2EFDA

Ara7/atvps9a
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
246
structure length
246
Chain Sequence
MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 101
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efdA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efdA02
2EFEA 2EFDA 2EFCA 2OT3A 4G01A 2EFHA 1TXUA 4N3ZA
chains in the Genus database with same CATH superfamily
5AGYA 4O92A 4YQMA 4PX1A 3ZMLA 1BG1A 2GSQA 5LCZA 4LB2A 1HNAA 1GUMA 1VF1A 2DBWA 2HNLA 2OADA 3O3TA 2HRKB 1MD4A 5J41A 4IW2A 1JLWA 1LOTA 5ECHB 20GSA 4LUFA 2VD1A 5J40A 3PPUA 2C4JA 5DDLA 5D9TA 5GSTA 2O5VA 2WDUA 1U88A 4K0GA 5FT3A 5ECIB 1GTBA 5F07A 2C80A 3CRTA 2YCDA 3LU8A 1KDXA 13GSA 4EC0A 4FXYP 4EXJA 5J4YA 2DC5A 4ECJA 5J4UA 4G9HA 2VO4A 2WJUA 2QMCA 1JNBA 1HK4A 1KXPD 1M99A 5IJFA 4HGKA 4F5VA 4ECIA 5A5KA 1K0OA 3KM6A 1VFIA 1GLPA 5B7CA 5JCWA 2CAIA 2AHEA 2BXIA 3CSJA 4ZB8A 2J9HA 12GSA 2HSMA 1HNBA 3MDKA 2BXEA 4GDXA 4MZWA 2BXFA 1K3LA 1UA5A 3PGTA 2AB6A 4C31B 4PI2C 4W4UB 1PKWA 4IW9A 3WD6A 3GTUA 4KDYA 4MPFA 3M0FA 2WW1A 3R3EA 4HGMB 1Y6EA 2GDRA 2O3EA 1M0UA 1FW1A 1PD21 3KJYA 2XW1A 22GSA 3UBLA 2DG5A 3C8EA 5ECQB 2XVWA 2VD0A 4J2VA 2BXDA 2I2ZA 5DBYA 3W1SA 4NHZA 5IQYA 1YDKA 4E99A 1AW9A 1F3AA 3IR4A 4PI0C 1DUGA 4L8EA 1S4BP 2EFDA 4BY9C 5EL8A 4PURA 6GSSA 4IQAA 3ZFLA 3LYPA 3ZFBA 4G04A 4G03A 2CA8A 1MD3A 1GULA 3QR6A 4ZBAA 2GSTA 4LA0A 4DM0A 1TDIA 5JCUA 4YAVA 5KEJA 2IMKA 1TF0A 4OTTA 2PERA 4BL7A 5A34B 3ECPA 2EFCA 2R3XA 4Q5FA 3HMJG 1GSFA 1A0FA 2OA7A 1KBNA 2VUFA 4EDYA 4MF6A 2A2RA 4OFNA 4F03A 5A5HB 5F06A 1GTIA 2HQTA 1LBKA 3IE3A 19GSA 4IELA 2FNOA 1MIWA 2CZ3A 3FR6A 3LQ7A 3KMNA 2AJEA 4OMVA 4JK4A 3B9MA 2VCVA 5ECRB 2WW3A 5BMUA 5GIOA 4KDXA 2XMOA 3RFRC 4D7XA 2BXGA 4IKHA 5A4VA 1VZSA 5HOZA 4F5TA 8GSSA 2QM6A 1XWKA 1XW6A 2OZBB 3L0HA 3KXOA 4L5OA 3Q18A 4L5LA 1BX9A 4KX4A 3PLAA 10GSA 3ISOA 2HSNA 2PBJA 2LXTA 1FHEA 1GSSA 1VF2A 4PXOA 3M3MA 4ZB6A 3UBKA 1HK1A 1BG5A 4HZ2A 4ZBQA 4ZC6A 4ZCGA 2A2SA 2VCTA 6GSXA 3Q19A 1N5UA 18GSA 5FWGA 5IIHA 2GTUA 4AGSA 5DALA 2BXHA 1SB0A 4G01A 1HQOA 4AKHA 4IGJA 3DGQA 1EOGA 6GSUA 3V03A 3CSIA 3R2QA 2NQOA 4IVFA 3KJLA 3G7JA 3VI5A 1SVMA 4PNGA 3GUSA 4HJ2A 2K0NA 3Q74A 1NT2B 1GLQA 1K3OA 4MK3A 1E78A 4EMXA 1TU7A 1VF3A 4G0KA 3UAPA 4AKXB 4NAWB 4F5UA 3PR8A 4TOPA 5ECOB 5F0GA 1YKCA 4I9OA 4PGTA 3CSHA 2I30A 4MF5A 3GA9L 1HA2A 1K0MA 2YV9A 4IS0A 5DAKA 1AQXA 6GSTA 1ML6A 5IIXA 1ZL9A 2VCWA 5ECMB 5A4UA 5J5NA 4PNFA 1E7IA 3GSSA 3FR3A 4KGIA 2VUEA 2VCZA 2HRAA 3M1GA 3CWGA 3IK9A 2F8FA 4GCIA 2PMTA 5D9WA 3SWLA 1VF4A 4KH7A 11GSA 1B48A 4FIPB 3V08A 1KW2A 1YJ6A 4LB9A 2V6KA 4PUAA 3KMOA 4AKIA 3M99C 2AAWA 2H1LA 3GX0A 5LD0A 3MHHB 4QMKA 4ZBBA 3FYGA 5ECNB 3JQZA 2JL4A 5GIPA 4MBEC 1OE8A 1YEWC 1BM0A 2WS2A 3TU3B 3WHRA 4BVYB 3NVMA 4KAEA 4MDCA 1HK5A 1K0CA 4FK5B 2R5GA 3LU7A 1B4PA 2C3TA 1LNSA 2Z8JA 3RBTA 5FHIA 1K0DA 4GDKB 1N2AA 3NIVA 4G10A 3LXZA 4WR5A 1EOHA 1H5WA 1PX7A 1H9ZA 2GSSA 3RGBC 2LQHA 2CVDA 2HRKA 1MIYA 2XVQA 3CX9A 4Q5RA 4W66A 3LFLA 4ECCA 4ZXGA 4GF0A 4AKGA 14GSA 2GLRA 1SVOA 2PGTA 4ISDA 3IK7A 1MUHA 1GUHA 5A1NB 2BXOA 1EEMA 2VDBA 1M9AA 4EE0A 2Z8IA 2R4VA 3N9JA 1NHYA 3UARA 5IJ5A 2YDFA 2LQIA 2IL3A 2WVYA 4PTSA 4S1YA 1Y1UA 3A75A 2WVXB 1PX6A 2CZ2A 3QAGA 1V40A 4ZUXV 3B9LA 5DQSA 1IJGA 4OT2A 4BVXB 4AI6A 2F3MA 5D73A 2QHBA 2EFHA 1R5AA 3P90A 4E8EA 3FNMA 1AO6A 2BXNA 1OYJA 1IYIA 2VCQA 4MF7A 1J7EA 4GDFA 5DJLA 5GINA 1MA9A 