2EELA

Solution structure of the cide-n domain of human cell death activator cide-a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death activator CIDE-A
publication title Solution structure of the CIDE-N domain of human cell death activator CIDE-A
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2eelA00
1P7EA 1XCQL 2JU6X 1C9FA 2RPVA 4GLSC 4MACA 5BMIA 4D2KA 1IGDA 1MI0A 1ZXHA 1EM7A 1K52A 1Q10A 1YMHE 2RMMA 1F2RI 2LGIA 4HJGE 4WH4A 4KGSA 5HHDG 5HI1A 1K51A 1P7FA 2GI9A 1D4BA 2ONQA 2IGGA 5HG2A 1FCLA 1YNTE 2LHDA 2PTLA 3UI3A 5BMHA 1PGBA 2ZW1A 5HFYA 2JXTA 2J53A 1GB1A 1MVKA 4OZBA 2OEDA 2JWUA 1PGXA 2ON8A 2N7JA 2N9LA 4HKZE 1JMLA 1XCTL 2LUMA 1XF5L 2JZPA 2KACA 2IGHA 1HEZE 4OZAA 2LHEA 5BMGA 1QKZA 3V3XA 2EELA 2NMQA 1F2RC 2ZW0A 4IOIE 3FILA 3GB1A 1MHHE 2IGDA 1UWXA 2QSDA 3FILB 1FCCC 1K53A 4OZCA 3MP9A 1GB4A 2KDMA 1IBXA 2KQ4X 1PGAA 2JSVX 1HZ6A 1MHXA 2K0PA 1MPEA 1IBXB 2I2YA 1HZ5A 2J52A 2PLPA 1KH0A 2QMTA 2N9KA 1IGCA 4IKGA 2KWDA 4KGTA 1K50A 1FD6A 4KGRA 2KN4A 2GB1A 2PW9A 5JXVA 2I38A
chains in the Genus database with same CATH superfamily
5LLIA 2JX5A 3ZLZA 4FA6A 3N1XC 1MI0A 4MGZE 5G55A 4RGOS 4DK5A 2RD0A 2O6VA 5T8IA 2WWZA 3U52E 4HEA1 1UZXB 1WYGA 2K25A 1I42A 2V3PA 4F7ZA 2V4LA 3AE6B 4II2B 2KKCA 4LNOA 3H7SA 4A55A 4HK2A 2MP2B 3PS6A 1EWCA 3AE1B 3K9PB 4RM8A 2WYQA 2DYBA 4ZOHC 1YJ1A 2J53A 1CJEA 1L2NA 3RCZA 2DYOA 1LGRA 1BT0A 1MJDA 3RNCC 1XD3B 2BBCA 3RPFC 4LDTD 3Q14C 1CK1A 2QJLA 1FXAA 1V6EA 4M0WA 4A9AA 3EFCA 4IWQA 4WIPA 4OZAA 3HM3A 4KX6B 3O65B 2OHFA 5DPWA 3RN9C 2D2QA 4HPPA 2WDVB 1VZ8A 1MHHE 3A9JB 3RZWC 3PPAA 3HIZA 1SE4A 2NS5A 2K22A 4XWTA 4HDQA 3MC0B 3N20C 1YN3A 3IXSA 2MHJA 3DBRI 4ACFA 1F1HA 2BS2B 3BYTB 3IBEA 2GBNA 3W1SA 4ANWA 2PE6B 2O6VB 1C3TA 5CHWA 4ASWC 2Y5PA 3DOWA 4GLSC 3IT6B 4MACA 5FR3A 5BMIA 3BINA 3VH4B 1WY8A 2LI5A 4JL9A 2J7QB 3EUB2 3LYYA 2BB6A 1YJJA 1Q10A 4TMAB 2M17A 2M1MA 4RNAA 1ZGUB 2QIEB 2MJDA 3M95A 3ZIMA 4MH0E 4RH6A 3DVNU 1E10A 3JYUA 2GI9A 4KZ0A 3DBHB 4HDOA 3DBLI 5MPOA 3AU4A 3DBSA 4CHKA 2IDYA 3AEFB 2TSSA 2JXTA 2MBBB 3DVGX 4IM3A 1MVKA 4W9CA 2N1WA 2ACZB 2K8BA 1IP9A 1XF5L 1C4PA 3TSSA 4GDKB 2QILA 1WWTA 3PZ8A 5CX3A 2LVOA 3SU8X 2GBRA 3LDZE 2JPHA 3RYTA 3AE3B 2O2VA 2FCNA 2BB5A 4K7SA 3T9LA 3AE7B 2K3UA 3PRPB 4HPLB 5DPRA 1UWXA 3CIRB 5KHOA 3U7ZA 4XZ4A 4AJYB 2LWPA 3V6EB 3AECB 3B08A 4YWGG 5AUKA 2KDFB 3VTUA 1E8WA 5GXGB 3RI7C 1IBXB 3IFWB 2KMCA 2WXFA 4S0RA 1AN8A 3AE4B 4C7YA 3VUXA 1JWUD 2ZPNA 2PPHA 5BYSA 2C60A 2JF5A 5CHFA 1C9FA 2CKHB 4XX5A 4MH8A 1HTQA 2WXLA 3DHGC 4MGKE 5IO9A 4PT5A 3AN1A 1E7UA 1I4QA 1YX5B 3TEXA 3OJ3A 4TQ0A 1WM3A 2BTEA 1N63A 4LNKA 3H1UA 3VQIA 4JX1C 1F2RI 3Q8FA 1QOAA 2B76B 1E9MA 4KGSA 2LGYA 1XEEA 3N3KB 2K8HA 4WJOA 3NVVA 4EEWA 2INDC 5E6NA 2G4SA 3R7RA 1GC7A 1KLUD 2NVUI 2G45B 4YTNB 2L0TA 2W9NA 3DPDA 3L0WB 2LHDA 3I63C 4FBJB 2BKRB 3FKYA 2VH1A 2CHZA 2AL6A 5BMHA 2WNMA 1U4AA 3MHSD 2MBOA 1GB1A 1D6EC 1JW9D 1WXSA 1VDVA 2WS3B 4ICVA 4KDLB 2KDEB 2N1VA 2BS4B 2GBJA 4ZHPA 3JSVB 2IGHA 4GSWA 4A90A 5CTRC 2ZW0A 2CJNA 2DNFA 4K7WA 3M62B 2LVQA 2BWES 3ZRCA 1WXAA 4CYEA 3QWZB 2ZJDA 2JYTA 3CMMB 4LNNA 3RNFC 2O6VD 4HCNB 1SB3C 1E7PB 2XNAC 3RZFA 3EHVA 3L08A 2GRIA 4NAMA 2RR9A 2IY0B 3QAQA 2KFKA 3ZYYX 5IA7A 5J2RA 1T6BX 4B9KA 3WAMA 1C4AA 1R4MI 2AEHA 4KGRA 4OVVA 3K9OB 4GN1A 3AU5A 2KN4A 1JWSD 5BO4B 2X38A 2NPTA 1TIFA 2PW9A 3R8BA 3KUDB 2JYEA 4MEMA 1OTRB 2K39A 3GE8C 1EM7A 2PJHA 4GGQA 2GMIC 2L1AA 1JALA 1N61A 1UBQA 2WX1A 3PLUA 3NHEB 4BKGA 2KZRA 2V3NA 2LVPA 4YL8A 5BYQA 2XBBC 1MG8A 1WX7A 1VLBA 3UIOB 3A4RA 2UU7A 3A1QA 1J7CA 3KVFB 2AYOB 3RNEC 2WXMA 1QQRA 1FXIA 1LM8B 2FAZA 1NI3A 2L00B 2KC1A 2WGSA 3C19A 4IG7B 2KACA 3PHXB 3N1YC 3E9SA 1WYWB 4G50A 5C2TB 3ZNGC 1UBIA 4BKSA 2ICIA 3C0RB 4GU2A 2KXJA 5KHQA 3CWIA 1LQBA 3VXWA 2KFKB 3PO0A 4TV3A 3BIID 1GJZA 1TGZB 4NAWA 1HZ6A 1ZXIA 2A5UA 3PREA 2I2YA 5FR6A 3NZSA 3WIMA 3A9KB 1VCBA 4HKQA 3QK0A 1TYGB 1FXTB 2HJ8A 2FCMA 2UWQA 1SIFA 1QOGA 2C5LC 2BKFA 3A33B 2WDRB 4C56C 4YSYB 5E6JA 3ABVB 3V62A 1OQQA 1V81A 1WFYA 1JROA 2MQJA 2EMSA 1UGMA 4MGYE 2JVCA 1EO6A 3M3JA 3SHQA 1OQRA 5TSSA 2M19A 3DHIC 4L23A 3AXCA 3OJ4B 3W5UB 3A1QB 3PV1A 3HVDA 4HWIB 2Y5CA 1NYRA 2IZVB 4M02A 4PK1A 5HI1A 3HHMA 4W9KA 2IGGA 2DWQA 3VUYA 3MC9A 3W1SC 3P4SB 3U4EG 4LJPB 1TS2A 2QCZA 3VH3B 3ZTDA 2M4NA 2PTLA 2CR5A 5C23A 2QEJC 1RAXA 1PGXA 2HJ1A 1V5OA 2N9LA 3QX1A 1JMLA 2W54A 1VZ7A 1HA5A 1EF1A 3FC4A 2MJ3A 2FIFA 2K5PA 2KK8A 2L32A 2RSUA 2X8XX 2KJ6A 4NAWB 3W9CB 2PKOA 1ZOYB 4BOZB 4MJSA 4IOIE 1I4GA 3FILA 4QAYA 4K7UA 5D3IB 3QIJA 4DHZE 3R7QA 2LGSA 2BQQA 2WU5B 2K1FA 4NPNA 4OW0A 1UWMA 3V6CB 5FK9C 4S17A 3MC8A 4WJPA 2K8CA 3NUHB 1Q1OA 2PVOD 2QMTA 3KW5B 1KFYB 1WMHA 5H92C 3AE5B 2INNE 3KUCB 3DCGA 3AEBB 3QQ8B 4YTPB 3S2AA 4NY0A 2CHWA 1B1ZA 5LXHA 3DBLB 1AW7A 1HXYD 2L7RA 3ZVVA 3I5JC 3KWLA 1JWMD 2L0FA 1A70A 2WLBA 4HVBA 4GMVA 5GMVA 2Z0EB 2KN5A 1T3QA 3AEDB 3EA6A 2Z8LA 3AH7A 5J18A 3ENEA 1V1PB 3Q3JA 2XEWA 1I4XA 1N60A 1AWDA 2LGDA 3QHTA 4A3OA 4WJQA 1FCLA 3LJ3A 2BWFA 1GC6A 3UI3A 1KOTA 2RGFA 2IPKD 4W9EA 5JHBA 3PSEB 4DHJB 4OZBA 4AJWA 2JWUA 4MJSB 4L2YA 4YT0B 2DZMA 1JCKB 1QOFA 4HKZE 1WF9A 2KHWB 5LNK1 3HRDD 5G5GA 3MFGA 2KD0A 3WAPA 1PUTA 4WURA 4W9HA 2DZIA 1TZOA 4AUQC 3ZDTA 2DAJA 1L4ZB 5G2NA 2INCC 1ZKHA 3V05A 1C76A 1QILA 2WXIA 2KO3A 4EUTA 3ETRA 2ZZPB 3ONSA 4A8XC 1WMHB 4XE0A 1GB4A 2N9PC 2JXXA 