2LTQC 2DQDL 3W5NA 1HHHB 2ZUYA 1KCVH 2LVEA 2VZOA 4TYUA 2I60L 3WE6B 3PABA 2VDMB 3FUDA 1HCYA 4XVTH 5EBWA 4AEFA 3NSFA 3RAJL 2BXYA 5A2FA 4FEIA 2F15A 3NCWA 4AEHH 5CEYA 4FZ8L 4W81A 3MLRH 4G6JH 4HIEA 4M1GH 5C0BE 1F90L 2AK1H 2V9QA 3MJ9L 3RVVD 1QUPA 5E2VL 2XTSA 1L3NA 4WWOA 3IDGA 1RMFH 2H47C 4R7DA 3SQBA 1ZT4A 4MNHA 4F7CB 5TGBA 3JWOC 4NRXB 1UM5L 1HEZB 3ABZA 3CDCA 4CVXB 4LVHB 5EOTB 2YZ8A 1F1DA 1NM9A 4W9CC 4ZI8A 4MHHG 1INDH 3EDFA 4HFWB 3MUUA 4LAJH 5D1ZC 4CSZA 4W68A 3ULVE 1DVFA 3KM1A 2PTTA 3VX1A 1NLDH 4NUPA 1CFMA 2IG2H 3RPIA 1MJUL 3QZLA 2A6KB 2OULB 3DHUA 3NK3A 3OV6A 3DIDA 2NY5C 4YXHH 5I1AB 5L2KE 1YUHA 2XPGB 3B7RL 2C9AA 1AS8A 3PWPD 1S9XA 4PREB 5TFSH 1ACYL 5ETUB 3WDIA 1YEGL 4M1CD 1NFIB 2W9EL 3UTZB 5FW8A 3L1OH 1MW3A 4KO6A 3D85D 3IS1X 1SYVB 32C2B 3PGFL 2K4WA 3BLPX 2J6EA 4JFTA 3DGGA 3LH9A 4UINH 3BZ4A 3MODL 2JB5H 4PJFE 4YLQT 2CR0A 4RZCA 4IIZA 1ZWIA 1FSKB 4KZEH 3SOBL 2X38A 5F1NB 3GIVB 4FA7B 1RUPL 2XY2A 1TZAA 3WSQL 1S7XB 3WE1A 2DMBA 2NYKA 3D25B 1PD1A 3WJMB 3HKZA 1QWNA 3LVTA 5IKCA 4D8PA 3P77A 1NGXA 1OQOA 4KAQH 3AABA 4MAUH 3P2BA 1KT2A 3UADA 4HKXA 2VT0A 1AH1A 2IOOA 3CDFA 1KOAA 3VXTB 2H6UA 2XJLA 2DB8A 2IAMC 3ZW3A 5EU6B 2BJML 2A6KA 3MCYA 4PJ8D 1WAAE 5I1AA 4RX4D 1AGBA 1BP3B 5ILTH 3T6XA 1XGUB 1NCCL 1EIBA 2C9UA 1YPZE 3QISA 1KB5B 2DH3A 1YEEL 3OZ9H 3US1A 1J7VR 2IFGA 5C70A 5ETUA 4Y2DA 2AJVH 4D3CL 3R0MA 5ABAA 3IDIB 4UT9H 4Q58C 1FIGL 1I7UB 4ODXB 3OKNB 3DJ9A 5LN4A 5DVOA 4MNGA 3S5LA 5A2LH 3UTZA 3VYOA 4CGTA 3EIFA 3L81A 4PR5B 2XETA 3U82B 3VQLA 5H4ZA 2CDFB 4LAQH 1UFUA 2DQMA 3GMQB 3TN0B 5AL8A 4FG6D 2X0VA 2OK0H 3RZWA 4MAYC 3T4AC 3F7KA 3T6QC 2F54D 3IWVA 4NN6C 2GJ6A 4GPVA 1A6TB 1WFIA 4H20L 2V8LA 2ARWA 2D4DA 1BF5A 1I3RA 1B88A 3WL9B 3VTAA 1E4XH 4JVPA 2EICA 4WKZA 1KTJA 2X9WA 3TASA 5C7XH 1BIHA 4MQ7A 1NL0L 1FH5H 4DN3L 1DO5A 2HAZA 2ZCKH 1BM7A 2YGNA 3C5JB 4LVEA 1RPKA 2OMWA 3GLAA 2ITCA 3JZ7A 3OM3B 3F01A 4OI7A 5C9JA 4HEPG 1RHHA 4F7KA 5DGRA 1G6RL 1I8LA 4PS7A 4J3OG 5C3LD 1KB5A 1HHJA 3VFSB 1ZHKB 3EH4B 3M1OA 3OKOB 3VFWB 5JNYA 1G4RA 5K59E 3N41B 3LRSB 4Z77B 3UG4A 3T0BA 2XWTA 3IDIA 4OFDA 1I7UA 1T0PB 2MQ0A 4ODXA 3QG7H 2E4FA 3REWB 1TZHA 1EERB 1MH5B 4OFVA 1MHEA 2DAVA 3M17B 4PR5A 2PNDA 2HRHA 5FW6A 4LKCB 4IGBA 5IG7A 1PG7H 1IAIM 5A16B 2GBVA 2J4WL 3TN0A 1NIFA 2PYED 2YKLH 4XPHL 3VGBA 5CSZB 3NYKA 1FN4A 1KB9J 2RTTA 2VB5A 4YSRA 1OP5K 3ROOA 2UXFA 3WS6A 3UTSA 5CCKL 5FKAB 2UX7A 5AZEL 2A9DA 4BHUA 2VC2L 3QUXC 1A6TA 4OCWH 4R4FH 4JZJC 4RGND 4P2QA 3WL9A 1G7MA 2DRUA 3E1F1 2ENQA 12E8L 4QUOA 4J4PC 1S7RA 3B9KC 1ESOA 4PJAA 3AB0C 1MRFL 1IAII 5J4MA 2XBDA 3KXFB 1WWCA 1UCTA 4KPHH 4BFRA 4DNLA 3W9EB 4GMTH 3FU0A 4QHKJ 3IJ8A 3FH7A 1RU9H 4HW6A 3N1PC 2A9MH 5DEZA 2F19L 1JDDA 4FFYH 3EAKA 4UQAA 5FIEA 2VKWA 1T7XA 2Y23A 3VFSA 1BQHB 4BQ9A 2JJWA 4G3YH 2FYYA 3RGVD 1QEWA 3IE4A 4PRDB 4PJAF 1AHMA 4IIQA 4MJIE 1TPXC 4PRPA 3KYOB 4LF3A 1F4YL 1BVZA 3NZHH 2Y1ZA 4A2EA 2H0PA 5HYJB 1HESA 3M17A 4GINA 1KZYA 3QJXA 4X98B 1WBYB 3HLAB 4AUJA 4KZ0A 4QXWA 2O6EA 4O9HH 5AL0A 2YK1H 5CSZA 3EHBC 2C3VA 2QTVA 3CV5A 2YPKB 3N41F 4LCWA 1COBA 3WKML 2BVYA 2JKSA 4OCXL 4WAFA 4KH2A 3MLUL 5KVDE 3V4VL 2E7LA 4ZXBC 2ZF8A 3P40A 3U7WH 3O2DH 3NCBB 1BZOA 5JHDB 4TOYL 3EOAA 2FRGP 3N43F 1JV5B 2ZAIA 4KX9A 5C3TA 2CR6A 1A9VA 4P23D 2FB4H 1DZBA 2NUPB 4N85A 4JHAH 4A6YH 3D0VB 5LDSA 3EO1A 1GCYA 3B56A 5B4MC 2FT7A 1JZ5A 4C8XA 2VR5A 2BFGA 3W9EA 4PJCE 3JZYA 3MROB 1L9QA 1AR1D 3FSAA 4JO4L 2J2ZA 2X4SB 4XCFL 1R17A 2CLZB 3FQTB 2IDTA 1JPFA 1JWUB 5E5RB 3J07A 1H8NA 2FQEA 2VDQB 1AANA 2FYVA 4TV3A 1OLLA 3ASWA 3WD5H 3Q6GH 3OR7B 1K5WA 5D1QE 1MEXH 3PWJA 5F89A 2HJLA 1MKFA 3J2PA 1WBYA 5ESVB 1A66A 5EIVA 2WQWA 4HK3J 3I9GL 1U8IB 5SX5K 5HVHB 2CRMA 1XH1A 3D3VE 4OJDH 3ES6B 4B6ZA 4EI5B 1FL3A 3GINA 4JKPH 3GNMH 4K5MA 1THAA 5DJ8A 2QVMA 3TP4A 3TZVB 2VRKA 3WJJC 2A9CA 4JFFB 4LCVA 4HAKA 3ARGD 3VWKB 4MMXB 4Y16B 3QIBA 3PWLA 5DR5H 4KJPC 4IBWA 4OLVH 2BNQE 1ZGLP 5E4IA 1G0DA 4OZHB 3FUEA 1BDYA 3MLSH 1Q94A 5EDXA 4IEFA 3MBEB 2VLJB 4J3WA 2LQRA 4LCCB 5IJBC 3GTNA 3MROA 1HVXA 2X4SA 4FLHA 3CZEA 2FJHB 5K9OB 1JSYA 3B7YA 2FLMA 4HKBA 3UJJH 2R2HB 5E6IC 5FKPB 3UTQB 4G7YL 2B3RA 5CZXC 1CF8L 3T8VA 2O26U 4JRWA 2P5EE 5I24A 1O7DE 1OAXL 5J8OA 3H9YA 5KVFE 4R96B 5T5FH 4EUPA 4KJYB 3BKML 4F5CE 2NW3B 1EEQA 5D1XE 1U8IA 4MDIB 4ZD3L 1P4IH 1OAJA 4NKOA 4B7LA 1ICTA 1NAKH 3BHBB 4FA6A 1DBAH 2BERA 4AVIA 4UDUA 4ZFFB 5IJDC 1WH0A 4YDVB 3TZVA 1PY9A 5BRZE 3SD5A 4Q6YA 4EDWH 4JFFA 5IVOA 4MMXA 2GSMB 2AXJA 5DD0L 1VLXA 2QPFA 3IGFA 1TLKA 4LLUA 1DBJL 2ZWSA 3UGEA 5K9KB 1LE5A 3GJFK 3CU1A 4N8VG 1FZOA 3TNMB 4YK4B 5HJ3B 1KXQE 3OMNB 3MBEA 3SHSA 4QRRB 3LKPB 4ONHB 1SOXA 4JFQB 2BNRD 4LCIL 4G42B 5HD8D 3VXRE 5C0AB 3DOSB 1KDIA 