2EFDA

Ara7/atvps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
246
structure length
246
Chain Sequence
b'MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 101
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efdA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efdA02
1TXUA 2EFCA 2EFEA 4N3ZA 2EFHA 2OT3A 2EFDA 4G01A
chains in the Genus database with same CATH superfamily
4ZC6A 4PNFA 3JQZA 3UAPA 3RFRC 2N5FA 3G7JA 4J2FA 3TU3B 2HSMB 3W8SA 5ECMB 4GTUA 4L8EA 2IL3A 4BL7B 1K3LA 4G0LA 5GHKA 1GWCA 4G10A 1OE8A 4JK4A 4K0GA 3WD6A 4MPFA 1MA9A 3VQIA 5IIHA 6GSSA 3N5OA 5J4VA 4AKHA 3BPJA 1C72A 3WHQA 4F0BA 1ZGNA 4HGMB 4GDXA 5A4WA 1JZRA 2XVQA 2HSMA 4OFTA 1DUGA 5IJEA 1EEMA 4PGTA 3PPUA 4GDFA 2WVYA 4ZBBA 3GQXA 5BMUA 4W4UB 4JBBA 2JL4A 2YCDA 1U88A 3IK9A 3D0ZA 3GH6A 1EOHA 2BXKA 1PL1A 2D2ZA 2WDUA 2WW0A 1ML6A 3IE3A 2J9HA 4NHWA 1H5WA 2C3TA 2CAQA 3SWLA 1VF2A 4HGKA 1LOTA 3LQ7A 5EL8A 5DAKB 1YY7A 5GIPA 4KX4A 1LBKA 1RK4A 3NVKA 1GNJA 2C3NA 3HKRA 3V08A 3LYPA 4EC0A 4E8HA 3GSTA 2F3MA 1BG5A 1YEWC 2XVUA 16GSA 4RI6A 4WR4A 2BXQA 4ZUXV 5DAKA 4PI0C 4EMXA 3IC8A 3MHSB 1TDIA 2WS2A 3DGQA 5F05A 1XWGA 5G5FA 1G7OA 2R6KA 1BM0A 4BKEA 1GTAA 4K0NA 2BXOA 2OZBB 5DJMA 4ZBDA 2BXMA 3KJLA 2E0YA 5J5NA 5J40A 2ON5A 4Q5QA 1VF1A 1LNSA 4BVXA 1GUKA 1M9BA 3W1SA 4RI7A 4IQ1A 1MIYA 4TOPA 19GSA 4ECBA 3LFLA 1UORA 2VDBA 5AGYA 1IJGA 5F07A 1Y1UA 1USBA 1SVLA 1MIWA 3NMUA 3JRYA 2F8FA 4MF6A 4LA0A 3GTUB 4L8UA 2YV7A 1VZSA 3KTLA 4YQUA 4ECJA 2OACA 1E7HA 2VCXA 4Z69A 2CAIA 3VURA 2VD0A 2AHEA 5AIXA 14GSA 18GSA 1MM8A 11GSA 1FHEA 2BX8A 2PVQA 1XW5A 1AQXA 1TF0A 3U6VA 3VPQA 5ID9A 5GSSA 1E7GA 3GTUA 2HSNB 1UA5A 1J7EA 4G19A 1XW6A 2BXFA 5LCZA 3PR8A 3LU6A 2DBUA 3GSSA 4M70B 1PMTA 3L0HA 4F5TA 5FUOA 2C4JA 3LYKA 2DBWA 1NT2B 4Z9OA 3SIUB 4Q5FA 1GNEA 1JLVA 2VCVA 4PTSA 2Z8JA 4LUFA 1M99A 5GIOA 5DDLA 3LJRA 3UBLA 1GSDA 1PN9A 2HRKB 2GSSA 5DJLA 4F5UA 7GSSA 2ROHA 3Q19A 5IJFA 3H3AA 3FR9A 1YVLA 1GULA 4FJCB 5ECOB 5J47A 3HJMA 5ECIB 2LXTA 3AY8A 20GSA 3TDLA 1JLWA 1MTCA 4GSNA 4LB9A 4KSMA 2OADA 5ECLB 2HRKA 1GNIA 4K2CA 2DSAA 1EOGA 4YQVA 13GSA 3QAVA 1OYJA 12GSA 3F63A 2EFHA 1R5AA 4W66A 5D9WA 1PA3A 3WHRA 1O9XA 2BXLA 1Q4JA 1YJ6A 3M1GA 3GUSA 1AQWA 5BMUB 4K71A 4KDYA 1PD21 3G9KD 1BAYA 2WB9A 2BXIA 3O3TA 1M9AA 4GLTA 4MZWA 1OE7A 3FRCA 5AIVA 1G6WA 4KAEA 1VF3A 5DBYA 1GUMA 2UV8G 2EFDA 5GINA 3RBTA 4L9QA 4PHZC 4EDYA 1GLQA 1PX7A 2YV9A 4G0KA 1E78A 5D9XA 1AW9A 2VCWA 5JCUA 2I2ZA 2PGTA 1HNAA 5ECKB 3CBUA 3TOTA 1EV4A 1SB0A 1GSUA 2EFEA 5ECSA 5HFKA 4PURA 4ZBQA 4BVYB 3IK7A 4ZB9A 4MPGA 1GSFA 4YAVA 5F8BA 4OT2A 2VO4A 1HA2A 5IIXA 1A0FA 3FNMA 4LMVA 4OR0A 4G04A 2GTUA 4L5LA 5J4UA 2V6KA 4IGJA 1N2AA 2DC5A 3HJOA 4BVXB 6GSTA 4DHXB 3UARA 4G03A 3MDKA 4BVYA 2NQOA 3NIVA 3KMOA 5ELAA 4AKGA 3B9LA 3ISOA 2AGHB 1HK2A 4F03A 1V2AA 8GSSA 5J41A 3FR6A 1GSSA 5EVOA 4NAXA 1LJRA 3F6FA 3MAKA 4LMWA 1H9ZA 1TW9A 4MF5A 1KDXA 3I6AA 5A34B 4ISDA 4ZBKA 1B4PA 2XVVA 4J2VA 4N0UD 3KJYA 1YQ1A 1SVMA 2PERA 2NNWA 22GSA 4IKHA 3H1NA 4MDCA 2WVXB 4GF0A 3I69A 2XW1A 2XW0A 3LU7A 1K0AA 3EINA 3G7IA 4ZBAA 3TGZA 4AGSA 4N3ZA 2E0XA 1TU7A 5IJ5A 2DYOA 1FW1A 4QQ7A 5DQSA 5A34A 1SVOA 2VCQA 2GSQA 3QAWA 1E7FA 4E99A 5A4VA 2IMIA 3CHXC 3UIVA 5F0GA 1N5UA 2HRAA 4YH2A 2WVXA 4E68A 1K0MA 3N9JA 3KIKA 2PBJA 2VKZG 4GSTA 3QAGA 4HZ2A 4F0CA 3FWBC 5HOZA 4FIPB 1B8XA 1GUHA 3LU8A 4WA6B 17GSA 2A2RA 1TXUA 2LJRA 3BBYA 3GURA 4IBPA 