1XLQA 1XLPA 5L95C 1SE9A 3URYA 1MPEA 1ZDVA 1VRAB 1T0RC 4DWFA 3NY5A 2KWUB 1AYFA 3RUIB 1WGGA 3VTWA 3TBLD 3IT4B 3X0WA 4JQWC 4RF1A 1STEA 2WDTB 3PT2B 1VR9A 4IDIA 1ENFA 4B0EA 1IGDA 2IO1B 1TY0A 2D3AA 2KX3A 2ZEQA 4K3CA 4I6LB 1RYJA 1A5RA 2JY6A 2C7NB 5H8YE 2M8SA 5HKHA 1R4NB 3J9CA 3ML9A 2LGIA 1E0ZA 1P3QU 1XLOA 2MBEA 4DXAB 1WXVA 4BKSD 1WIAA 3N30A 4B95A 2N9EB 4WWMA 4A3PA 4MDKE 4JE3B 1FNVA 1E8ZA 3UINB 1KTKA 1JRPA 1WGYA 2ZPYA 1WJ4A 2ZVOA 3QA8A 4IWPA 2N4FA 2NBVB 1ZDXA 3SFEB 4LCDE 2EKEC 3NJTA 4ZDVA 2VH2A 4US8A 1T5XD 2L52A 1RWSA 4I6NB 2KTFA 4LJOB 4YXDB 5J17A 3JVZX 2MBHA 4M0WB 4ZYSA 2LGXA 3KUZA 2R61A 1EUVB 4GB9A 1J7BA 3H7PA 4MELA 4IM0A 2MLBA 2QSDA 4AS1A 3IAS1 3MP9A 2D3GA 2SAKA 1RLFA 4WWOA 1XLNA 2W82A 2JRHA 1YX6B 4WJNA 2IBIB 1I4PA 4LNIA 3TEZA 2KFJA 4LNFA 2JQRB 1KH0A 4MM3A 2NCNA 1K50A 3NVYA 1SXTA 1G6JA 3KYDD 3PVLA 4AOFA 3ML8A 5D2MB 2JU6X 3R66C 2MH7A 1F77A 2GLSA 4B0MA 2FNJB 2WHIA 4JLCA 1ZXHA 1K52A 2ZNVB 3HK0A 1J8CA 3AEAB 2RDHA 3N1ZC 2NTTA 3RNAC 3VDZA 3KWVA 5AZFA 1Z2MA 3AM9A 1UUPA 2V4IB 1IYFA 4RF0A 3GZNB 1QF6A 3IVFA 3QC8B 2DZJA 3R2TA 4DHJD 1D3ZA 3WA0A 5HG2A 2LXCA 2LJ5A 5EDSA 1YNTE 4K1RB 3TMPB 2OOBB 1L0YB 1P98A 3V60A 1PGBA 1WH3A 5HFYA 4AQ7A 2FE8A 2W3SA 2DENB 2KOXA 1FFVA 4XDCA 4ARCA 2YLMA 5D6JB 4XC2A 5IOIA 1RFKA 1N5XA 4W9JA 3Q3OC 4KDIC 2E3TA 2RDGA 2Z59B 3Q2AC 4MT5A 2KT7A 2I1JA 1V49A 4C4VA 2G9HD 3GB1A 1P9DU 3R3MA 2YEPB 2QC8A 3H9DA 5EE0A 4BKTA 3PRZA 4RGMA 4ITKA 2O2VB 4MM3B 2FBWB 4B6WA 1VD2A 5FKAC 1B9RA 2MCNB 1WR1A 2HE7A 3TEWA 4DHZB 4EE2A 1J7AA 4ANUA 1RRBA 2KJRA 1WXMA 2AL3A 1EU3A 2MW5A 2SEBD 3AULA 1YN5A 3P1MA 4WWNA 1L5PA 3DDCB 1TY2A 1OEYJ 4E71A 2PE9A 3B2GA 3QJZA 1SJHD 2INPE 2L05A 3IHPC 4ZRJA 3MHZA 4KKIA 2DX5B 2CU1A 2N7DA 2BS3B 1DYQA 2J0KA 2C7MB 2WQYB 3Q8BA 1TKEA 2FCSA 4RGNA 1K51A 4PS8A 4BAXA 3ZXVA 3R2IA 1SBBB 3TEYA 2JRIB 2B3AA 1GG3A 4L1BA 2I1KA 3BWUD 2JZ3B 2HTHA 3Q3NC 2OEDA 2KLCA 4C4VB 1WGDA 1FRDA 2KLGA 1NYQA 2WXQA 4WAFA 1ZE3D 1TBEA 3PGEA 1DOIA 3W5VB 1F2RC 2J0MA 1V8CA 4ANVA 2KTRA 5EE9A 4GOCA 2KQ7A 4ICUA 2NTSA 1F0ZA 3PHWB 4OZCA 3PLVA 1PGAA 3APDA 4IM2A 1WRDB 2ZCBA 1QZEA 1YD8U 3I57A 2D3BA 2MA9B 2YEPF 3U7DA 2WU2B 3W2DA 2KYWA 2K0PA 2BYFA 1YN4A 1TT5B 2LASA 1XT9B 4ARIA 2BF8B 3VRAB 4CO7A 2PVGC 1NDDA 1KLGD 1IGCA 4P7IA 4P6VF 1XQQA 2NBUA 3WALA 3KYCD 4DDID 2AWTA 4C00A 1P7EA 2EMTA 2RPVA 1KJTA 2MBQA 2HD5B 2KDBA 2NPTB 1E5WA 1I7HA 3Q69A 4HLEA 2M0XA 4XWWA 2DZKA 1L0XB 1P1AA 3VRBB 3APCA 4W9GA 1ET6A 1LO5D 2JUOA 4KV2A 4RM9A 4XDDA 2KMMA 1NBFC 1SGHA 5EE3A 4OVUA 1WZ3A 4JWSC 2DBYA 4TUUA 4A6QA 3U30A 4IW0A 3ZDMC 3ZW3A 2ZW1A 4N6EB 2KTRB 4DBGA 1NENB 2W55A 3JW0X 2ON8A 3ZXRA 5IP4D 2WXOA 2VRRB 1EF5A 1L0VB 4TQ1A 4NZLB 2MEKA 3CF6E 3GOEA 3V3XA 2NMQA 2PIAA 2NBWB 2WX0A 1P0RA 1V86A 3NS1A 3DQVA 1Q0WB 1PFDA 2L8JA 2PEAA 1Q5WB 3SD5A 2ZNVC 1R7SA 5IKCM 1UNSA 2AQ1B 2MX2A 4FXCA 2BT6A 4E3CA 3P42A 2C9WB 4NJCA 1XO3A 2MJEA 1S1QB 1BMLC 4EZLA 3O13A 1OQYA 3NZ3A 1WM2A 3VTVA 2FCQA 3ZJVA 1WGHA 2HTME 4IKGA 4JWUC 3ALBA 1SE3A 3DBRB 3W1YA 4W9FA 2BPSA 2JZZA 3WCQA 2WP9B 2LMCA 4FULA 3AMZA 4OVZA 3HVZA 2QDFA 1WGRA 1SJED 4BVUC 4P1CC 5E6OA 3N9YC 1CZPA 1QOBA 5JHAA 2YVCA 3NOBA 1PQSA 1OFFA 5G5HA 2KDIA 4W9LA 1YMHE 4NQKE 2GBKA 2IO2B 2FIDA 1L4DB 5D3DA 2MP2A 2WXNA 3ZNZB 1LFDA 1WSPA 4ZRQA 3SFDB 1GOZA 1GNUA 1C78A 3ZJUA 1WX8A 2OJWA 1KLVA 1I35A 3QARA 3WANA 1M4VA 2KJHB 3DHHC 4US9A 3U2SC 1HTOA 1E7VA 2H89B 2Y5BB 1C79A 2WXKA 1V97A 3FAHA 5AZHA 1FNWA 3WAOA 1IPGA 3PTFC 4MGIE 2LRUA 1GAQB 2EELA 4PYUA 4FJVB 4IWOA 1AARA 1UH6A 3T8MA 1WE7A 2MSED 3AEGB 3Q6BA 3EC8A 2UYZB 3FILB 5JZEB 1FCCC 1E6EB 5CHVC 4IUMB 4Q2JA 2K9XA 2DAFA 4LTUA 2KQ4X 3OG5A 5AZGA 4KVGB 3MJWA 1KRHA 3P4QB 3KH0A 2G4DB 1WJ6A 2M0AA 1JQ4A 4N58A 1DGJA 1HZ5A 4ZYNA 2PLPA 4JPSA 3L4PA 4BBNC 3VAWA 1TZ1A 2Q5WD 5D94A 2CU3A 4LK0M 1PDXA 2KWCA 2J0JA 2GB1A 4ZRKA 1RM6C 1GUAB 1XCQL 1NEKB 3Q8EA 3BVMA 1ESFA 3SDLC 3NS8A 2G3QB 2MWSB 1YQ3B 1I4RA 1V5TA 4N9F4 4BFRA 2ASQA 2XK5A 1FFUA 1N62A 4FHJA 3RFZB 3VFKA 2FUG1 3ZRFA 2V3SA 2IO3B 1D4BA 2ONQA 4O1NA 1SSNA 4F1SA 4XGAB 4RMAA 3B2FA 1ET9A 2K6QA 1ZPSA 3KQ4A 1E8YA 3BZDB 3RD2A 1WJNA 1T0YA 4GDKA 4K3BA 2XN9C 2HDEA 1XCTL 2LUMA 3P2BA 3TL5A 4W9IA 3DWMA 4KIKA 1YQBA 4BZAA 4PS3A 3P4RB 4G3XB 1HE8A 2CJOA 4DXGA 3EGRA 1L6VA 2VZKB 2KC2A 4RCOA 1FM0D 3RT3B 1SE2A 1WR6E 1V80A 1M94A 2WDQB 2WXRA 1FNUA 3P4PB 1IBXA 4HROA 4MSMB 3UF8A 1YQ4B 2AQ2B 1EU4A 3T3NA 3HM6X 2REXA 1KF6B 4R3DA 4C80A 2J4XA 1YIWA 2N9KA 2AX5A 3GS2A 5DPSA 2WXHA 2I38A 1R4MB 2XK5B 1D5XC 2CS4A 2MRPA 2LZ6A 1FMAD 4P1BC 2KANA 2C7HA 4FJYA 2KAJA 5LXIB 2K6DB 1NVID 1TS4A 4HCPB 1N5WA 4ANXA 3NVZA 1H4RA 1L7YA 3B0AA 3QCAA 1WI0A 3RMKC 1P7FA 3M63B 3GP7A 1C77A 3NRZA 4URKA 3BVGA 1ZP0B 2Y3AA 2KQSA 1L6UA 3TUOA 4KIKB 1SIJA 2LEKA 1Z5SB 2M56B 1TJEA 3SR6A 1TKGA 3VR8B 2AQ3B 5E6PA 3JSVA 2N7JA 4EOYA 3OLMD 1JRUA 1UF0A 4IC7B 4M00A 4J6IA 1HEZE 4MSQB 4RGTA 2PMVA 1QKZA 3VUWA 4FN2A 2LXAA 4DDGD 1ZW7A 4HRSA 4FLHA 2A4ZA 5DCNA 4LLGM 1HQRD 1PYWD 3H7PB 2DYMA 1CQVA 1UD7A 2IJ0A 2IY1B 1C1YB 1MHXA 1ZUD2 3DWGC 4M8MA 4TKNA 5IN7A 1YOVB 4NQLB 3IAM1 1GPXA 1BXTA 3L13A 2BGFA 4HPMB 2FUHB 2BYTA 1FD6A 1V1OA 4HXDA 4BOSC 3ZNHB 2D07B 3B9JA 4FADA 4D2KA 4EZJA 5DPTA 1R4NI 2R2QA 3VHTC 2RMMA 3L17A 4CQNA 3OAWA 3V61A 2L76A 1WE6A 3GE3C 1WJUA 2BYVE 3OWEB 2JWZA 4GIVA 2IO0B 1CMXB 3RULA 4KSLC 4REZA 1QT9A 4PYZA 1K8RB 3B1LX 