2EF4A

Crystal structure of the arginase from thermus thermophilus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
290
structure length
282
Chain Sequence
ERVAVVGVPMDLGANRRGVDMGPSALRYARLLEQLEDLGYTVEDLGDVPVSLARLAYLEEIRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAARGRRVGVVWVDAHADFNTPETSPSGNVHGMPLAVLSGLGHPRLTEVFRAVDPKDVVLVGVRSLDPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILAESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase
publication title Crystal structure of the arginase from thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 102
structure length 282
sequence length 290
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 2ef4A00
2EF5A 1P8OA 1GQ6A 2EF4A 2RLAA 4Q3TA 4Q3SA 3THHA 3E6VA 1HQFA 4RHMA 1WOHA 3RLAA 3MFVA 3LP4A 4Q3VA 3THJA 1R1OA 4Q40A 4DZ4A 4HWWA 4RLAA 4Q3QA 5CEVA 3F80A 2PHAA 4GSZA 2ZAVA 4GSVA 1T4PA 4FCIA 1TA1A 4FCKA 1P8QA 3TH7A 4IXVA 1T5FA 1T4TA 2A0MA 3M1RA 3NIOA 3GN0A 4GSMA 1TBJA 4HXQA 2AEBA 4MXRA 4Q3RA 3THEA 2EIVA 5HJ9A 4Q42A 3GMZA 4I06A 4Q3UA 1P8MA 3MJLA 4RHIA 5HJAA 4MYNA 1GQ7A 4GWDA 3LHLA 1HQ5A 1TBHA 4RHJA 3NIPA 4IU1A 1P8PA 3CEVA 3E8ZA 1P8NA 3SL0A 3MFWA 3NIQA 5RLAA 1HQXA 3KV2A 1WVBA 1WOGA 3E8QA 4ITYA 4IXUA 4HZEA 1WOIA 4CEVA 4IE3A 4MYLA 4MYKA 3DJ8A 3LP7A 1P8RA 3E6KA 1PQ3A 1TBLA 4RHQA 1T5GA 1D3VA 1P8SA 1WVAA 3MMRA 4Q3RC 1T4SA 4G3HA 2CEVA 3SL1A 1T4RA 4IE1A 4RHLA 3SKKA 4Q41A 2PHOA 4IU0A 1CEVA 4GWCA 4IU5A 1HQHA 3E9BA 4IE2A 3TF3A 3SJTA 2PLLA 4Q3PA 3PZLA 1XFKA 1ZPGA 1HQGA 1RLAA 4MYFA 4IU4A 4RHKA 1ZPEA
chains in the Genus database with same CATH superfamily
3C0YA 2EF5A 5EFHA 4QA1A 3MENA 5G0YA 5G1CA 1T67A 1P8OA 4RN2A 5EFNA 4ZUNA 1GQ6A 5THTA 2EF4A 2RLAA 4Q3TA 3EZTA 4RN1A 4Q3SA 5IWGA 5G1BA 3E6VA 5FUEA 3THHA 1HQFA 4RHMA 1WOHA 3RLAA 3MFVA 4QA4A 3LP4A 5EEKA 4Q3VA 5EENA 3THJA 1R1OA 2VQWG 3F06A 4HWWA 4Q40A 4ZUOA 4DZ4A 4RLAA 5D1CA 5DC5A 2V5WA 4Q3QA 5CEVA 3F80A 5EEMA 5EF7A 2PHAA 3ZNSA 4GSZA 2VQMA 2ZAVA 4GSVA 3ZNRA 4BZ6A 1T4PA 4FCIA 5A2SA 1TA1A 4FCKA 1P8QA 5LI3A 4BZ5A 4BZ9A 3TH7A 1ZZ0A 5G0JA 3Q9BA 2VQQA 5THSA 5EFJD 4IXVA 1T5FA 4QA0A 1T4TA 5THUA 4ZUQA 2A0MA 3M1RA 3NIOA 3GN0A 3MZ4A 4LXZA 4GSMA 1TBJA 5EEIA 4HXQA 2AEBA 4QA6A 4MXRA 4Q3RA 3THEA 2EIVA 5HJ9A 4Q42A 2VQVA 3GMZA 4I06A 4Q3UA 1P8MA 3MJLA 1VKGA 4RHIA 5DC7A 5HJAA 4MYNA 1GQ7A 