4IW9A 4E8EA 1K0OA 3GQUA 2GUTA 3MHHB 2VUFA 3ZMKA 4EDZA 2XMOA 2BXNA 2BXBA 2WZSA 2CZ2A 1HK5A 2QM6A 2YDFA 3ERGA 4I9OA 2HNLA 4TQ1A 3V03A 1HK3A 4NHZA 1IYIA 2C3QA 3ICXA 3IBHA 1BF5A 2R4VA 1KBNA 3PGTA 1K0BA 5LD0A 3ERFA 4WR5A 2WW2A 1YDKA 4OFNA 3VPTA 9GSSA 3VK9A 2QMCA 1E7IA 2KBZA 2LQHA 4G01A 3M99C 2O3EA 3Q74A 4GDKB 4PNGA 4MBEC 1G6YA 4D7XA 3SIVB 4IJIA 4KGIA 5DQFA 4EE0A 2VD1A 4IW1A 5AN1A 3TOUA 1KW2A 4PUAA 5A5HB 2PMTA 4PQHA 6GSYA 5FWGA 4IW2A 2WRTA 3ZMLA 5AISA 4MF7A 3CRTA 1HNCA 3P90A 4S1YA 4ZCGA 1PKZA 3LXZA 2UZ8A 1HNBA 1YKCA 3ZFBA 3KMNA 1XWKA 1PX6A 2AAWA 3C8EA 5DALA 4O7HA 2FNOA 1J78A 3R2QA 2BXHA 3B9MA 5A5HA 1N25A 4ACSA 2LQIA 5J4YA 5BPKA 1EV9A 2BXCA 4GG2A 2R5GA 4IVFA 2DBXA 3LXTA 4ECIA 4ZBRA 4QMKA 1E7BA 2GDRA 3P8WA 2VCTA 5ID7A 1BX9A 4PI2C 1E6BA 3UVHA 5KEJA 1MD4A 1NHYA 5EY6A 2XSIA 2JUHA 1AQVA 2BXEA 3M0FA 2BXGA 4DM0A 3KM6A 1GTBA 4GSSA 5D9VA 5IFOA 2HQTA 1HQOA 1OKTA 1Z9HA 4F5VA 5ECHB 1GTIA 4PX1A 3EE2A 4ZXGA 3IR4A 3KXOA 1E7AA 2WVZA 4N0VA 2CZ3A 4YAPA 2K0NA 4ID0A 1AO6A 3WYWA 1E7EA 2DYMA 3O76A 1BKEA 1KXPD 1M0UA 2Z8KA 4F5SA 4ZB6A 4BL7A 4O92A 1V40A 4DEJA 2I30A 2WJUA 4I97A 4FQUA 2OT3A 2KWFA 3CRUA 4KH7A 2Z8IA 4YQMA 2R3XA 1HK1A 2VCZA 4HJ2A 1F2EA 4CHSA 3FWCC 4TQ0A 2AB6A 4HZ4A 3SQJA 1TU8A 3FR3A 4FXYP 3PLAA 1JNBA 1GNWA 4NAWB 1GSEA 4C31B 4Q5NA 1HK4A 2OA7A 5FHIA 1F3BA 1E7CA 4L5OA 3VLNA 3CSJA 1U3IA 4PXOA 1VFIA 4LUHA 4L9KA 3FYGA 3A73A 5ECPB 2C80A 3CWGA 3H37A 1MUHA 3ECPA 3Q18A 2CA8A 3LSZA 5GSTA 5A1NB 5A4UA 4HOJA 2LXSA 1I1IP 5A5KA 1K3OA 5F06A 2LOQA 2WW1A 4G0IA 4G9HA 3WHSA 1GTUA 4KF9A 4IQAA 2EFCA 4USSA 4OMVA 2BXDA 1K0DA 3VI5A 2GSRA 5JCWA 5IIUA 1S4BP 4ZB7A 2CVDA 2O36A 2GSTA 3M8NA 3CSIA 1F3AA 2XVWA 4AKXB 3RGBC 4OTTA 4PQIA 5A1NA 5GZZB 4OTUA 4MP4A 3F6DA 1GLPA 4JZQA 4BY9C 3ZFLA 4IELA 4ECCA 2BXPA 4GDLB 2IMKA 2NTOA 1Y6EA 2VUEA 4PO0A 1MUSA 5ELGA 5IQYA 2CKXA 4OFMA 1PGTA 4JEDA 1K0NA 2A2SA 3FY7A 4FK5B 1U87A 3NVIA 2BXAA 1BJ5A 6GSXA 1GSQA 5B5TA 2FHEA 1ZL9A 2V36A 5B7CA 1K0CA 1PL2A 3VI7A 4Q5RA 1VF4A 3V09A 2DG5A 3LG6A 1B48A 3NVMA 3R3EA 3CSHA 3GX0A 4EXJA 5D9TA 10GSA 1IYHA 4ZB8A 6GSWA 1MIVA 4HI7A 1K3YA 3A75A 5DALB 5ECQB 4AKIA 3CX9A 2C8UA 5ECRB 4AI6A 2H1LA 2GLRA 1BYEA 5ECNB 2ON7A 2HSNA 2O5VA 1GSYA 6GSUA 2QHBA 5D7GA 3GA9L 5D73A 3HMJG 4KDUA 1AXDA 4KE3A 3UBKA 2X64A 4IS0A 4MK3A 3VWXA 1PKWA 1MD3A 3QR6A 4N0FD 5FT3A 2AJEA 2WW3A 1BG1A 1FOUA 3M3MA 4GCIA 3DD3A 5DCGA 6GSVA 4KDXA 4LB2A 5G5EA
chains in the Genus database with same CATH topology
4ZC6A 4PNFA 3JQZA 3UAPA 2N5FA 3G7JA 4J2FA 3TU3B 2HSMB 3W8SA 5ECMB 4GTUA 4L8EA 2IL3A 4BL7B 1K3LA 4G0LA 5GHKA 1GWCA 4G10A 1OE8A 4JK4A 4K0GA 3WD6A 4MPFA 1MA9A 3VQIA 5IIHA 6GSSA 3N5OA 5J4VA 4AKHA 1C72A 3WHQA 4F0BA 1ZGNA 4HGMB 4GDXA 5A4WA 1JZRA 2XVQA 2HSMA 4OFTA 1DUGA 5IJEA 1EEMA 4PGTA 3PPUA 4GDFA 4ZBBA 3GQXA 5BMUA 4W4UB 4JBBA 2JL4A 2YCDA 1U88A 3IK9A 3D0ZA 3GH6A 1EOHA 2BXKA 1PL1A 2D2ZA 2WDUA 3IE3A 1ML6A 4NHWA 2J9HA 1H5WA 2C3TA 2CAQA 3SWLA 1VF2A 4HGKA 1LOTA 3LQ7A 5EL8A 5DAKB 1YY7A 5GIPA 4KX4A 1LBKA 1RK4A 3NVKA 1GNJA 2C3NA 3HKRA 3V08A 3LYPA 4EC0A 4E8HA 3GSTA 2F3MA 1BG5A 2XVUA 16GSA 4RI6A 4WR4A 2BXQA 4ZUXV 5DAKA 4EMXA 3IC8A 3MHSB 1TDIA 2WS2A 3DGQA 5F05A 1XWGA 5G5FA 1G7OA 2R6KA 1BM0A 4BKEA 1GTAA 4K0NA 2BXOA 2OZBB 5DJMA 4ZBDA 2BXMA 3KJLA 2E0YA 5J5NA 5J40A 2ON5A 4Q5QA 1VF1A 1LNSA 4BVXA 1M9BA 1GUKA 3W1SA 4RI7A 4IQ1A 1MIYA 4TOPA 19GSA 4ECBA 3LFLA 1UORA 2VDBA 5AGYA 