2FR4B 4KKAC 4LVOC 5ELIA 1NEZG 1NGQL 2WWKO 3RVXD 2NXZD 2AXFA 5IZ7A 3MRMB 2EDJA 3KBHE 4ATTA 3D2TA 1HOCA 1YNKL 4WTZG 1OAZH 2LW3A 1KGXA 2BCKB 4OZHF 5FKPA 3QRFM 1JAEA 4W9JC 4ETQB 5LBVA 2DEXX 2OZNA 3D34A 1I7TA 3KPRD 4RMTA 2CMRH 4G6FB 5HGAB 4F1ZA 1PL3A 4Y4KC 3TJHD 2CWRA 2J8UA 2UYLB 4Y7MA 4AZUA 4JN1L 4KJYA 2FLBT 4X7SL 3VU2A 1NFKA 4NN7C 1CS6A 1UJTA 1PLCA 4DHLA 2P24B 3IFOB 4MDIA 1CLZL 4ODSH 3VD3A 2K45A 3NPZB 3MNMA 5IWLC 2FLRT 3PUUA 1IFRA 1J8KA 3MKKA 1RUML 5HHOE 1IC7L 3TM6A 3S3JA 4FMVA 1ZVSB 4X6DB 1JCVA 4N0YH 3N85L 4UTBA 3TO4D 1L7TL 2N0KA 4JDEB 4NUQA 3WLBB 4XI5D 4DF9A 5IROA 3NRFA 3UPCA 3C60A 2Q7AA 4XXDB 4PRBB 1ZRUA 4FL4B 3INUL 5F7AA 3LNGA 4PP1D 4QRRA 3RY6C 2DH2A 2HJFB 2IAAC 3PHOB 4OQTL 5D7LB 3DOSA 4H25B 3TPUA 1RSFA 1WG3A 5IFHH 4O02H 4GRLB 2W91A 3AQXA 3MRMA 5I6MA 4YE4L 6CGTA 1L7IL 2XTJC 3ISYA 2BCKA 4MQTB 1IQWL 2BW5A 4ADJA 3GO1L 3WFEH 1AY1L 4XBPB 5FV2A 3FOLB 1FLRH 2IGTA 1KACB 4HMDA 1S5IH 2WANA 1QMUA 2Q8AL 3QDGD 1KCUH 3ZGIA 2Y2WA 3KPLB 3L3JA 3VRJA 1IC5L 5I66A 5F7DA 5L2JB 4HJ1A 4JJ5B 4WWKC 2OW6A 2MJWA 3BZEA 1I9RL 2J1YA 2R9HD 4ZYKA 4RFNC 4BA8A 3FQXB 2AF2A 3GPSA 3GI9H 1B9ZA 3GRWH 4X6DA 4Z7NE 4FFVC 5ENWB 4JDEA 3JV4A 1JPEA 2H32A 3BPNC 4W9IC 4LGSB 2Y7LA 4ZO9A 4IRZL 3QJVB 2FX8H 2VL5B 2PO6A 4KKZA 1YNLH 1YNTA 3RNKB 4ZSOA 1PNDA 3Q2LA 1B2WL 2BC4B 1QFUH 2W95A 2X3CA 2YGPA 1OAUH 4P9HH 4X6DF 4BH7B 2CCLA 4LVNB 4XMUA 2VQ1A 4Q56A 3RTQA 2HWZH 2ZUUA 3D4YA 3VI3B 5I28A 1PGRB 4X6FB 2A9NL 4O4YH 1FFNB 3IXTA 3WKPA 3STBA 3LVEA 2XOTA 1YNTF 4XRCA 3HAEG 5DHVH 5EUKA 1NGWA 1KEMH 2C9RA 1BSIA 1DTUA 2Z31D 3NSXA 4XB7A 4E9TA 4MJ6B 3QR0A 5TE4H 2Z9TA 1MPAL 4TVPD 4X5XB 2I9TB 2OR7A 4YFEA 5L2JA 4JJ5A 4MJHA 6PAZA 5EU6D 1BBJB 4PP2B 4M62L 1BJ1J 1HYRC 3FQXA 3FS9A 3WXVL 5FECA 2X9ZA 2ZXEB 4YXLH 1HWWA 5DJ6B 5ENWA 3QFDA 3FTXA 1BWMA 1ROCA 4ZAKA 2VR4A 5D93C 4AQ1C 5DUPH 2QBWA 5FYKH 4Y89A 4POZD 3LSOB 5L0QC 2VLRD 3RNKA 4W93A 3EYSH 1EBPA 4F57H 2FEEL 1D7CA 3V79C 5I73C 5GZOC 1RFDH 1D6EB 1J9SA 4I77H 3PJNA 5BV7B 4BH8A 4N6RB 2FVNA 1T4WA 4NP4L 2X44D 3KJ6L 1MJ7L 2QQKH 3JWNE 4KV5F 1VFMA 4DK6A 4LLDB 3CFUA 2EH8L 2H4EA 4KVNH 4YDNA 5AD0A 3K8KA 5C0RL 4NRZA 4LHUD 4TQEL 4N1CA 2YAFA 3GMPB 1L9OA 3RFRA 2VQUA 2PCPB 1G43A 2H0EA 4ESKA 5EBMA 3LPWA 4XVJL 3WIHL 1TETL 3T65A 3VI3F 3O4LB 3SPJA 3V0VB 1CU4H 3OLEA 2I9TA 1QFWI 1XGQA 2BHYA 4WFED 4HAGA 4AGPA 4PI0A 1BBJA 3NJXA 4N2DA 5F96H 4WUUA 1A64A 4QTHA 4ZUTB 2PWDA 5F9OL 5I1EL 2ZWZA 5EH1A 4WUKH 1OOWA 4AQOA 3BZFA 3FU9A 4UZSA 1YEKL 3RFZA 1JZJA 2HLFC 3MXVH 1M2VB 4YHLH 4A7QA 1BV8A 1LO5A 2AJZB 1GL4B 4UNTA 4DKAA 4E41E 4XNQB 4XXWC 3KR3L 4IRSC 1SJXA 2WZ6A 3GWJA 2Q9OA 1SLUA 2Z7WA 3QDJA 1E0OB 2V33A 5C3IA 3VI4E 5CU5A 3SQRA 1D6EA 4P5TB 1CFVL 4PGDA 5DSCA 5H37H 4BQ8A 5E8EB 5DVPA 3DTXB 3UTTE 3N1MC 1PZUB 1DVZA 2EDWA 4JRFA 4N5ED 1NUDA 3ARVA 2EIKB 2VQTA 3FO0L 3FYIB 4G72B 3S37H 1J18A 5C71A 4UM8A 4TUKH 3GMPA 5E5UB 4FQLH 3NIDE 4PB9L 1IGJB 2A6IA 5FCUH 4BK5A 3IFLL 2AJYH 5GGVH 5LCVH 2F7IA 2EDOA 4FQPA 4OZIA 3RILA 4LBEA 4KK9D 2E8ZA 4RDQG 3ARFC 4U0RB 3O4LA 1AO7B 1MCLA 3RWGA 4ZMYA 2Y0SA 2GFBB 3QHTC 3OX8B 3GXPA 4OCNC 1P1ZB 2XNAA 2DEWX 5EFIB 4D0CB 3G9VA 4ZUTA 5DUMH 1QVOB 3QCUH 1AGCA 4X99A 3A6OA 4HEPA 3HC3H 2X2UA 2XYCA 4XAWH 2X6VA 5I8EB 4NM8H 4Y5VA 1U8NA 3GMRB 4JFZL 2DF3A 5KOMC 3UMTA 1KG0A 3G5ZB 1GY1A 3D39E 4AQEA 3O6FC 4NM4H 1DBMH 5HYJD 3EH5B 1O9VA 5EF0A 3BSZA 4P5TA 3T2NL 3C8KA 1YEFL 5C0FA 4JPVL 1IKFH 2OBGA 5DO8A 3DTXA 4RGOL 2FEDC 4FQHA 2VITA 2DMCA 3RVXC 4XO9A 2Y2YA 4XMKL 2B16A 2B7DT 5I6PA 5F7BA 1JVKA 1KTBA 3BP5A 4NO0B 5JHDD 1HQ4A 1UZGA 4R7LA 4NZJA 4AYBA 4OBSA 4HETA 5EO0A 1P6FA 3D6GA 1AJ7L 1VGKA 2EC8A 2HFGH 4XNYL 1ED3B 2VW6A 2XPYA 2P5WA 3OX8A 3HC2A 4FULA 2YEQA 1WHPA 4XPGH 1ADQL 1EGJH 1JZFA 4OJAA 5IIEB 3MJ7B 3QFJD 4BWUA 4XHJD 1C1EL 1SDYA 3MSPA 1I9JL 3LS4H 3DUUB 1MZYA 5SWZB 5L4MA 5MEPB 3KZ8A 3GMRA 1BVKA 1FA4A 3LPPA 4U1NB 4ELKA 1U3JA 5EG6C 3G5ZA 2RACA 5I1DB 3QH3B 4JFPB 4XBMA 3P3RA 2PPAA 3CMOL 5KTEL 5IQMA 1CFQA 4EOWH 5EO1B 5GRZA 2F53B 3TBVA 2AQTA 1DJYA 2VZ3A 3K4DA 4EI5D 1BVNT 5FYLD 2XI9A 3ET9F 1P7QB 1Z0NA 2KLRA 2VDPH 3QJFB 1TU2B 3VWKD 4Y16D 5FM5O 5HI3C 3SPCA 3UERA 1AACA 5CJQH 2V5SA 5J9PA 3D4ZA 5FHBH 1OB1A 3INOA 2OYPA 1OM3H 3UJIH 2PPDA 1UKSA 5EOCJ 3IPBA 3B3BA 4NKDB 2V2TA 4GRMB 2VLJD 2V7HA 1Q0EA 3MLYH 1RZQA 5MENB 4FI6A 3F8UB 2CJUL 2JKRM 3P30L 1QSZA 3QS3A 5IIEA 4X6BB 3KLSA 3H9SA 3MJ7A 2ISDA 3B1TA 1X7TA 3AY2A 5JXED 4L0PB 1DL7H 3DX1A 4PJHA 5HGHB 4U3XA 3DUUA 5AG8A 1BD2E 1WFJA 3RHWF 3ETSA 2CO2A 4I48A 5MEPA 3KD4A 4FYQA 5E0FA 2PXYA 2I25N 3QH3A 1R3IL 2K9FB 2YMXL 1MWAH 1KXTB 4JFPA 2P8LA 1YY8B 3EW3B 3EZJB 1YMME 2JE8A 1ACCA 1UQSA 2FE0A 1MNUL 5KYXB 3MLWH 4PJHF 1OGTB 