1T0SC 1QLBB 3PRMB 5L83A 1J0GA 3NG0A 5C1ZA 1V2YA 2D11A 4WQMA 2VZKD 3DBHI 1S3SG 2V9HA 4USAA 2JZPA 1D5ZC 3Q8CA 3UQAA 2EKIA 2LHEA 5BMGA 3VVWB 4WAAA 1VZ6A 4ZHOA 1V9JA 2KX0A 2LJIA 3BK1A 1TTNA 1MFWA 4HJKA 2IGDA 2ZCCA 2KMAA 2RPQA 3L10B 3CSFA 3ZJTA 1EWYC 3KLSX 2GBMA 4YSXB 3A9KA 1WGKA 4AP4C 2R2OA 4ZRPA 2E6XA 3ZTCA 4TSSA 4KZCA 5IAAC 3TCAA 4YTMB 4F8CB 1I4HA 1X1MA 2KWDA 2D5GA 3IG3A 2RDBC 2OJRA 3D32A 1E90A 4RFBA 3U8ZA 4H2AA 1SEBD 1ISNA 2D10A 5JXVA 3UIPB 4XYCA 1FO4A 3I3TB 2KVZA 2BYEA 1TS5A 4YSZB 1H8CA 2J42A 4P16A 1UELA 5EE1A 3ZO5B 3GZNI 3PZ7A 4NNJB 1WXQA 2KWVB 2LD9A 2NR2A 4HJGE 3ZGZA 4WH4A 1DOYA 5HHDG 3UGBB 4NJ7A 3Q3FA 2G1EA 2WXGA 1IUEA 4PS7A 5I4DA 4M8NA 3LXFA 1E8XA 3E56A 5D7GA 4UDUC 3Q8AA 2V1YA 2H88B 2LUEA 2IYDB 1YJIA 5AUIA 4N59A 2Z0DB 1KM7A 4X57B 2GOWA 1J19A 1XXGA 2KNBA 2N7EA 3AEEB 1N6ZA 3VR9B 3X23A 3I9V1 3RNGC 4LDTB 4GDLA 3EECA 3AE9B 3DVGY 4BBNF 4I6PA 4II3B 3HUIA 4DQOC 2L3ZA 2WXJA 1WZ0A 1FPYA 3ECIA 1LXDA 1WX9A 1SF0A 4KGTA 3AE8B 1ROEA 3ZQ4A 4C7ZA 5BYRA 2N9XA 4WWPA 3MTNB 3N32A 3NZUA 5AEKB 2DLBA 3LB8C 1NI2A 1F52A 1TS3A 3Q3MC 3AB5A 4AWJA 1DOXA 1T0QC 3DVNV 3BVZA 3UQBA 5TR5A 3ZUNA 1V1PA 2D3CA 4G0NB 2LFIA 4KSKC 1Y56A 1FIQA 3NVWA 2BW2A 4WQOB 1TKYA 2JT4B 5C3JB 4E74A 3AV8A 1ACCA 3BYYB 4G11A 4W9DA 3MJ5A 1OGWA 3APFA 3ZKJC 1Y8RC 1C4CA 1OEYA 3TIXA 4DXFA 2CHXA 1VJKA 3CSTA 1UGJA 4FJZA 2N0SB 4M01A 4FHKA 2LRWA 3L54A 1RFAA 3T3OA 3BK2A 4GXBA 1FEHA 4JIOU 3H8HA 4GDLB 4EFOA 2DHZA 1BUIC 3EFUA 2KVRA 3ZNID 3H6NA 3SEBA 4NJ6A 2ZVNA 1FRRA 1WRIA 3P63A 4JGHB 3AI5A 2QHOA 4A20A 1K53A 4ZRIA 4OHJA 2KDMA 2WXPA 2JSVX 3RNBC 1MG4A 3L16A 3TJPA 4KKJA 3AE2B 3A4SC 2V0GA 1JWAD 1D5MC 3PZDA 4K81A 2J52A 3A9JA 2BVCA 1JWBD 3C8YA 4J3OD 4EZKA 5JH5C 1F9JA 3BY4B 2W3RA 4EKUA 2L83A
chains in the Genus database with same CATH topology
1D5XC 2JX5A 1OQQA 1MI0A 3B2GA 1FMAD 1JROA 1SJHD 4RGOS 2INPE 2KAJA 5T8IA 1OQRA 3MHZA 4KKIA 5TSSA 2M19A 4L23A 3W5UB 3U52E 2BS3B 4HEA1 1NVID 1TS4A 1WYGA 1N5WA 2V3PA 3HVDA 1DYQA 2Y5CA 3NVZA 1NYRA 2WQYB 3AE6B 3Q8BA 1TKEA 4RGNA 1K51A 1P7FA 5HI1A 3GP7A 1C77A 3NRZA 4A55A 2IGGA 3BVGA 2DWQA 1ZP0B 2Y3AA 3P4SB 3U4EG 3R2IA 1SBBB 1TS2A 1EWCA 1L6UA 3TUOA 3TEYA 1SIJA 2LEKA 2M56B 1TJEA 2PTLA 4L1BA 3SR6A 3AE1B 1TKGA 2QEJC 3BWUD 4ZOHC 3VR8B 2J53A 1CJEA 2AQ3B 2OEDA 2DYOA 1PGXA 1FRDA 2BBCA 2N7JA 2N9LA 1NYQA 3RPFC 1JMLA 2W54A 1VZ7A 2WXQA 4WAFA 1CK1A 2QJLA 1HA5A 1FXAA 3FC4A 1ZE3D 4M0WA 4A9AA 4WIPA 1HEZE 2MJ3A 4OZAA 4RGTA 2PMVA 1QKZA 1DOIA 3W5VB 1F2RC 2K5PA 1V8CA 4KX6B 2L32A 3W9CB 4NAWB 2OHFA 5EE9A 2PKOA 1ZOYB 4IOIE 1I4GA 4HRSA 3FILA 2WDVB 1VZ8A 1MHHE 5D3IB 2NTSA 1F0ZA 1SE4A 4LLGM 1HQRD 2K22A 4OZCA 2WU5B 1PYWD 4XWTA 2DYMA 1PGAA 1CQVA 2IJ0A 4OW0A 3I57A 3MC0B 1MHXA 1ZUD2 3DWGC 2YEPF 3W2DA 2WU2B 1YN3A 2K0PA 1UWMA 3IXSA 5FK9C 1YN4A 4ARIA 3VRAB 3IAM1 1GPXA 2PVGC 2BS2B 3NUHB 3BYTB 1KLGD 2PVOD 2QMTA 1BXTA 1IGCA 3W1SA 4P6VF 1KFYB 5H92C 2BYTA 1FD6A 3AE5B 2INNE 1V1OA 3B9JA 1P7EA 2Y5PA 2RPVA 3IT6B 4GLSC 4MACA 5FR3A 5BMIA 4D2KA 3AEBB 1I7HA 3Q69A 4YTPB 3EUB2 3LYYA 1B1ZA 2BB6A 1YJJA 1Q10A 4XWWA 2RMMA 1AW7A 1HXYD 4TMAB 4CQNA 1L0XB 4RNAA 3KWLA 3VRBB 1JWMD 2QIEB 1A70A 2WLBA 1ET6A 2MJDA 1LO5D 1T3QA 3AEDB 3EA6A 2Z8LA 3AH7A 4XDDA 1V1PB 3OWEB 2KMMA 4RH6A 1I4XA 1N60A 1AWDA 1E10A 2GI9A 5EE3A 4REZA 4JWSC 1QT9A 1FCLA 5MPOA 2DBYA 4A6QA 3UI3A 2IDYA 3AEFB 1QLBB 2IPKD 2ZW1A 2TSSA 2JXTA 4N6EB 1MVKA 4OZBA 1NENB 2JWUA 2W55A 2ACZB 2ON8A 4L2YA 4YT0B 4WQMA 1JCKB 1QOFA 2VZKD 4HKZE 4USAA 5LNK1 2WXOA 3HRDD 1XF5L 1C4PA 2JZPA 5G5GA 3TSSA 1L0VB 4GDKB 4TQ1A 3MFGA 4NZLB 1D5ZC 1PUTA 3Q8CA 2MEKA 4WURA 2EKIA 1TZOA 2LHEA 5BMGA 2QILA 3V3XA 2NMQA 2PIAA 1WWTA 1VZ6A 3PZ8A 1L4ZB 4ZHOA 3NS1A 2LJIA 3AE3B 3BK1A 3V05A 1C76A 1PFDA 1QILA 2WXIA 2BB5A 3AE7B 2K3UA 1R7SA 2IGDA 1UNSA 1UWXA 3CIRB 2AQ1B 3ETRA 3U7ZA 4FXCA 2BT6A 4A8XC 3P42A 4XE0A 4NJCA 3ZJTA 1GB4A 1EWYC 3KLSX 1XLQA 3AECB 1XLPA 1XO3A 4YWGG 5AUKA 4YSXB 2MJEA 1WGKA 1BMLC 3O13A 4ZRPA 5GXGB 3URYA 2E6XA 1MPEA 1ZDVA 3NZ3A 1IBXB 1VRAB 4TSSA 4YTMB 3ZJVA 1AYFA 2WXFA 1I4HA 2HTME 1AN8A 4IKGA 3AE4B 2KWDA 4JWUC 4C7YA 3IT4B 2D5GA 1JWUD 1SE3A 5BYSA 4RF1A 3WCQA 1STEA 2LMCA 2WP9B 3AMZA 4OVZA 4H2AA 1SEBD 4RFBA 3HVZA 5JXVA 1SJED 1C9FA 1VR9A 4IDIA 1ENFA 4MH8A 2WXLA 4B0EA 1IGDA 4PT5A 1FO4A 3AN1A 1TY0A 3N9YC 1CZPA 1I4QA 1QOBA 1TS5A 4YSZB 5G5HA 1OFFA 2J42A 4P16A 3TEXA 1RYJA 4TQ0A 1YMHE 2BTEA 5EE1A 1N63A 5H8YE 3PZ7A 1WXQA 3J9CA 1L4DB 1F2RI 2LGIA 4JX1C 3VQIA 1E0ZA 5D3DA 1XLOA 3Q8FA 1QOAA 4HJGE 2B76B 1E9MA 4WH4A 4KGSA 2WXNA 3ZGZA 1DOYA 5HHDG 1XEEA 1WSPA 4ZRQA 3NVVA 2G1EA 4WWMA 3SFDB 1GOZA 1KLUD 2WXGA 1C78A 3ZJUA 4JE3B 4YTNB 1IUEA 2LHDA 5I4DA 1FNVA 3LXFA 5BMHA 2WNMA 1KTKA 1JRPA 3E56A 5D7GA 4UDUC 1GB1A 3Q8AA 1M4VA 1D6EC 1JW9D 2H88B 4US9A 2WS3B 1VDVA 3U2SC 2H89B 1C79A 1ZDXA 2WXKA 3SFEB 1V97A 3FAHA 1YJIA 5AUIA 4N59A 2BS4B 4US8A 1FNWA 1T5XD 2L52A 4ZHPA 1RWSA 2IGHA 1GAQB 2EELA 4YXDB 4A90A 1XXGA 2ZW0A 3AEEB 2CJNA 3VR9B 4ZYSA 3I9V1 3AEGB 2R61A 1J7BA 2QSDA 3AE9B 3FILB 1FCCC 1TY2A 1E6EB 2JYTA 4AS1A 3IAS1 3MP9A 4Q2JA 2K9XA 4LTUA 2SAKA 2KQ4X 1XLNA 1KRHA 2W82A 3P4QB 1SB3C 1E7PB 3HUIA 2M0AA 2XNAC 4DQOC 1I4PA 2WXJA 1JQ4A 4N58A 1DGJA 1HZ5A 2GRIA 3TEZA 4NAMA 2PLPA 4JPSA 2JQRB 3L4PA 1KH0A 3ZYYX 1T6BX 4KGTA 1SF0A 1C4AA 1K50A 2Q5WD 3AE8B 1ROEA 1SXTA 3NVYA 3ZQ4A 4KGRA 4C7ZA 