1IJGA 5F07A 1Y1UA 1USBA 1SVLA 1MIWA 3NMUA 3JRYA 2F8FA 4MF6A 4LA0A 3GTUB 4L8UA 2YV7A 1VZSA 3KTLA 4YQUA 4ECJA 2OACA 1E7HA 2VCXA 4Z69A 2CAIA 3VURA 2VD0A 2AHEA 5AIXA 14GSA 18GSA 11GSA 1FHEA 2BX8A 2PVQA 1XW5A 1AQXA 1TF0A 3U6VA 3VPQA 5ID9A 5GSSA 1E7GA 3GTUA 2HSNB 1UA5A 1J7EA 4G19A 1XW6A 2BXFA 5LCZA 3PR8A 3LU6A 2DBUA 3GSSA 4M70B 1PMTA 3L0HA 4F5TA 5FUOA 2C4JA 3LYKA 2DBWA 1NT2B 4Z9OA 3SIUB 4Q5FA 1GNEA 1JLVA 2VCVA 4PTSA 2Z8JA 4LUFA 1M99A 5GIOA 5DDLA 3LJRA 3UBLA 1GSDA 1PN9A 2HRKB 2GSSA 5DJLA 4F5UA 7GSSA 2ROHA 3Q19A 5IJFA 3H3AA 3FR9A 1YVLA 1GULA 4FJCB 5ECOB 5J47A 3HJMA 5ECIB 3AY8A 20GSA 3TDLA 1JLWA 1MTCA 4GSNA 4LB9A 4KSMA 2OADA 5ECLB 2HRKA 1GNIA 4K2CA 2DSAA 1EOGA 4YQVA 13GSA 3QAVA 1OYJA 12GSA 3F63A 2EFHA 1R5AA 4W66A 5D9WA 1PA3A 3WHRA 1O9XA 2BXLA 1Q4JA 1YJ6A 3M1GA 3GUSA 1AQWA 5BMUB 4K71A 4KDYA 1PD21 3G9KD 1BAYA 2WB9A 2BXIA 3O3TA 1M9AA 4GLTA 4MZWA 1OE7A 3FRCA 5AIVA 1G6WA 4KAEA 1VF3A 5DBYA 1GUMA 2UV8G 2EFDA 5GINA 3RBTA 4L9QA 4EDYA 1GLQA 1PX7A 2YV9A 4G0KA 1E78A 5D9XA 1AW9A 2VCWA 5JCUA 2I2ZA 2PGTA 1HNAA 5ECKB 3CBUA 3TOTA 1EV4A 1GSUA 2EFEA 5ECSA 5HFKA 4PURA 4ZBQA 4BVYB 3IK7A 4ZB9A 4MPGA 1GSFA 4YAVA 5F8BA 4OT2A 2VO4A 1HA2A 5IIXA 1A0FA 3FNMA 4LMVA 4OR0A 4G04A 2GTUA 4L5LA 5J4UA 2V6KA 4IGJA 1N2AA 2DC5A 3HJOA 4BVXB 6GSTA 4DHXB 3UARA 4G03A 3MDKA 4BVYA 2NQOA 3NIVA 3KMOA 5ELAA 4AKGA 3B9LA 3ISOA 4F03A 1HK2A 1V2AA 8GSSA 5J41A 3FR6A 1GSSA 5EVOA 4NAXA 1LJRA 3F6FA 3MAKA 4LMWA 1H9ZA 1TW9A 4MF5A 3I6AA 5A34B 4ISDA 4ZBKA 1B4PA 2XVVA 4J2VA 4N0UD 3KJYA 1YQ1A 1SVMA 2PERA 2NNWA 22GSA 4IKHA 3H1NA 4MDCA 4GF0A 3I69A 2XW1A 2XW0A 3LU7A 1K0AA 3EINA 3G7IA 4ZBAA 3TGZA 4AGSA 4N3ZA 2E0XA 1TU7A 5IJ5A 2DYOA 1FW1A 4QQ7A 5DQSA 5A34A 1SVOA 2VCQA 2GSQA 3QAWA 1E7FA 4E99A 5A4VA 2IMIA 3UIVA 5F0GA 1N5UA 2HRAA 4YH2A 4E68A 1K0MA 3N9JA 3KIKA 2PBJA 2VKZG 4GSTA 3QAGA 4HZ2A 4F0CA 3FWBC 5HOZA 4FIPB 1B8XA 1GUHA 3LU8A 4WA6B 17GSA 2A2RA 1TXUA 2LJRA 3BBYA 3GURA 4IBPA 4IW9A 4E8EA 1K0OA 3GQUA 3ZMKA 3MHHB 2VUFA 4EDZA 2XMOA 2BXNA 2BXBA 2CZ2A 1HK5A 2QM6A 2YDFA 3ERGA 2HNLA 4TQ1A 3V03A 1HK3A 4NHZA 1IYIA 2C3QA 3ICXA 3IBHA 1BF5A 2R4VA 1KBNA 3PGTA 1K0BA 5LD0A 3ERFA 4WR5A 1YDKA 4OFNA 3VPTA 9GSSA 3VK9A 2QMCA 1E7IA 2KBZA 4G01A 3M99C 3Q74A 4GDKB 4PNGA 4MBEC 1G6YA 3SIVB 4KGIA 4IJIA 5DQFA 4EE0A 2VD1A 4IW1A 5AN1A 3TOUA 1KW2A 4PUAA 5A5HB 2PMTA 4PQHA 6GSYA 5FWGA 4IW2A 2WRTA 3ZMLA 5AISA 4MF7A 3CRTA 1HNCA 3P90A 4S1YA 4ZCGA 1PKZA 3LXZA 2UZ8A 1HNBA 1YKCA 3ZFBA 3KMNA 1XWKA 1PX6A 2AAWA 3C8EA 5DALA 4O7HA 2FNOA 1J78A 3R2QA 2BXHA 3B9MA 5A5HA 1N25A 4ACSA 5J4YA 5BPKA 1EV9A 2BXCA 4GG2A 2R5GA 4IVFA 2DBXA 3LXTA 4ECIA 4ZBRA 4QMKA 1E7BA 2GDRA 3P8WA 2VCTA 5ID7A 1BX9A 1E6BA 3UVHA 5KEJA 1MD4A 1NHYA 5EY6A 2XSIA 2JUHA 1AQVA 2BXEA 3M0FA 2BXGA 3KM6A 1GTBA 4GSSA 5D9VA 5IFOA 2HQTA 1HQOA 1OKTA 1Z9HA 4F5VA 5ECHB 1GTIA 4PX1A 3EE2A 4ZXGA 3IR4A 3KXOA 1E7AA 4YAPA 4N0VA 2CZ3A 4ID0A 1AO6A 3WYWA 1E7EA 2DYMA 3O76A 1BKEA 1KXPD 1M0UA 2Z8KA 4F5SA 4ZB6A 4BL7A 4O92A 1V40A 4DEJA 2I30A 2WJUA 4I97A 4FQUA 2OT3A 4KH7A 3CRUA 2Z8IA 4YQMA 2R3XA 1HK1A 2VCZA 4HJ2A 1F2EA 4CHSA 3FWCC 4TQ0A 2AB6A 4HZ4A 3SQJA 1TU8A 3FR3A 3PLAA 1JNBA 1GNWA 4NAWB 1GSEA 4C31B 4Q5NA 1HK4A 2OA7A 5FHIA 1F3BA 1E7CA 4L5OA 3VLNA 3CSJA 1U3IA 4PXOA 1VFIA 4LUHA 4L9KA 3FYGA 3A73A 5ECPB 2C80A 3CWGA 3H37A 3Q18A 2CA8A 3LSZA 5GSTA 5A1NB 5A4UA 4HOJA 5A5KA 1K3OA 5F06A 2LOQA 4G0IA 4G9HA 3WHSA 1GTUA 