2AW2A 2F53A 2IWGA 1OANA 1XB3A 3HZYB 5I8CB 2R1XB 5F9WB 4KX8A 2KQNA 4GEJA 4HK0A 1TU2A 4P2RE 4QMEA 5KN5B 2Q76B 5GISH 1EJ8A 2W60B 5I6XB 3PWUB 4MD5A 1M7IB 4PSRA 1C7TA 3JUZA 3FCTA 4DO5A 4GRMA 3UAAA 3SGJC 4F8PA 5I8OH 3L2NA 4K8RD 1ZOXA 4OD3H 2OSWA 1Q90A 5C0AD 2YEZA 3DMMB 1B0RB 2FK9A 1OGAA 1WCQA 2AHIA 1JDAA 4LSSL 4L23A 3CSYB 3LB6D 4F9LC 3UZQB 5K69A 2BK8A 2FWLB 5IQOA 3ZO0A 1HIMH 1E9PB 1QZNA 3SKJL 1FE8H 1UA7A 4N2MA 3NRPA 2CA4A 2NZ9C 3WFDH 4H44C 4G6FD 4FP8L 5E9DB 5HI5D 2OMTB 4DESA 3U6XS 4HDIB 5I0WA 4IOSA 1G9EA 5FLVA 2EIEA 1HZKA 1J5OL 2YUXA 1TIUA 4S1QL 2JQZA 4XNUH 4EBQL 5IREA 4LLAA 2UXTA 2P80A 5KYXA 1R5IB 3HI6L 1UOWA 4U1SB 1OGTA 4XVSL 1LYQA 5C2BH 1I1AC 5AOIA 1ZLVH 1KB3A 5DQ9B 5JIKA 2NLJB 5I8CA 3TX4A 4QEGA 4QRUB 1OF2B 2ZCHH 3S36L 3VM5A 3ABLB 2VN5A 3UXFA 4Q9QL 3T77B 3ZKXB 5E6RB 4K73A 2CBQA 5LDUA 4GQ9H 3PL6C 4RWYL 2OJEB 5KWYC 3P73A 2LLNA 3FB7B 3LZFH 3G9AB 3DIVA 3L3OA 4N8VA 4X5QA 4JRXE 5E0QA 5ACZA 1TYEB 4J6RH 3BUYB 3KVQA 3MJ9A 3PHSA 4J3SA 4YSTA 3T4YA 1T4KB 3L4WA 4ICWA 4TSCH 5D7LD 2MTAA 2R23B 3K3QA 2VN6A 1CE1H 2EDEA 2HKFL 2WHVA 4GRLD 1F58H 4QHKI 3CSYA 4B50A 1FHNA 4NDMA 3UZQA 3C6LC 3ZRSA 3DBXB 1LP9E 2YRPA 1N2RB 4LOEA 3NFSH 4WTZA 3UPAA 3GJFB 1MFDH 4DT2A 4JG0H 3EOBB 3UAJD 2IPUG 5CFHA 2GSIB 4UV7L 2OP4H 1KFAL 1RUAH 3PQYB 3L6FB 1YQVL 2OMTA 5DVNA 5JW4Q 2RA1A 3VJ6A 3G6DH 4GKSB 4HDIA 3ZRFC 1A6AB 4FGMA 4S1SH 2YFNA 2ZYIA 2Z35B 1D5IH 1LO2L 3H42H 4KI5E 4OCYH 3U9WA 1G7HB 1AE6L 2ATAA 1R5IA 3VX0A 4U1SA 5I1IL 1HXYB 3HNTH 2P1YA 4M4PA 3VG0L 1JF5A 5AYTA 5DQ9A 3ESNA 3B9AA 5B7MA 4QRUA 2G3XA 1WIPA 1RZKH 3F7YA 3OL2A 1F8TL 3K6DA 4NHUA 3OGOE 1QYGH 5HYIA 5CD3A 4EZKA 1MCDA 3HFMH 4PVBA 5FYJL 3T77A 2WMPA 1JPTH 2Y2TA 4I0PC 5D8JL 2OPCA 4ELDA 3FB8B 4HOMA 2FTAA 3VMNA 4B9YA 3AITA 3JV5A 1MVUB 3FW6A 2UWEE 1X6LA 1T1XB 2FO4A 3MRDA 4LP4A 3I6GA 2QZQA 4OGYL 2R2EB 4LFHG 4R4BB 3S36X 3SKOB 5I30H 3MGOA 1NCHA 2BY1A 2R23A 3LY6A 3ZDXE 1IUZA 4LGRB 1RVFH 2FJSA 3FKUS 3FSZA 1M3IA 2GC4C 4XPTH 5ITBH 1KZQA 4Z3EA 4DN4H 1N2RA 4G83A 3NDZE 3GJFA 4AYID 3EOBA 2GSIA 2AVGA 1IQDB 3PQYA 3X11A 4GEIA 3MRCA 2AV7A 4I3GA 1CIUA 4ODUB 2WINB 5SV3A 4XMPL 5IM7B 2VXVH 3T0ED 1LJMA 1SRDA 2ZZUT 5EV7A 2Z35A 3DXAB 2UY7B 2VDMH 3CFDA 5D7JC 3E9UA 3P4MA 2NUTA 3GUFA 4H8HA 1YN6A 1LE9A 1G7HA 1MFMA 2IXQB 2J6EH 4ZT1A 4P9HC 5ECJE 1GH7A 4YJZL 1R34A 2ZP0T 4JHWL 4XPFH 3FFCB 1IX2A 3IAQA 3FHEA 4IYKA 5T3XD 3T5WA 4Z9KB 3ULSB 3U48A 5CEZL 4WJG3 5H94A 1PZSA 3IGUA 3GD1C 2JIXB 8FABA 4FXGB 2VLLA 3FB8A 1SBSH 3L5JA 4G2AA 5JR1L 4Z7WA 1BZ7B 1JHTB 1E7UA 1UD5A 4KKCD 3OAUL 1FYTB 4JX0A 3QEQE 2P7TB 1T1XA 2K4AA 4JMNA 3VXSE 4R4BA 3SKOA 1R3HB 2GBUA 5KS9B 4HJTA 3G5VA 1DUYA 2WO2B 4RFOH 1UWXK 2GTZB 4X42A 3CDGB 4YMPA 2ZF9A 1F45A 4L18A 3DX7B 1KWKA 3VFMB 3C08L 1D7FA 3ZL2A 3BMVA 3O0RH 1HCFX 1W6WA 1M7XA 3QPQD 4HPOL 3HAEA 5F8QC 1E8YA 5I2IA 2E7MA 3K2IA 5E51A 1Z5YD 4XO3A 4ODUA 4ZMNA 3DROA 2ZJSL 4B3EA 1X5GA 2IO5A 3POHA 5L7XH 5C0EB 4F8QA 1QASA 1V5JA 3NJLA 4KGJA 3RKPA 1AR2A 4X7FC 3B5TA 4YFLI 4EIBA 1FP5A 2M1KA 3VXUE 4C55A 5FOJA 5EBGA 2UX6A 4GFTB 1BGXL 5HI4D 3CN2A 1UD4A 4HQQH 3RA7L 5FUZH 1NOFA 1T7VA 1UFGA 3ZMRA 1D5MB 1P7KA 3DX6B 4FXGA 2ZYSA 5F6IC 5C0BB 4OCRL 5DUBA 4M1CC 5BUAA 2CHZA 3T6ZA 4FTVA 1BEYL 4X8GA 4X4XA 5DS2A 3QC5X 4PGBA 4NIKB 2OMZB 1I85A 1R3HA 4Y9GA 5DVKA 3ECWA 2P5PA 1A6ZB 2GTZA 4NBXB 3VXNA 3UC0H 5DFVD 3DX7A 2ADFH 5KSVA 1ITCA 3ARDC 2MFNA 5AOMA 1JZ7A 4JFEA 1KB5H 1M4KA 2WCGA 4P04A 3WY3A 4OY9A 2O6DA 1E4KC 2AZAA 1UOLA 3MRHB 4QHNB 4NUGH 5FOBB 35C8L 1RI8A 4RDBA 3G5XB 4IM8A 1ZS2A 3G3LA 4WSJA 1FNGB 4ERSH 2X4OA 3ARBC 4KMTH 1N6QH 1AO7D 1UD3A 2F18A 4N0CC 1TMCB 1NSNL 5ICUA 4XE0A 1J1OH 3VFPB 1DN0B 4M8QB 2E76C 1ZA6A 2EYSB 2IV8A 1U8PA 2L8AA 2QKIA 3L5XL 3MRKA 4G6KL 5B3NA 3WTSA 5I76A 4XVUC 3B2VL 4YAQB 4H1LG 4NWTL 2A38A 3HR5A 2E6JA 3OB0H 1Q8MA 2QV2A 5IQ9A 1AGEA 3N2JA 4PJFB 5C0BA 3KJ4B 4B3VA 4PJ7E 4AYFA 5I75B 5CILL 3NFNB 1M71B 4PGCA 3HI5L 3GHPA 3HTLX 5FC9A 3TVMB 5LG1A 3BQUB 2ARJB 5DJCB 1AS7A 3U6RB 3IU4L 4GBXA 4U6VL 1A1NA 3QG6B 3LRLA 4Q0XL 1CURA 3QB7C 3U1QA 3N55A 2CJ3A 4P3CL 1UENA 2EDMA 3WS3A 4BKSC 1U42A 3TEZA 4ONOA 2M26A 3ZVVA 4NO0D 3DPBB 2OJ1A 4BCXA 3MOBH 4PH8A 1I7ZB 2BZCA 2J71A 4FF9A 4BUHA 1MHPH 1BQKA 4QHNA 2FO1A 2FQFA 4UUJB 2Q3ZA 2HVBA 3IDJA 3NAAH 1YPZB 2LVCA 3LKNA 4JFHD 5JZ7D 3H1ZA 4RAUB 1FNGA 1QSFE 5CHNA 5E56A 5FM4A 2DBLH 1WS7A 3STZB 2J43A 4K07A 1DBBL 1KN2L 3ULVF 5C08E 1DN0A 3RWIB 2EYSA 3CVHL 3X17A 2NY2B 4C56D 1GYUA 4XC1H 1SXCA 3BIBX 3VW3H 3TCLA 5KG9B 1OE3A 3CHQA 5SWSB 3H53A 3KVPA 1GOGA 5HHME 3ULAB 3LN4A 5HDQH 3TIEB 1HYSD 3FJTA 3NJKA 4UT7H 1QSEB 4WFHD 3BKJH 2XXMB 1LEGA 2ZE0A 4DTGL 2VH5H 3K4AA 2X0UA 1VB9A 3MBXL 3TVMA 1CFBA 2UZYB 