1GNWA 3I69A 4KSMA 2UV8G 2BXBA 5J4VA 5EVOA 2XSIA 4I97A 4GSSA 4NAXA 1U3IA 2D2ZA 1GNJA 5AIVA 2IMIA 3SIVB 3ERFA 4LMWA 4F0BA 2OT3A 17GSA 2X64A 4WR4A 1B8XA 4NHWA 1YQ1A 3H3AA 1MIVA 2LXSA 2OACA 4F5SA 1BJ5A 4ZBDA 4EDZA 4PHZC 6GSYA 1PKZA 2UZ8A 5DQFA 2BXLA 5GHKA 4N0VA 1PMTA 1HK2A 4PQIA 4GSTA 3HJOA 1BAYA 3V09A 1E7AA 4Z69A 1V2AA 3MHSB 5ECPB 3NVIA 4QQ7A 3O76A 1MM8A 4E68A 1JZRA 1E7CA 5G5EA 4YQUA 4F0CA 3DD3A 3ERGA 2E0YA 2DBXA 1J78A 4Q5QA 1GSQA 4N3ZA 1EV4A 1E7BA 5IIUA 1AQVA 5ECLB 4GSNA 5GSSA 3H37A 2HSMB 4ZB9A 2VCXA 5ECKB 3TOUA 1LJRA 3WYWA 3G9KD 1GSEA 5A34A 2LOQA 3LYKA 1OE7A 3VPQA 2R6KA 3EE2A 4PO0A 3U6VA 1TXUA 4BKEA 1EV9A 3FR9A 5ELAA 5A5HA 3FWCC 4GLTA 3HKRA 3GTUB 2E0XA 1TW9A 5D7GA 1PGTA 2WRTA 2C3QA 4IQ1A 2GUTA 1GSDA 1AXDA 4KDUA 3TOTA 1USBA 3VQIA 2XVUA 4DHXB 1N25A 3I6AA 4OR0A 1GTUA 3GQUA 3P8WA 16GSA 3VPTA 4ZB7A 4L9KA 1U87A 5B5TA 2LJRA 4ECBA 3A73A 3EINA 3LU6A 3IC8A 2BXMA 2VKZG 1G7OA 1E6BA 1E7HA 3AY8A 2BXQA 2N5FA 7GSSA 4ID0A 9GSSA 1PA3A 3VK9A 1PN9A 1O9XA 3NVKA 4N0UD 5A4WA 4N0FD 3GURA 3NMUA 1E7EA 3FRCA 3GQXA 1OKTA 2PVQA 5AISA 3F63A 4JBBA 4BL7B 3HJMA 4KF9A 4RI7A 1ZGNA 1I1IP 2ON5A 5F05A 3UVHA 1XWGA 2DSAA 1HK3A 2BXKA 3LJRA 4GDLB 1K0NA 3UIVA 2V36A 5ID9A 3VURA 2NTOA 2FHEA 4IW1A 3ICXA 3CHXC 1C72A 3VI7A 4OTUA 4GG2A 4LUHA 4Z9OA 4TQ1A 2BXAA 4G19A 3LG6A 4K0NA 1BF5A 2YV7A 1GSUA 1MTCA 4HOJA 5D9XA 5HFKA 2AGHB 4MP4A 4K71A 3SIUB 2WB9A 1G6YA 3N5OA 5AIXA 3FY7A 3MAKA 2Z8KA 1PL1A 1GUKA 1RK4A 3LXTA 5BMUB 3W8SA 2CAQA 4CHSA 4WA6B 4O7HA 2C3NA 2KBZA 4G0IA 1HNCA 3VWXA 3CRUA 1GNEA 3BPJA 2EFEA 5ELGA 2HSNB 5GZZB 4YAPA 3IBHA 4L8UA 1UORA 5F8BA 4GTUA 2JUHA 4L9QA 1MUSA 4M70B 4TQ0A 4OFMA 4HI7A 3TDLA 2O36A 1F3BA 3M8NA 3QAVA 3F6FA 3ZMKA 1K3YA 5DALB 4OFTA 1YVLA 3LSZA 2XVVA 1K0BA 2GSRA 3QAWA 1BYEA 3F6DA 1E7FA 2BXCA 3FWBC 4HZ4A 4YQVA 3D0ZA 2DBUA 5ID7A 4BVYA 5J47A 2KWFA 1GNIA 2WW0A 4ZBKA 3GSTA 4JEDA 4KE3A 4J2FA 5DCGA 1JLVA 4K2CA 5BPKA 1F2EA 3WHQA 6GSVA 2NNWA 1GSYA 5DJMA 1IYHA 1BKEA 4LMVA 3CBUA 4MPGA 1GTAA 5DAKB 4IJIA 1SVLA 1XW5A 3GH6A 2CKXA 3BBYA 3H1NA 4DEJA 2ROHA 2XW0A 5A1NA 4PQHA 1TU8A 3G7IA 4FQUA 3VLNA 4ZBRA 4E8HA 4G0LA 2ON7A 4USSA 1Q4JA 2WVXA 4IBPA 4FJCB 1K0AA 1G6WA 5AN1A 3TGZA 1FOUA 1M9BA 2C8UA 2WVZA 6GSWA 4JZQA 2BXPA 5EY6A 5G5FA 1GWCA 4YH2A 2BX8A 4BVXA 5IJEA 1YY7A 4RI6A 3WHSA 2WW2A 2WZSA 2DYOA 2DYMA 4ACSA 5D9VA 5IFOA 4Q5NA 3KTLA 1E7GA 1PL2A 1Z9HA 3KIKA 3SQJA 1AQWA 5FUOA 3JRYA 5ECSA
chains in the Genus database with same CATH topology
5AGYA 4O92A 4YQMA 4PX1A 3ZMLA 1BG1A 2GSQA 5LCZA 4LB2A 1HNAA 1GUMA 1VF1A 2DBWA 2HNLA 2OADA 3O3TA 2HRKB 1MD4A 5J41A 4IW2A 1JLWA 1LOTA 5ECHB 20GSA 4LUFA 2VD1A 5J40A 3PPUA 2C4JA 5DDLA 5D9TA 5GSTA 2O5VA 2WDUA 1U88A 4K0GA 5FT3A 5ECIB 1GTBA 5F07A 2C80A 3CRTA 2YCDA 3LU8A 13GSA 4EC0A 4EXJA 5J4YA 2DC5A 4ECJA 5J4UA 4G9HA 2VO4A 2WJUA 2QMCA 1JNBA 1HK4A 1KXPD 1M99A 5IJFA 4HGKA 4F5VA 4ECIA 5A5KA 1K0OA 3KM6A 1VFIA 1GLPA 5B7CA 5JCWA 2CAIA 2AHEA 2BXIA 3CSJA 4ZB8A 2J9HA 12GSA 2HSMA 1HNBA 3MDKA 2BXEA 4GDXA 4MZWA 2BXFA 1K3LA 1UA5A 3PGTA 2AB6A 4C31B 4W4UB 1PKWA 4IW9A 3WD6A 3GTUA 4KDYA 4MPFA 3M0FA 3R3EA 4HGMB 1Y6EA 2GDRA 1M0UA 1FW1A 1PD21 3KJYA 2XW1A 22GSA 3UBLA 2DG5A 3C8EA 5ECQB 2XVWA 2VD0A 4J2VA 2BXDA 2I2ZA 5DBYA 3W1SA 4NHZA 5IQYA 1YDKA 4E99A 1AW9A 1F3AA 3IR4A 1DUGA 4L8EA 2EFDA 4BY9C 5EL8A 4PURA 6GSSA 4IQAA 3ZFLA 3LYPA 3ZFBA 4G04A 4G03A 2CA8A 1MD3A 1GULA 3QR6A 