2CU3A 5BYRA 4LK0M 1PDXA 2KN4A 1JWSD 2GB1A 2X38A 2PW9A 1RM6C 1XCQL 2JU6X 3R8BA 2MH7A 1NEKB 2DLBA 3LB8C 3Q8EA 2JYEA 1F77A 3BVMA 4B0MA 1TS3A 1ESFA 1ZXHA 3AB5A 1EM7A 1DOXA 1K52A 3AEAB 2RDHA 2L1AA 3BVZA 1JALA 2NTTA 1N61A 1YQ3B 1V1PA 1I4RA 2LFIA 3KWVA 1FFUA 1N62A 3AM9A 1UUPA 1FIQA 1Y56A 3NVWA 3RFZB 2V4IB 2BW2A 2FUG1 4RF0A 1QF6A 2V3NA 1TKYA 5C3JB 5BYQA 3R2TA 1D4BA 2ONQA 5HG2A 3AV8A 1ACCA 1SSNA 1VLBA 3BYYB 4O1NA 3MJ5A 1YNTE 3B2FA 1L0YB 1ET9A 1J7CA 1C4CA 1ZPSA 4DXFA 3KQ4A 1VJKA 1PGBA 5HFYA 1UGJA 2N0SB 2WXMA 3BZDB 1QQRA 1FXIA 4AQ7A 2FE8A 3T3OA 3BK2A 2W3SA 2XN9C 1FEHA 2HDEA 1FFVA 4XDCA 1NI3A 1XCTL 2LUMA 4ARCA 3H8HA 4GDLB 2KACA 3DWMA 1BUIC 1RFKA 3E9SA 3P4RB 1N5XA 5C2TB 2E3TA 2CJOA 2RDGA 4MT5A 3EGRA 4DXGA 1L6VA 2VZKB 2ICIA 2G9HD 3GB1A 4RCOA 1FM0D 3CWIA 3SEBA 2YEPB 5EE0A 1SE2A 1FRRA 1WRIA 3P63A 4RGMA 3PO0A 4ITKA 2WDQB 4MM3B 2FBWB 2WXRA 3BIID 1FNUA 1K53A 3P4PB 4OHJA 2KDMA 1IBXA 4HROA 2WXPA 2JSVX 1YQ4B 2AQ2B 1EU4A 5FKAC 1HZ6A 3T3NA 1B9RA 1ZXIA 4KKJA 1KF6B 4R3DA 3AE2B 4C80A 2V0GA 2J4XA 1JWAD 1D5MC 3TEWA 2I2YA 4EE2A 2J52A 1J7AA 4HKQA 1TYGB 1JWBD 2N9KA 3C8YA 2AX5A 4J3OD 1EU3A 2SEBD 3GS2A 1QOGA 1YN5A 3P1MA 2W3RA 2WDRB 4C56C 4YSYB 1L5PA 2WXHA 5E6JA 2L83A 2I38A 3ABVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7E A;  1XCQ L;  2JU6 X;  1C9F A;  2RPV A;  4GLS C;  4MAC A;  5BMI A;  4D2K A;  1IGD A;  1MI0 A;  1ZXH A;  1EM7 A;  1K52 A;  1Q10 A;  1YMH E;  2RMM A;  1F2R I;  2LGI A;  4HJG E;  4WH4 A;  4KGS A;  5HHD G;  5HI1 A;  1K51 A;  1P7F A;  2GI9 A;  1D4B A;  2ONQ A;  2IGG A;  5HG2 A;  1FCL A;  1YNT E;  2LHD A;  2PTL A;  3UI3 A;  5BMH A;  1PGB A;  2ZW1 A;  5HFY A;  2JXT A;  2J53 A;  1GB1 A;  1MVK A;  4OZB A;  2OED A;  2JWU A;  1PGX A;  2ON8 A;  2N7J A;  2N9L A;  4HKZ E;  1JML A;  1XCT L;  2LUM A;  1XF5 L;  2JZP A;  2KAC A;  2IGH A;  1HEZ E;  4OZA A;  2LHE A;  5BMG A;  1QKZ A;  3V3X A;  2EEL A;  2NMQ A;  1F2R C;  2ZW0 A;  4IOI E;  3FIL A;  3GB1 A;  1MHH E;  2IGD A;  1UWX A;  2QSD A;  3FIL B;  1FCC C;  1K53 A;  4OZC A;  3MP9 A;  1GB4 A;  2KDM A;  1IBX A;  2KQ4 X;  1PGA A;  2JSV X;  1HZ6 A;  1MHX A;  2K0P A;  1MPE A;  1IBX B;  2I2Y A;  1HZ5 A;  2J52 A;  2PLP A;  1KH0 A;  2QMT A;  2N9K A;  1IGC A;  4IKG A;  2KWD A;  4KGT A;  1K50 A;  1FD6 A;  4KGR A;  2KN4 A;  2GB1 A;  2PW9 A;  5JXV A;  2I38 A; 
#chains in the Genus database with same CATH topology
 5LLI A;  2JX5 A;  3ZLZ A;  4FA6 A;  3N1X C;  1MI0 A;  4MGZ E;  5G55 A;  4RGO S;  4DK5 A;  2RD0 A;  2O6V A;  5T8I A;  2WWZ A;  3U52 E;  4HEA 1;  1UZX B;  1WYG A;  2K25 A;  1I42 A;  2V3P A;  4F7Z A;  2V4L A;  3AE6 B;  4II2 B;  2KKC A;  4LNO A;  3H7S A;  4A55 A;  4HK2 A;  2MP2 B;  3PS6 A;  1EWC A;  3AE1 B;  3K9P B;  4RM8 A;  2WYQ A;  2DYB A;  4ZOH C;  1YJ1 A;  2J53 A;  1CJE A;  1L2N A;  3RCZ A;  2DYO A;  1LGR A;  1BT0 A;  1MJD A;  3RNC C;  1XD3 B;  2BBC A;  3RPF C;  4LDT D;  3Q14 C;  1CK1 A;  2QJL A;  1FXA A;  1V6E A;  4M0W A;  4A9A A;  3EFC A;  4IWQ A;  4WIP A;  4OZA A;  3HM3 A;  4KX6 B;  3O65 B;  2OHF A;  5DPW A;  3RN9 C;  2D2Q A;  4HPP A;  2WDV B;  1VZ8 A;  1MHH E;  3A9J B;  3RZW C;  3PPA A;  3HIZ A;  1SE4 A;  2NS5 A;  2K22 A;  4XWT A;  4HDQ A;  3MC0 B;  3N20 C;  1YN3 A;  3IXS A;  2MHJ A;  3DBR I;  4ACF A;  1F1H A;  2BS2 B;  3BYT B;  3IBE A;  2GBN A;  3W1S A;  4ANW A;  2PE6 B;  2O6V B;  1C3T A;  5CHW A;  4ASW C;  2Y5P A;  3DOW A;  4GLS C;  3IT6 B;  4MAC A;  5FR3 A;  5BMI A;  3BIN A;  3VH4 B;  1WY8 A;  2LI5 A;  4JL9 A;  2J7Q B;  3EUB 2;  3LYY A;  2BB6 A;  1YJJ A;  1Q10 A;  4TMA B;  2M17 A;  2M1M A;  4RNA A;  1ZGU B;  2QIE B;  2MJD A;  3M95 A;  3ZIM A;  4MH0 E;  4RH6 A;  3DVN U;  1E10 A;  3JYU A;  2GI9 A;  4KZ0 A;  3DBH B;  4HDO A;  3DBL I;  5MPO A;  3AU4 A;  3DBS A;  4CHK A;  2IDY A;  3AEF B;  2TSS A;  2JXT A;  2MBB B;  3DVG X;  4IM3 A;  1MVK A;  4W9C A;  2N1W A;  2ACZ B;  2K8B A;  1IP9 A;  1XF5 L;  1C4P A;  3TSS A;  4GDK B;  2QIL A;  1WWT A;  3PZ8 A;  5CX3 A;  2LVO A;  3SU8 X;  2GBR A;  3LDZ E;  2JPH A;  3RYT A;  3AE3 B;  2O2V A;  2FCN A;  2BB5 A;  4K7S A;  3T9L A;  3AE7 B;  2K3U A;  3PRP B;  4HPL B;  5DPR A;  1UWX A;  3CIR B;  5KHO A;  3U7Z A;  4XZ4 A;  4AJY B;  2LWP A;  3V6E B;  3AEC B;  3B08 A;  4YWG G;  5AUK A;  2KDF B;  3VTU A;  1E8W A;  5GXG B;  3RI7 C;  1IBX B;  3IFW B;  2KMC A;  2WXF A;  4S0R A;  1AN8 A;  3AE4 B;  4C7Y A;  3VUX A;  1JWU D;  2ZPN A;  2PPH A;  5BYS A;  2C60 A;  2JF5 A;  5CHF A;  1C9F A;  2CKH B;  4XX5 A;  4MH8 A;  1HTQ A;  2WXL A;  3DHG C;  4MGK E;  5IO9 A;  4PT5 A;  3AN1 A;  1E7U A;  1I4Q A;  1YX5 B;  3TEX A;  3OJ3 A;  4TQ0 A;  1WM3 A;  2BTE A;  1N63 A;  4LNK A;  3H1U A;  3VQI A;  4JX1 C;  1F2R I;  3Q8F A;  1QOA A;  2B76 B;  1E9M A;  4KGS A;  2LGY A;  1XEE A;  3N3K B;  2K8H A;  4WJO A;  3NVV A;  4EEW A;  2IND C;  5E6N A;  2G4S A;  3R7R A;  1GC7 A;  1KLU D;  2NVU I;  2G45 B;  4YTN B;  2L0T A;  2W9N A;  3DPD A;  3L0W B;  2LHD A;  3I63 C;  4FBJ B;  2BKR B;  3FKY A;  2VH1 A;  2CHZ A;  2AL6 A;  5BMH A;  2WNM A;  1U4A A;  3MHS D;  2MBO A;  1GB1 A;  1D6E C;  1JW9 D;  1WXS A;  1VDV A;  2WS3 B;  4ICV A;  4KDL B;  2KDE B;  2N1V A;  2BS4 B;  2GBJ A;  4ZHP A;  3JSV B;  2IGH A;  4GSW A;  4A90 A;  5CTR C;  2ZW0 A;  2CJN A;  2DNF A;  4K7W