5DJCA 2MKWA 1S7VB 4H8VA 5HHXL 2Q6WB 3QG6A 2E56A 4X9HA 1QNIA 3MV9A 4PWJA 3CFQA 3PP4H 4PJFF 3L3DB 3R4RA 4MXWL 4JFYA 3PNRB 1P7QD 3VGDA 2C5DC 2Y9RT 3D9AL 2KUTA 3E6HA 3G6AB 4N26A 5TDPB 1BBDH 3A4EA 3FB6B 3VDBA 3MPCA 1I7ZA 1WISA 3L3KA 4WWNA 5I18L 5AVQB 4F37K 2KERA 4UUJA 1Y1DA 3UEQA 5EN2A 2OMNA 1QSVA 1IVTA 4XNXH 4RAUA 4BGLA 5EUOA 1XSKA 1GSMA 5HDOA 3STZA 4GS7B 4HWBA 5MEND 1HH6A 2VZTA 3RWIA 3VSQA 5CM1A 1A6VL 5CIPA 5BUPA 4BFIB 1NAML 4EVNB 5T1LA 1T2JA 1T5WB 5DVLA 2BSTA 4G71B 3VE0A 4MA1C 3I6KA 3V0HA 1JDCA 1YPZF 5SWSA 3F7VB 4OGZA 3GSOA 5J57B 4OD1L 1E5ZA 5EUOF 5DQDH 5GZNA 4ETYA 1ODUA 1C5CH 3V6FB 3ZDWA 1QSEA 5HGBA 5IFAL 1SMOA 3KH3A 3T3ME 1MFBH 1YEWA 3ZHDA 2JF1A 1FZMB 4EQ3A 3H7BB 1EXGA 1MFEL 4R5VA 2XG4A 4FQ2H 3TFKC 2QDVA 2IH9A 4K9EL 1UJ3C 3O6MH 4BZ1A 5EF3A 4NZ8A 1LO3L 4YDLB 2DWEA 4QYAA 3G6AA 4PRID 2CUMA 2VDQH 4XN9A 1JL8A 1T2QH 3FQWA 4A04A 3H3KA 3PE9A 3HC0B 3W2DH 3ZOAA 3VA6A 3LKOA 4JAMB 4PLNC 3V6OC 4PHXA 3ZKQD 3HNSH 4PSPA 5G55A 3GIZH 2GQHA 3MNWA 5B7EA 1HHGA 3GBNL 4CA4A 1CK0L 2HUHA 3QIWA 4IJ3B 3BAEH 5F71A 1I4FB 3GXUB 3X3GH 1F3DH 3MXWL 4HEME 4KXZI 2WQXA 4MJIB 1Q0XH 2JJTA 3DMMD 4FQIH 1AR1C 1NLBH 3P0VH 4X8XA 4K7FA 3NJJA 1T5WA 2WY3B 3KL5A 5IBTH 4XP9H 3MNDA 3GGWA 4XOBA 2ZPKH 4L2LA 4ZMVA 3F7VA 4G5ZL 4MFHA 4X4MA 4OGXH 3MO1B 4PJIE 5E9DD 1K8DA 2BMKB 5K59F 3V6FA 3HC4H 3B5GA 5I1HL 4NQUA 2A6DB 4KGLA 4WCYL 4CRPA 3SDAC 1HSAB 2R51A 1TTBA 1QUNA 1FZMA 4PMEA 4NOFA 3H7BA 5I71C 4WEBL 1VFBB 4PV8B 4FHKA 4BE6A 4M5TA 3DHMA 1U0QA 1NCJA 5T1JA 1QLRB 2JKTM 1EJOL 2CM5A 3NIGB 4KK6D 5GJTL 3ZT7A 4MKMA 2NR6A 1BQLL 4JAMA 4OTXH 4FLQA 5DZOA 1MIEH 1Z5HA 2XZAL 5EIIB 5E94A 5JYMA 5IJKC 1EZVY 5C0GA 5KSAC 2HXAA 4H7VA 4OIIL 3IB4A 3MRQB 1TJIL 3IJYA 4FQJH 4JY6B 1I4FA 1Z3GH 3HJ0A 4XP1L 1RK1B 3RWHA 4KC3B 1F97A 4CSSA 5D1QB 3EOTH 4X4YB 5BRPA 2UZXA 4AV5A 4LGPB 1F13A 1XO8A 1OW0A 3C5SB 3FO1B 2BDNH 5KVGH 1H6TA 3ARUA 1I8UA 3OXRB 4ZTOH 2JLPA 3D3VB 3FCGA 4TLUA 4KROC 3MO1A 1I3GL 1NGPL 1JWMB 4WSKA 2A6DA 4K2UL 1WFUA 4E0RB 4LSPL 3TBWB 2E46A 3LXBA 4F20A 3FUKA 4NPKA 2RCSH 3TYGL 2FX9L 5EMYA 1AIFB 2BNQB 2VR6A 5CO1A 1HE7A 3AREB 1KGWA 4I85A 1RZJH 1FFPB 1QLRA 3GT6A 4QXTB 3LXCA 2AEOA 3GSRA 3K6OA 4MMZB 3P3SA 2GT9A 4IRZA 4TVSa 1BF8A 4PJDA 5D7KD 1BXVA 4HIJA 1T0NB 2FT8A 2XFXA 3PGCB 4XMWA 2BRRL 1INQB 2YUWA 1HWGB 1AFVL 1JPGB 4R8WH 2VNCA 4NX0A 2W94A 1S9YA 3U2IA 2DMKA 2ED8A 1KLFB 1KIUB 4RLDA 5DRNA 3VXOB 25C8H 4BQCA 4XNZC 4JANB 1DVQA 3NIGF 3QZWG 2VM3A 4L3FA 3O8XD 1FNSH 4XVTL 5HD8C 2HVKB 4EMZA 5D1QA 1A1MB 2W65A 1S6NA 1DJGA 1T22A 3OMZA 3TBTB 4AEHL 3MLRL 3VMPA 1Z5LB 4P5MB 2AQ1A 4M1GL 3CHSA 4S0HA 2ADGA 3NJGA 2AK1L 3F62A 1RZKC 5F7WC 2IEPA 5D1XB 3OXRA 2XKNB 3G6JA 3FQNA 1H8LA 4PG2C 2E4TA 2QLYA 1G7JA 1FO0B 3DOIA 1RMFL 3KW7A 1SEBA 3LPOA 3MJGX 1TG8A 2G60H 5CF3A 5DEJA 3U4AA 4LBAA 1IB5A 2W81C 3DXAD 3JTBA 2F7RA 3PCYA 3STLB 3W39B 1TITA 5D70L 3IJSB 1DVFC 2GKIA 3I85A 2EVFA 1WJ3A 2KKQA 4NJAL 3OSKA 3QO1B 1NLDL 1MELA 4F2FA 2IG2L 3FFCD 4X6EB 4QXTA 3BWZA 4MMZA 4YIQB 2DLHA 1HCZA 3VXRB 4QGYA 4BE5A 4A7UA 2OL3B 2JIXD 3LRMA 4G5AA 4FG0A 5CBEA 2R7EA 2YXWA 5F8RC 4NENA 5AOJA 2P8PB 1RZFH 1FYTD 4MASA 1KLFA 3VXOA 4DCQB 4Y1AE 4PP1C 4F9PA 3IKCB 1FRGH 2CGZA 4TS6A 3L1OL 3WYRA 3BKCH 4AIOA 1A1MA 2CHNA 4HJJH 1NOLA 4FHJA 4M6OH 3TBTA 1Z5LA 1DJHA 1CXEA 4P5MA 4WRLA 2JB5L 2BWIA 2PW2A 1KSRA 1J8HA 3DDFA 2XKNA 4R2GB 2GC7C 1OV8A 2TAAA 4MJ2A 1FO0A 2A4ZA 2FAUA 2VIRA 1SOKA 3GZOA 4RH4A 1HL9A 1ZV2A 4YPJA 2QDWA 5HHOB 2FWOB 3D07A 2VDNB 4YQXL 5DZ9A 2Z0UA 5E5LA 3STLA 2HX9A 3FAXA 3M45A 3SDCA 4YSCA 1KBWA 3IJSA 1ZHLB 2QKSA 2EXWD 1AXSB 3LQZA 2DI7A 1AKJA 1ZY9A 2YBRB 5DK0B 1N70A 3QO1A 3TV8A 3RJQB 4X6EA 5DO2C 1QRKA 2W1NA 5AKTA 2FJFB 4EZLA 2L7QA 2TRHA 2J72A 2ZCZA 1CFNA 2VMFA 4J8RB 3AY4A 5ILTL 1BQUA 4UV4L 4QHPA 4UMSA 3OZ9L 3QIUD 1NPNA 1XGTB 4F8LA 2AJVL 3ESPA 3WHE0 1OP3K 3D51A 4DCQA 2RFXA 2AFNA 3QUYB 2WXKA 4HWEL 2D0HA 5JORA 1HHKA 2CHWA 1S3RA 1MRDH 3BAKA 4GP4B 2GHWB 5LXGH 3BFOA 3RWCA 1KCBA 4LAQL 1KB9K 5D4IA 3IN0A 3K74B 3BP7A 3MRIB 1BFOB 4CW1B 4HUUA 2OK0L 3MRJB 1GAFL 1BPLB 1FSKC 4IQHA 1LTXA 1AZNA 4HJSA 5INDA 5CGYD 3ARSA 1OTSC 5AUMB 5IHWA 4MB5A 2X4NA 4ZMZA 3K6NA 2K7PA 5L2KD 2DJ4A 5D71H 3IJ7A 3LEVL 5IMKA 5K9QI 4Z7NB 5GGSY 1AD9A 1E4XL 4LDCA 4JQVA 4BSWA 4HU8A 2R1YB 5AG9A 3EJCA 1AXSA 5IOPB 5BV7H 3MCG1 3VXQB 3QRBA 2LU5A 1XF4B 2OTWB 1R24B 4Q2ZB 3BXNB 2ZUWA 1XGZA 2ZCKL 1HI6A 4KITB 3CFJB 4AMKH 4YGVB 3HBGA 4KKQA 4U1JA 4J8RA 4U1KB 3UIZA 5E2WH 1U9KA 1UXWB 4W1TA 4JJHA 4WO4A 3R1GL 2KQMA 4DP6X 4H5SB 1P5UB 3PXHA 4UIMA 2K3TA 4XP5H 2H7WA 1R3KA 1L0YA 3BCDA 1EZVX 2IANA 2Z8SA 4Y2NA 4AEIL 3WFHA 1RJZB 3TN0C 1TZIB 3FHQA 1PG7L 1UYWH 1T89A 3BOVA 3MLVH 1I3VA 3H3PH 