4ZBAA 2GSTA 4LA0A 1TDIA 5JCUA 4YAVA 5KEJA 2IMKA 1TF0A 4OTTA 2PERA 4BL7A 5A34B 2EFCA 2R3XA 4Q5FA 3HMJG 1GSFA 1A0FA 2OA7A 1KBNA 2VUFA 4EDYA 4MF6A 2A2RA 4OFNA 4F03A 5A5HB 5F06A 1GTIA 2HQTA 1LBKA 3IE3A 19GSA 4IELA 2FNOA 1MIWA 2CZ3A 3FR6A 3LQ7A 3KMNA 2AJEA 4OMVA 4JK4A 3B9MA 2VCVA 5ECRB 5BMUA 5GIOA 4KDXA 2XMOA 2BXGA 4IKHA 5A4VA 1VZSA 5HOZA 4F5TA 8GSSA 2QM6A 1XWKA 1XW6A 2OZBB 3L0HA 3KXOA 4L5OA 3Q18A 4L5LA 1BX9A 4KX4A 3PLAA 10GSA 3ISOA 2HSNA 2PBJA 1FHEA 1GSSA 1VF2A 4PXOA 3M3MA 4ZB6A 3UBKA 1HK1A 1BG5A 4HZ2A 4ZBQA 4ZC6A 4ZCGA 2A2SA 2VCTA 6GSXA 3Q19A 1N5UA 18GSA 5FWGA 5IIHA 2GTUA 4AGSA 5DALA 2BXHA 1HQOA 4G01A 4AKHA 4IGJA 3DGQA 1EOGA 6GSUA 3V03A 3CSIA 3R2QA 2NQOA 4IVFA 3KJLA 3G7JA 3VI5A 1SVMA 4PNGA 3GUSA 4HJ2A 3Q74A 1NT2B 1GLQA 1K3OA 4MK3A 1E78A 4EMXA 1TU7A 1VF3A 4G0KA 3UAPA 4AKXB 4NAWB 4F5UA 3PR8A 4TOPA 5ECOB 5F0GA 1YKCA 4PGTA 3CSHA 2I30A 4MF5A 3GA9L 1HA2A 1K0MA 2YV9A 4IS0A 5DAKA 1AQXA 6GSTA 1ML6A 5IIXA 1ZL9A 2VCWA 5ECMB 5A4UA 5J5NA 4PNFA 1E7IA 3GSSA 3FR3A 4KGIA 2VUEA 2VCZA 2HRAA 3M1GA 3CWGA 3IK9A 2F8FA 4GCIA 2PMTA 5D9WA 3SWLA 1VF4A 4KH7A 11GSA 1B48A 4FIPB 3V08A 1KW2A 1YJ6A 4LB9A 2V6KA 4PUAA 3KMOA 4AKIA 3M99C 2AAWA 2H1LA 3GX0A 5LD0A 3MHHB 4QMKA 4ZBBA 3FYGA 5ECNB 3JQZA 2JL4A 5GIPA 4MBEC 1OE8A 1BM0A 2WS2A 3TU3B 3WHRA 4BVYB 3NVMA 4KAEA 4MDCA 1HK5A 1K0CA 4FK5B 2R5GA 3LU7A 1B4PA 2C3TA 1LNSA 2Z8JA 3RBTA 5FHIA 1K0DA 4GDKB 1N2AA 3NIVA 4G10A 3LXZA 4WR5A 1EOHA 1H5WA 1PX7A 1H9ZA 2GSSA 2CVDA 2HRKA 1MIYA 2XVQA 3CX9A 4Q5RA 4W66A 3LFLA 4ECCA 4ZXGA 4GF0A 4AKGA 14GSA 2GLRA 1SVOA 2PGTA 4ISDA 3IK7A 1GUHA 5A1NB 2BXOA 1EEMA 2VDBA 1M9AA 4EE0A 2Z8IA 2R4VA 3N9JA 1NHYA 3UARA 5IJ5A 2YDFA 2IL3A 4PTSA 4S1YA 1Y1UA 3A75A 1PX6A 2CZ2A 3QAGA 1V40A 4ZUXV 3B9LA 5DQSA 1IJGA 4OT2A 4BVXB 4AI6A 2F3MA 5D73A 2QHBA 2EFHA 1R5AA 3P90A 4E8EA 3FNMA 1AO6A 2BXNA 1OYJA 1IYIA 2VCQA 4MF7A 1J7EA 4GDFA 5DJLA 5GINA 1MA9A 1GNWA 3I69A 4KSMA 2UV8G 2BXBA 5J4VA 5EVOA 2XSIA 4I97A 4GSSA 4NAXA 1U3IA 2D2ZA 1GNJA 5AIVA 2IMIA 3SIVB 3ERFA 4LMWA 4F0BA 2OT3A 17GSA 2X64A 4WR4A 1B8XA 4NHWA 1YQ1A 3H3AA 1MIVA 2OACA 4F5SA 1BJ5A 4ZBDA 4EDZA 6GSYA 1PKZA 2UZ8A 5DQFA 2BXLA 5GHKA 4N0VA 1PMTA 1HK2A 4PQIA 4GSTA 3HJOA 1BAYA 3V09A 1E7AA 4Z69A 1V2AA 3MHSB 5ECPB 3NVIA 4QQ7A 3O76A 4E68A 1JZRA 1E7CA 5G5EA 4YQUA 4F0CA 3DD3A 3ERGA 2E0YA 2DBXA 1J78A 4Q5QA 1GSQA 4N3ZA 1EV4A 1E7BA 5IIUA 1AQVA 5ECLB 4GSNA 5GSSA 3H37A 2HSMB 4ZB9A 2VCXA 5ECKB 3TOUA 1LJRA 3WYWA 3G9KD 1GSEA 5A34A 2LOQA 3LYKA 1OE7A 3VPQA 2R6KA 3EE2A 4PO0A 3U6VA 1TXUA 4BKEA 1EV9A 3FR9A 5ELAA 5A5HA 3FWCC 4GLTA 3HKRA 3GTUB 2E0XA 1TW9A 5D7GA 1PGTA 2WRTA 2C3QA 4IQ1A 1GSDA 1AXDA 4KDUA 3TOTA 1USBA 3VQIA 2XVUA 4DHXB 1N25A 3I6AA 4OR0A 1GTUA 3GQUA 3P8WA 16GSA 3VPTA 4ZB7A 4L9KA 1U87A 5B5TA 2LJRA 4ECBA 3A73A 3EINA 3LU6A 3IC8A 2BXMA 2VKZG 1G7OA 1E6BA 1E7HA 3AY8A 2BXQA 2N5FA 7GSSA 4ID0A 9GSSA 1PA3A 3VK9A 1PN9A 1O9XA 3NVKA 4N0UD 5A4WA 4N0FD 3GURA 3NMUA 1E7EA 3FRCA 3GQXA 1OKTA 2PVQA 5AISA 3F63A 4JBBA 4BL7B 3HJMA 4KF9A 4RI7A 1ZGNA 2ON5A 5F05A 3UVHA 1XWGA 2DSAA 1HK3A 2BXKA 3LJRA 4GDLB 1K0NA 3UIVA 2V36A 5ID9A 3VURA 2NTOA 2FHEA 4IW1A 3ICXA 1C72A 3VI7A 4OTUA 4GG2A 4LUHA 4Z9OA 4TQ1A 2BXAA 4G19A 3LG6A 4K0NA 1BF5A 2YV7A 1GSUA 1MTCA 4HOJA 5D9XA 5HFKA 4MP4A 4K71A 3SIUB 2WB9A 1G6YA 3N5OA 5AIXA 3FY7A 3MAKA 2Z8KA 1PL1A 1GUKA 1RK4A 3LXTA 5BMUB 3W8SA 2CAQA 4CHSA 4WA6B 4O7HA 2C3NA 