4KF9A 4IQAA 2EFCA 4USSA 4OMVA 2BXDA 1K0DA 3VI5A 2GSRA 5JCWA 5IIUA 4ZB7A 2CVDA 2GSTA 3M8NA 3CSIA 1F3AA 2XVWA 4AKXB 4OTTA 4PQIA 5A1NA 5GZZB 4OTUA 4MP4A 3F6DA 1GLPA 4JZQA 4BY9C 3ZFLA 4IELA 4ECCA 2BXPA 4GDLB 2IMKA 2NTOA 1Y6EA 2VUEA 4PO0A 5ELGA 5IQYA 2CKXA 4OFMA 1PGTA 4JEDA 1K0NA 2A2SA 3FY7A 4FK5B 1U87A 3NVIA 2BXAA 1BJ5A 6GSXA 1GSQA 5B5TA 2FHEA 1ZL9A 2V36A 5B7CA 1K0CA 1PL2A 3VI7A 4Q5RA 1VF4A 3V09A 2DG5A 3LG6A 1B48A 3NVMA 3R3EA 3CSHA 3GX0A 4EXJA 5D9TA 10GSA 1IYHA 4ZB8A 6GSWA 1MIVA 4HI7A 1K3YA 3A75A 5DALB 5ECQB 4AKIA 3CX9A 2C8UA 5ECRB 4AI6A 2H1LA 2GLRA 1BYEA 5ECNB 2ON7A 2HSNA 2O5VA 1GSYA 6GSUA 2QHBA 5D7GA 3GA9L 5D73A 3HMJG 4KDUA 1AXDA 4KE3A 3UBKA 2X64A 4IS0A 4MK3A 3VWXA 1PKWA 1MD3A 3QR6A 4N0FD 5FT3A 2AJEA 1BG1A 1FOUA 3M3MA 4GCIA 3DD3A 5DCGA 6GSVA 4KDXA 4LB2A 5G5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXU A;  2EFC A;  2EFE A;  4N3Z A;  2EFH A;  2OT3 A;  2EFD A;  4G01 A; 
#chains in the Genus database with same CATH topology
 4ZC6 A;  4PNF A;  3JQZ A;  3UAP A;  3RFR C;  2N5F A;  3G7J A;  4J2F A;  3TU3 B;  2HSM B;  3W8S A;  5ECM B;  4GTU A;  4L8E A;  2IL3 A;  4BL7 B;  1K3L A;  4G0L A;  5GHK A;  1GWC A;  4G10 A;  1OE8 A;  4JK4 A;  4K0G A;  3WD6 A;  4MPF A;  1MA9 A;  3VQI A;  5IIH A;  6GSS A;  3N5O A;  5J4V A;  4AKH A;  3BPJ A;  1C72 A;  3WHQ A;  4F0B A;  1ZGN A;  4HGM B;  4GDX A;  5A4W A;  1JZR A;  2XVQ A;  2HSM A;  4OFT A;  1DUG A;  5IJE A;  1EEM A;  4PGT A;  3PPU A;  4GDF A;  2WVY A;  4ZBB A;  3GQX A;  5BMU A;  4W4U B;  4JBB A;  2JL4 A;  2YCD A;  1U88 A;  3IK9 A;  3D0Z A;  3GH6 A;  1EOH A;  2BXK A;  1PL1 A;  2D2Z A;  2WDU A;  2WW0 A;  1ML6 A;  3IE3 A;  2J9H A;  4NHW A;  1H5W A;  2C3T A;  2CAQ A;  3SWL A;  1VF2 A;  4HGK A;  1LOT A;  3LQ7 A;  5EL8 A;  5DAK B;  1YY7 A;  5GIP A;  4KX4 A;  1LBK A;  1RK4 A;  3NVK A;  1GNJ A;  2C3N A;  3HKR A;  3V08 A;  3LYP A;  4EC0 A;  4E8H A;  3GST A;  2F3M A;  1BG5 A;  1YEW C;  2XVU A;  16GS A;  4RI6 A;  4WR4 A;  2BXQ A;  4ZUX V;  5DAK A;  4PI0 C;  4EMX A;  3IC8 A;  3MHS B;  1TDI A;  2WS2 A;  3DGQ A;  5F05 A;  1XWG A;  5G5F A;  1G7O A;  2R6K A;  1BM0 A;  4BKE A;  1GTA A;  4K0N A;  2BXO A;  2OZB B;  5DJM A;  4ZBD A;  2BXM A;  3KJL A;  2E0Y A;  5J5N A;  5J40 A;  2ON5 A;  4Q5Q A;  1VF1 A;  1LNS A;  4BVX A;  1GUK A;  1M9B A;  3W1S A;  4RI7 A;  4IQ1 A;  1MIY A;  4TOP A;  19GS A;  4ECB A;  3LFL A;  1UOR A;  2VDB A;  5AGY A;  1IJG A;  5F07 A;  1Y1U A;  1USB A;  1SVL A;  1MIW A;  3NMU A;  3JRY A;  2F8F A;  4MF6 A;  4LA0 A;  3GTU B;  4L8U A;  2YV7 A;  1VZS A;  3KTL A;  4YQU A;  4ECJ A;  2OAC A;  1E7H A;  2VCX A;  4Z69 A;  2CAI A;  3VUR A;  2VD0 A;  2AHE A;  5AIX A;  14GS A;  18GS A;  1MM8 A;  11GS A;  1FHE A;  2BX8 A;  2PVQ A;  1XW5 A;  1AQX A;  1TF0 A;  3U6V A;  3VPQ A;  5ID9 A;  5GSS A;  1E7G A;  3GTU A;  2HSN B;  1UA5 A;  1J7E A;  4G19 A;  1XW6 A;  2BXF A;  5LCZ A;  3PR8 A;  3LU6 A;  2DBU A;  3GSS A;  4M70 B;  1PMT A;  3L0H A;  4F5T A;  5FUO A;  2C4J A;  3LYK A;  2DBW A;  1NT2 B;  4Z9O A;  3SIU B;  4Q5F A;  1GNE A;  1JLV A;  2VCV A;  4PTS A;  2Z8J A;  4LUF A;  1M99 A;  5GIO A;  5DDL A;  3LJR A;  3UBL A;  1GSD A;  1PN9 A;  2HRK B;  2GSS A;  5DJL A;  4F5U A;  7GSS A;  2ROH A;  3Q19 A;  5IJF A;  3H3A A;  3FR9 A;  1YVL A;  1GUL A;  4FJC B;  5ECO B;  5J47 A;  3HJM A;  5ECI B;  2LXT A;  3AY8 A;  20GS