A;  3M62 B;  2LVQ A;  2BWE S;  3ZRC A;  1WXA A;  4CYE A;  3QWZ B;  2ZJD A;  2JYT A;  3CMM B;  4LNN A;  3RNF C;  2O6V D;  4HCN B;  1SB3 C;  1E7P B;  2XNA C;  3RZF A;  3EHV A;  3L08 A;  2GRI A;  4NAM A;  2RR9 A;  2IY0 B;  3QAQ A;  2KFK A;  3ZYY X;  5IA7 A;  5J2R A;  1T6B X;  4B9K A;  3WAM A;  1C4A A;  1R4M I;  2AEH A;  4KGR A;  4OVV A;  3K9O B;  4GN1 A;  3AU5 A;  2KN4 A;  1JWS D;  5BO4 B;  2X38 A;  2NPT A;  1TIF A;  2PW9 A;  3R8B A;  3KUD B;  2JYE A;  4MEM A;  1OTR B;  2K39 A;  3GE8 C;  1EM7 A;  2PJH A;  4GGQ A;  2GMI C;  2L1A A;  1JAL A;  1N61 A;  1UBQ A;  2WX1 A;  3PLU A;  3NHE B;  4BKG A;  2KZR A;  2V3N A;  2LVP A;  4YL8 A;  5BYQ A;  2XBB C;  1MG8 A;  1WX7 A;  1VLB A;  3UIO B;  3A4R A;  2UU7 A;  3A1Q A;  1J7C A;  3KVF B;  2AYO B;  3RNE C;  2WXM A;  1QQR A;  1FXI A;  1LM8 B;  2FAZ A;  1NI3 A;  2L00 B;  2KC1 A;  2WGS A;  3C19 A;  4IG7 B;  2KAC A;  3PHX B;  3N1Y C;  3E9S A;  1WYW B;  4G50 A;  5C2T B;  3ZNG C;  1UBI A;  4BKS A;  2ICI A;  3C0R B;  4GU2 A;  2KXJ A;  5KHQ A;  3CWI A;  1LQB A;  3VXW A;  2KFK B;  3PO0 A;  4TV3 A;  3BII D;  1GJZ A;  1TGZ B;  4NAW A;  1HZ6 A;  1ZXI A;  2A5U A;  3PRE A;  2I2Y A;  5FR6 A;  3NZS A;  3WIM A;  3A9K B;  1VCB A;  4HKQ A;  3QK0 A;  1TYG B;  1FXT B;  2HJ8 A;  2FCM A;  2UWQ A;  1SIF A;  1QOG A;  2C5L C;  2BKF A;  3A33 B;  2WDR B;  4C56 C;  4YSY B;  5E6J A;  3ABV B;  3V62 A;  1OQQ A;  1V81 A;  1WFY A;  1JRO A;  2MQJ A;  2EMS A;  1UGM A;  4MGY E;  2JVC A;  1EO6 A;  3M3J A;  3SHQ A;  1OQR A;  5TSS A;  2M19 A;  3DHI C;  4L23 A;  3AXC A;  3OJ4 B;  3W5U B;  3A1Q B;  3PV1 A;  3HVD A;  4HWI B;  2Y5C A;  1NYR A;  2IZV B;  4M02 A;  4PK1 A;  5HI1 A;  3HHM A;  4W9K A;  2IGG A;  2DWQ A;  3VUY A;  3MC9 A;  3W1S C;  3P4S B;  3U4E G;  4LJP B;  1TS2 A;  2QCZ A;  3VH3 B;  3ZTD A;  2M4N A;  2PTL A;  2CR5 A;  5C23 A;  2QEJ C;  1RAX A;  1PGX A;  2HJ1 A;  1V5O A;  2N9L A;  3QX1 A;  1JML A;  2W54 A;  1VZ7 A;  1HA5 A;  1EF1 A;  3FC4 A;  2MJ3 A;  2FIF A;  2K5P A;  2KK8 A;  2L32 A;  2RSU A;  2X8X X;  2KJ6 A;  4NAW B;  3W9C B;  2PKO A;  1ZOY B;  4BOZ B;  4MJS A;  4IOI E;  1I4G A;  3FIL A;  4QAY A;  4K7U A;  5D3I B;  3QIJ A;  4DHZ E;  3R7Q A;  2LGS A;  2BQQ A;  2WU5 B;  2K1F A;  4NPN A;  4OW0 A;  1UWM A;  3V6C B;  5FK9 C;  4S17 A;  3MC8 A;  4WJP A;  2K8C A;  3NUH B;  1Q1O A;  2PVO D;  2QMT A;  3KW5 B;  1KFY B;  1WMH A;  5H92 C;  3AE5 B;  2INN E;  3KUC B;  3DCG A;  3AEB B;  3QQ8 B;  4YTP B;  3S2A A;  4NY0 A;  2CHW A;  1B1Z A;  5LXH A;  3DBL B;  1AW7 A;  1HXY D;  2L7R A;  3ZVV A;  3I5J C;  3KWL A;  1JWM D;  2L0F A;  1A70 A;  2WLB A;  4HVB A;  4GMV A;  5GMV A;  2Z0E B;  2KN5 A;  1T3Q A;  3AED B;  3EA6 A;  2Z8L A;  3AH7 A;  5J18 A;  3ENE A;  1V1P B;  3Q3J A;  2XEW A;  1I4X A;  1N60 A;  1AWD A;  2LGD A;  3QHT A;  4A3O A;  4WJQ A;  1FCL A;  3LJ3 A;  2BWF A;  1GC6 A;  3UI3 A;  1KOT A;  2RGF A;  2IPK D;  4W9E A;  5JHB A;  3PSE B;  4DHJ B;  4OZB A;  4AJW A;  2JWU A;  4MJS B;  4L2Y A;  4YT0 B;  2DZM A;  1JCK B;  1QOF A;  4HKZ E;  1WF9 A;  2KHW B;  5LNK 1;  3HRD D;  5G5G A;  3MFG A;  2KD0 A;  3WAP A;  1PUT A;  4WUR A;  4W9H A;  2DZI A;  1TZO A;  4AUQ C;  3ZDT A;  2DAJ A;  1L4Z B;  5G2N A;  2INC C;  1ZKH A;  3V05 A;  1C76 A;  1QIL A;  2WXI A;  2KO3 A;  4EUT A;  3ETR A;  2ZZP B;  3ONS A;  4A8X C;  1WMH B;  4XE0 A;  1GB4 A;  2N9P C;  2JXX A;  1XLQ A;  1XLP A;  5L95 C;  1SE9 A;  3URY A;  1MPE A;  1ZDV A;  1VRA B;  1T0R C;  4DWF A;  3NY5 A;  2KWU B;  1AYF A;  3RUI B;  1WGG A;  3VTW A;  3TBL D;  3IT4 B;  3X0W A;  4JQW C;  4RF1 A;  1STE A;  2WDT B;  3PT2 B;  1VR9 A;  4IDI A;  1ENF A;  4B0E A;  1IGD A;  2IO1 B;  1TY0 A;  2D3A A;  2KX3 A;  2ZEQ A;  4K3C A;  4I6L B;  1RYJ A;  1A5R A;  2JY6 A;  2C7N B;  5H8Y E;  2M8S A;  5HKH A;  1R4N B;  3J9C A;  3ML9 A;  2LGI A;  1E0Z A;  1P3Q U;  1XLO A;  2MBE A;  4DXA B;  1WXV A;  4BKS D;  1WIA A;  3N30 A;  4B95 A;  2N9E B;  4WWM A;  4A3P A;  4MDK E;  4JE3 B;  1FNV A;  1E8Z A;  3UIN B;  1KTK A;  1JRP A;  1WGY A;  2ZPY A;  1WJ4 A;  2ZVO A;  3QA8 A;  4IWP A;  2N4F A;  2NBV B;  1ZDX A;  3SFE B;  4LCD E;  2EKE C;  3NJT A;  4ZDV A;  2VH2 A;  4US8 A;  1T5X D;  2L52 A;  1RWS A;  4I6N B;  2KTF A;  4LJO B;  4YXD B;  5J17 A;  3JVZ X;  2MBH A;  4M0W B;  4ZYS A;  2LGX A;  3KUZ A;  2R61 A;  1EUV B;  4GB9 A;  1J7B A;  3H7P A;  4MEL A;  4IM0 A;  2MLB A;  2QSD A;  4AS1 A;  3IAS 1;  3MP9 A;  2D3G A;  2SAK A;  1RLF A;  4WWO A;  1XLN A;  2W82 A;  2JRH A;  1YX6 B;  4WJN A;  2IBI B;  1I4P A;  4LNI A;  3TEZ A;  2KFJ A;  4LNF A;  2JQR B;  1KH0 A;  4MM3 A;  2NCN A;  1K50 A;  3NVY A;  1SXT A;  1G6J A;  3KYD D;  3PVL A;  4AOF A;  3ML8 A;  5D2M B;  2JU6 X;  3R66 C;  2MH7 A;  1F77 A;  2GLS A;  4B0M A;  2FNJ B;  2WHI A;  4JLC A;  1ZXH A;  1K52 A;  2ZNV B;  3HK0 A;  1J8C A;  3AEA B;  2RDH A;  3N1Z C;  2NTT A;  3RNA C;  3VDZ A;  3KWV A;  5AZF A;  1Z2M A;  3AM9 A;  1UUP A;  2V4I B;  1IYF A;  4RF0 A;  3GZN B;  1QF6 A;  3IVF A;  3QC8 B;  2DZJ A;  3R2T A;  4DHJ D;  1D3Z A;  3WA0 A;  5HG2 A;  2LXC A;  2LJ5 A;  5EDS A;  1YNT E;  4K1R B;  3TMP B;  2OOB B;  1L0Y B;  1P98 A;  3V60 A;  1PGB A;  1WH3 A;  5HFY A;  4AQ7 A;  2FE8 A;  2W3S A;  2DEN B;  2KOX A;  1FFV A;  4XDC A;  4ARC A;  2YLM