2KBZA 4G0IA 1HNCA 3VWXA 3CRUA 1GNEA 2EFEA 5ELGA 2HSNB 5GZZB 4YAPA 3IBHA 4L8UA 1UORA 5F8BA 4GTUA 2JUHA 4L9QA 4OFMA 4M70B 4TQ0A 4HI7A 3TDLA 1F3BA 3M8NA 3QAVA 3F6FA 3ZMKA 1K3YA 5DALB 4OFTA 1YVLA 3LSZA 2XVVA 1K0BA 2GSRA 3QAWA 1BYEA 3F6DA 1E7FA 2BXCA 3FWBC 4HZ4A 4YQVA 3D0ZA 2DBUA 5ID7A 4BVYA 5J47A 3GSTA 1GNIA 4JEDA 4ZBKA 4KE3A 4J2FA 5DCGA 1JLVA 4K2CA 5BPKA 1F2EA 3WHQA 6GSVA 2NNWA 1GSYA 5DJMA 1IYHA 1BKEA 4LMVA 3CBUA 4MPGA 1GTAA 5DAKB 4IJIA 1SVLA 1XW5A 3GH6A 2CKXA 3BBYA 3H1NA 4DEJA 2ROHA 2XW0A 5A1NA 4PQHA 1TU8A 3G7IA 4FQUA 3VLNA 4ZBRA 4E8HA 4G0LA 2ON7A 4USSA 1Q4JA 4IBPA 5AN1A 4FJCB 1K0AA 1G6WA 3TGZA 1FOUA 1M9BA 2C8UA 6GSWA 4JZQA 2BXPA 5EY6A 5G5FA 1GWCA 4YH2A 2BX8A 4BVXA 5IJEA 1YY7A 4RI6A 3WHSA 2DYOA 2DYMA 4ACSA 5D9VA 5IFOA 4Q5NA 3KTLA 1E7GA 1PL2A 1Z9HA 3KIKA 3SQJA 1AQWA 5FUOA 3JRYA 5ECSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFE A;  2EFD A;  2EFC A;  2OT3 A;  4G01 A;  2EFH A;  1TXU A;  4N3Z A; 
#chains in the Genus database with same CATH topology
 5AGY A;  4O92 A;  4YQM A;  4PX1 A;  3ZML A;  1BG1 A;  2GSQ A;  5LCZ A;  4LB2 A;  1HNA A;  1GUM A;  1VF1 A;  2DBW A;  2HNL A;  2OAD A;  3O3T A;  2HRK B;  1MD4 A;  5J41 A;  4IW2 A;  1JLW A;  1LOT A;  5ECH B;  20GS A;  4LUF A;  2VD1 A;  5J40 A;  3PPU A;  2C4J A;  5DDL A;  5D9T A;  5GST A;  2O5V A;  2WDU A;  1U88 A;  4K0G A;  5FT3 A;  5ECI B;  1GTB A;  5F07 A;  2C80 A;  3CRT A;  2YCD A;  3LU8 A;  1KDX A;  13GS A;  4EC0 A;  4FXY P;  4EXJ A;  5J4Y A;  2DC5 A;  4ECJ A;  5J4U A;  4G9H A;  2VO4 A;  2WJU A;  2QMC A;  1JNB A;  1HK4 A;  1KXP D;  1M99 A;  5IJF A;  4HGK A;  4F5V A;  4ECI A;  5A5K A;  1K0O A;  3KM6 A;  1VFI A;  1GLP A;  5B7C A;  5JCW A;  2CAI A;  2AHE A;  2BXI A;  3CSJ A;  4ZB8 A;  2J9H A;  12GS A;  2HSM A;  1HNB A;  3MDK A;  2BXE A;  4GDX A;  4MZW A;  2BXF A;  1K3L A;  1UA5 A;  3PGT A;  2AB6 A;  4C31 B;  4PI2 C;  4W4U B;  1PKW A;  4IW9 A;  3WD6 A;  3GTU A;  4KDY A;  4MPF A;  3M0F A;  2WW1 A;  3R3E A;  4HGM B;  1Y6E A;  2GDR A;  2O3E A;  1M0U A;  1FW1 A;  1PD2 1;  3KJY A;  2XW1 A;  22GS A;  3UBL A;  2DG5 A;  3C8E A;  5ECQ B;  2XVW A;  2VD0 A;  4J2V A;  2BXD A;  2I2Z A;  5DBY A;  3W1S A;  4NHZ A;  5IQY A;  1YDK A;  4E99 A;  1AW9 A;  1F3A A;  3IR4 A;  4PI0 C;  1DUG A;  4L8E A;  1S4B P;  2EFD A;  4BY9 C;  5EL8 A;  4PUR A;  6GSS A;  4IQA A;  3ZFL A;  3LYP A;  3ZFB A;  4G04 A;  4G03 A;  2CA8 A;  1MD3 A;  1GUL A;  3QR6 A;  4ZBA A;  2GST A;  4LA0 A;  4DM0 A;  1TDI A;  5JCU A;  4YAV A;  5KEJ A;  2IMK A;  1TF0 A;  4OTT A;  2PER A;  4BL7 A;  5A34 B;  3ECP A;  2EFC A;  2R3X A;  4Q5F A;  3HMJ G;  1GSF A;  1A0F A;  2OA7 A;  1KBN A;  2VUF A;  4EDY A;  4MF6 A;  2A2R A;  4OFN A;  4F03 A;  5A5H B;  5F06 A;  1GTI A;  2HQT A;  1LBK A;  3IE3 A;  19GS A;  4IEL A;  2FNO A;  1MIW A;  2CZ3 A;  3FR6 A;  3LQ7 A;  3KMN A;  2AJE A;  4OMV A;  4JK4 A;  3B9M A;  2VCV A;  5ECR B;  2WW3 A;  5BMU A;  5GIO A;  4KDX A;  2XMO A;  3RFR C;  4D7X A;  2BXG A;  4IKH A;  5A4V A;  1VZS A;  5HOZ A;  4F5T A;  8GSS A;  2QM6 A;  1XWK A;  1XW6 A;  2OZB B;  3L0H A;  3KXO A;  4L5O A;  3Q18 A;  4L5L A;  1BX9 A;  4KX4 A;  3PLA A;  10GS A;  3ISO A;  2HSN A;  2PBJ A;  2LXT A;  1FHE A;  1GSS A;  1VF2 A;  4PXO A;  3M3M A;  4ZB6 A;  3UBK A;  1HK1 A;  1BG5 A;  4HZ2 A;  4ZBQ A;  4ZC6 A;  4ZCG A;  2A2S A;  2VCT A;  6GSX A;  