A;  3TDL A;  1JLW A;  1MTC A;  4GSN A;  4LB9 A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  1GNI A;  4K2C A;  2DSA A;  1EOG A;  4YQV A;  13GS A;  3QAV A;  1OYJ A;  12GS A;  3F63 A;  2EFH A;  1R5A A;  4W66 A;  5D9W A;  1PA3 A;  3WHR A;  1O9X A;  2BXL A;  1Q4J A;  1YJ6 A;  3M1G A;  3GUS A;  1AQW A;  5BMU B;  4K71 A;  4KDY A;  1PD2 1;  3G9K D;  1BAY A;  2WB9 A;  2BXI A;  3O3T A;  1M9A A;  4GLT A;  4MZW A;  1OE7 A;  3FRC A;  5AIV A;  1G6W A;  4KAE A;  1VF3 A;  5DBY A;  1GUM A;  2UV8 G;  2EFD A;  5GIN A;  3RBT A;  4L9Q A;  4PHZ C;  4EDY A;  1GLQ A;  1PX7 A;  2YV9 A;  4G0K A;  1E78 A;  5D9X A;  1AW9 A;  2VCW A;  5JCU A;  2I2Z A;  2PGT A;  1HNA A;  5ECK B;  3CBU A;  3TOT A;  1EV4 A;  1SB0 A;  1GSU A;  2EFE A;  5ECS A;  5HFK A;  4PUR A;  4ZBQ A;  4BVY B;  3IK7 A;  4ZB9 A;  4MPG A;  1GSF A;  4YAV A;  5F8B A;  4OT2 A;  2VO4 A;  1HA2 A;  5IIX A;  1A0F A;  3FNM A;  4LMV A;  4OR0 A;  4G04 A;  2GTU A;  4L5L A;  5J4U A;  2V6K A;  4IGJ A;  1N2A A;  2DC5 A;  3HJO A;  4BVX B;  6GST A;  4DHX B;  3UAR A;  4G03 A;  3MDK A;  4BVY A;  2NQO A;  3NIV A;  3KMO A;  5ELA A;  4AKG A;  3B9L A;  3ISO A;  2AGH B;  1HK2 A;  4F03 A;  1V2A A;  8GSS A;  5J41 A;  3FR6 A;  1GSS A;  5EVO A;  4NAX A;  1LJR A;  3F6F A;  3MAK A;  4LMW A;  1H9Z A;  1TW9 A;  4MF5 A;  1KDX A;  3I6A A;  5A34 B;  4ISD A;  4ZBK A;  1B4P A;  2XVV A;  4J2V A;  4N0U D;  3KJY A;  1YQ1 A;  1SVM A;  2PER A;  2NNW A;  22GS A;  4IKH A;  3H1N A;  4MDC A;  2WVX B;  4GF0 A;  3I69 A;  2XW1 A;  2XW0 A;  3LU7 A;  1K0A A;  3EIN A;  3G7I A;  4ZBA A;  3TGZ A;  4AGS A;  4N3Z A;  2E0X A;  1TU7 A;  5IJ5 A;  2DYO A;  1FW1 A;  4QQ7 A;  5DQS A;  5A34 A;  1SVO A;  2VCQ A;  2GSQ A;  3QAW A;  1E7F A;  4E99 A;  5A4V A;  2IMI A;  3CHX C;  3UIV A;  5F0G A;  1N5U A;  2HRA A;  4YH2 A;  2WVX A;  4E68 A;  1K0M A;  3N9J A;  3KIK A;  2PBJ A;  2VKZ G;  4GST A;  3QAG A;  4HZ2 A;  4F0C A;  3FWB C;  5HOZ A;  4FIP B;  1B8X A;  1GUH A;  3LU8 A;  4WA6 B;  17GS A;  2A2R A;  1TXU A;  2LJR A;  3BBY A;  3GUR A;  4IBP A;  4IW9 A;  4E8E A;  1K0O A;  3GQU A;  2GUT A;  3MHH B;  2VUF A;  3ZMK A;  4EDZ A;  2XMO A;  2BXN A;  2BXB A;  2WZS A;  2CZ2 A;  1HK5 A;  2QM6 A;  2YDF A;  3ERG A;  4I9O A;  2HNL A;  4TQ1 A;  3V03 A;  1HK3 A;  4NHZ A;  1IYI A;  2C3Q A;  3ICX A;  3IBH A;  1BF5 A;  2R4V A;  1KBN A;  3PGT A;  1K0B A;  5LD0 A;  3ERF A;  4WR5 A;  2WW2 A;  1YDK A;  4OFN A;  3VPT A;  9GSS A;  3VK9 A;  2QMC A;  1E7I A;  2KBZ A;  2LQH A;  4G01 A;  3M99 C;  2O3E A;  3Q74 A;  4GDK B;  4PNG A;  4MBE C;  1G6Y A;  4D7X A;  3SIV B;  4IJI A;  4KGI A;  5DQF A;  4EE0 A;  2VD1 A;  4IW1 A;  5AN1 A;  3TOU A;  1KW2 A;  4PUA A;  5A5H B;  2PMT A;  4PQH A;  6GSY A;  5FWG A;  4IW2 A;  2WRT A;  3ZML A;  5AIS A;  4MF7 A;  3CRT A;  1HNC A;  3P90 A;  4S1Y A;  4ZCG A;  1PKZ A;  3LXZ A;  2UZ8 A;  1HNB A;  1YKC A;  3ZFB A;  3KMN A;  1XWK A;  1PX6 A;  2AAW A;  3C8E A;  5DAL A;  4O7H A;  2FNO A;  1J78 A;  3R2Q A;  2BXH A;  3B9M A;  5A5H A;  1N25 A;  4ACS A;  2LQI A;  5J4Y A;  5BPK A;  1EV9 A;  2BXC A;  4GG2 A;  2R5G A;  4IVF A;  2DBX A;  3LXT A;  4ECI A;  4ZBR A;  4QMK A;  1E7B A;  2GDR A;  3P8W A;  2VCT A;  5ID7 A;  1BX9 A;  4PI2 C;  1E6B A;  3UVH A;  5KEJ A;  1MD4 A;  1NHY A;  5EY6 A;  2XSI A;  2JUH A;  1AQV A;  2BXE A;  3M0F A;  2BXG A;  4DM0 A;  3KM6 A;  