2HA1A 2YKLL 1BFOA 4NQED 2NTSP 4CW1A 3MRJA 1WFMA 3GZPA 1O9WA 4K3JH 1Q0YH 1UH3A 3QQXA 1PS3A 1VGEL 4XCNB 5DFWH 3F58H 4NO5B 3FUHA 5CJXC 5HHPB 1CFSB 3L5WA 1RQ5A 4OCWL 3EGDA 1ADQA 4RSVA 1BZDA 3BVUA 5HDRA 3HE7D 4WU7B 3QI9D 4UOW1 3PDOA 2PYFB 2ZKHH 3LDBB 2FZ3B 2EIDA 1KCKA 4R5XA 5IOPA 3QQ4B 2CDGB 4Q2ZA 4GMTL 1AKPA 3ROLA 5SX4H 1E3ZA 1JD9A 2NY2D 3LMJH 1RU9L 1EQWA 4ZPVB 4Z7QE 2I7OA 4FFYL 4E9WA 4U1KA 1U36A 2DQEH 3RPKA 3A4AA 4IIQC 3BIAX 3W11D 4FYRA 1JZ4A 1P5UA 4JPWL 5CCJA 3U4BL 4L4VE 3NZHL 4O2EB 1MLCA 1M6OB 3OAWA 2UUDK 3SPGA 4KDWA 4RRPM 1GIGH 4ZOAA 3WCYA 3CC1A 5DD1H 4DPBX 1RJZA 1WA2X 1TZIA 1XCXA 3NACL 2N7BA 4QXGL 2MNUA 1WWBX 4N87A 4AIXA 4O9HL 2YK1L 1S7TB 2WWMD 4YLCA 3AXLA 1MIMH 2ADIA 4N5EC 1B9KA 3DTUB 2ZXDA 5C09B 3TESA 5T1DH 2E7LC 2R4RH 3SE9H 1JFHA 3GXMA 2DWYA 3U7WL 1BLIA 5HHPA 4PM1A 3O2DL 5CLXA 2ICEB 2X2HA 5IBLD 2HX7A 3KLHC 2ZCLH 2XVGA 1JI2A 3IRCA 4L37B 4BQBA 3OC5A 2FB4L 4JM4L 4XWGH 2NSXA 4MDJA 2GTWA 1WWWX 3AT8A 4JHAL 5DF0A 3EJUA 5CD5C 3RP1A 5EN3A 3VH8G 1UWEL 3GSXA 3QAZB 4E41B 2CDGA 4FQQB 1HILA 4GSRA 3WN5B 3AQDA 1ET8A 2WKLA 1ZLWH 3VQ1C 5HP5A 5C0IB 1KENH 4ZPVA 4R84A 3VI4B 2D3JA 2GUOB 4AZ8B 5KEZA 1NBCA 3MUJA 3ZE2E 4NB7A 3UTTB 2RQ8A 1ASQA 4TXVB 3WKQA 3K6IA 5B8CB 1MCOH 3Q6GL 4G8FA 3CHOA 4G11A 1WC7A 1KYOJ 2ZSWA 1OTTD 1GC1L 4PWHA 3SBPA 5JXAL 2XWXA 2Z4QB 4JQIA 4LLVB 4J3XA 4O2EA 1M6OA 4EZMA 3B37A 2OMYB 1XL4A 1K3ZA 4PUBH 4JPIA 1T7WA 1S9VB 3NIDB 1IT9H 2ATKB 4APXA 4KI1A 2VSKB 1S7TA 2VXSH 5KS9E 43CAA 5L8LB 4Y5YA 2V5RA 4FJ6A 4JKPL 3GNML 5C09A 3ILPA 3CSFA 2G5BA 2IOMA 2YRLA 3CTTA 5IB5B 2ICEA 2G0LA 3GM8A 4NO2B 5DR5L 3GBMH 4K3GA 1QNZH 3OKLB 4OLZL 2WZPA 2J1XA 2L7EA 2MRYA 2QEJA 2CLRB 3FO2B 3V9CA 1CCZA 3MLSL 4PV1C 4U1IA 1U3YA 4MJID 1UXMA 4JG1H 1HXMB 3WN5A 5C8JB 4GY4A 5IB4A 2D7TL 1SMAA 4BYHA 2R1WA 5CN2A 1WFNA 2O5ZL 2BRQA 3H4HA 2P8MB 4WGKA 4XHJC 4J3UA 4CN4A 1UEMA 2I07A 1RXLA 3IF1B 3UJJL 3HS8A 2GUOA 1ORSA 3ZTJG 2FH6A 4FFZA 4ZUVA 5B8CA 3PWPE 2BY0A 1PKOA 5HYEA 2X6AA 2Z4QA 3CXFA 4EEEA 2BOBA 1U6AH 3C6SA 4GUQA 5HGDA 2OMYA 3L17A 4S11A 1NH6A 4BFGA 1R4XA 2WLYA 3H0TB 3VI4F 4FTDA 1S9VA 3KAAA 5KOVC 2DICA 1H6UA 1P4IL 3HG5A 1QRNB 1MFCH 3OAZK 1NAKL 3TZVC 1DBAL 1TFPA 1FDLH 3TV3L 1XCTB 3BGFB 4NLAA 4BQ6A 5DD5H 1NA8A 1RLBA 3ARXA 3IFPA 3MYJB 3E6FA 4MZIA 4MMXC 2R4SH 4Y16C 4JGMA 3VWKC 4EDWL 4ZX3A 1DP0A 1D9KB 4PTUA 3A0OA 5BW7A 5IB5A 1N68A 4UTAL 4NO2A 4DKFL 2DM2A 3RNQB 2XV2A 2EQDA 3NIDF 2Y7QB 5D9SB 5IB2A 2CLRA 3NJVA 3MBEC 1RY7B 1DQLH 4RETB 2ZXCA 4ZFZB 4Y4FA 3F3HA 1A6WL 4HD9A 4S1DD 1GGIL 4IHOB 2LAGB 4QRAA 3EADA 2ZX6A 3K8LA 3NJNA 2V7NB 3U0WH 3CK0H 2W92A 3ZE0F 2VDOB 2XN9B 4FDWA 4NC0B 5HY9B 3D3VD 1LEKB 1OAZL 4I2XA 5EEUA 2LLGA 2XBTA 1XH0A 3WGVB 3UGXA 2CMRL 1CG9B 4HLEA 5CZKA 1XSOA 1EEYB 2XQBH 1PKQE 4K23L 1N64H 3LPFA 2BNQD 4F37F 5C0DA 2X4RA 3ARED 3FQ4A 4BKTC 1QRNA 4JO3H 1NPJA 4NWUH 4OW6A 5I1GH 5DMGD 1XCTA 1IGIL 4GG8B 1VKXB 4XT1C 3N1GC 3MYJA 1GR7A 2WW8A 5KBDA 4DAGH 3EZ8A 1T21B 5D1ZA 3SCMD 5IROC 3IMBA 3C60C 1XH3B 3GZKA 4ALAL 1FZJB 2P48B 5I82A 1ZLUK 4YK4C 2BS8A 3FN9A 4I18B 3QQNA 1BD2B 3V7AG 4CUCA 4KTGA 3T2PA 1KYAA 3KWTA 3EO9L 5DJAB 4HH8A 3GSWB 2P5ED 2WP3O 2O72A 3IMUA 4IHOA 1QKZH 2PW1A 1UXSA 2GAZA 2VXQH 1RZJC 3LB6C 4KX7A 4O02L 4UBDC 2V7NA 2XN9A 4PB0H 1YMMB 3SDXE 3CDZA 4A7SA 5HY9A 3QEHB 5D1XD 1UZ8B 4RNRB 1LEKA 3W5MA 2N4IA 5T33H 3LH2H 3WFEL 2ZD0A 5HI5C 5BRZD 5T1KD 5TJWK 1CG9A 3AROA 4PV9A 1FLRL 1EEYA 1JXJA 4P2RB 1L5GB 1KCUL 4XC3H 2HTLC 4KHTL 1KTDB 4L8SA 4PRPD 2Y7MA 5HHQA 1G1CA 4G43A 3L54A 2AJ3A 3SYAA 4FXTA 4HX1B 2CPUA 1BFTA 4OJYA 2C9SA 5DI8A 4EN3D 3BGMB 2QGEA 4GG8A 4MD0B 1VKXA 5ABDE 1WHOA 3GJFH 5CBAA 3VXRD 2ROXA 5FYKU 1A8JH 1SJMA 1P4LA 5I9QC 5LGHH 2J12B 3H56A 4RCAA 1MZZA 2R56H 3D33A 3EKCA 2VXUH 4FC3E 4G1EB 1XH3A 4QRPD 3K71B 4FL4C 1R47A 1BD2A 2FX8L 5IK3A 1YHPA 3FU7B 3S7GA 2ZOLB 1YEHL 3QZWA 4LSUL 3N5AA 3GSWA 3O2VH 2X88A 1QFUL 1L6XA 4GRLC 2BLFA 4IRJA 4K15A 5F7EH 3RUGE 3EGSA 3RTQC 5I5MA 3PWVB 3QEHA 1W0YT 2HWZL 4G7SB 4XE5B 4PD4J 1ZLEA 4JFDE 1D6VH 3BEWB 4R2GD 5LGYA 4B9ZA 4EXKA 4O4YL 4G8GA 2XWDA 3OHXB 2Q2EB 3ZO9A 4M3HA 5AKRA 2NY4D 3NG5A 2VL4A 1L9TA 4KK8C 3GS0A 5HHOD 2QZ5A 3H8NA 3KWXA 3FU5A 4NCC1 2D2OA 1KEML 1L5GA 1ZCRA 3RKDD 5J6SA 1F5WA 3GK8H 5TE4L 4MAYA 5DC4B 3T4AA 5A7EA 3ECVA 4J1UB 3BN9D 3V4PB 4G1MB 1AP2B 2OM5A 4XZUA 4UT6H 4B5ZA 4JVWA 4ABWA 3NT0A 3WHXB 1KFGA 4JRXB 5BQDA 3NVQA 3UBXB 4MD0A 2NXYD 2OR8A 2DQUL 3D48R 1FFQA 2ZUXA 2G2RA 5EU3B 3DHPA 4AJ0A 3MV8A 4G9FA 4YXLL 3ATDA 3D4GA 1M53A 2EABA 5DQJB 5IW6A 1H15A 5AW5B 5JA9A 1N3NB 3LZQA 4G1EA 4LSVH 4QOKE 2WVUA 5FF6B 5FGSA 4YR6A 3ZYZA 1K5NA 3EG9B 1LP9B 3K71A 5DUPL 5FYKL 3MYZA 3QUYD 3HE6B 3EYSL 4F57L 3ARYA 2WLHA 