3Q19 A;  1N5U A;  18GS A;  5FWG A;  5IIH A;  2GTU A;  4AGS A;  5DAL A;  2BXH A;  1SB0 A;  4G01 A;  1HQO A;  4AKH A;  4IGJ A;  3DGQ A;  1EOG A;  6GSU A;  3V03 A;  3CSI A;  3R2Q A;  2NQO A;  4IVF A;  3KJL A;  3G7J A;  3VI5 A;  1SVM A;  4PNG A;  3GUS A;  4HJ2 A;  2K0N A;  3Q74 A;  1NT2 B;  1GLQ A;  1K3O A;  4MK3 A;  1E78 A;  4EMX A;  1TU7 A;  1VF3 A;  4G0K A;  3UAP A;  4AKX B;  4NAW B;  4F5U A;  3PR8 A;  4TOP A;  5ECO B;  5F0G A;  1YKC A;  4I9O A;  4PGT A;  3CSH A;  2I30 A;  4MF5 A;  3GA9 L;  1HA2 A;  1K0M A;  2YV9 A;  4IS0 A;  5DAK A;  1AQX A;  6GST A;  1ML6 A;  5IIX A;  1ZL9 A;  2VCW A;  5ECM B;  5A4U A;  5J5N A;  4PNF A;  1E7I A;  3GSS A;  3FR3 A;  4KGI A;  2VUE A;  2VCZ A;  2HRA A;  3M1G A;  3CWG A;  3IK9 A;  2F8F A;  4GCI A;  2PMT A;  5D9W A;  3SWL A;  1VF4 A;  4KH7 A;  11GS A;  1B48 A;  4FIP B;  3V08 A;  1KW2 A;  1YJ6 A;  4LB9 A;  2V6K A;  4PUA A;  3KMO A;  4AKI A;  3M99 C;  2AAW A;  2H1L A;  3GX0 A;  5LD0 A;  3MHH B;  4QMK A;  4ZBB A;  3FYG A;  5ECN B;  3JQZ A;  2JL4 A;  5GIP A;  4MBE C;  1OE8 A;  1YEW C;  1BM0 A;  2WS2 A;  3TU3 B;  3WHR A;  4BVY B;  3NVM A;  4KAE A;  4MDC A;  1HK5 A;  1K0C A;  4FK5 B;  2R5G A;  3LU7 A;  1B4P A;  2C3T A;  1LNS A;  2Z8J A;  3RBT A;  5FHI A;  1K0D A;  4GDK B;  1N2A A;  3NIV A;  4G10 A;  3LXZ A;  4WR5 A;  1EOH A;  1H5W A;  1PX7 A;  1H9Z A;  2GSS A;  3RGB C;  2LQH A;  2CVD A;  2HRK A;  1MIY A;  2XVQ A;  3CX9 A;  4Q5R A;  4W66 A;  3LFL A;  4ECC A;  4ZXG A;  4GF0 A;  4AKG A;  14GS A;  2GLR A;  1SVO A;  2PGT A;  4ISD A;  3IK7 A;  1MUH A;  1GUH A;  5A1N B;  2BXO A;  1EEM A;  2VDB A;  1M9A A;  4EE0 A;  2Z8I A;  2R4V A;  3N9J A;  1NHY A;  3UAR A;  5IJ5 A;  2YDF A;  2LQI A;  2IL3 A;  2WVY A;  4PTS A;  4S1Y A;  1Y1U A;  3A75 A;  2WVX B;  1PX6 A;  2CZ2 A;  3QAG A;  1V40 A;  4ZUX V;  3B9L A;  5DQS A;  1IJG A;  4OT2 A;  4BVX B;  4AI6 A;  2F3M A;  5D73 A;  2QHB A;  2EFH A;  1R5A A;  3P90 A;  4E8E A;  3FNM A;  1AO6 A;  2BXN A;  1OYJ A;  1IYI A;  2VCQ A;  4MF7 A;  1J7E A;  4GDF A;  5DJL A;  5GIN A;  1MA9 A;  1GNW A;  3I69 A;  4KSM A;  2UV8 G;  2BXB A;  5J4V A;  5EVO A;  2XSI A;  4I97 A;  4GSS A;  4NAX A;  1U3I A;  2D2Z A;  1GNJ A;  5AIV A;  2IMI A;  3SIV B;  3ERF A;  4LMW A;  4F0B A;  2OT3 A;  17GS A;  2X64 A;  4WR4 A;  1B8X A;  4NHW A;  1YQ1 A;  3H3A A;  1MIV A;  2LXS A;  2OAC A;  4F5S A;  1BJ5 A;  4ZBD A;  4EDZ A;  4PHZ C;  6GSY A;  1PKZ A;  2UZ8 A;  5DQF A;  2BXL A;  5GHK A;  4N0V A;  1PMT A;  1HK2 A;  4PQI A;  4GST A;  3HJO A;  1BAY A;  3V09 A;  1E7A A;  4Z69 A;  1V2A A;  3MHS B;  5ECP B;  3NVI A;  4QQ7 A;  3O76 A;  1MM8 A;  4E68 A;  1JZR A;  1E7C A;  5G5E A;  4YQU A;  4F0C A;  3DD3 A;  3ERG A;  2E0Y A;  2DBX A;  1J78 A;  4Q5Q A;  1GSQ A;  4N3Z A;  1EV4 A;  1E7B A;  5IIU A;  1AQV A;  5ECL B;  4GSN A;  5GSS A;  3H37 A;  2HSM B;  4ZB9 A;  2VCX A;  5ECK B;  3TOU A;  1LJR A;  3WYW A;  3G9K D;  1GSE A;  5A34 A;  2LOQ A;  3LYK A;  1OE7 A;  3VPQ A;  2R6K A;  3EE2 A;  4PO0 A;  3U6V A;  1TXU A;  4BKE A;  1EV9 A;  3FR9 A;  5ELA A;  5A5H A;  3FWC C;  4GLT A;  3HKR A;  3GTU B;  2E0X A;  1TW9 A;  5D7G A;  1PGT A;  2WRT A;  2C3Q A;  4IQ1 A;  2GUT A;  1GSD A;  1AXD A;  4KDU A;  3TOT A;  1USB A;  3VQI A;  2XVU A;  4DHX B;  1N25 A;  3I6A A;  4OR0 A;  1GTU A;  3GQU A;  3P8W A;  16GS A;  3VPT A;  4ZB7 A;  4L9K