2EF8A

Crystal structure of c.ecot38is
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
83
Chain Sequence
PTIHDHRYRLVQLLTKLRKEASLSQSELAIFLGLSQSDISKIESFERRLDALELFELLEVVASRLGLPMDILLKDTYESISKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C.EcoT38IS
rcsb
source organism Enterobacteria phage p2
molecule tags Transcription regulator
molecule keywords Putative transcription factor
total genus 27
structure length 83
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2ef8A00
2PUBA 3TRBA 1QP0A 2IUOA 4JCYA 2PE5A 1CQTA 1WH6A 1LCDA 1PERL 1HF0A 2LCVA 2O49A 4MCTA 4O8BA 4YARA 1ZZ6A 2IVGA 2GZUA 3SCHA 1UTXA 3KZ3A 3QWGA 2KZ8A 3SCGA 4Z5CA 4IVZA 4GQMA 1EFAA 1E3OC 2PUGA 3O9XA 1S7EA 2LYRA 2GRMA 1Y9QA 2A6CA 3JXCL 4PU4C 3CLCA 4X4IA 3L1PA 4OB4A 1JWLA 1NERA 1PNRA 1RPEL 3ZKCA 3S8QA 2BNMA 1OCTC 3OP9A 2AXVA 4JQDA 2XI8A 4X4GA 4NDWA 2MEZA 4X4DA 2KPJA 3F51A 4X4HA 2HINA 1UXDA 4YG1A 2PUAA 2IVBA 3BS3A 4J1XA 3G7DA 1QQAA 1UXCA 2CSFA 4JCXA 2AW6A 1ADRA 4Z59A 2JVLA 3QYXA 5K98B 3BDNA 2ICTA 2FJRA 3FYMA 3H5TA 2ICPA 1IC8A 2OR1L 2B5AA 4X4EA 3D1NI 2CROA 3JXDL 1WETA 1NEQA 3FYAA 2LYPA 3R1FA 1AU7A 4Z5DA 2EWTA 1X57A 3OMTA 1ZZ7A 1BDIA 1ZPQA 3G5GA 3PXPA 2BNNA 1PRVA 1CJGA 1ZZCA 3LISA 1DWKA 3F6WA 2LYKA 2XCJA 1R63A 1XWRA 2R1JL 3B7HA 4I6UA 3OQNA 2JCGA 2IV1A 4Y42A 4Z58A 2L8NA 4X4BA 2XSDC 1LLIA 2D5VA 2MQKA 3KJXA 2AWIA 2LYLA 2LYSA 3DNVB 2PUDA 4I8TA 2KEJA 1RZRD 2LYJA 2PUCA 1WH8A 2PPXA 2EF8A 3GN5A 4I6RA 4F8DA 3GN5B 1JFTA 1ZZ8A 3FMYA 1LMB3 1RIOA 1JFSA 2KEKA 2O4AA 4PU7A 2AUWA 1DW9A 1RZRA 3UFDA 5A7LA 3SCFA 1QP7A 2O38A 1QPZA 3IVPA 1POUA 3JXBC 1PRUA 1YSEA 1X2LA 1ZUGA 2R63A 1OSLA 1QP4A 4PU3C 1L1MA 2PIJA 4PU8A 2XIUA 1LCCA 2AXUA 2BNOA 2OFYA 1QQBA 3HZIB 1ZS4A 1GT0C 3QQ6A 4I6TA 4X4FA 1VPWA 1ZZ9A 3MLFA 2GRLA 1R69A 2IU7A 2XJ3A 3BD1A 3LFPA 4YBAA 3OQMA 2EBYA 3CROL 4FN3A 2L49A 2KEIA 4YG7B 2AXZA 4FBIA 1O4XA 4IWRA 1JH9A 1Y7YA 2WIUB 1ZVVA 1ZZBA 4MCXA 4J1WA 3QF3A 4IA8A 4YG4A 2WUSR 2H8RA 1RZSA 2IVQA 3ZHIA 3F52A 1BDHA 2HSGA 1SQ8A 4X4CA 1PRAA 1WIZA 3U3WA 1ZAYA 2PUFA 3EUSA 3VK0A 2PUEA 3KXAA 1B0NA 3CECA 3GBFA 4GHJA 4Z5HA 1LQCA 3OQOA 3RZZA 3ZHMA 2BJCA 2LYQA