4GWDA 3LHLA 3SFFA 1HQ5A 3SFHA 5THVA 3MZ7A 1TBHA 3MZ6A 4RHJA 3NIPA 4IU1A 3F07A 5G0IA 1P8PA 3CEVA 3E8ZA 1P8NA 3SL0A 3MFWA 3NIQA 5DC8A 5G11A 5EFBD 5G1AA 5RLAA 1HQXA 3KV2A 1WVBA 4ZURA 1WOGA 3E8QA 4ITYA 4IXUA 2GH6A 2VCGA 1WOIA 4HZEA 5G3WA 4CEVA 5JI5A 4IE3A 4MYLA 4RN0A 4QA2A 1C3SA 4MYKA 1ZZ3A 5D1DA 3DJ8A 5DC6A 4CBTA 3LP7A 3C0ZA 4QA3A 4CBYA 1P8RA 3E6KA 1PQ3A 1TBLA 4RHQA 5EF8A 5FCWA 5G10A 5G12A 1T5GA 3RQDA 1D3VA 1T69A 1C3PA 1P8SA 4BZ7A 4BZ8A 4CQFA 1WVAA 3MMRA 4QA7A 3MAXA 4Q3RC 1T4SA 4G3HA 2CEVA 5G0GA 3SL1A 1T4RA 3EW8A 5G0XA 3Q9EA 2V5XA 1W22A 3C10A 4ZUMA 4IE1A 5G17A 5IX0A 5EEFA 1C3RA 4RHLA 3SKKA 4Q41A 2PHOA 5BWZA 4A69A 4IU0A 1CEVA 4GWCA 3Q9FA 5D1BA 3MZ3A 4IU5A 1HQHA 4ZUPA 3E9BA 5EFGA 4IE2A 3TF3A 5ICNB 5EFKB 2PLLA 1ZZ1A 4Q3PA 3SJTA 1T64A 3PZLA 3EZPA 1XFKA 3EWFA 2VQOA 3F0RA 1ZPGA 1HQGA 2VQJA 3Q9CA 5G13A 4QA5A 4BKXB 5G0HA 1RLAA 4MYFA 4LY1A 4IU4A 4RHKA 1ZPEA
chains in the Genus database with same CATH topology
2EF5A 1P8OA 1GQ6A 2EF4A 2RLAA 4Q3TA 4Q3SA 3THHA 3E6VA 1HQFA 4RHMA 1WOHA 3RLAA 3MFVA 3LP4A 4Q3VA 3THJA 1R1OA 4Q40A 4DZ4A 4HWWA 4RLAA 4Q3QA 5CEVA 3F80A 2PHAA 4GSZA 2ZAVA 4GSVA 1T4PA 4FCIA 1TA1A 4FCKA 1P8QA 3TH7A 4IXVA 1T5FA 1T4TA 2A0MA 3M1RA 3NIOA 3GN0A 4GSMA 1TBJA 4HXQA 2AEBA 4MXRA 4Q3RA 3THEA 2EIVA 5HJ9A 4Q42A 3GMZA 4I06A 4Q3UA 1P8MA 3MJLA 4RHIA 5HJAA 4MYNA 1GQ7A 4GWDA 3LHLA 1HQ5A 1TBHA 4RHJA 3NIPA 4IU1A 1P8PA 3CEVA 3E8ZA 1P8NA 3SL0A 3MFWA 3NIQA 5RLAA 1HQXA 3KV2A 1WVBA 1WOGA 3E8QA 4ITYA 4IXUA 4HZEA 1WOIA 4CEVA 4IE3A 4MYLA 4MYKA 3DJ8A 3LP7A 1P8RA 3E6KA 1PQ3A 1TBLA 4RHQA 1T5GA 1D3VA 1P8SA 1WVAA 3MMRA 4Q3RC 1T4SA 4G3HA 2CEVA 3SL1A 1T4RA 4IE1A 4RHLA 3SKKA 4Q41A 2PHOA 4IU0A 1CEVA 4GWCA 4IU5A 1HQHA 3E9BA 4IE2A 3TF3A 3SJTA 2PLLA 4Q3PA 3PZLA 1XFKA 1ZPGA 1HQGA 1RLAA 4MYFA 4IU4A 4RHKA 1ZPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EF5 A;  1P8O A;  1GQ6 A;  2EF4 A;  2RLA A;  4Q3T A;  4Q3S A;  3THH A;  3E6V A;  1HQF A;  4RHM A;  1WOH A;  3RLA A;  3MFV A;  3LP4 A;  4Q3V A;  3THJ A;  1R1O A;  4Q40 A;  4DZ4 A;  4HWW A;  4RLA A;  4Q3Q A;  5CEV A;  3F80 A;  2PHA A;  4GSZ A;  2ZAV A;  4GSV A;  1T4P A;  4FCI A;  1TA1 A;  4FCK A;  1P8Q A;  3TH7 A;  4IXV A;  1T5F A;  1T4T A;  2A0M A;  3M1R A;  3NIO A;  3GN0 A;  4GSM A;  1TBJ A;  4HXQ A;  2AEB A;  4MXR A;  4Q3R A;  3THE A;  