A;  5D6J B;  4XC2 A;  5IOI A;  1RFK A;  1N5X A;  4W9J A;  3Q3O C;  4KDI C;  2E3T A;  2RDG A;  2Z59 B;  3Q2A C;  4MT5 A;  2KT7 A;  2I1J A;  1V49 A;  4C4V A;  2G9H D;  3GB1 A;  1P9D U;  3R3M A;  2YEP B;  2QC8 A;  3H9D A;  5EE0 A;  4BKT A;  3PRZ A;  4RGM A;  4ITK A;  2O2V B;  4MM3 B;  2FBW B;  4B6W A;  1VD2 A;  5FKA C;  1B9R A;  2MCN B;  1WR1 A;  2HE7 A;  3TEW A;  4DHZ B;  4EE2 A;  1J7A A;  4ANU A;  1RRB A;  2KJR A;  1WXM A;  2AL3 A;  1EU3 A;  2MW5 A;  2SEB D;  3AUL A;  1YN5 A;  3P1M A;  4WWN A;  1L5P A;  3DDC B;  1TY2 A;  1OEY J;  4E71 A;  2PE9 A;  3B2G A;  3QJZ A;  1SJH D;  2INP E;  2L05 A;  3IHP C;  4ZRJ A;  3MHZ A;  4KKI A;  2DX5 B;  2CU1 A;  2N7D A;  2BS3 B;  1DYQ A;  2J0K A;  2C7M B;  2WQY B;  3Q8B A;  1TKE A;  2FCS A;  4RGN A;  1K51 A;  4PS8 A;  4BAX A;  3ZXV A;  3R2I A;  1SBB B;  3TEY A;  2JRI B;  2B3A A;  1GG3 A;  4L1B A;  2I1K A;  3BWU D;  2JZ3 B;  2HTH A;  3Q3N C;  2OED A;  2KLC A;  4C4V B;  1WGD A;  1FRD A;  2KLG A;  1NYQ A;  2WXQ A;  4WAF A;  1ZE3 D;  1TBE A;  3PGE A;  1DOI A;  3W5V B;  1F2R C;  2J0M A;  1V8C A;  4ANV A;  2KTR A;  5EE9 A;  4GOC A;  2KQ7 A;  4ICU A;  2NTS A;  1F0Z A;  3PHW B;  4OZC A;  3PLV A;  1PGA A;  3APD A;  4IM2 A;  1WRD B;  2ZCB A;  1QZE A;  1YD8 U;  3I57 A;  2D3B A;  2MA9 B;  2YEP F;  3U7D A;  2WU2 B;  3W2D A;  2KYW A;  2K0P A;  2BYF A;  1YN4 A;  1TT5 B;  2LAS A;  1XT9 B;  4ARI A;  2BF8 B;  3VRA B;  4CO7 A;  2PVG C;  1NDD A;  1KLG D;  1IGC A;  4P7I A;  4P6V F;  1XQQ A;  2NBU A;  3WAL A;  3KYC D;  4DDI D;  2AWT A;  4C00 A;  1P7E A;  2EMT A;  2RPV A;  1KJT A;  2MBQ A;  2HD5 B;  2KDB A;  2NPT B;  1E5W A;  1I7H A;  3Q69 A;  4HLE A;  2M0X A;  4XWW A;  2DZK A;  1L0X B;  1P1A A;  3VRB B;  3APC A;  4W9G A;  1ET6 A;  1LO5 D;  2JUO A;  4KV2 A;  4RM9 A;  4XDD A;  2KMM A;  1NBF C;  1SGH A;  5EE3 A;  4OVU A;  1WZ3 A;  4JWS C;  2DBY A;  4TUU A;  4A6Q A;  3U30 A;  4IW0 A;  3ZDM C;  3ZW3 A;  2ZW1 A;  4N6E B;  2KTR B;  4DBG A;  1NEN B;  2W55 A;  3JW0 X;  2ON8 A;  3ZXR A;  5IP4 D;  2WXO A;  2VRR B;  1EF5 A;  1L0V B;  4TQ1 A;  4NZL B;  2MEK A;  3CF6 E;  3GOE A;  3V3X A;  2NMQ A;  2PIA A;  2NBW B;  2WX0 A;  1P0R A;  1V86 A;  3NS1 A;  3DQV A;  1Q0W B;  1PFD A;  2L8J A;  2PEA A;  1Q5W B;  3SD5 A;  2ZNV C;  1R7S A;  5IKC M;  1UNS A;  2AQ1 B;  2MX2 A;  4FXC A;  2BT6 A;  4E3C A;  3P42 A;  2C9W B;  4NJC A;  1XO3 A;  2MJE A;  1S1Q B;  1BML C;  4EZL A;  3O13 A;  1OQY A;  3NZ3 A;  1WM2 A;  3VTV A;  2FCQ A;  3ZJV A;  1WGH A;  2HTM E;  4IKG A;  4JWU C;  3ALB A;  1SE3 A;  3DBR B;  3W1Y A;  4W9F A;  2BPS A;  2JZZ A;  3WCQ A;  2WP9 B;  2LMC A;  4FUL A;  3AMZ A;  4OVZ A;  3HVZ A;  2QDF A;  1WGR A;  1SJE D;  4BVU C;  4P1C C;  5E6O A;  3N9Y C;  1CZP A;  1QOB A;  5JHA A;  2YVC A;  3NOB A;  1PQS A;  1OFF A;  5G5H A;  2KDI A;  4W9L A;  1YMH E;  4NQK E;  2GBK A;  2IO2 B;  2FID A;  1L4D B;  5D3D A;  2MP2 A;  2WXN A;  3ZNZ B;  1LFD A;  1WSP A;  4ZRQ A;  3SFD B;  1GOZ A;  1GNU A;  1C78 A;  3ZJU A;  1WX8 A;  2OJW A;  1KLV A;  1I35 A;  3QAR A;  3WAN A;  1M4V A;  2KJH B;  3DHH C;  4US9 A;  3U2S C;  1HTO A;  1E7V A;  2H89 B;  2Y5B B;  1C79 A;  2WXK A;  1V97 A;  3FAH A;  5AZH A;  1FNW A;  3WAO A;  1IPG A;  3PTF C;  4MGI E;  2LRU A;  1GAQ B;  2EEL A;  4PYU A;  4FJV B;  4IWO A;  1AAR A;  1UH6 A;  3T8M A;  1WE7 A;  2MSE D;  3AEG B;  3Q6B A;  3EC8 A;  2UYZ B;  3FIL B;  5JZE B;  1FCC C;  1E6E B;  5CHV C;  4IUM B;  4Q2J A;  2K9X A;  2DAF A;  4LTU A;  2KQ4 X;  3OG5 A;  5AZG A;  4KVG B;  3MJW A;  1KRH A;  3P4Q B;  3KH0 A;  2G4D B;  1WJ6 A;  2M0A A;  1JQ4 A;  4N58 A;  1DGJ A;  1HZ5 A;  4ZYN A;  2PLP A;  4JPS A;  3L4P A;  4BBN C;  3VAW A;  1TZ1 A;  2Q5W D;  5D94 A;  2CU3 A;  4LK0 M;  1PDX A;  2KWC A;  2J0J A;  2GB1 A;  4ZRK A;  1RM6 C;  1GUA B;  1XCQ L;  1NEK B;  3Q8E A;  3BVM A;  1ESF A;  3SDL C;  3NS8 A;  2G3Q B;  2MWS B;  1YQ3 B;  1I4R A;  1V5T A;  4N9F 4;  4BFR A;  2ASQ A;  2XK5 A;  1FFU A;  1N62 A;  4FHJ A;  3RFZ B;  3VFK A;  2FUG 1;  3ZRF A;  2V3S A;  2IO3 B;  1D4B A;  2ONQ A;  4O1N A;  1SSN A;  4F1S A;  4XGA B;  4RMA A;  3B2F A;  1ET9 A;  2K6Q A;  1ZPS A;  3KQ4 A;  1E8Y A;  3BZD B;  3RD2 A;  1WJN A;  1T0Y A;  4GDK A;  4K3B A;  2XN9 C;  2HDE A;  1XCT L;  2LUM A;  3P2B A;  3TL5 A;  4W9I A;  3DWM A;  4KIK A;  1YQB A;  4BZA A;  4PS3 A;  3P4R B;  4G3X B;  1HE8 A;  2CJO A;  4DXG A;  3EGR A;  1L6V A;  2VZK B;  2KC2 A;  4RCO A;  1FM0 D;  3RT3 B;  1SE2 A;  1WR6 E;  1V80 A;  1M94 A;  2WDQ B;  2WXR A;  1FNU A;  3P4P B;  1IBX A;  4HRO A;  4MSM B;  3UF8 A;  1YQ4 B;  2AQ2 B;  1EU4 A;  3T3N A;  3HM6 X;  2REX A;  1KF6 B;  4R3D A;  4C80 A;  2J4X A;  1YIW A;  2N9K A;  2AX5 A;  3GS2 A;  5DPS A;  2WXH A;  2I38 A;  1R4M B;  2XK5 B;  1D5X C;  2CS4 A;  2MRP A;  2LZ6 A;  1FMA D;  4P1B C;  2KAN A;  2C7H A;  4FJY A;  2KAJ A;  5LXI B;  2K6D B;  1NVI D;  1TS4 A;  4HCP B;  1N5W A;  4ANX A;  3NVZ A;  1H4R A;  1L7Y A;  3B0A A;  3QCA A;  1WI0 A;  3RMK C;  1P7F A;  3M63 B;  3GP7 A;  1C77 A;  3NRZ A;  4URK A;  3BVG A;  1ZP0 B;  2Y3A A;  2KQS A;  1L6U A;  3TUO A;  4KIK B;  1SIJ A;  2LEK A;  1Z5S B;  2M56 B;  1TJE A;  3SR6 A;  1TKG A;  3VR8 B;  2AQ3 B;  5E6P A;  3JSV A;  2N7J A;  4EOY A;  3OLM D;  1JRU A;  1UF0 A;  4IC7 