chains in the Genus database with same CATH superfamily
5DSXA 3TRBA 2IUOA 4JCYA 1CQTA 2FFHA 1WH6A 1LCDA 2LCVA 2O49A 1UTXA 3KZ3A 1E3OC 2PUGA 1S7EA 3JXCL 1Y9QA 4X4IA 3ZKCA 2BNMA 4X4GA 3TFLA 4NDWA 4X4DA 4ER6A 4YG1A 1QQAA 2CSFA 3G0TA 4Z59A 2JQEA 3QYXA 3UWPA 3DM5A 3SR4A 1IC8A 2B5AA 3D1NI 3QFIA 3GUUA 3R1FA 1AU7A 3SX0A 3G5GA 4WVLA 3PXPA 1DWKA 3F6WA 1R63A 2PXDA 1QZXA 4Z58A 2L8NA 2XSDC 2AWIA 3DNVB 3ZPXA 2PUCA 1WH8A 4I6RA 2J7WA 3GN5B 1RIOA 1JFSA 2AUWA 2XXPA 1PRUA 3KL4A 1X2LA 1OSLA 2BNOA 3QQ6A 4X4FA 1ZZ9A 2IU7A 2XJ3A 4YBAA 2HFZA 4FN3A 2L49A 1JH9A 2WIUB 4MCXA 2YBDA 3GZCA 1RZSA 3F52A 2HSGA 4X4CA 1ZAYA 2PUEA 1B0NA 3OQOA 3ZHMA 1QP0A 1PERL 1HQ1A 2PXBA 2IVGA 2PXVA 3QWGA 2KZ8A 3VWSA 4GQMA 3NROA 3QOWA 2LYRA 3O9XA 2A6CA 4PU4C 4OB4A 1NERA 1RPEL 4JQDA 2AXVA 3OWQA 2XI8A 2HINA 2PUAA 4EKIA 3TEPA 2AW6A 2ICTA 2FJRA 2ICPA 4ER3A 2OR1L 5DTRA 3JXDL 1NEQA 3FYAA 4Z5DA 2EWTA 2M4HA 1CJGA 1PRVA 2PXPA 1XWRA 4ER5A 1DULA 3NXHA 2LYLA 4I8TA 2KEJA 1RZRD 2LYJA 2PPXA 4F8DA 3GN5A 3FMYA 3A9YA 4PU7A 1RZRA 5A7LA 5DRYA 1ZUGA 1QP4A 1L1MA 2PIJA 1LCCA 2XIUA 1U2ZA 5DTQA 2OFYA 1QQBA 2LLVA 1VPWA 3NZLA 1NW3A 1R69A 3OQMA 2MXDA 4YG7B 2PXLA 2HCSA 2WUSR 1PRAA 3U3WA 2XXAA 2J7UA 3EUSA 2VEOA 4GHJA 3TELA 1LQCA 3RZZA 2LYQA 4MCTA 4O8BA 1ZZ6A 3SCHA 4Z5CA 1EFAA 5DTMA 2PXTA 3L1PA 1OCTC 3OP9A 2MEZA 4X4HA 2PXKA 1UXDA 3MEJA 2IVBA 3BS3A 3G7DA 1ADRA 2JVLA 5K98B 3H5TA 2PXEA 1WETA 2CROA 3R09A 1X57A 3LQXA 3OMTA 1ZZ7A 1BDIA 2BNNA 1ZZCA 4OBMA 2LYKA 3PE5A 3B7HA 4I6UA 3OQNA 2JCGA 2IV1A 1LLIA 4Y42A 1MFQC 2D5VA 2MQKA 3KJXA 2LYSA 5DRTA 3ME5A 3A9ZA 1LMB3 1DW9A 3UFDA 3SCFA 1POUA 3JXBC 4DE9A 4ER7A 2HCNA 4ER0A 1ZS4A 4I6TA 2GRLA 5GAHi 3BD1A 2EBYA 2KEIA 5DT2A 2AXZA 3A9XA 1Y7YA 1ZVVA 2PXFA 1ZZBA 4J1WA 4EQZA 3QF3A 4IA8A 2IVQA 1BDHA 1SQ8A 3GZDA 4HRAA 4Z5HA 1JFTA 2PUBA 2PE5A 1HF0A 4EZIA 4YARA 2GZUA 2ODRD 3NDBB 3SCGA 4IVZA 4EKGA 1QB2A 3CLCA 2GRMA 1JWLA 1PNRA 3S8QA 4Q2JA 2KPJA 3F51A 4J1XA 1UXCA 4JCXA 3BDNA 2PXUA 3FYMA 3GZDC 3M9LA 4X4EA 2LYPA 1ZPQA 3LISA 2XCJA 2R1JL 4X4BA 2LLWA 5GAGi 2PUDA 2EF8A 2PXQA 1ZZ8A 2KEKA 2O4AA 1QPZA 1QP7A 2O38A 3OKZA 3IVPA 1YSEA 2L1PA 2R63A 4PU3C 4PU8A 2AXUA 3HZIB 1GT0C 3QOXA 3MLFA 3LFPA 3CROL 5JUWA 4FBIA 1O4XA 4YG4A 2H8RA 3ZHIA 1WIZA 4EK9A 2PUFA 2LNMA 3VK0A 3KXAA 3CECA 2XXQA 3GBFA 4DE8A 4IWRA 2BJCA 2V3CC