A;  1U87 A;  5B5T A;  2LJR A;  4ECB A;  3A73 A;  3EIN A;  3LU6 A;  3IC8 A;  2BXM A;  2VKZ G;  1G7O A;  1E6B A;  1E7H A;  3AY8 A;  2BXQ A;  2N5F A;  7GSS A;  4ID0 A;  9GSS A;  1PA3 A;  3VK9 A;  1PN9 A;  1O9X A;  3NVK A;  4N0U D;  5A4W A;  4N0F D;  3GUR A;  3NMU A;  1E7E A;  3FRC A;  3GQX A;  1OKT A;  2PVQ A;  5AIS A;  3F63 A;  4JBB A;  4BL7 B;  3HJM A;  4KF9 A;  4RI7 A;  1ZGN A;  1I1I P;  2ON5 A;  5F05 A;  3UVH A;  1XWG A;  2DSA A;  1HK3 A;  2BXK A;  3LJR A;  4GDL B;  1K0N A;  3UIV A;  2V36 A;  5ID9 A;  3VUR A;  2NTO A;  2FHE A;  4IW1 A;  3ICX A;  3CHX C;  1C72 A;  3VI7 A;  4OTU A;  4GG2 A;  4LUH A;  4Z9O A;  4TQ1 A;  2BXA A;  4G19 A;  3LG6 A;  4K0N A;  1BF5 A;  2YV7 A;  1GSU A;  1MTC A;  4HOJ A;  5D9X A;  5HFK A;  2AGH B;  4MP4 A;  4K71 A;  3SIU B;  2WB9 A;  1G6Y A;  3N5O A;  5AIX A;  3FY7 A;  3MAK A;  2Z8K A;  1PL1 A;  1GUK A;  1RK4 A;  3LXT A;  5BMU B;  3W8S A;  2CAQ A;  4CHS A;  4WA6 B;  4O7H A;  2C3N A;  2KBZ A;  4G0I A;  1HNC A;  3VWX A;  3CRU A;  1GNE A;  3BPJ A;  2EFE A;  5ELG A;  2HSN B;  5GZZ B;  4YAP A;  3IBH A;  4L8U A;  1UOR A;  5F8B A;  4GTU A;  2JUH A;  4L9Q A;  1MUS A;  4M70 B;  4TQ0 A;  4OFM A;  4HI7 A;  3TDL A;  2O36 A;  1F3B A;  3M8N A;  3QAV A;  3F6F A;  3ZMK A;  1K3Y A;  5DAL B;  4OFT A;  1YVL A;  3LSZ A;  2XVV A;  1K0B A;  2GSR A;  3QAW A;  1BYE A;  3F6D A;  1E7F A;  2BXC A;  3FWB C;  4HZ4 A;  4YQV A;  3D0Z A;  2DBU A;  5ID7 A;  4BVY A;  5J47 A;  2KWF A;  1GNI A;  2WW0 A;  4ZBK A;  3GST A;  4JED A;  4KE3 A;  4J2F A;  5DCG A;  1JLV A;  4K2C A;  5BPK A;  1F2E A;  3WHQ A;  6GSV A;  2NNW A;  1GSY A;  5DJM A;  1IYH A;  1BKE A;  4LMV A;  3CBU A;  4MPG A;  1GTA A;  5DAK B;  4IJI A;  1SVL A;  1XW5 A;  3GH6 A;  2CKX A;  3BBY A;  3H1N A;  4DEJ A;  2ROH A;  2XW0 A;  5A1N A;  4PQH A;  1TU8 A;  3G7I A;  4FQU A;  3VLN A;  4ZBR A;  4E8H A;  4G0L A;  2ON7 A;  4USS A;  1Q4J A;  2WVX A;  4IBP A;  4FJC B;  1K0A A;  1G6W A;  5AN1 A;  3TGZ A;  1FOU A;  1M9B A;  2C8U A;  2WVZ A;  6GSW A;  4JZQ A;  2BXP A;  5EY6 A;  5G5F A;  1GWC A;  4YH2 A;  2BX8 A;  4BVX A;  5IJE A;  1YY7 A;  4RI6 A;  3WHS A;  2WW2 A;  2WZS A;  2DYO A;  2DYM A;  4ACS A;  5D9V A;  5IFO A;  4Q5N A;  3KTL A;  1E7G A;  1PL2 A;  1Z9H A;  3KIK A;  3SQJ A;  1AQW A;  5FUO A;  3JRY A;  5ECS A; 
#chains in the Genus database with same CATH homology
 5AGY A;  4O92 A;  4YQM A;  4PX1 A;  3ZML A;  1BG1 A;  2GSQ A;  5LCZ A;  4LB2 A;  1HNA A;  1GUM A;  1VF1 A;  2DBW A;  2HNL A;  2OAD A;  3O3T A;  2HRK B;  1MD4 A;  5J41 A;  4IW2 A;  1JLW A;  1LOT A;  5ECH B;  20GS A;  4LUF A;  2VD1 A;  5J40 A;  3PPU A;  2C4J A;  5DDL A;  5D9T A;  5GST A;  2O5V A;  2WDU A;  1U88 A;  4K0G A;  5FT3 A;  5ECI B;  1GTB A;  5F07 A;  2C80 A;  3CRT A;  2YCD A;  3LU8 A;  13GS A;  4EC0 A;  4EXJ A;  5J4Y A;  2DC5 A;  4ECJ A;  5J4U A;  4G9H A;  2VO4 A;  2WJU A;  2QMC A;  1JNB A;  1HK4 A;  1KXP D;  1M99 A;  5IJF A;  4HGK A;  4F5V A;  4ECI A;  5A5K A;  1K0O A;  3KM6 A;  1VFI A;  1GLP A;  5B7C A;  5JCW A;  2CAI A;  2AHE A;  2BXI A;  3CSJ A;  4ZB8 A;  2J9H A;  12GS A;  2HSM A;  1HNB A;  3MDK A;  2BXE A;  4GDX A;  4MZW A;  2BXF A;  1K3L A;  1UA5 A;  3PGT A;  2AB6 A;  4C31 B;  4W4U B;  1PKW A;  4IW9 A;  3WD6 A;  3GTU A;  4KDY A;  4MPF A;  3M0F A;  3R3E A;  4HGM B;  1Y6E A;  2GDR A;  1M0U A;  1FW1 A;  