B;  4M00 A;  4J6I A;  1HEZ E;  4MSQ B;  4RGT A;  2PMV A;  1QKZ A;  3VUW A;  4FN2 A;  2LXA A;  4DDG D;  1ZW7 A;  4HRS A;  4FLH A;  2A4Z A;  5DCN A;  4LLG M;  1HQR D;  1PYW D;  3H7P B;  2DYM A;  1CQV A;  1UD7 A;  2IJ0 A;  2IY1 B;  1C1Y B;  1MHX A;  1ZUD 2;  3DWG C;  4M8M A;  4TKN A;  5IN7 A;  1YOV B;  4NQL B;  3IAM 1;  1GPX A;  1BXT A;  3L13 A;  2BGF A;  4HPM B;  2FUH B;  2BYT A;  1FD6 A;  1V1O A;  4HXD A;  4BOS C;  3ZNH B;  2D07 B;  3B9J A;  4FAD A;  4D2K A;  4EZJ A;  5DPT A;  1R4N I;  2R2Q A;  3VHT C;  2RMM A;  3L17 A;  4CQN A;  3OAW A;  3V61 A;  2L76 A;  1WE6 A;  3GE3 C;  1WJU A;  2BYV E;  3OWE B;  2JWZ A;  4GIV A;  2IO0 B;  1CMX B;  3RUL A;  4KSL C;  4REZ A;  1QT9 A;  4PYZ A;  1K8R B;  3B1L X;  1T0S C;  1QLB B;  3PRM B;  5L83 A;  1J0G A;  3NG0 A;  5C1Z A;  1V2Y A;  2D11 A;  4WQM A;  2VZK D;  3DBH I;  1S3S G;  2V9H A;  4USA A;  2JZP A;  1D5Z C;  3Q8C A;  3UQA A;  2EKI A;  2LHE A;  5BMG A;  3VVW B;  4WAA A;  1VZ6 A;  4ZHO A;  1V9J A;  2KX0 A;  2LJI A;  3BK1 A;  1TTN A;  1MFW A;  4HJK A;  2IGD A;  2ZCC A;  2KMA A;  2RPQ A;  3L10 B;  3CSF A;  3ZJT A;  1EWY C;  3KLS X;  2GBM A;  4YSX B;  3A9K A;  1WGK A;  4AP4 C;  2R2O A;  4ZRP A;  2E6X A;  3ZTC A;  4TSS A;  4KZC A;  5IAA C;  3TCA A;  4YTM B;  4F8C B;  1I4H A;  1X1M A;  2KWD A;  2D5G A;  3IG3 A;  2RDB C;  2OJR A;  3D32 A;  1E90 A;  4RFB A;  3U8Z A;  4H2A A;  1SEB D;  1ISN A;  2D10 A;  5JXV A;  3UIP B;  4XYC A;  1FO4 A;  3I3T B;  2KVZ A;  2BYE A;  1TS5 A;  4YSZ B;  1H8C A;  2J42 A;  4P16 A;  1UEL A;  5EE1 A;  3ZO5 B;  3GZN I;  3PZ7 A;  4NNJ B;  1WXQ A;  2KWV B;  2LD9 A;  2NR2 A;  4HJG E;  3ZGZ A;  4WH4 A;  1DOY A;  5HHD G;  3UGB B;  4NJ7 A;  3Q3F A;  2G1E A;  2WXG A;  1IUE A;  4PS7 A;  5I4D A;  4M8N A;  3LXF A;  1E8X A;  3E56 A;  5D7G A;  4UDU C;  3Q8A A;  2V1Y A;  2H88 B;  2LUE A;  2IYD B;  1YJI A;  5AUI A;  4N59 A;  2Z0D B;  1KM7 A;  4X57 B;  2GOW A;  1J19 A;  1XXG A;  2KNB A;  2N7E A;  3AEE B;  1N6Z A;  3VR9 B;  3X23 A;  3I9V 1;  3RNG C;  4LDT B;  4GDL A;  3EEC A;  3AE9 B;  3DVG Y;  4BBN F;  4I6P A;  4II3 B;  3HUI A;  4DQO C;  2L3Z A;  2WXJ A;  1WZ0 A;  1FPY A;  3ECI A;  1LXD A;  1WX9 A;  1SF0 A;  4KGT A;  3AE8 B;  1ROE A;  3ZQ4 A;  4C7Z A;  5BYR A;  2N9X A;  4WWP A;  3MTN B;  3N32 A;  3NZU A;  5AEK B;  2DLB A;  3LB8 C;  1NI2 A;  1F52 A;  1TS3 A;  3Q3M C;  3AB5 A;  4AWJ A;  1DOX A;  1T0Q C;  3DVN V;  3BVZ A;  3UQB A;  5TR5 A;  3ZUN A;  1V1P A;  2D3C A;  4G0N B;  2LFI A;  4KSK C;  1Y56 A;  1FIQ A;  3NVW A;  2BW2 A;  4WQO B;  1TKY A;  2JT4 B;  5C3J B;  4E74 A;  3AV8 A;  1ACC A;  3BYY B;  4G11 A;  4W9D A;  3MJ5 A;  1OGW A;  3APF A;  3ZKJ C;  1Y8R C;  1C4C A;  1OEY A;  3TIX A;  4DXF A;  2CHX A;  1VJK A;  3CST A;  1UGJ A;  4FJZ A;  2N0S B;  4M01 A;  4FHK A;  2LRW A;  3L54 A;  1RFA A;  3T3O A;  3BK2 A;  4GXB A;  1FEH A;  4JIO U;  3H8H A;  4GDL B;  4EFO A;  2DHZ A;  1BUI C;  3EFU A;  2KVR A;  3ZNI D;  3H6N A;  3SEB A;  4NJ6 A;  2ZVN A;  1FRR A;  1WRI A;  3P63 A;  4JGH B;  3AI5 A;  2QHO A;  4A20 A;  1K53 A;  4ZRI A;  4OHJ A;  2KDM A;  2WXP A;  2JSV X;  3RNB C;  1MG4 A;  3L16 A;  3TJP A;  4KKJ A;  3AE2 B;  3A4S C;  2V0G A;  1JWA D;  1D5M C;  3PZD A;  4K81 A;  2J52 A;  3A9J A;  2BVC A;  1JWB D;  3C8Y A;  4J3O D;  4EZK A;  5JH5 C;  1F9J A;  3BY4 B;  2W3R A;  4EKU A;  2L83 A; 
#chains in the Genus database with same CATH homology
 1D5X C;  2JX5 A;  1OQQ A;  1MI0 A;  3B2G A;  1FMA D;  1JRO A;  1SJH D;  4RGO S;  2INP E;  2KAJ A;  5T8I A;  1OQR A;  3MHZ A;  4KKI A;  5TSS A;  2M19 A;  4L23 A;  3W5U B;  3U52 E;  2BS3 B;  4HEA 1;  1NVI D;  1TS4 A;  1WYG A;  1N5W A;  2V3P A;  3HVD A;  1DYQ A;  2Y5C A;  3NVZ A;  1NYR A;  2WQY B;  3AE6 B;  3Q8B A;  1TKE A;  4RGN A;  1K51 A;  1P7F A;  5HI1 A;  3GP7 A;  1C77 A;  3NRZ A;  4A55 A;  2IGG A;  3BVG A;  2DWQ A;  1ZP0 B;  2Y3A A;  3P4S B;  3U4E G;  3R2I A;  1SBB B;  1TS2 A;  1EWC A;  1L6U A;  3TUO A;  3TEY A;  1SIJ A;  2LEK A;  2M56 B;  1TJE A;  2PTL A;  4L1B A;  3SR6 A;  3AE1 B;  1TKG A;  2QEJ C;  3BWU D;  4ZOH C;  3VR8 B;  2J53 A;  1CJE A;  2AQ3 B;  2OED A;  2DYO A;  1PGX A;  1FRD A;  2BBC A;  2N7J A;  2N9L A;  1NYQ A;  3RPF C;  1JML A;  2W54 A;  1VZ7 A;  2WXQ A;  4WAF A;  1CK1 A;  2QJL A;  1HA5 A;  1FXA A;  3FC4 A;  1ZE3 D;  4M0W A;  4A9A A;  4WIP A;  1HEZ E;  2MJ3 A;  4OZA A;  4RGT A;  2PMV A;  1QKZ A;  1DOI A;  3W5V B;  1F2R C;  2K5P A;  1V8C A;  4KX6 B;  2L32 A;  3W9C B;  4NAW B;  2OHF A;  5EE9 A;  2PKO A;  1ZOY B;  4IOI E;  1I4G A;  4HRS A;  3FIL A;  2WDV B;  1VZ8 A;  1MHH E;  5D3I B;  2NTS A;  1F0Z A;  1SE4 A;  4LLG M;  1HQR D;  2K22 A;  4OZC A;  2WU5 B;  1PYW D;  4XWT A;  2DYM A;  1PGA A;  1CQV A;  2IJ0 A;  4OW0 A;  3I57 A;  3MC0 B;  1MHX A;  1ZUD 2;  3DWG C;  2YEP F;  3W2D A;  2WU2 B;  1YN3 A;  2K0P A;  1UWM A;  3IXS A;  5FK9 C;  1YN4 A;  4ARI A;  3VRA B;  3IAM 1;  1GPX A;  2PVG C;  2BS2 B;  3NUH B;  3BYT B;  1KLG D;  2PVO D;  2QMT A;  1BXT A;  1IGC A;  3W1S A;  4P6V F;  1KFY B;  5H92 C;  2BYT A;  1FD6 A;  3AE5 B;  2INN E;  1V1O A;  3B9J A;  1P7E A;  2Y5P A;  2RPV A;  3IT6 B;  4GLS C;  4MAC A;  5FR3 A;  5BMI A;  4D2K A;  3AEB B;  1I7H A;  3Q69 A;  4YTP B;  3EUB 2;  3LYY A;  1B1Z A;  2BB6 