chains in the Genus database with same CATH topology
2PUBA 3TRBA 1QP0A 2IUOA 4JCYA 2PE5A 1CQTA 1WH6A 1LCDA 1PERL 1HF0A 2LCVA 2O49A 4MCTA 4O8BA 4YARA 1ZZ6A 2IVGA 2GZUA 3SCHA 1UTXA 3KZ3A 3QWGA 2KZ8A 3SCGA 4Z5CA 4IVZA 4GQMA 1EFAA 1E3OC 2PUGA 3O9XA 1S7EA 2LYRA 2GRMA 1Y9QA 2A6CA 3JXCL 4PU4C 3CLCA 4X4IA 3L1PA 4OB4A 1JWLA 1NERA 1PNRA 1RPEL 3ZKCA 3S8QA 2BNMA 1OCTC 3OP9A 2AXVA 4JQDA 2XI8A 4X4GA 4NDWA 2MEZA 4X4DA 2KPJA 3F51A 4X4HA 2HINA 1UXDA 4YG1A 2PUAA 2IVBA 3BS3A 4J1XA 3G7DA 1QQAA 1UXCA 2CSFA 4JCXA 2AW6A 1ADRA 4Z59A 2JVLA 3QYXA 5K98B 3BDNA 2ICTA 2FJRA 3FYMA 3H5TA 2ICPA 1IC8A 2OR1L 2B5AA 4X4EA 3D1NI 2CROA 3JXDL 1WETA 1NEQA 3FYAA 2LYPA 3R1FA 1AU7A 4Z5DA 2EWTA 1X57A 3OMTA 1ZZ7A 1BDIA 1ZPQA 3G5GA 3PXPA 2BNNA 1PRVA 1CJGA 1ZZCA 3LISA 1DWKA 3F6WA 2LYKA 2XCJA 1R63A 1XWRA 2R1JL 3B7HA 4I6UA 3OQNA 2JCGA 2IV1A 4Y42A 4Z58A 2L8NA 4X4BA 2XSDC 1LLIA 2D5VA 2MQKA 3KJXA 2AWIA 2LYLA 2LYSA 3DNVB 2PUDA 4I8TA 2KEJA 1RZRD 2LYJA 2PUCA 1WH8A 2PPXA 2EF8A 3GN5A 4I6RA 4F8DA 3GN5B 1JFTA 1ZZ8A 3FMYA 1LMB3 1RIOA 1JFSA 2KEKA 2O4AA 4PU7A 2AUWA 1DW9A 1RZRA 3UFDA 5A7LA 3SCFA 1QP7A 2O38A 1QPZA 3IVPA 1POUA 3JXBC 1PRUA 1YSEA 1X2LA 1ZUGA 2R63A 1OSLA 1QP4A 4PU3C 1L1MA 2PIJA 4PU8A 2XIUA 1LCCA 2AXUA 2BNOA 2OFYA 1QQBA 3HZIB 1ZS4A 1GT0C 3QQ6A 4I6TA 4X4FA 1VPWA 1ZZ9A 3MLFA 2GRLA 1R69A 2IU7A 2XJ3A 3BD1A 3LFPA 4YBAA 3OQMA 2EBYA 3CROL 4FN3A 2L49A 2KEIA 4YG7B 2AXZA 4FBIA 1O4XA 4IWRA 1JH9A 1Y7YA 2WIUB 1ZVVA 1ZZBA 4MCXA 4J1WA 3QF3A 4IA8A 4YG4A 2WUSR 2H8RA 1RZSA 2IVQA 3ZHIA 3F52A 1BDHA 2HSGA 1SQ8A 4X4CA 1PRAA 1WIZA 3U3WA 1ZAYA 2PUFA 3EUSA 3VK0A 2PUEA 3KXAA 1B0NA 3CECA 3GBFA 4GHJA 4Z5HA 1LQCA 3OQOA 3RZZA 3ZHMA 2BJCA 2LYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUB A;  3TRB A;  1QP0 A;  2IUO A;  4JCY A;  2PE5 A;  1CQT A;  1WH6 A;  