1PD2 1;  3KJY A;  2XW1 A;  22GS A;  3UBL A;  2DG5 A;  3C8E A;  5ECQ B;  2XVW A;  2VD0 A;  4J2V A;  2BXD A;  2I2Z A;  5DBY A;  3W1S A;  4NHZ A;  5IQY A;  1YDK A;  4E99 A;  1AW9 A;  1F3A A;  3IR4 A;  1DUG A;  4L8E A;  2EFD A;  4BY9 C;  5EL8 A;  4PUR A;  6GSS A;  4IQA A;  3ZFL A;  3LYP A;  3ZFB A;  4G04 A;  4G03 A;  2CA8 A;  1MD3 A;  1GUL A;  3QR6 A;  4ZBA A;  2GST A;  4LA0 A;  1TDI A;  5JCU A;  4YAV A;  5KEJ A;  2IMK A;  1TF0 A;  4OTT A;  2PER A;  4BL7 A;  5A34 B;  2EFC A;  2R3X A;  4Q5F A;  3HMJ G;  1GSF A;  1A0F A;  2OA7 A;  1KBN A;  2VUF A;  4EDY A;  4MF6 A;  2A2R A;  4OFN A;  4F03 A;  5A5H B;  5F06 A;  1GTI A;  2HQT A;  1LBK A;  3IE3 A;  19GS A;  4IEL A;  2FNO A;  1MIW A;  2CZ3 A;  3FR6 A;  3LQ7 A;  3KMN A;  2AJE A;  4OMV A;  4JK4 A;  3B9M A;  2VCV A;  5ECR B;  5BMU A;  5GIO A;  4KDX A;  2XMO A;  2BXG A;  4IKH A;  5A4V A;  1VZS A;  5HOZ A;  4F5T A;  8GSS A;  2QM6 A;  1XWK A;  1XW6 A;  2OZB B;  3L0H A;  3KXO A;  4L5O A;  3Q18 A;  4L5L A;  1BX9 A;  4KX4 A;  3PLA A;  10GS A;  3ISO A;  2HSN A;  2PBJ A;  1FHE A;  1GSS A;  1VF2 A;  4PXO A;  3M3M A;  4ZB6 A;  3UBK A;  1HK1 A;  1BG5 A;  4HZ2 A;  4ZBQ A;  4ZC6 A;  4ZCG A;  2A2S A;  2VCT A;  6GSX A;  3Q19 A;  1N5U A;  18GS A;  5FWG A;  5IIH A;  2GTU A;  4AGS A;  5DAL A;  2BXH A;  1HQO A;  4G01 A;  4AKH A;  4IGJ A;  3DGQ A;  1EOG A;  6GSU A;  3V03 A;  3CSI A;  3R2Q A;  2NQO A;  4IVF A;  3KJL A;  3G7J A;  3VI5 A;  1SVM A;  4PNG A;  3GUS A;  4HJ2 A;  3Q74 A;  1NT2 B;  1GLQ A;  1K3O A;  4MK3 A;  1E78 A;  4EMX A;  1TU7 A;  1VF3 A;  4G0K A;  3UAP A;  4AKX B;  4NAW B;  4F5U A;  3PR8 A;  4TOP A;  5ECO B;  5F0G A;  1YKC A;  4PGT A;  3CSH A;  2I30 A;  4MF5 A;  3GA9 L;  1HA2 A;  1K0M A;  2YV9 A;  4IS0 A;  5DAK A;  1AQX A;  6GST A;  1ML6 A;  5IIX A;  1ZL9 A;  2VCW A;  5ECM B;  5A4U A;  5J5N A;  4PNF A;  1E7I A;  3GSS A;  3FR3 A;  4KGI A;  2VUE A;  2VCZ A;  2HRA A;  3M1G A;  3CWG A;  3IK9 A;  2F8F A;  4GCI A;  2PMT A;  5D9W A;  3SWL A;  1VF4 A;  4KH7 A;  11GS A;  1B48 A;  4FIP B;  3V08 A;  1KW2 A;  1YJ6 A;  4LB9 A;  2V6K A;  4PUA A;  3KMO A;  4AKI A;  3M99 C;  2AAW A;  2H1L A;  3GX0 A;  5LD0 A;  3MHH B;  4QMK A;  4ZBB A;  3FYG A;  5ECN B;  3JQZ A;  2JL4 A;  5GIP A;  4MBE C;  1OE8 A;  1BM0 A;  2WS2 A;  3TU3 B;  3WHR A;  4BVY B;  3NVM A;  4KAE A;  4MDC A;  1HK5 A;  1K0C A;  4FK5 B;  2R5G A;  3LU7 A;  1B4P A;  2C3T A;  1LNS A;  2Z8J A;  3RBT A;  5FHI A;  1K0D A;  4GDK B;  1N2A A;  3NIV A;  4G10 A;  3LXZ A;  4WR5 A;  1EOH A;  1H5W A;  1PX7 A;  1H9Z A;  2GSS A;  2CVD A;  2HRK A;  1MIY A;  2XVQ A;  3CX9 A;  4Q5R A;  4W66 A;  3LFL A;  4ECC A;  4ZXG A;  4GF0 A;  4AKG A;  14GS A;  2GLR A;  1SVO A;  2PGT A;  4ISD A;  3IK7 A;  1GUH A;  5A1N B;  2BXO A;  1EEM A;  2VDB A;  1M9A A;  4EE0 A;  2Z8I A;  2R4V A;  3N9J A;  1NHY A;  3UAR A;  5IJ5 A;  2YDF A;  2IL3 A;  4PTS A;  4S1Y A;  1Y1U A;  3A75 A;  1PX6 A;  2CZ2 A;  3QAG A;  1V40 A;  4ZUX V;  3B9L A;  5DQS A;  1IJG A;  4OT2 A;  4BVX B;  4AI6 A;  2F3M A;  5D73 A;  2QHB A;  2EFH A;  1R5A A;  3P90 A;  4E8E A;  3FNM A;  1AO6 A;  2BXN A;  1OYJ A;  1IYI A;  2VCQ A;  4MF7 A;  1J7E A;  4GDF A;  5DJL A;  5GIN A;  1MA9 A;  1GNW A;  3I69 A;  4KSM A;  2UV8 G;  2BXB A;  5J4V A;  5EVO A;  2XSI A;  4I97 A;  4GSS A;  4NAX A;  1U3I A;  2D2Z A;  1GNJ A;  5AIV A;  