1GTB A;  4GSS A;  5D9V A;  5IFO A;  2HQT A;  1HQO A;  1OKT A;  1Z9H A;  4F5V A;  5ECH B;  1GTI A;  4PX1 A;  3EE2 A;  4ZXG A;  3IR4 A;  3KXO A;  1E7A A;  2WVZ A;  4N0V A;  2CZ3 A;  4YAP A;  2K0N A;  4ID0 A;  1AO6 A;  3WYW A;  1E7E A;  2DYM A;  3O76 A;  1BKE A;  1KXP D;  1M0U A;  2Z8K A;  4F5S A;  4ZB6 A;  4BL7 A;  4O92 A;  1V40 A;  4DEJ A;  2I30 A;  2WJU A;  4I97 A;  4FQU A;  2OT3 A;  2KWF A;  3CRU A;  4KH7 A;  2Z8I A;  4YQM A;  2R3X A;  1HK1 A;  2VCZ A;  4HJ2 A;  1F2E A;  4CHS A;  3FWC C;  4TQ0 A;  2AB6 A;  4HZ4 A;  3SQJ A;  1TU8 A;  3FR3 A;  4FXY P;  3PLA A;  1JNB A;  1GNW A;  4NAW B;  1GSE A;  4C31 B;  4Q5N A;  1HK4 A;  2OA7 A;  5FHI A;  1F3B A;  1E7C A;  4L5O A;  3VLN A;  3CSJ A;  1U3I A;  4PXO A;  1VFI A;  4LUH A;  4L9K A;  3FYG A;  3A73 A;  5ECP B;  2C80 A;  3CWG A;  3H37 A;  1MUH A;  3ECP A;  3Q18 A;  2CA8 A;  3LSZ A;  5GST A;  5A1N B;  5A4U A;  4HOJ A;  2LXS A;  1I1I P;  5A5K A;  1K3O A;  5F06 A;  2LOQ A;  2WW1 A;  4G0I A;  4G9H A;  3WHS A;  1GTU A;  4KF9 A;  4IQA A;  2EFC A;  4USS A;  4OMV A;  2BXD A;  1K0D A;  3VI5 A;  2GSR A;  5JCW A;  5IIU A;  1S4B P;  4ZB7 A;  2CVD A;  2O36 A;  2GST A;  3M8N A;  3CSI A;  1F3A A;  2XVW A;  4AKX B;  3RGB C;  4OTT A;  4PQI A;  5A1N A;  5GZZ B;  4OTU A;  4MP4 A;  3F6D A;  1GLP A;  4JZQ A;  4BY9 C;  3ZFL A;  4IEL A;  4ECC A;  2BXP A;  4GDL B;  2IMK A;  2NTO A;  1Y6E A;  2VUE A;  4PO0 A;  1MUS A;  5ELG A;  5IQY A;  2CKX A;  4OFM A;  1PGT A;  4JED A;  1K0N A;  2A2S A;  3FY7 A;  4FK5 B;  1U87 A;  3NVI A;  2BXA A;  1BJ5 A;  6GSX A;  1GSQ A;  5B5T A;  2FHE A;  1ZL9 A;  2V36 A;  5B7C A;  1K0C A;  1PL2 A;  3VI7 A;  4Q5R A;  1VF4 A;  3V09 A;  2DG5 A;  3LG6 A;  1B48 A;  3NVM A;  3R3E A;  3CSH A;  3GX0 A;  4EXJ A;  5D9T A;  10GS A;  1IYH A;  4ZB8 A;  6GSW A;  1MIV A;  4HI7 A;  1K3Y A;  3A75 A;  5DAL B;  5ECQ B;  4AKI A;  3CX9 A;  2C8U A;  5ECR B;  4AI6 A;  2H1L A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  2HSN A;  2O5V A;  1GSY A;  6GSU A;  2QHB A;  5D7G A;  3GA9 L;  5D73 A;  3HMJ G;  4KDU A;  1AXD A;  4KE3 A;  3UBK A;  2X64 A;  4IS0 A;  4MK3 A;  3VWX A;  1PKW A;  1MD3 A;  3QR6 A;  4N0F D;  5FT3 A;  2AJE A;  2WW3 A;  1BG1 A;  1FOU A;  3M3M A;  4GCI A;  3DD3 A;  5DCG A;  6GSV A;  4KDX A;  4LB2 A;  5G5E A; 
#chains in the Genus database with same CATH homology
 4ZC6 A;  4PNF A;  3JQZ A;  3UAP A;  2N5F A;  3G7J A;  4J2F A;  3TU3 B;  2HSM B;  3W8S A;  5ECM B;  4GTU A;  4L8E A;  2IL3 A;  4BL7 B;  1K3L A;  4G0L A;  5GHK A;  1GWC A;  4G10 A;  1OE8 A;  4JK4 A;  4K0G A;  3WD6 A;  4MPF A;  1MA9 A;  3VQI A;  5IIH A;  6GSS A;  3N5O A;  5J4V A;  4AKH A;  1C72 A;  3WHQ A;  4F0B A;  1ZGN A;  4HGM B;  4GDX A;  5A4W A;  1JZR A;  2XVQ A;  2HSM A;  4OFT A;  1DUG A;  5IJE A;  1EEM A;  4PGT A;  3PPU A;  4GDF A;  4ZBB A;  3GQX A;  5BMU A;  4W4U B;  4JBB A;  2JL4 A;  2YCD A;  1U88 A;  3IK9 A;  3D0Z A;  3GH6 A;  1EOH A;  2BXK A;  1PL1 A;  2D2Z A;  2WDU A;  3IE3 A;  1ML6 A;  4NHW A;  2J9H A;  1H5W A;  2C3T A;  2CAQ A;  3SWL A;  1VF2 A;  4HGK A;  1LOT A;  3LQ7 A;  5EL8 A;  5DAK B;  1YY7 A;  5GIP A;  4KX4 A;  1LBK A;  1RK4 A;  3NVK A;  1GNJ A;  2C3N A;  3HKR A;  3V08 A;  3LYP A;  4EC0 A;  4E8H A;  3GST A;  2F3M A;  1BG5 A;  2XVU A;  16GS A;  4RI6 A;  4WR4 A;  2BXQ A;  4ZUX V;  5DAK A;  4EMX A;  3IC8 A;  3MHS