2MH4A 3SD2A 3LKRA 4YDIL 4PVLA 3AAZB 4LIQL 4K3DH 4LVNC 2B2XL 2BP8B 4I77L 2BY3A 3ZK0A 5KVEH 4AGMA 5E8DH 3QDHA 5DC9B 1BG1A 4LB8A 1U58B 1CXFA 3MV7E 3ZGHA 1DQMH 3HHSB 2YA2A 4M56A 5D72H 3ZQWA 2LV4A 1PZDA 4LLQB 3OHXA 4B5EA 1X6NA 4OZFB 3B7UX 4P49A 4ZUSA 4K0OA 4AT6A 2FD6H 3GTTA 4WJ5A 3NQKA 2VYRE 3WIFA 4DZ8A 3H9HB 1FVDB 5I1JL 3IGAB 3V4PA 1AP2A 1H3UA 1E5AA 3MDJA 1BMZA 1CVSC 3RVUC 1CU4L 1OT1A 3ULUF 2YFOA 3QUXA 4JRXA 1S7SB 5IEHA 1V7NH 4JZJA 3SEPA 5F96L 1TNMA 5DMKB 2J44A 4YHKH 1IGCH 5EU3A 1FG2B 3IDYB 3RB5A 1GHFH 4YLBA 3RFZC 3HMXH 4GIPD 2ZICA 3B9KA 1U4FA 5DQJA 2PLTA 4F93B 3MXVL 4YUEH 1XX9C 5FF6A 2FT6A 3I3BA 2WO4A 2UZPA 4PRHD 1TYJA 5ICXA 3KDMB 2AGJH 1A65A 5CJBA 3THML 1CLVA 1LD9A 3BO8A 3CN4A 4DUXA 3BFQG 5JOPE 4MKTA 5CEZE 1ZKAA 1JD7A 3MZTA 3PPEA 5BV7C 3MLTB 1AIZA 5EIQA 3QNYB 2OZ4H 3E1ZA 3DETC 5D6CA 2WBJB 1J1PH 1LP9F 5DDHB 5LO7A 4HUMB 3WELA 1JGVH 1FCCA 5B39B 4N1EA 5CAYB 4JY4B 3S37L 1KEGH 4BK5C 4NQTA 2Y4SA 3QUMB 4IOIA 2A1WH 4I3SL 4FQLL 1OCWH 4L8DB 4NJ9H 4AW7A 2W07B 4I9WD 1YEJH 2CQVA 1JZDC 1W2KT 2AJYL 4OJCA 2MTPA 2X40A 4QD2E 5CS7A 5GGVL 5LCVL 3MRRA 4UQ3A 1FVDA 4AWJC 4NPYA 3BVNB 2JNZA 3K5RA 4TNVF 4HIIB 1L6PA 3Q8BA 5E5MB 4DO6A 1R19A 1EO5A 3ESOA 4IBQA 3KYNA 5DMKA 3VXSB 2A3TA 5CMAB 5DUML 1PW3A 3QCUL 3ULVH 1EZSA 1A4CA 5A2CA 3HC3L 1PCSA 3HG4A 2Q1EA 1DE4B 3JSSA 4NNXB 4PGEB 3QE5A 2F8OA 4NUMA 4NM8L 1MFUA 1ZLDA 3RVWD 1ZT7B 2H2SD 3ECQA 3WTUA 5IY5B 5CP3A 1OSPH 4KY1H 1DBML 4MX7A 4NM4L 1W9XA 4RAVB 1NCWH 5F7FA 4P5TC 1LXMA 3VD5A 2HLAA 1OAQH 4U4BA 1IKFL 2BP5M 5DFVC 3MMEB 2D8KA 1SHSA 2WAHA 3AU0A 4PQXA 3SB3A 2WBJA 1NTDA 4GAJH 1T1YA 2NPLX 5B39A 4I8DA 4K5LA 1A3RL 3VXUB 4JY4A 1IC0A 2VO8A 1GRWA 2E27H 3QUMA 4P4RA 4WTQA 1NAMA 3IDMB 4U0RC 4A2LA 1CDCA 2HFGL 2L7JA 2AK4E 4L4TE 5GHWH 3VH8B 3WFBH 4DWHA 4E41D 4DVRL 5C0JA 1TUPA 1K72A 1MQKH 1YQ2A 4TPRH 3VXMB 4WENB 2HH0H 1BIIB 5E5MA 4XPGL 4A2HA 2NT1A 4GI9A 2Z8WC 5IW3A 4LASH 4X80L 1A22B 2EDXA 3L1GA 3S3CB 2P43B 4NNXA 2J73A 1ANUA 3UTTD 4PJ5E 1BOGA 1ZT7A 3ZQXA 1T1ZA 4YHYB 4IKNA 5CEXB 3L3IA 5TF1H 5JPNB 5TF0A 4RAVA 2GK0A 1TZGH 5I16A 2XZCH 5E6IA 2VE6A 1P7BA 2YC1B 5IUSA 4EOWL 1WYJA 4U3SB 4LRNL 3N0PB 3V55A 3ZQ9A 2AI0H 3UG3A 4KQ3H 2KPWA 1GYWA 2VDPL 3Q2VA 4HMCA 4BSVA 4XMLH 4WNJA 3VXUA 4WZ9A 3MRLB 4D7BA 5CJQL 2HYMA 2YWZA 3MUY1 5E2UH 5FHBL 3D2UA 3Q01A 2WPGA 1OM3L 3CN3A 2EIJB 4DZBA 5KYNA 4PJBE 4P57B 3IDMA 3QDGE 4H26B 5FM8A 3VH8A 1CQKA 2UY6A 3MLYL 4MA7L 4PJ7B 4BZ1H 4XN8A 5FB8B 2UXVA 4ADGA 4OI8A 2D3VA 2H9GB 2HT2D 2K0RA 3D39D 2NNRA 4JDZA 3VXMA 1FJ1A 1K4DB 4GSQA 4M7LH 3CBRA 5I0ZA 2ALWA 4FYSA 3NDYE 3TCXA 5IVXE 5G5DA 1WIOA 2GBAA 1HYSC 5FHAH 1IBGH 2P9RA 3WEAA 1A9EA 2PXYC 1IO4C 4Z7VA 5IR1B 4HC1L 1B6UA 1MWAL 1YN7B 3MOAH 1FAKT 5ALCH 1ZAGA 4KQ4H 4XCCH 4ACPA 3SQOH 3AS3A 3V52L 1C8PA 3MLWL 3HI1B 4HWZA 2D9CA 4LHQB 1R5VB 4HJUA 1QSFB 4XO8A 5I1KH 3NCJH 3PGDB 2Y6SC 1T5XB 1AVAA 1JMZA 1MSPA 1SUHA 2MKLC 5C08B 4K94H 5DGQA 3QJHB 4H8WH 4PRAA 5GISL 3MRLA 1HKLH 1E43A 3HUJE 5CWSA 4KFMA 4JM2D 2R69A 3NCCB 2A4EA 3I6LD 5BZWA 4HKZB 5I8OL 3QARA 3UTPE 4OD3L 2DQGH 4PJ7A 1LEIB 1BX2B 3OG4B 2FJGB 2WO3B 4P48A 1AQ8A 4AGLA 1G6RB 4NXKA 4IBVA 2IWFA 1G7IA 5IBUB 3V0FA 4F7PB 4PGJA 3QUKA 2JLLA 4WUUD 4OF7A 2NQDA 4M7ZB 3WFDL 1HNGA 3LKSB 2GTQA 5FCSH 2XWJB 4PJ7F 4E9YA 3F7LA 4IBTA 5IR1A 2X53A 2XWEA 2CRYA 2AKRB 2YPLE 1YN7A 3MCKA 4LLYB 4HD5A 1JRHI 2GIYA 2QVKA 2N01B 4XNUL 4MJ4A 1VFAB 2VLRE 3WFCH 1X9UA 3A5VA 3W38A 4OLYL 2NY3B 1G9NH 3HI1A 4AM0Q 5C2BL 3F84A 1R5VA 3CU7A 3H2PA 5F9WC 1TTUA 5E4OA 2ZCHL 1U95A 2VC2B 4GP8B 5I6XC 3VFUB 3QHFH 1NFDE 2AJUH 1TF4A 3FCUB 5JTWA 2P44B 2W5PA 1JERA 1E6JL 4GQ9L 5KSBA 1H5BA 5KVDH 4ANKA 2VR3A 3DWTA 4AKPA 3LZFL 3T1FA 2JJSA 1T03H 3ELQA 4JFOB 4QRTB 4KZDH 4J6RL 1NICA 1X7QA 2AQSA 4OFPA 4XBEH 4CL7A 3DMMC 4U1LA 5ANMA 3NCYP 1SVCP 2JV6A 1WD8A 2CCWA 5EO9A 4Q6IB 3T3MB 4WTWA 2YQ2A 3V6ZA 4Y9CA 2G9HB 4YFLF 5DRWB 1ET5A 5IP4A 1VIWA 1YMMD 3HB3B 1BVNP 4XMVA 3HKFA 3QA3A 4YHNB 2LU7A 4FZEH 3NFSL 3AACA 2Z64C 1MFDL 4JG0L 2NY6B 3RWJA 1INEH 1DQDL 3CE1A 3WIIL 1RUAL 3BZ5A 2R0ZH 5JOFA 1K6QL 3FH8A 3K4ZA 4P2RD 1OO2A 4P07A 4JDTH 1WBXB 4J3OD 4S1SL 2IDQA 3H42L 1C16B 1D5IL 2SEBB 1OSYA 4LLYA 4ZX5A 1IEBA 5F9JB 5F3BA 3VD1A 3DV6A 4NNYB 1OWWA 3GI8H 5KSUB 2YOCA 4M3JA 5GGRB 4TL5A 3F6JA 4JUSA 2OXGB 1NBYB 3HNTL 3MX0A 5I5JA 4X6CA 5JIHA 1SEQH 5CCHE 1N59A 1T6WA 3BAXA 2Z93B 2K78A 1ZT1B 3R06B 5BRQA 3V4VB 1OAKH 3WTYA 3IMVA 1HOEA 1RZKL 2DWDA 3OKKA 1QYGL 4W70A 5C0CA 1O6TA 3ZKXC 3HFML 4ZMLA 3V6BR 1X5FA 4PG9B 3IETA 1JPTL 1MCQA 2PKDA 4F1SA 2WQRA 3FQRB 3C5ZD 4XB8A 4FKKA 1IARB 4YDZA 3MCLH 4KKBD 1JNNH 2B3IA 2J21A 2VR8A 3DX2A 5DZLA 4AC4A 1GS6X 2BZDA 2DKUA 2FBJL 2FNWA 3PHQB 