2EIV A;  5HJ9 A;  4Q42 A;  3GMZ A;  4I06 A;  4Q3U A;  1P8M A;  3MJL A;  4RHI A;  5HJA A;  4MYN A;  1GQ7 A;  4GWD A;  3LHL A;  1HQ5 A;  1TBH A;  4RHJ A;  3NIP A;  4IU1 A;  1P8P A;  3CEV A;  3E8Z A;  1P8N A;  3SL0 A;  3MFW A;  3NIQ A;  5RLA A;  1HQX A;  3KV2 A;  1WVB A;  1WOG A;  3E8Q A;  4ITY A;  4IXU A;  4HZE A;  1WOI A;  4CEV A;  4IE3 A;  4MYL A;  4MYK A;  3DJ8 A;  3LP7 A;  1P8R A;  3E6K A;  1PQ3 A;  1TBL A;  4RHQ A;  1T5G A;  1D3V A;  1P8S A;  1WVA A;  3MMR A;  4Q3R C;  1T4S A;  4G3H A;  2CEV A;  3SL1 A;  1T4R A;  4IE1 A;  4RHL A;  3SKK A;  4Q41 A;  2PHO A;  4IU0 A;  1CEV A;  4GWC A;  4IU5 A;  1HQH A;  3E9B A;  4IE2 A;  3TF3 A;  3SJT A;  2PLL A;  4Q3P A;  3PZL A;  1XFK A;  1ZPG A;  1HQG A;  1RLA A;  4MYF A;  4IU4 A;  4RHK A;  1ZPE A; 
#chains in the Genus database with same CATH topology
 3C0Y A;  2EF5 A;  5EFH A;  4QA1 A;  3MEN A;  5G0Y A;  5G1C A;  1T67 A;  1P8O A;  4RN2 A;  5EFN A;  4ZUN A;  1GQ6 A;  5THT A;  2EF4 A;  2RLA A;  4Q3T A;  3EZT A;  4RN1 A;  4Q3S A;  5IWG A;  5G1B A;  3E6V A;  5FUE A;  3THH A;  1HQF A;  4RHM A;  1WOH A;  3RLA A;  3MFV A;  4QA4 A;  3LP4 A;  5EEK A;  4Q3V A;  5EEN A;  3THJ A;  1R1O A;  2VQW G;  3F06 A;  4HWW A;  4Q40 A;  4ZUO A;  4DZ4 A;  4RLA A;  5D1C A;  5DC5 A;  2V5W A;  4Q3Q A;  5CEV A;  3F80 A;  5EEM A;  5EF7 A;  2PHA A;  3ZNS A;  4GSZ A;  2VQM A;  2ZAV A;  4GSV A;  3ZNR A;  4BZ6 A;  1T4P A;  4FCI A;  5A2S A;  1TA1 A;  4FCK A;  1P8Q A;  5LI3 A;  4BZ5 A;  4BZ9 A;  3TH7 A;  1ZZ0 A;  5G0J A;  3Q9B A;  2VQQ A;  5THS A;  5EFJ D;  4IXV A;  1T5F A;  4QA0 A;  1T4T A;  5THU A;  4ZUQ A;  2A0M A;  3M1R A;  3NIO A;  3GN0 A;  3MZ4 A;  4LXZ A;  4GSM A;  1TBJ A;  5EEI A;  4HXQ A;  2AEB A;  4QA6 A;  4MXR A;  4Q3R A;  3THE A;  2EIV A;  5HJ9 A;  4Q42 A;  2VQV A;  3GMZ A;  4I06 A;  4Q3U A;  1P8M A;  3MJL A;  1VKG A;  4RHI A;  5DC7 A;  5HJA A;  4MYN A;  1GQ7 A;  4GWD A;  3LHL A;  3SFF A;  1HQ5 A;  3SFH A;  5THV A;  3MZ7 A;  1TBH A;  3MZ6 A;  4RHJ A;  3NIP A;  4IU1 A;  3F07 A;  5G0I A;  1P8P A;  3CEV A;  3E8Z A;  1P8N A;  3SL0 A;  3MFW A;  3NIQ A;  5DC8 A;  5G11 A;  5EFB D;  5G1A A;  5RLA A;  1HQX A;  3KV2 A;  1WVB A;  4ZUR A;  1WOG A;  3E8Q A;  4ITY A;  4IXU A;  2GH6 A;  2VCG A;  1WOI A;  4HZE A;  5G3W A;  4CEV A;  5JI5 A;  4IE3 A;  4MYL