B;  1TDI A;  2WS2 A;  3DGQ A;  5F05 A;  1XWG A;  5G5F A;  1G7O A;  2R6K A;  1BM0 A;  4BKE A;  1GTA A;  4K0N A;  2BXO A;  2OZB B;  5DJM A;  4ZBD A;  2BXM A;  3KJL A;  2E0Y A;  5J5N A;  5J40 A;  2ON5 A;  4Q5Q A;  1VF1 A;  1LNS A;  4BVX A;  1M9B A;  1GUK A;  3W1S A;  4RI7 A;  4IQ1 A;  1MIY A;  4TOP A;  19GS A;  4ECB A;  3LFL A;  1UOR A;  2VDB A;  5AGY A;  1IJG A;  5F07 A;  1Y1U A;  1USB A;  1SVL A;  1MIW A;  3NMU A;  3JRY A;  2F8F A;  4MF6 A;  4LA0 A;  3GTU B;  4L8U A;  2YV7 A;  1VZS A;  3KTL A;  4YQU A;  4ECJ A;  2OAC A;  1E7H A;  2VCX A;  4Z69 A;  2CAI A;  3VUR A;  2VD0 A;  2AHE A;  5AIX A;  14GS A;  18GS A;  11GS A;  1FHE A;  2BX8 A;  2PVQ A;  1XW5 A;  1AQX A;  1TF0 A;  3U6V A;  3VPQ A;  5ID9 A;  5GSS A;  1E7G A;  3GTU A;  2HSN B;  1UA5 A;  1J7E A;  4G19 A;  1XW6 A;  2BXF A;  5LCZ A;  3PR8 A;  3LU6 A;  2DBU A;  3GSS A;  4M70 B;  1PMT A;  3L0H A;  4F5T A;  5FUO A;  2C4J A;  3LYK A;  2DBW A;  1NT2 B;  4Z9O A;  3SIU B;  4Q5F A;  1GNE A;  1JLV A;  2VCV A;  4PTS A;  2Z8J A;  4LUF A;  1M99 A;  5GIO A;  5DDL A;  3LJR A;  3UBL A;  1GSD A;  1PN9 A;  2HRK B;  2GSS A;  5DJL A;  4F5U A;  7GSS A;  2ROH A;  3Q19 A;  5IJF A;  3H3A A;  3FR9 A;  1YVL A;  1GUL A;  4FJC B;  5ECO B;  5J47 A;  3HJM A;  5ECI B;  3AY8 A;  20GS A;  3TDL A;  1JLW A;  1MTC A;  4GSN A;  4LB9 A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  1GNI A;  4K2C A;  2DSA A;  1EOG A;  4YQV A;  13GS A;  3QAV A;  1OYJ A;  12GS A;  3F63 A;  2EFH A;  1R5A A;  4W66 A;  5D9W A;  1PA3 A;  3WHR A;  1O9X A;  2BXL A;  1Q4J A;  1YJ6 A;  3M1G A;  3GUS A;  1AQW A;  5BMU B;  4K71 A;  4KDY A;  1PD2 1;  3G9K D;  1BAY A;  2WB9 A;  2BXI A;  3O3T A;  1M9A A;  4GLT A;  4MZW A;  1OE7 A;  3FRC A;  5AIV A;  1G6W A;  4KAE A;  1VF3 A;  5DBY A;  1GUM A;  2UV8 G;  2EFD A;  5GIN A;  3RBT A;  4L9Q A;  4EDY A;  1GLQ A;  1PX7 A;  2YV9 A;  4G0K A;  1E78 A;  5D9X A;  1AW9 A;  2VCW A;  5JCU A;  2I2Z A;  2PGT A;  1HNA A;  5ECK B;  3CBU A;  3TOT A;  1EV4 A;  1GSU A;  2EFE A;  5ECS A;  5HFK A;  4PUR A;  4ZBQ A;  4BVY B;  3IK7 A;  4ZB9 A;  4MPG A;  1GSF A;  4YAV A;  5F8B A;  4OT2 A;  2VO4 A;  1HA2 A;  5IIX A;  1A0F A;  3FNM A;  4LMV A;  4OR0 A;  4G04 A;  2GTU A;  4L5L A;  5J4U A;  2V6K A;  4IGJ A;  1N2A A;  2DC5 A;  3HJO A;  4BVX B;  6GST A;  4DHX B;  3UAR A;  4G03 A;  3MDK A;  4BVY A;  2NQO A;  3NIV A;  3KMO A;  5ELA A;  4AKG A;  3B9L A;  3ISO A;  4F03 A;  1HK2 A;  1V2A A;  8GSS A;  5J41 A;  3FR6 A;  1GSS A;  5EVO A;  4NAX A;  1LJR A;  3F6F A;  3MAK A;  4LMW A;  1H9Z A;  1TW9 A;  4MF5 A;  3I6A A;  5A34 B;  4ISD A;  4ZBK A;  1B4P A;  2XVV A;  4J2V A;  4N0U D;  3KJY A;  1YQ1 A;  1SVM A;  2PER A;  2NNW A;  22GS A;  4IKH A;  3H1N A;  4MDC A;  4GF0 A;  3I69 A;  2XW1 A;  2XW0 A;  3LU7 A;  1K0A A;  3EIN A;  3G7I A;  4ZBA A;  3TGZ A;  4AGS A;  4N3Z A;  2E0X A;  1TU7 A;  5IJ5 A;  2DYO A;  1FW1 A;  4QQ7 A;  5DQS A;  5A34 A;  1SVO A;  2VCQ A;  2GSQ A;  3QAW A;  1E7F A;  4E99 A;  5A4V A;  2IMI A;  3UIV A;  5F0G A;  1N5U A;  2HRA A;  4YH2 A;  4E68 A;  1K0M A;  3N9J A;  3KIK A;  2PBJ A;  2VKZ G;  4GST A;  3QAG A;  4HZ2 A;  4F0C A;  3FWB C;  5HOZ A;  4FIP B;  1B8X A;  1GUH A;  3LU8 A;  4WA6 B;  17GS A;  2A2R A;  1TXU A;  2LJR A;  3BBY A;  3GUR A;  4IBP A;  4IW9 A;  4E8E A;  1K0O A;  3GQU A;  3ZMK A;  3MHH B;  2VUF A;  