1LCD A;  1PER L;  1HF0 A;  2LCV A;  2O49 A;  4MCT A;  4O8B A;  4YAR A;  1ZZ6 A;  2IVG A;  2GZU A;  3SCH A;  1UTX A;  3KZ3 A;  3QWG A;  2KZ8 A;  3SCG A;  4Z5C A;  4IVZ A;  4GQM A;  1EFA A;  1E3O C;  2PUG A;  3O9X A;  1S7E A;  2LYR A;  2GRM A;  1Y9Q A;  2A6C A;  3JXC L;  4PU4 C;  3CLC A;  4X4I A;  3L1P A;  4OB4 A;  1JWL A;  1NER A;  1PNR A;  1RPE L;  3ZKC A;  3S8Q A;  2BNM A;  1OCT C;  3OP9 A;  2AXV A;  4JQD A;  2XI8 A;  4X4G A;  4NDW A;  2MEZ A;  4X4D A;  2KPJ A;  3F51 A;  4X4H A;  2HIN A;  1UXD A;  4YG1 A;  2PUA A;  2IVB A;  3BS3 A;  4J1X A;  3G7D A;  1QQA A;  1UXC A;  2CSF A;  4JCX A;  2AW6 A;  1ADR A;  4Z59 A;  2JVL A;  3QYX A;  5K98 B;  3BDN A;  2ICT A;  2FJR A;  3FYM A;  3H5T A;  2ICP A;  1IC8 A;  2OR1 L;  2B5A A;  4X4E A;  3D1N I;  2CRO A;  3JXD L;  1WET A;  1NEQ A;  3FYA A;  2LYP A;  3R1F A;  1AU7 A;  4Z5D A;  2EWT A;  1X57 A;  3OMT A;  1ZZ7 A;  1BDI A;  1ZPQ A;  3G5G A;  3PXP A;  2BNN A;  1PRV A;  1CJG A;  1ZZC A;  3LIS A;  1DWK A;  3F6W A;  2LYK A;  2XCJ A;  1R63 A;  1XWR A;  2R1J L;  3B7H A;  4I6U A;  3OQN A;  2JCG A;  2IV1 A;  4Y42 A;  4Z58 A;  2L8N A;  4X4B A;  2XSD C;  1LLI A;  2D5V A;  2MQK A;  3KJX A;  2AWI A;  2LYL A;  2LYS A;  3DNV B;  2PUD A;  4I8T A;  2KEJ A;  1RZR D;  2LYJ A;  2PUC A;  1WH8 A;  2PPX A;  2EF8 A;  3GN5 A;  4I6R A;  4F8D A;  3GN5 B;  1JFT A;  1ZZ8 A;  3FMY A;  1LMB 3;  1RIO A;  1JFS A;  2KEK A;  2O4A A;  4PU7 A;  2AUW A;  1DW9 A;  1RZR A;  3UFD A;  5A7L A;  3SCF A;  1QP7 A;  2O38 A;  1QPZ A;  3IVP A;  1POU A;  3JXB C;  1PRU A;  1YSE A;  1X2L A;  1ZUG A;  2R63 A;  1OSL A;  1QP4 A;  4PU3 C;  1L1M A;  2PIJ A;  4PU8 A;  2XIU A;  1LCC A;  2AXU A;  2BNO A;  2OFY A;  1QQB A;  3HZI B;  1ZS4 A;  1GT0 C;  3QQ6 A;  4I6T A;  4X4F A;  1VPW A;  1ZZ9 A;  3MLF A;  2GRL A;  1R69 A;  2IU7 A;  2XJ3 A;  3BD1 A;  3LFP A;  4YBA A;  3OQM A;  2EBY A;  3CRO L;  4FN3 A;  2L49 A;  2KEI A;  4YG7 B;  2AXZ A;  4FBI A;  1O4X A;  4IWR A;  1JH9 A;  1Y7Y A;  2WIU B;  1ZVV A;  1ZZB A;  4MCX A;  4J1W A;  3QF3 A;  4IA8 A;  4YG4 A;  2WUS R;  2H8R A;  1RZS A;  2IVQ A;  3ZHI A;  3F52 A;  1BDH A;  2HSG A;  1SQ8 A;  4X4C A;  1PRA A;  1WIZ A;  3U3W A;  1ZAY A;  2PUF A;  3EUS A;  3VK0 A;  2PUE A;  3KXA A;  1B0N A;  3CEC A;  3GBF A;  4GHJ A;  4Z5H A;  1LQC A;  3OQO A;  3RZZ A;  3ZHM A;  2BJC A;  2LYQ A; 