4AQ1A 3AFLA 3P0YH 1U8LA 2EE3A 4KHXH 1BECA 2WOBA 5DD3H 2P5WD 2Y5EA 1IAIH 1EHLL 3Q8AA 1FNLA 3S96B 3VMOA 1OOAA 2QSCH 3QNZA 3A4FA 1D5BB 5GZOA 1JGLH 5ABZA 1XEUA 2DJSA 3T3MF 1UT2A 3WKNA 1WBXA 2H1PL 2VXVL 2MQGA 3BDYH 4OM1H 4CMHB 2VDML 5DTFA 2WZ5A 3LRHA 4DK3A 1IAKB 1I1YB 4WW1A 3EXJA 2J6EL 4NC1E 2OXGA 3R7QA 4PY8J 5CP7A 1GXEA 4EIUA 3L7EA 2V2XB 1NDMB 1OPGH 4XPFL 2Z93A 2X5PA 4UT9A 3QEGL 1B6DA 1CICB 4FCAA 2QR0A 4V1DA 5ACLA 2WK2A 4AIEA 5CKAA 4O2FB 1FO0H 4UF7C 4N2KA 5J3HC 4ZNEE 1KPUB 5H37G 3SPVB 5JHBA 1SBSL 4JBSA 1ZGLM 3GS4A 2DI8A 4JFSA 4K7PH 4J3BA 4NFCA 1CE6A 3W0WB 3HE6D 1WPCA 4DP9X 1ZMYA 3Q2NA 2NT0A 3V8CA 1CTMA 2G9KA 4KXCA 3L3HA 5ESQB 3TF4A 4KI5D 4RFOL 3DNKA 5JW5A 3FTSA 2OKMA 5KYYA 4XXWA 4TSBH 4HBCL 4HS3A 1BMWA 3TLRA 4HT1H 4IRSA 3S96A 1XGPA 2OL3H 2DLFH 2QELA 4NAJA 3IK2A 3O0RL 3DKHA 2WLIB 1XCQB 1D5BA 4DQOL 3H9SD 3L45A 3O11B 1M05B 1IBBA 3HCVB 3NEOA 4OD2B 5L7XL 2FSDA 4OZGE 4UQ9A 2HZHA 1LMKA 1WUNT 2CKBB 1IAKA 1KIPB 3FU6A 3I2CL 3QWRD 4LOUD 5GRUH 1FFRA 4F7EB 2EUVA 5GGTA 3ECBB 1GA2A 1YA5A 1YYML 3ORJA 2CLVA 3GBDA 3LIZA 4Y9FA 1CL7I 4L29A 3O3DB 1CICA 1SXNA 4MXVE 1HQRB 5FYLE 1Z9SA 4HQQL 4POUB 4F8OA 1GTNA 4LQFH 1TSRA 2QJDA 4FXGC 3ARFA 2W0LA 4HXAH 2EZ0D 4HH9B 2Z65C 4HUVA 1JYVA 1ZDSA 2XWBB 2X1PA 3U9PH 2NRDA 4UM9A 3W0WA 1E5UI 1I85C 1F41A 3B9DA 4XWOC 1XD1A 4M93B 5IESH 3GBEA 4Z5RA 3IMRA 2HLEB 4P2OD 3N44B 1A4AA 3UC0L 1EDQA 3VCLA 2ADFL 1TO5A 4N0FB 3O6FA 5GJSH 2MPAH 1E9QB 3RZCB 3DOHA 1KB5L 4WK4B 1XCQA 2Z7YA 5IMOB 3VFOB 1M05A 1MHCB 2X4PA 3GF8A 5DK2B 3SIKA 4NUGL 1EAPB 2ESVE 4ELMB 4CC1A 3HCVA 3UYPB 1EAJA 2MQ3A 2EH7H 5CLTA 2CKBA 3QAQA 4ERSL 3X14B 4KMTL 2YN3A 2GCYA 5SWQB 3MC0A 4MCNA 3IYLW 1J1OL 3ECBA 2R15A 2WXOA 3P3TA 1JGEA 3QEQD 4HF5H 4L3EA 4Y1AB 3VXSD 3NJFA 3O3DA 3QJUB 4P4KB 1OCCB 1LQBC 3S3BB 1M7DB 3ISRA 3EH3B 1UEYA 4HH9A 3C9NA 5FFGA 3O41A 3LNEA 5E95B 4G9DA 4X9BA 1S8DB 1IKOP 1UUSA 1I7RB 2OTUB 1TVBB 4GBXC 1CGWA 3O2DA 2EP6A 2IQAB 3SZKC 5F7HA 1QBML 5A1AA 2NW2B 1NOAA 5FGCE 2MHAB 3KPSE 3HPJA 2PTUA 4HUXA 5K39B 3EYOB 3ULVC 4N0FA 3ALWA 3PPSA 1E9QA 3KPQA 4GAFB 4MCZB 3SJVA 4A6YA 1B90A 4NQVB 1DYZA 4F7TB 2O93L 4YZWA 2XVBA 4C57C 2RJMA 4Q74A 1MHCA 4XP4H 1ML0A 1MHPL 3TA4D 1EAPA 2VTFA 1F4AA 2HT3C 1ZTXH 3NSDA 4ELMA 2M83A 3M1CA 4MA3B 2M2DA 4Y9EA 2BSDA 3N44F 5TH2B 2DBLL 1E9OA 3CAFA 3L9YA 2OMUB 5C6TH 1HDMA 3KCPA 1A9BB 1A4BA 5I74B 4Y7OC 3A67H 2JMRA 1RCYA 1IGYB 1HWHB 3CC5B 4P4KA 3TTYA 4ELMF 5B38G 3VW3L 1EMTH 5CGTA 2PP9A 4FJYA 3KJ4C 4H8UA 5EZLB 5HDQL 5DZJA 4C54A 5I75C 4X7EC 1F1AA 1Z9NA 1YCSA 4NZRH 2R29H 1Q4NX 5D2LA 3TVMC 4MNQA 3BQUC 1S8DA 3VYPA 1NZRA 4UYQA 2VH5L 4ANXA 3NSCA 1I7RA 1TVBA 3BPCB 2I9LB 1JUFA 2IH1A 1QI3A 4R26H 5KYWB 2R27A 3FFOA 2NW2A 1OGPA 4G8AC 2XQ0A 4KJQD 4KXDA 3PP4L 1S7QB 1MW0A 3TS8A 3G04B 5LAPA 4MCZA 3EJRA 5E00B 1TJGH 2YKKA 1T04B 4NQVA 1BBDL 4AYEC 1S5HB 5EEVA 1M9SA 4JRYE 5FGRA 2X3AA 1U2CA 2VLKB 3JWNH 4YHIA 1MCNA 2ICCA 2IGFH 4JQIH 5DEGA 3D06A 5AAWA 4MA3A 3VDAA 2EVIA 4XNXL 4I3RL 5JDSB 4NUJB 5KUMA 3N40P 5JO5B 2OMUA 2WYTA 2AQPA 2PWHA 5IT2H 2J7LA 4MQXD 3AUWB 4YS4A 1QA9B 1IGYA 1WT5A 3MFGB 2PPEA 2E9JA 5T5FA 3SGJA 5GZNC 1CD1B 3W11C 4DEUA 2BVPB 1LILA 1C5CL 1O9ZA 2ITFA 1LK2A 1BVOA 1L0QA 4F9LA 4N2BA 4QCIB 4L8CB 4KUCF 2GJZA 1O6SB 1SHMA 4RQQA 2I9LA 5EOQH 3MJ6A 4JR9H 1KJ2B 4ZOEA 4X7TA 4AH2A 4FABL 2GITB 1EO8H 2G75A 1QSFD 4UI2A 2XA8H 1S7QA 1X7SA 5E99H 1XMWA 1S7WB 3FRPG 3G04A 1T04A 4FFZH 4UAOB 3ECUA 4N2EA 4TSAL 3SDDD 4Z3IA 1YEDB 5D2NB 5IBLC 3W2DL 5DHDA 3ZIMA 2VLKA 1XZ0A 4P46B 1JBJA 4UOJA 3NA9H 1I1AA 3HNSL 2IPTH 1T3FB 1G94A 1T0OA 1U8HA 2H1LM 5HHMD 1SLXA 2G4EA 3T0EE 2CU9A 3BAEL 1Z9PA 2JJTC 3BLKA 4PJ9A 5EHFA 3X3GL 4RBPH 5JO5A 1Q0XL 1TKWA 2KDGA 4CDGC 4FQIL 4OT1H 4L4VB 2WSDA 3P0VL 1XGRB 4KK5C 2N1KA 1AMYA 5FK9A 2WIIB 3NCYS 5IBTL 4FNLH 1LGVA 1E4HA 2IV9A 4Y4HB 3PIQB 2WVVB 4K94C 1RP9A 5IFJB 4H8WC 4NO3A 4NQCB 4LXFA 4OGXL 3T71A 4QWWD 5DFAA 3HC4L 4ORGB 1P4BL 3BDXA 4JLRA 4BDVA 1WTLA 4CU8A 5IJVB 4XAKE 1BVLB 1I31A 1O6SA 1DBKL 4N2FA 1KJ2A 3KWUA 2NY3D 3AG3B 4XHQA 4WIQA 2GITA 3IU3A 5AW7B 3W82A 3ZTCC 3MQIA 1OWRM 4D2NA 2H3NB 5I0YA 3QUZB 2VMJA 5GXBB 4LNRB 3S9DB 5ADPH 5JHLA 4N2GA 4LCUA 2E7HA 2ZIDA 5AAMA 4JB9H 1FL5B 1QI5A 1WZ1H 1YEDA 3EJSA 5D2NA 4GXFA 4QHUB 3AUVA 3SODB 4OTXL 1F6FB 4P46A 1MIEL 2Y3AA 2C1OA 1T3FA 4IJ3C 4KTYA 4JZOB 2VW4A 3FFDB 3QWOA 4MZ2A 1RULH 1W8NA 3KHOA 3TWYA 4FQJL 4HG4J 1Z3GL 1PZBA 1DSWA 5L88L 2KL6A 4PWKA 5H2BA 1G9NC 4CGUB 5FW7A 3RX8A 4L4VA 4I88A 1XGRA 4ANVA 4F2ME 3U79A 4BUQA 2A73A 2WIIA 5GGQH 3U7YH 4JNXA 2BDNL 4LSQH 1SDDA 3DUHA 4D0DB 4UTBL 3N3EA 5KVGL 5IFJA 1QFWH 3PYCA 4ZTOL 2VW7A 1P2CA 2NY6D 2SODB 3NGBB 4NQCA 1CZ8H 2C9XA 1JG9A 2DM4A 4FNPA 