A;  4RN0 A;  4QA2 A;  1C3S A;  4MYK A;  1ZZ3 A;  5D1D A;  3DJ8 A;  5DC6 A;  4CBT A;  3LP7 A;  3C0Z A;  4QA3 A;  4CBY A;  1P8R A;  3E6K A;  1PQ3 A;  1TBL A;  4RHQ A;  5EF8 A;  5FCW A;  5G10 A;  5G12 A;  1T5G A;  3RQD A;  1D3V A;  1T69 A;  1C3P A;  1P8S A;  4BZ7 A;  4BZ8 A;  4CQF A;  1WVA A;  3MMR A;  4QA7 A;  3MAX A;  4Q3R C;  1T4S A;  4G3H A;  2CEV A;  5G0G A;  3SL1 A;  1T4R A;  3EW8 A;  5G0X A;  3Q9E A;  2V5X A;  1W22 A;  3C10 A;  4ZUM A;  4IE1 A;  5G17 A;  5IX0 A;  5EEF A;  1C3R A;  4RHL A;  3SKK A;  4Q41 A;  2PHO A;  5BWZ A;  4A69 A;  4IU0 A;  1CEV A;  4GWC A;  3Q9F A;  5D1B A;  3MZ3 A;  4IU5 A;  1HQH A;  4ZUP A;  3E9B A;  5EFG A;  4IE2 A;  3TF3 A;  5ICN B;  5EFK B;  2PLL A;  1ZZ1 A;  4Q3P A;  3SJT A;  1T64 A;  3PZL A;  3EZP A;  1XFK A;  3EWF A;  2VQO A;  3F0R A;  1ZPG A;  1HQG A;  2VQJ A;  3Q9C A;  5G13 A;  4QA5 A;  4BKX B;  5G0H A;  1RLA A;  4MYF A;  4LY1 A;  4IU4 A;  4RHK A;  1ZPE A; 
#chains in the Genus database with same CATH homology
 2EF5 A;  1P8O A;  1GQ6 A;  2EF4 A;  2RLA A;  4Q3T A;  4Q3S A;  3THH A;  3E6V A;  1HQF A;  4RHM A;  1WOH A;  3RLA A;  3MFV A;  3LP4 A;  4Q3V A;  3THJ A;  1R1O A;  4Q40 A;  4DZ4 A;  4HWW A;  4RLA A;  4Q3Q A;  5CEV A;  3F80 A;  2PHA A;  4GSZ A;  2ZAV A;  4GSV A;  1T4P A;  4FCI A;  1TA1 A;  4FCK A;  1P8Q A;  3TH7 A;  4IXV A;  1T5F A;  1T4T A;  2A0M A;  3M1R A;  3NIO A;  3GN0 A;  4GSM A;  1TBJ A;  4HXQ A;  2AEB A;  4MXR A;  4Q3R A;  3THE A;  2EIV A;  5HJ9 A;  4Q42 A;  3GMZ A;  4I06 A;  4Q3U A;  1P8M A;  3MJL A;  4RHI A;  5HJA A;  4MYN A;  1GQ7 A;  4GWD A;  3LHL A;  1HQ5 A;  1TBH A;  4RHJ A;  3NIP A;  4IU1 A;  1P8P A;  3CEV A;  3E8Z A;  1P8N A;  3SL0 A;  3MFW A;  3NIQ A;  5RLA A;  1HQX A;  3KV2 A;  1WVB A;  1WOG A;  3E8Q A;  4ITY A;  4IXU A;  4HZE A;  1WOI A;  4CEV A;  4IE3 A;  4MYL A;  4MYK A;  3DJ8 A;  3LP7 A;  1P8R A;  3E6K A;  1PQ3 A;  1TBL A;  4RHQ A;  1T5G A;  1D3V A;  1P8S A;  1WVA A;  3MMR A;  4Q3R C;  1T4S A;  4G3H A;  2CEV A;  3SL1 A;  1T4R A;  4IE1 A;  4RHL A;  3SKK A;  4Q41 A;  2PHO A;  4IU0 A;  1CEV A;  4GWC A;  4IU5 A;  1HQH A;  3E9B A;  4IE2 A;  3TF3 A;  3SJT A;  2PLL A;  4Q3P A;  3PZL A;  1XFK A;  1ZPG A;  1HQG A;  1RLA A;  4MYF A;  4IU4 A;  4RHK A;  1ZPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...