#chains in the Genus database with same CATH topology
 5DSX A;  3TRB A;  2IUO A;  4JCY A;  1CQT A;  2FFH A;  1WH6 A;  1LCD A;  2LCV A;  2O49 A;  1UTX A;  3KZ3 A;  1E3O C;  2PUG A;  1S7E A;  3JXC L;  1Y9Q A;  4X4I A;  3ZKC A;  2BNM A;  4X4G A;  3TFL A;  4NDW A;  4X4D A;  4ER6 A;  4YG1 A;  1QQA A;  2CSF A;  3G0T A;  4Z59 A;  2JQE A;  3QYX A;  3UWP A;  3DM5 A;  3SR4 A;  1IC8 A;  2B5A A;  3D1N I;  3QFI A;  3GUU A;  3R1F A;  1AU7 A;  3SX0 A;  3G5G A;  4WVL A;  3PXP A;  1DWK A;  3F6W A;  1R63 A;  2PXD A;  1QZX A;  4Z58 A;  2L8N A;  2XSD C;  2AWI A;  3DNV B;  3ZPX A;  2PUC A;  1WH8 A;  4I6R A;  2J7W A;  3GN5 B;  1RIO A;  1JFS A;  2AUW A;  2XXP A;  1PRU A;  3KL4 A;  1X2L A;  1OSL A;  2BNO A;  3QQ6 A;  4X4F A;  1ZZ9 A;  2IU7 A;  2XJ3 A;  4YBA A;  2HFZ A;  4FN3 A;  2L49 A;  1JH9 A;  2WIU B;  4MCX A;  2YBD A;  3GZC A;  1RZS A;  3F52 A;  2HSG A;  4X4C A;  1ZAY A;  2PUE A;  1B0N A;  3OQO A;  3ZHM A;  1QP0 A;  1PER L;  1HQ1 A;  2PXB A;  2IVG A;  2PXV A;  3QWG A;  2KZ8 A;  3VWS A;  4GQM A;  3NRO A;  3QOW A;  2LYR A;  3O9X A;  2A6C A;  4PU4 C;  4OB4 A;  1NER A;  1RPE L;  4JQD A;  2AXV A;  3OWQ A;  2XI8 A;  2HIN A;  2PUA A;  4EKI A;  3TEP A;  2AW6 A;  2ICT A;  2FJR A;  2ICP A;  4ER3 A;  2OR1 L;  5DTR A;  3JXD L;  1NEQ A;  3FYA A;  4Z5D A;  2EWT A;  2M4H A;  1CJG A;  1PRV A;  2PXP A;  1XWR A;  4ER5 A;  1DUL A;  3NXH A;  2LYL A;  4I8T A;  2KEJ A;  1RZR D;  2LYJ A;  2PPX A;  4F8D A;  3GN5 A;  3FMY A;  3A9Y A;  4PU7 A;  1RZR A;  5A7L A;  5DRY A;  1ZUG A;  1QP4 A;  1L1M A;  2PIJ A;  1LCC A;  2XIU A;  1U2Z A;  5DTQ A;  2OFY A;  1QQB A;  2LLV A;  1VPW A;  3NZL A;  1NW3 A;  1R69 A;  3OQM A;  2MXD A;  4YG7 B;  2PXL A;  2HCS A;  2WUS R;  1PRA A;  3U3W A;  2XXA A;  2J7U A;  3EUS A;  2VEO A;  4GHJ A;  3TEL