5F21B 9PCYA 1RZ8B 5FO7A 3IAPA 3VVVA 4BWTA 4ZFGH 2ILLA 2PMZA 2CIIA 1L9RA 3L9EA 1U8JA 4ODVL 2A77H 1T7YA 3L3GB 4WI2A 3D12B 3MUGA 3PWNA 2OW7A 1BREA 3CBJB 3GRWA 5E6SB 5TDNB 3IDNB 3D1MC 2RCSL 4G6AD 3V0WH 4QKTA 4GXVL 1FVCA 2ZOOA 1AZRA 3O45B 4N3TA 3CXHJ 2H3NA 1RZJL 2VDOH 3L4ZA 3ZUNC 3QSKB 4LNRA 5B21A 4U2YA 5LGJA 1EK3A 1FWXA 2Y1AA 4GUCA 1JYWA 1FL5A 1KC5H 5EWIL 3G5WA 2CD0A 4LU5H 4QHMB 1LNUB 4HS8H 2O61A 1XBRA 3QULB 3OJMB 1V3KA 3Q5TA 3MRPB 5LXVA 2BWDA 3ZR6A 25C8L 2PN5A 1RV6X 2GB2A 2XV3A 1XIWB 5D1QC 3PWPB 5I1LB 1XF2B 4ODWA 4E5XB 1QW9A 4D9RE 3F65A 2CE6A 1OT4A 1BFSA 4MVBC 4OB5H 5BJTB 1Q1JH 2ZX9A 3BW9B 4F33A 1U8CA 3RDTB 3JUYA 5J1TC 5LLIC 3OB0K 1FZKA 5DJZB 3UPRB 2AXWA 3D85B 1R46A 4FXKB 3LNFA 4GG6E 4NQSB 1G7LA 2G60L 2Y5TB 5FFLA 3BP4B 4OV5B 4J2QA 4R90H 2J1KA 1MCCA 1CI3M 2IFFH 3VM7A 1OHZA 5E08H 2CO4A 5TDNA 3IDNA 2NMSA 1XSIA 4MMZC 4HUWB 4LCYB 5KS9F 2FATH 3HG1E 4KVCH 4RMVA 3PV6B 4TL4A 2E9WA 4NGHH 1FFOB 2WD0A 4B7IA 1CTOA 5ADOL 2QPDB 2P52A 3WXWH 2EAEA 2ZSVA 1LDPL 2YARA 2ZOKB 3P9WB 1GCFA 2YLHA 4PJ8B 1RZFL 2EXSA 4O2CA 1EHKB 2QADC 4PIRF 3EJYC 2ENJA 3PWPA 3D8MA 3CFCH 3N9GH 4J12A 1XF2A 3KLKA 2TSBA 4JQXC 1E2ZA 4HJJL 1TEYA 2EO9A 3OXSA 3HOGA 1PKQB 1UACL 4R7NB 1Z1WA 3CX5J 3VGAB 5IVZB 3CFEA 4F58L 3FH5A 3BW9A 4XCEA 3A22A 2HG5B 2FDBP 1ETZB 1E3FA 2WLLA 4DUVA 3GEWB 3GBLA 3D85A 3GLDA 4LLMA 4FXKA 4DERA 1A02N 2OV0A 1KLGB 3ZL1A 1DUZA 1PYWA 1NCIA 1DLFH 3TT1H 1BF2A 2VMCA 5KYUB 5BXFB 1BFVH 3SDCC 2N7AA 4KTDH 5AVWB 1BAFH 4Z7AA 3NH7L 1N7MH 2MCAA 5BOZG 3ARTA 1XGYH 5GRWA 3FBKA 2F58L 5E1QA 4N6QA 1QLFA 2QVFB 1P5VA 1KNOA 4HUWA 5H35A 3BCFA 2FBOJ 4ENZA 4TQIA 2WM0A 4N2AA 3AY4C 4Y8AA 3PV6A 3ULUH 1TQBB 1CFTB 4FD0A 1A14L 1P6WA 3QORB 1KYUA 1UB5B 2F1EA 3RQ3A 4Z8FH 1FAIH 3SDXB 5H37A 1EV2E 3KHQA 4XX5A 5AB9A 4PJ8A 1IIIA 1ZHNB 4PS4H 3DLQR 1AHKA 4RX4A 2X7LB 1MHHB 3CPUA 3SYOA 3V4PH 4EI6A 2H41A 4DP7X 1IGMH 4N2OA 4PI2A 4W4NA 1MRDL 4XNBA 4TNEA 3PXJA 4LKXA 5J6HB 5LXGL 2ZUVA 3QIWD 3Q13A 4W4OC 5IVZA 2R0LL 1N5YH 3QDMD 4R2GC 3OWRA 3RZCD 1F3RB 5LCVA 5FUOH 5HJDA 1I9IH 1IIKA 2D0GA 3JTSA 4WHTA 3S35X 5C07E 3DVGA 4Q4EA 4DVBB 2K7QA 1GY2A 4TNFA 4UILH 3CQFA 1SJEA 5D71L 1TCRA 2ZOTA 4KKPA 3SY0B 4JQVC 4MWFA 2X2JA 1MG2C 4HJGA 5A2AA 4UIKH 3D08A 1WEJL 3MJ8B 3KYMA 2F54A 1E8XA 5BV7L 1ID5I 1NFAA 2IF7A 1X4XA 5EB9A 5LGKA 5B1JA 1J5DA 4GQPH 2NTFB 2Z0BA 1MFAH 2ZXGA 4MD4B 3QPXH 4DGIH 3UOAB 1UH2A 3K91A 5HDBE 2PUQT 4OZFH 1MXDA 1XSJA 2APBA 2P49B 5E2WL 1UB5A 3RUGB 5IHZB 5JDJA 1OVZA 1E2WA 3SDXA 1DSYA 4Q8BA 3F7QA 4JFDB 4GFXA 1ZHNA 1MHHA 1SJHB 1ZV9A 3D7PA 1GVIA 1DVYA 2PCFB 2Z7UA 5DLLA 1BQHG 3NZ8A 4M03A 1T89C 3QO0B 5J6HA 2EDRA 2JKIS 3RGVB 2H5UA 1Z3RA 2W9DH 2GHZA 5JLZB 2X9XA 3MLVL 3H3PL 3MNZA 1KYFA 4EDXB 4AEEA 4PTTA 5DJXA 2JI2A 2CK0H 5FYKE 4G8EB 3SDXF 4K3JL 4U1HB 5FPIA 4H88L 1PU0A 5D7SH 3F58L 1CGSH 4LIQE 4PLKC 4DVBA 4EE2A 2PYEA 5AB1A 5JIMA 1NJ9A 1JN6A 4JO8A 5CP3H 4U1MB 1EGJA 3SN6N 1KN4H 3KWWB 2C7FA 1AGFA 2BP0B 5IB3B 3BSZL 4XNMB 4M61B 1KELH 2ADJA 4XZ4A 3TJPA 1R3JA 4KUCD 1UZ6E 4XPAL 4DGVL 3LMJL 2F7OA 3S6CA 5A43C 1UM4L 5E9AA 3NEEA 4AQ8A 4H2CA 5FX3A 1QLEH 2CJSA 3KPMA 1OP3H 2X6UA 4XR8C 2DQEL 3D50A 3EJPA 1KYOK 5FO2A 5IHZA 1AZCA 3QUMH 2Q10A 1P5UC 1RL1A 1WGOA 2CDEB 4KOCA 4LPVA 3OGCB 3TH2T 2BOCB 2WVTA 3MV7B 5D5MA 3L1FA 4U6XA 2JH2A 2AJXH 1CT8B 4OZ4B 1R5WB 3FZUD 2LU4A 3L9BA 4FQXD 4KXBA 4CKQA 1KBVA 4OU3A 5GRVK 3QGVA 3CZNA 5DD1L 4G7VH 4BGDA 3QO0A 1BZQK 4ENED 3RGVA 2Q8BH 5JLZA 3RUGF 2JWYA 1DSFH 2CXKA 1MUJB 3LQMA 3R0NA 2VM4A 5EC2A 4G8EA 2Z3FA 4EQ2A 4KU1A 2ITDA 1A2YA 3QXTA 3KLAA 5LG6A 2DLTA 3A47A 3MRBB 3V9EA 1HJCA 1CGYA 2ZCLL 3HZMB 2GJPA 5GSRB 3CUPA 4U1MA 4I0CC 3RAJH 2FHFA 2QGCA 3DUSA 1Q38A 2ZXBA 3DX8B 3KPPA 4XWGL 3LDBC 4ONGH 5CN1A 2X1QA 5EC1A 4CJ1A 5DK3A 4WY7H 5BVJB 4F80A 2Z8VC 2WWNA 3ARGB 3K2KA 4XNMA 3CZGA 5I15L 4TTGA 4MB3A 3D0AA 2F8VA 3N6YA 2WNWA 3FAWA 3V6OA 4GQRA 4P23A 1YVLA 4PY8I 4ZS7L 1VAHA 2VR9A 3FC8A 3NIFE 5ITFA 2H26A 4HWUA 3PHAA 1MCEA 1Y6KR 1X5MA 2YLKA 1NIBA 5C1MB 1D5RA 1XVSA 3FB5B 1QR1A 3I74A 3QXDB 3H54A 4P2AA 2CDEA 4JZNA 2BIPA 2D03L 1B4LA 2R2BB 2BH0A 4W9ZA 3TWCL 5FO8B 3LH8A 2EXYC 4B95C 4OZ4A 3RX5A 1D2PA 3V5DB 3GPEA 3H4FA 2XG5B 4W6YB 5ISZE 4EKXA 3C8DA 4PUBL 2VRQA 2PF6A 2GI7A 4Q7DA 1IT9L 2X2YA 3U1SL 4JVUA 2NNFA 2HFEA 1A5FH 5GGUB 1PG7W 2VXSL 4K5PA 4U6HA 2D7OA 1QX1A 4M43H 2LLLA 1W72B 3BN3B 1CLCA 1VERA 4G8IB 4G7RB 2ICEC 3ZXAC 4RA0C 1D5XA 1ZIBA 2NX5A 2VABB 3QRGH 4PCTA 5GSRA 3VAEA 1QNZL 3DIFB 3T6WA 3PGFH 3DX8A 2N3JA 4CMMA 2BVEA 1NANI 5DWUL 4DSYA 1XF3A 3QAZC 5BVJA 3ARGA 1KCRH 1C5DA 2DQIL 2Y06H 3Q9PA 3WN5C 5BMFH 4QT5A 4PJXA 4RISH 2AV1A 4JY5H 4M8RA 2QPSA 3Q2WA 3TT3H 1ZD6A 3Q6FA 4GUOA 1ASPA 1X5AA