2EF7A

Crystal structure of st2348, a hypothetical protein with cbs domains from sulfolobus tokodaii strain7
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
MEEEIVKEYMKTQVISVTKDAKLNDIAKVMTEKNIGSVIVVDGNKPVGIITERDIVKAIGKGKSLETKAEEFMTASLITIREDSPITGALALMRQFNIRHLPVVDDKGNLKGIISIRDITRAIDDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ST2348, a CBS domain protein, from hyperthermophilic archaeon Sulfolobus tokodaii
pubmed doi rcsb
molecule keywords Hypothetical protein ST2348
molecule tags Oxidoreductase
source organism Sulfolobus tokodaii
total genus 32
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2ef7A00
4IY3A 4GQYA 2P9MA 3FWRA 4GQVA 3I8NA 5LXQA 1PBJA 2RIFA 3HF7A 3FNAA 5KS7A 2UV7A 4L27A 4FRYA 4ESYB 1O50A 2ZY9A 2QREE 4P1OA 3L2BA 3LQNA 3OCOA 2D4ZA 4O9KA 2QLVC 3KPCA 3FV6A 2OOYE 4L28A 2NYEA 5K22B 5K25C 2UV4A 2UV6A 4NOCA 4FXSA 4L0DA 3PC3A 4DQWA 2YVXA 1Y5HA 3TE5C 3OCMA 4HG0A 3KH5A 2YZIA 2YZQA 2NYCA 4IY0A 3SL7A 3DDJA 3LV9A 4L3VA 3K2VA 2UV5A 3FWSA 3L31A 4COOA 4UUUA 3TDHC 3T4NC 3OI8A 5MMZA 2EF7A 2OUXA 2QRCE 2RIHA 3PC2A 2OOXE 3K6EA 3KPDA 4ESYA 2PFIA 2QRDE 3GBYA 4IYSA 2YVYA 2QR1E 4IY4A 2RC3A 1PVMA 4PCUA 2YVZA 5K24C 2QH1A 3LFZA 3PC4A 3ORGA 2O16A 4GQWA 1XKFA 5IIPA 3KPBA 1YAVA 4P1GA 3FHMA 2EMQA 3KXRA 5K23C 4IY2A 3LHHA
chains in the Genus database with same CATH superfamily
4IY3A 4GQYA 2P9MA 3FWRA 4GQVA 3I8NA 5LXQA 1PBJA 2RIFA 3HF7A 3FNAA 5KS7A 2UV7A 4L27A 4FRYA 4ESYB 1O50A 2ZY9A 2QREE 4P1OA 3L2BA 3LQNA 3OCOA 2D4ZA 4O9KA 2QLVC 3KPCA 3FV6A 2OOYE 2JA3A 4L28A 2NYEA 5K22B 5K25C 2UV4A 2UV6A 4NOCA 4FXSA 4L0DA 3PC3A 4DQWA 2YVXA 1Y5HA 3TE5C 3OCMA 4HG0A 3KH5A 2YZIA 2YZQA 2NYCA 4IY0A 3SL7A 3DDJA 3LV9A 4L3VA 3K2VA 2UV5A 3FWSA 3L31A 4COOA 4UUUA 3TDHC 3T4NC 3OI8A 5MMZA 2EF7A 2OUXA 2QRCE 2RIHA 3PC2A 2OOXE 3K6EA 3KPDA 4ESYA 2PFIA 2QRDE 3GBYA 4IYSA 2YVYA 2QR1E 4IY4A 2RC3A 1PVMA 4PCUA 2YVZA 5K24C 2QH1A 3LFZA 3PC4A 3ORGA 2J9LA 2O16A 4GQWA 1XKFA 5IIPA 3KPBA 1YAVA 4P1GA 3FHMA 2EMQA 3KXRA 5K23C 4IY2A 3LHHA
chains in the Genus database with same CATH topology
4IY3A 4GQYA 2P9MA 3FWRA 4GQVA 3I8NA 5LXQA 1PBJA 2RIFA 3HF7A 3FNAA 5KS7A 2UV7A 4L27A 4FRYA 4ESYB 1O50A 2ZY9A 2QREE 4P1OA 3L2BA 3LQNA 3OCOA 2D4ZA 4O9KA 2QLVC 3KPCA 3FV6A 2OOYE 2JA3A 4L28A 2NYEA 5K22B 5K25C 2UV4A 2UV6A 4NOCA 4FXSA 4L0DA 3PC3A 4DQWA 2YVXA 1Y5HA 3TE5C 3OCMA 4HG0A 3KH5A 2YZIA 2YZQA 2NYCA 4IY0A 3SL7A 3DDJA 3LV9A 4L3VA 3K2VA 2UV5A 3FWSA 3L31A 4COOA 4UUUA 3TDHC 3T4NC 3OI8A 5MMZA 2EF7A 2OUXA 2QRCE 2RIHA 3PC2A 2OOXE 3K6EA 3KPDA 4ESYA 2PFIA 2QRDE 3GBYA 4IYSA 2YVYA 2QR1E 4IY4A 2RC3A 1PVMA 4PCUA 2YVZA 5K24C 2QH1A 3LFZA 3PC4A 3ORGA 2J9LA 2O16A 4GQWA 1XKFA 5IIPA 3KPBA 1YAVA 4P1GA 3FHMA 2EMQA 3KXRA 5K23C 4IY2A 3LHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IY3 A;  4GQY A;  2P9M A;  3FWR A;  4GQV A;  3I8N A;  5LXQ A;  1PBJ A;  2RIF A;  3HF7 A;  3FNA A;  5KS7 A;  2UV7 A;  4L27 A;  4FRY A;  4ESY B;  1O50 A;  