A;  1LQC A;  3RZZ A;  2LYQ A;  4MCT A;  4O8B A;  1ZZ6 A;  3SCH A;  4Z5C A;  1EFA A;  5DTM A;  2PXT A;  3L1P A;  1OCT C;  3OP9 A;  2MEZ A;  4X4H A;  2PXK A;  1UXD A;  3MEJ A;  2IVB A;  3BS3 A;  3G7D A;  1ADR A;  2JVL A;  5K98 B;  3H5T A;  2PXE A;  1WET A;  2CRO A;  3R09 A;  1X57 A;  3LQX A;  3OMT A;  1ZZ7 A;  1BDI A;  2BNN A;  1ZZC A;  4OBM A;  2LYK A;  3PE5 A;  3B7H A;  4I6U A;  3OQN A;  2JCG A;  2IV1 A;  1LLI A;  4Y42 A;  1MFQ C;  2D5V A;  2MQK A;  3KJX A;  2LYS A;  5DRT A;  3ME5 A;  3A9Z A;  1LMB 3;  1DW9 A;  3UFD A;  3SCF A;  1POU A;  3JXB C;  4DE9 A;  4ER7 A;  2HCN A;  4ER0 A;  1ZS4 A;  4I6T A;  2GRL A;  5GAH i;  3BD1 A;  2EBY A;  2KEI A;  5DT2 A;  2AXZ A;  3A9X A;  1Y7Y A;  1ZVV A;  2PXF A;  1ZZB A;  4J1W A;  4EQZ A;  3QF3 A;  4IA8 A;  2IVQ A;  1BDH A;  1SQ8 A;  3GZD A;  4HRA A;  4Z5H A;  1JFT A;  2PUB A;  2PE5 A;  1HF0 A;  4EZI A;  4YAR A;  2GZU A;  2ODR D;  3NDB B;  3SCG A;  4IVZ A;  4EKG A;  1QB2 A;  3CLC A;  2GRM A;  1JWL A;  1PNR A;  3S8Q A;  4Q2J A;  2KPJ A;  3F51 A;  4J1X A;  1UXC A;  4JCX A;  3BDN A;  2PXU A;  3FYM A;  3GZD C;  3M9L A;  4X4E A;  2LYP A;  1ZPQ A;  3LIS A;  2XCJ A;  2R1J L;  4X4B A;  2LLW A;  5GAG i;  2PUD A;  2EF8 A;  2PXQ A;  1ZZ8 A;  2KEK A;  2O4A A;  1QPZ A;  1QP7 A;  2O38 A;  3OKZ A;  3IVP A;  1YSE A;  2L1P A;  2R63 A;  4PU3 C;  4PU8 A;  2AXU A;  3HZI B;  1GT0 C;  3QOX A;  3MLF A;  3LFP A;  3CRO L;  5JUW A;  4FBI A;  1O4X A;  4YG4 A;  2H8R A;  3ZHI A;  1WIZ A;  4EK9 A;  2PUF A;  2LNM A;  3VK0 A;  3KXA A;  3CEC A;  2XXQ A;  3GBF A;  4DE8 A;  4IWR A;  2BJC A;  2V3C C; 
#chains in the Genus database with same CATH homology
 2PUB A;  3TRB A;  1QP0 A;  2IUO A;  4JCY A;  2PE5 A;  1CQT A;  1WH6 A;  1LCD A;  1PER L;  1HF0 A;  2LCV A;  2O49 A;  4MCT A;  4O8B A;  4YAR A;  1ZZ6 A;  2IVG A;  2GZU A;  3SCH A;  1UTX A;  3KZ3 A;  3QWG A;  2KZ8 A;  3SCG A;  4Z5C A;  4IVZ A;  4GQM A;  1EFA A;  1E3O C;  2PUG A;  3O9X A;  1S7E A;  2LYR A;  2GRM A;  1Y9Q A;  2A6C A;  3JXC L;  4PU4 C;  3CLC A;  4X4I A;  3L1P A;  4OB4 A;  