4EDZ A;  2XMO A;  2BXN A;  2BXB A;  2CZ2 A;  1HK5 A;  2QM6 A;  2YDF A;  3ERG A;  2HNL A;  4TQ1 A;  3V03 A;  1HK3 A;  4NHZ A;  1IYI A;  2C3Q A;  3ICX A;  3IBH A;  1BF5 A;  2R4V A;  1KBN A;  3PGT A;  1K0B A;  5LD0 A;  3ERF A;  4WR5 A;  1YDK A;  4OFN A;  3VPT A;  9GSS A;  3VK9 A;  2QMC A;  1E7I A;  2KBZ A;  4G01 A;  3M99 C;  3Q74 A;  4GDK B;  4PNG A;  4MBE C;  1G6Y A;  3SIV B;  4KGI A;  4IJI A;  5DQF A;  4EE0 A;  2VD1 A;  4IW1 A;  5AN1 A;  3TOU A;  1KW2 A;  4PUA A;  5A5H B;  2PMT A;  4PQH A;  6GSY A;  5FWG A;  4IW2 A;  2WRT A;  3ZML A;  5AIS A;  4MF7 A;  3CRT A;  1HNC A;  3P90 A;  4S1Y A;  4ZCG A;  1PKZ A;  3LXZ A;  2UZ8 A;  1HNB A;  1YKC A;  3ZFB A;  3KMN A;  1XWK A;  1PX6 A;  2AAW A;  3C8E A;  5DAL A;  4O7H A;  2FNO A;  1J78 A;  3R2Q A;  2BXH A;  3B9M A;  5A5H A;  1N25 A;  4ACS A;  5J4Y A;  5BPK A;  1EV9 A;  2BXC A;  4GG2 A;  2R5G A;  4IVF A;  2DBX A;  3LXT A;  4ECI A;  4ZBR A;  4QMK A;  1E7B A;  2GDR A;  3P8W A;  2VCT A;  5ID7 A;  1BX9 A;  1E6B A;  3UVH A;  5KEJ A;  1MD4 A;  1NHY A;  5EY6 A;  2XSI A;  2JUH A;  1AQV A;  2BXE A;  3M0F A;  2BXG A;  3KM6 A;  1GTB A;  4GSS A;  5D9V A;  5IFO A;  2HQT A;  1HQO A;  1OKT A;  1Z9H A;  4F5V A;  5ECH B;  1GTI A;  4PX1 A;  3EE2 A;  4ZXG A;  3IR4 A;  3KXO A;  1E7A A;  4YAP A;  4N0V A;  2CZ3 A;  4ID0 A;  1AO6 A;  3WYW A;  1E7E A;  2DYM A;  3O76 A;  1BKE A;  1KXP D;  1M0U A;  2Z8K A;  4F5S A;  4ZB6 A;  4BL7 A;  4O92 A;  1V40 A;  4DEJ A;  2I30 A;  2WJU A;  4I97 A;  4FQU A;  2OT3 A;  4KH7 A;  3CRU A;  2Z8I A;  4YQM A;  2R3X A;  1HK1 A;  2VCZ A;  4HJ2 A;  1F2E A;  4CHS A;  3FWC C;  4TQ0 A;  2AB6 A;  4HZ4 A;  3SQJ A;  1TU8 A;  3FR3 A;  3PLA A;  1JNB A;  1GNW A;  4NAW B;  1GSE A;  4C31 B;  4Q5N A;  1HK4 A;  2OA7 A;  5FHI A;  1F3B A;  1E7C A;  4L5O A;  3VLN A;  3CSJ A;  1U3I A;  4PXO A;  1VFI A;  4LUH A;  4L9K A;  3FYG A;  3A73 A;  5ECP B;  2C80 A;  3CWG A;  3H37 A;  3Q18 A;  2CA8 A;  3LSZ A;  5GST A;  5A1N B;  5A4U A;  4HOJ A;  5A5K A;  1K3O A;  5F06 A;  2LOQ A;  4G0I A;  4G9H A;  3WHS A;  1GTU A;  4KF9 A;  4IQA A;  2EFC A;  4USS A;  4OMV A;  2BXD A;  1K0D A;  3VI5 A;  2GSR A;  5JCW A;  5IIU A;  4ZB7 A;  2CVD A;  2GST A;  3M8N A;  3CSI A;  1F3A A;  2XVW A;  4AKX B;  4OTT A;  4PQI A;  5A1N A;  5GZZ B;  4OTU A;  4MP4 A;  3F6D A;  1GLP A;  4JZQ A;  4BY9 C;  3ZFL A;  4IEL A;  4ECC A;  2BXP A;  4GDL B;  2IMK A;  2NTO A;  1Y6E A;  2VUE A;  4PO0 A;  5ELG A;  5IQY A;  2CKX A;  4OFM A;  1PGT A;  4JED A;  1K0N A;  2A2S A;  3FY7 A;  4FK5 B;  1U87 A;  3NVI A;  2BXA A;  1BJ5 A;  6GSX A;  1GSQ A;  5B5T A;  2FHE A;  1ZL9 A;  2V36 A;  5B7C A;  1K0C A;  1PL2 A;  3VI7 A;  4Q5R A;  1VF4 A;  3V09 A;  2DG5 A;  3LG6 A;  1B48 A;  3NVM A;  3R3E A;  3CSH A;  3GX0 A;  4EXJ A;  5D9T A;  10GS A;  1IYH A;  4ZB8 A;  6GSW A;  1MIV A;  4HI7 A;  1K3Y A;  3A75 A;  5DAL B;  5ECQ B;  4AKI A;  3CX9 A;  2C8U A;  5ECR B;  4AI6 A;  2H1L A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  2HSN A;  2O5V A;  1GSY A;  6GSU A;  2QHB A;  5D7G A;  3GA9 L;  5D73 A;  3HMJ G;  4KDU A;  1AXD A;  4KE3 A;  3UBK A;  2X64 A;  4IS0 A;  4MK3 A;  3VWX A;  1PKW A;  1MD3 A;  3QR6 A;  4N0F D;  5FT3 A;  2AJE A;  1BG1 A;  1FOU A;  3M3M A;  4GCI A;  3DD3 A;  5DCG A;  6GSV A;  4KDX A;  4LB2 A;  5G5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...