A;  1YJJ A;  1Q10 A;  4XWW A;  2RMM A;  1AW7 A;  1HXY D;  4TMA B;  4CQN A;  1L0X B;  4RNA A;  3KWL A;  3VRB B;  1JWM D;  2QIE B;  1A70 A;  2WLB A;  1ET6 A;  2MJD A;  1LO5 D;  1T3Q A;  3AED B;  3EA6 A;  2Z8L A;  3AH7 A;  4XDD A;  1V1P B;  3OWE B;  2KMM A;  4RH6 A;  1I4X A;  1N60 A;  1AWD A;  1E10 A;  2GI9 A;  5EE3 A;  4REZ A;  4JWS C;  1QT9 A;  1FCL A;  5MPO A;  2DBY A;  4A6Q A;  3UI3 A;  2IDY A;  3AEF B;  1QLB B;  2IPK D;  2ZW1 A;  2TSS A;  2JXT A;  4N6E B;  1MVK A;  4OZB A;  1NEN B;  2JWU A;  2W55 A;  2ACZ B;  2ON8 A;  4L2Y A;  4YT0 B;  4WQM A;  1JCK B;  1QOF A;  2VZK D;  4HKZ E;  4USA A;  5LNK 1;  2WXO A;  3HRD D;  1XF5 L;  1C4P A;  2JZP A;  5G5G A;  3TSS A;  1L0V B;  4GDK B;  4TQ1 A;  3MFG A;  4NZL B;  1D5Z C;  1PUT A;  3Q8C A;  2MEK A;  4WUR A;  2EKI A;  1TZO A;  2LHE A;  5BMG A;  2QIL A;  3V3X A;  2NMQ A;  2PIA A;  1WWT A;  1VZ6 A;  3PZ8 A;  1L4Z B;  4ZHO A;  3NS1 A;  2LJI A;  3AE3 B;  3BK1 A;  3V05 A;  1C76 A;  1PFD A;  1QIL A;  2WXI A;  2BB5 A;  3AE7 B;  2K3U A;  1R7S A;  2IGD A;  1UNS A;  1UWX A;  3CIR B;  2AQ1 B;  3ETR A;  3U7Z A;  4FXC A;  2BT6 A;  4A8X C;  3P42 A;  4XE0 A;  4NJC A;  3ZJT A;  1GB4 A;  1EWY C;  3KLS X;  1XLQ A;  3AEC B;  1XLP A;  1XO3 A;  4YWG G;  5AUK A;  4YSX B;  2MJE A;  1WGK A;  1BML C;  3O13 A;  4ZRP A;  5GXG B;  3URY A;  2E6X A;  1MPE A;  1ZDV A;  3NZ3 A;  1IBX B;  1VRA B;  4TSS A;  4YTM B;  3ZJV A;  1AYF A;  2WXF A;  1I4H A;  2HTM E;  1AN8 A;  4IKG A;  3AE4 B;  2KWD A;  4JWU C;  4C7Y A;  3IT4 B;  2D5G A;  1JWU D;  1SE3 A;  5BYS A;  4RF1 A;  3WCQ A;  1STE A;  2LMC A;  2WP9 B;  3AMZ A;  4OVZ A;  4H2A A;  1SEB D;  4RFB A;  3HVZ A;  5JXV A;  1SJE D;  1C9F A;  1VR9 A;  4IDI A;  1ENF A;  4MH8 A;  2WXL A;  4B0E A;  1IGD A;  4PT5 A;  1FO4 A;  3AN1 A;  1TY0 A;  3N9Y C;  1CZP A;  1I4Q A;  1QOB A;  1TS5 A;  4YSZ B;  5G5H A;  1OFF A;  2J42 A;  4P16 A;  3TEX A;  1RYJ A;  4TQ0 A;  1YMH E;  2BTE A;  5EE1 A;  1N63 A;  5H8Y E;  3PZ7 A;  1WXQ A;  3J9C A;  1L4D B;  1F2R I;  2LGI A;  4JX1 C;  3VQI A;  1E0Z A;  5D3D A;  1XLO A;  3Q8F A;  1QOA A;  4HJG E;  2B76 B;  1E9M A;  4WH4 A;  4KGS A;  2WXN A;  3ZGZ A;  1DOY A;  5HHD G;  1XEE A;  1WSP A;  4ZRQ A;  3NVV A;  2G1E A;  4WWM A;  3SFD B;  1GOZ A;  1KLU D;  2WXG A;  1C78 A;  3ZJU A;  4JE3 B;  4YTN B;  1IUE A;  2LHD A;  5I4D A;  1FNV A;  3LXF A;  5BMH A;  2WNM A;  1KTK A;  1JRP A;  3E56 A;  5D7G A;  4UDU C;  1GB1 A;  3Q8A A;  1M4V A;  1D6E C;  1JW9 D;  2H88 B;  4US9 A;  2WS3 B;  1VDV A;  3U2S C;  2H89 B;  1C79 A;  1ZDX A;  2WXK A;  3SFE B;  1V97 A;  3FAH A;  1YJI A;  5AUI A;  4N59 A;  2BS4 B;  4US8 A;  1FNW A;  1T5X D;  2L52 A;  4ZHP A;  1RWS A;  2IGH A;  1GAQ B;  2EEL A;  4YXD B;  4A90 A;  1XXG A;  2ZW0 A;  3AEE B;  2CJN A;  3VR9 B;  4ZYS A;  3I9V 1;  3AEG B;  2R61 A;  1J7B A;  2QSD A;  3AE9 B;  3FIL B;  1FCC C;  1TY2 A;  1E6E B;  2JYT A;  4AS1 A;  3IAS 1;  3MP9 A;  4Q2J A;  2K9X A;  4LTU A;  2SAK A;  2KQ4 X;  1XLN A;  1KRH A;  2W82 A;  3P4Q B;  1SB3 C;  1E7P B;  3HUI A;  2M0A A;  2XNA C;  4DQO C;  1I4P A;  2WXJ A;  1JQ4 A;  4N58 A;  1DGJ A;  1HZ5 A;  2GRI A;  3TEZ A;  4NAM A;  2PLP A;  4JPS A;  2JQR B;  3L4P A;  1KH0 A;  3ZYY X;  1T6B X;  4KGT A;  1SF0 A;  1C4A A;  1K50 A;  2Q5W D;  3AE8 B;  1ROE A;  1SXT A;  3NVY A;  3ZQ4 A;  4KGR A;  4C7Z A;  2CU3 A;  5BYR A;  4LK0 M;  1PDX A;  2KN4 A;  1JWS D;  2GB1 A;  2X38 A;  2PW9 A;  1RM6 C;  1XCQ L;  2JU6 X;  3R8B A;  2MH7 A;  1NEK B;  2DLB A;  3LB8 C;  3Q8E A;  2JYE A;  1F77 A;  3BVM A;  4B0M A;  1TS3 A;  1ESF A;  1ZXH A;  3AB5 A;  1EM7 A;  1DOX A;  1K52 A;  3AEA B;  2RDH A;  2L1A A;  3BVZ A;  1JAL A;  2NTT A;  1N61 A;  1YQ3 B;  1V1P A;  1I4R A;  2LFI A;  3KWV A;  1FFU A;  1N62 A;  3AM9 A;  1UUP A;  1FIQ A;  1Y56 A;  3NVW A;  3RFZ B;  2V4I B;  2BW2 A;  2FUG 1;  4RF0 A;  1QF6 A;  2V3N A;  1TKY A;  5C3J B;  5BYQ A;  3R2T A;  1D4B A;  2ONQ A;  5HG2 A;  3AV8 A;  1ACC A;  1SSN A;  1VLB A;  3BYY B;  4O1N A;  3MJ5 A;  1YNT E;  3B2F A;  1L0Y B;  1ET9 A;  1J7C A;  1C4C A;  1ZPS A;  4DXF A;  3KQ4 A;  1VJK A;  1PGB A;  5HFY A;  1UGJ A;  2N0S B;  2WXM A;  3BZD B;  1QQR A;  1FXI A;  4AQ7 A;  2FE8 A;  3T3O A;  3BK2 A;  2W3S A;  2XN9 C;  1FEH A;  2HDE A;  1FFV A;  4XDC A;  1NI3 A;  1XCT L;  2LUM A;  4ARC A;  3H8H A;  4GDL B;  2KAC A;  3DWM A;  1BUI C;  1RFK A;  3E9S A;  3P4R B;  1N5X A;  5C2T B;  2E3T A;  2CJO A;  2RDG A;  4MT5 A;  3EGR A;  4DXG A;  1L6V A;  2VZK B;  2ICI A;  2G9H D;  3GB1 A;  4RCO A;  1FM0 D;  3CWI A;  3SEB A;  2YEP B;  5EE0 A;  1SE2 A;  1FRR A;  1WRI A;  3P63 A;  4RGM A;  3PO0 A;  4ITK A;  2WDQ B;  4MM3 B;  2FBW B;  2WXR A;  3BII D;  1FNU A;  1K53 A;  3P4P B;  4OHJ A;  2KDM A;  1IBX A;  4HRO A;  2WXP A;  2JSV X;  1YQ4 B;  2AQ2 B;  1EU4 A;  5FKA C;  1HZ6 A;  3T3N A;  1B9R A;  1ZXI A;  4KKJ A;  1KF6 B;  4R3D A;  3AE2 B;  4C80 A;  2V0G A;  2J4X A;  1JWA D;  1D5M C;  3TEW A;  2I2Y A;  4EE2 A;  2J52 A;  1J7A A;  4HKQ A;  1TYG B;  1JWB D;  2N9K A;  3C8Y A;  2AX5 A;  4J3O D;  1EU3 A;  2SEB D;  3GS2 A;  1QOG A;  1YN5 A;  3P1M A;  2W3R A;  2WDR B;  4C56 C;  4YSY B;  1L5P A;  2WXH A;  5E6J A;  2L83 A;  2I38 A;  3ABV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...