2IMI A;  3SIV B;  3ERF A;  4LMW A;  4F0B A;  2OT3 A;  17GS A;  2X64 A;  4WR4 A;  1B8X A;  4NHW A;  1YQ1 A;  3H3A A;  1MIV A;  2OAC A;  4F5S A;  1BJ5 A;  4ZBD A;  4EDZ A;  6GSY A;  1PKZ A;  2UZ8 A;  5DQF A;  2BXL A;  5GHK A;  4N0V A;  1PMT A;  1HK2 A;  4PQI A;  4GST A;  3HJO A;  1BAY A;  3V09 A;  1E7A A;  4Z69 A;  1V2A A;  3MHS B;  5ECP B;  3NVI A;  4QQ7 A;  3O76 A;  4E68 A;  1JZR A;  1E7C A;  5G5E A;  4YQU A;  4F0C A;  3DD3 A;  3ERG A;  2E0Y A;  2DBX A;  1J78 A;  4Q5Q A;  1GSQ A;  4N3Z A;  1EV4 A;  1E7B A;  5IIU A;  1AQV A;  5ECL B;  4GSN A;  5GSS A;  3H37 A;  2HSM B;  4ZB9 A;  2VCX A;  5ECK B;  3TOU A;  1LJR A;  3WYW A;  3G9K D;  1GSE A;  5A34 A;  2LOQ A;  3LYK A;  1OE7 A;  3VPQ A;  2R6K A;  3EE2 A;  4PO0 A;  3U6V A;  1TXU A;  4BKE A;  1EV9 A;  3FR9 A;  5ELA A;  5A5H A;  3FWC C;  4GLT A;  3HKR A;  3GTU B;  2E0X A;  1TW9 A;  5D7G A;  1PGT A;  2WRT A;  2C3Q A;  4IQ1 A;  1GSD A;  1AXD A;  4KDU A;  3TOT A;  1USB A;  3VQI A;  2XVU A;  4DHX B;  1N25 A;  3I6A A;  4OR0 A;  1GTU A;  3GQU A;  3P8W A;  16GS A;  3VPT A;  4ZB7 A;  4L9K A;  1U87 A;  5B5T A;  2LJR A;  4ECB A;  3A73 A;  3EIN A;  3LU6 A;  3IC8 A;  2BXM A;  2VKZ G;  1G7O A;  1E6B A;  1E7H A;  3AY8 A;  2BXQ A;  2N5F A;  7GSS A;  4ID0 A;  9GSS A;  1PA3 A;  3VK9 A;  1PN9 A;  1O9X A;  3NVK A;  4N0U D;  5A4W A;  4N0F D;  3GUR A;  3NMU A;  1E7E A;  3FRC A;  3GQX A;  1OKT A;  2PVQ A;  5AIS A;  3F63 A;  4JBB A;  4BL7 B;  3HJM A;  4KF9 A;  4RI7 A;  1ZGN A;  2ON5 A;  5F05 A;  3UVH A;  1XWG A;  2DSA A;  1HK3 A;  2BXK A;  3LJR A;  4GDL B;  1K0N A;  3UIV A;  2V36 A;  5ID9 A;  3VUR A;  2NTO A;  2FHE A;  4IW1 A;  3ICX A;  1C72 A;  3VI7 A;  4OTU A;  4GG2 A;  4LUH A;  4Z9O A;  4TQ1 A;  2BXA A;  4G19 A;  3LG6 A;  4K0N A;  1BF5 A;  2YV7 A;  1GSU A;  1MTC A;  4HOJ A;  5D9X A;  5HFK A;  4MP4 A;  4K71 A;  3SIU B;  2WB9 A;  1G6Y A;  3N5O A;  5AIX A;  3FY7 A;  3MAK A;  2Z8K A;  1PL1 A;  1GUK A;  1RK4 A;  3LXT A;  5BMU B;  3W8S A;  2CAQ A;  4CHS A;  4WA6 B;  4O7H A;  2C3N A;  2KBZ A;  4G0I A;  1HNC A;  3VWX A;  3CRU A;  1GNE A;  2EFE A;  5ELG A;  2HSN B;  5GZZ B;  4YAP A;  3IBH A;  4L8U A;  1UOR A;  5F8B A;  4GTU A;  2JUH A;  4L9Q A;  4OFM A;  4M70 B;  4TQ0 A;  4HI7 A;  3TDL A;  1F3B A;  3M8N A;  3QAV A;  3F6F A;  3ZMK A;  1K3Y A;  5DAL B;  4OFT A;  1YVL A;  3LSZ A;  2XVV A;  1K0B A;  2GSR A;  3QAW A;  1BYE A;  3F6D A;  1E7F A;  2BXC A;  3FWB C;  4HZ4 A;  4YQV A;  3D0Z A;  2DBU A;  5ID7 A;  4BVY A;  5J47 A;  3GST A;  1GNI A;  4JED A;  4ZBK A;  4KE3 A;  4J2F A;  5DCG A;  1JLV A;  4K2C A;  5BPK A;  1F2E A;  3WHQ A;  6GSV A;  2NNW A;  1GSY A;  5DJM A;  1IYH A;  1BKE A;  4LMV A;  3CBU A;  4MPG A;  1GTA A;  5DAK B;  4IJI A;  1SVL A;  1XW5 A;  3GH6 A;  2CKX A;  3BBY A;  3H1N A;  4DEJ A;  2ROH A;  2XW0 A;  5A1N A;  4PQH A;  1TU8 A;  3G7I A;  4FQU A;  3VLN A;  4ZBR A;  4E8H A;  4G0L A;  2ON7 A;  4USS A;  1Q4J A;  4IBP A;  5AN1 A;  4FJC B;  1K0A A;  1G6W A;  3TGZ A;  1FOU A;  1M9B A;  2C8U A;  6GSW A;  4JZQ A;  2BXP A;  5EY6 A;  5G5F A;  1GWC A;  4YH2 A;  2BX8 A;  4BVX A;  5IJE A;  1YY7 A;  4RI6 A;  3WHS A;  2DYO A;  2DYM A;  4ACS A;  5D9V A;  5IFO A;  4Q5N A;  3KTL A;  1E7G A;  1PL2 A;  1Z9H A;  3KIK A;  3SQJ A;  1AQW A;  5FUO A;  3JRY A;  5ECS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...