1JWL A;  1NER A;  1PNR A;  1RPE L;  3ZKC A;  3S8Q A;  2BNM A;  1OCT C;  3OP9 A;  2AXV A;  4JQD A;  2XI8 A;  4X4G A;  4NDW A;  2MEZ A;  4X4D A;  2KPJ A;  3F51 A;  4X4H A;  2HIN A;  1UXD A;  4YG1 A;  2PUA A;  2IVB A;  3BS3 A;  4J1X A;  3G7D A;  1QQA A;  1UXC A;  2CSF A;  4JCX A;  2AW6 A;  1ADR A;  4Z59 A;  2JVL A;  3QYX A;  5K98 B;  3BDN A;  2ICT A;  2FJR A;  3FYM A;  3H5T A;  2ICP A;  1IC8 A;  2OR1 L;  2B5A A;  4X4E A;  3D1N I;  2CRO A;  3JXD L;  1WET A;  1NEQ A;  3FYA A;  2LYP A;  3R1F A;  1AU7 A;  4Z5D A;  2EWT A;  1X57 A;  3OMT A;  1ZZ7 A;  1BDI A;  1ZPQ A;  3G5G A;  3PXP A;  2BNN A;  1PRV A;  1CJG A;  1ZZC A;  3LIS A;  1DWK A;  3F6W A;  2LYK A;  2XCJ A;  1R63 A;  1XWR A;  2R1J L;  3B7H A;  4I6U A;  3OQN A;  2JCG A;  2IV1 A;  4Y42 A;  4Z58 A;  2L8N A;  4X4B A;  2XSD C;  1LLI A;  2D5V A;  2MQK A;  3KJX A;  2AWI A;  2LYL A;  2LYS A;  3DNV B;  2PUD A;  4I8T A;  2KEJ A;  1RZR D;  2LYJ A;  2PUC A;  1WH8 A;  2PPX A;  2EF8 A;  3GN5 A;  4I6R A;  4F8D A;  3GN5 B;  1JFT A;  1ZZ8 A;  3FMY A;  1LMB 3;  1RIO A;  1JFS A;  2KEK A;  2O4A A;  4PU7 A;  2AUW A;  1DW9 A;  1RZR A;  3UFD A;  5A7L A;  3SCF A;  1QP7 A;  2O38 A;  1QPZ A;  3IVP A;  1POU A;  3JXB C;  1PRU A;  1YSE A;  1X2L A;  1ZUG A;  2R63 A;  1OSL A;  1QP4 A;  4PU3 C;  1L1M A;  2PIJ A;  4PU8 A;  2XIU A;  1LCC A;  2AXU A;  2BNO A;  2OFY A;  1QQB A;  3HZI B;  1ZS4 A;  1GT0 C;  3QQ6 A;  4I6T A;  4X4F A;  1VPW A;  1ZZ9 A;  3MLF A;  2GRL A;  1R69 A;  2IU7 A;  2XJ3 A;  3BD1 A;  3LFP A;  4YBA A;  3OQM A;  2EBY A;  3CRO L;  4FN3 A;  2L49 A;  2KEI A;  4YG7 B;  2AXZ A;  4FBI A;  1O4X A;  4IWR A;  1JH9 A;  1Y7Y A;  2WIU B;  1ZVV A;  1ZZB A;  4MCX A;  4J1W A;  3QF3 A;  4IA8 A;  4YG4 A;  2WUS R;  2H8R A;  1RZS A;  2IVQ A;  3ZHI A;  3F52 A;  1BDH A;  2HSG A;  1SQ8 A;  4X4C A;  1PRA A;  1WIZ A;  3U3W A;  1ZAY A;  2PUF A;  3EUS A;  3VK0 A;  2PUE A;  3KXA A;  1B0N A;  3CEC A;  3GBF A;  4GHJ A;  4Z5H A;  1LQC A;  3OQO A;  3RZZ A;  3ZHM A;  2BJC A;  2LYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...