2ZY9 A;  2QRE E;  4P1O A;  3L2B A;  3LQN A;  3OCO A;  2D4Z A;  4O9K A;  2QLV C;  3KPC A;  3FV6 A;  2OOY E;  4L28 A;  2NYE A;  5K22 B;  5K25 C;  2UV4 A;  2UV6 A;  4NOC A;  4FXS A;  4L0D A;  3PC3 A;  4DQW A;  2YVX A;  1Y5H A;  3TE5 C;  3OCM A;  4HG0 A;  3KH5 A;  2YZI A;  2YZQ A;  2NYC A;  4IY0 A;  3SL7 A;  3DDJ A;  3LV9 A;  4L3V A;  3K2V A;  2UV5 A;  3FWS A;  3L31 A;  4COO A;  4UUU A;  3TDH C;  3T4N C;  3OI8 A;  5MMZ A;  2EF7 A;  2OUX A;  2QRC E;  2RIH A;  3PC2 A;  2OOX E;  3K6E A;  3KPD A;  4ESY A;  2PFI A;  2QRD E;  3GBY A;  4IYS A;  2YVY A;  2QR1 E;  4IY4 A;  2RC3 A;  1PVM A;  4PCU A;  2YVZ A;  5K24 C;  2QH1 A;  3LFZ A;  3PC4 A;  3ORG A;  2O16 A;  4GQW A;  1XKF A;  5IIP A;  3KPB A;  1YAV A;  4P1G A;  3FHM A;  2EMQ A;  3KXR A;  5K23 C;  4IY2 A;  3LHH A; 
#chains in the Genus database with same CATH topology
 4IY3 A;  4GQY A;  2P9M A;  3FWR A;  4GQV A;  3I8N A;  5LXQ A;  1PBJ A;  2RIF A;  3HF7 A;  3FNA A;  5KS7 A;  2UV7 A;  4L27 A;  4FRY A;  4ESY B;  1O50 A;  2ZY9 A;  2QRE E;  4P1O A;  3L2B A;  3LQN A;  3OCO A;  2D4Z A;  4O9K A;  2QLV C;  3KPC A;  3FV6 A;  2OOY E;  2JA3 A;  4L28 A;  2NYE A;  5K22 B;  5K25 C;  2UV4 A;  2UV6 A;  4NOC A;  4FXS A;  4L0D A;  3PC3 A;  4DQW A;  2YVX A;  1Y5H A;  3TE5 C;  3OCM A;  4HG0 A;  3KH5 A;  2YZI A;  2YZQ A;  2NYC A;  4IY0 A;  3SL7 A;  3DDJ A;  3LV9 A;  4L3V A;  3K2V A;  2UV5 A;  3FWS A;  3L31 A;  4COO A;  4UUU A;  3TDH C;  3T4N C;  3OI8 A;  5MMZ A;  2EF7 A;  2OUX A;  2QRC E;  2RIH A;  3PC2 A;  2OOX E;  3K6E A;  3KPD A;  4ESY A;  2PFI A;  2QRD E;  3GBY A;  4IYS A;  2YVY A;  2QR1 E;  4IY4 A;  2RC3 A;  1PVM A;  4PCU A;  2YVZ A;  5K24 C;  2QH1 A;  3LFZ A;  3PC4 A;  3ORG A;  2J9L A;  2O16 A;  4GQW A;  1XKF A;  5IIP A;  3KPB A;  1YAV A;  4P1G A;  3FHM A;  2EMQ A;  3KXR A;  5K23 C;  4IY2 A;  3LHH A; 
#chains in the Genus database with same CATH homology
 4IY3 A;  4GQY A;  2P9M A;  3FWR A;  4GQV A;  3I8N A;  5LXQ A;  1PBJ A;  2RIF A;  3HF7 A;  3FNA A;  5KS7 A;  2UV7 A;  4L27 A;  4FRY A;  4ESY B;  1O50 A;  2ZY9 A;  2QRE E;  4P1O A;  3L2B A;  3LQN A;  3OCO A;  2D4Z A;  4O9K A;  2QLV C;  3KPC A;  3FV6 A;  2OOY E;  2JA3 A;  4L28 A;  2NYE A;  5K22 B;  5K25 C;  2UV4 A;  2UV6 A;  4NOC A;  4FXS A;  4L0D A;  3PC3 A;  4DQW A;  2YVX A;  1Y5H A;  3TE5 C;  3OCM A;  4HG0 A;  3KH5 A;  2YZI A;  2YZQ A;  2NYC A;  4IY0 A;  3SL7 A;  3DDJ A;  3LV9 A;  4L3V A;  3K2V A;  2UV5 A;  3FWS A;  3L31 A;  4COO A;  4UUU A;  3TDH C;  3T4N C;  3OI8 A;  5MMZ A;  2EF7 A;  2OUX A;  2QRC E;  2RIH A;  3PC2 A;  2OOX E;  3K6E A;  3KPD A;  4ESY A;  2PFI A;  2QRD E;  3GBY A;  4IYS A;  2YVY A;  2QR1 E;  4IY4 A;  2RC3 A;  1PVM A;  4PCU A;  2YVZ A;  5K24 C;  2QH1 A;  3LFZ A;  3PC4 A;  3ORG A;  2J9L A;  2O16 A;  4GQW A;  1XKF A;  5IIP A;  3KPB A;  1YAV A;  4P1G A;  3FHM A;  2EMQ A;  3KXR A;  5K23 C;  4IY2 A;  3LHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...