2EFEA

Ara7-gdpnh2/atvps9a
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
246
structure length
246
Chain Sequence
MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 98
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efeA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efeA02
1TXUA 2EFEA 2EFCA 4N3ZA 2OT3A 2EFDA 4G01A 2EFHA
chains in the Genus database with same CATH superfamily
1TXUA 2A2SA 5FWGA 2EFCA 12GSA 1K0MA 4PI2C 3I6AA 3RBTA 5HOZA 3O3TA 2BXAA 3VURA 2FNOA 3WYWA 1B48A 5D73A 3CX9A 2R5GA 3M99C 1K0NA 5IJ5A 3P8WA 4ID0A 2BXOA 2BXLA 3CHXC 5ID9A 1GTIA 3FYGA 4TOPA 2VUFA 2Z8KA 2BXIA 5AGYA 4J2VA 4RI7A 2LQIA 4G03A 5AIXA 2GUTA 4ZB6A 4ACSA 3G7JA 3LU8A 1E7HA 2AGHB 1U3IA 1LNSA 4EXJA 3HMJG 4OFNA 4C31B 1PX7A 1ZGNA 3FY7A 4AI6A 3CSIA 2H1LA 2I30A 1NHYA 3M3MA 1ZL9A 4N3ZA 2WDUA 5IIHA 2E0YA 2JUHA 3ERGA 3QAVA 4FXYP 1SVOA 5EVOA 4AKHA 1OE7A 5DALA 5AN1A 1GSSA 4LUFA 1K0OA 5GIPA 1SVLA 4PGTA 18GSA 3LJRA 4GDKB 4OMVA 1PD21 5GSTA 2XVVA 3LU6A 4EE0A 1VFIA 2IL3A 4MF5A 1Y1UA 4EDZA 1YVLA 3LG6A 2PVQA 3ERFA 5BMUA 3B9LA 2LJRA 4O92A 1KDXA 2DBUA 1K3YA 1EOGA 4MK3A 4YQUA 4PNGA 2K0NA 2WW1A 3EINA 3H3AA 5F05A 4MZWA 1GTAA 3TU3B 3B9MA 1TW9A 2GLRA 3GH6A 2WVXB 3WHSA 4CHSA 1E7GA 2LXTA 3LYPA 1TF0A 5DQFA 1USBA 2HSMB 1PKZA 4BVXB 2AB6A 4YAVA 2VCTA 3CWGA 3SIVB 1XWGA 3JQZA 2O5VA 1VZSA 4Q5NA 3V08A 2Z8JA 3VLNA 5JCUA 2EFDA 1Z9HA 4W4UB 4ZBAA 4BKEA 4LB9A 2QHBA 1YY7A 2BXCA 1GTBA 5ECIB 3ZFBA 4GSNA 1R5AA 1HNCA 4IELA 5DAKA 1HK2A 3UIVA 4I97A 4YQMA 3MHSB 1PKWA 4MPFA 1JNBA 1GSYA 4HI7A 6GSYA 10GSA 1G6WA 1FHEA 2GTUA 4N0UD 20GSA 2F8FA 4PNFA 3W8SA 2VD0A 4F0CA 2DBXA 5ECSA 3NVKA 4O7HA 1IJGA 2XSIA 3M0FA 3M8NA 5A34A 8GSSA 2KBZA 1LBKA 4LA0A 4N0VA 1PL1A 3UARA 1SB0A 3TOTA 5IQYA 4ZBKA 22GSA 1M9BA 4GDLB 3P90A 4WR4A 2R3XA 4F0BA 4HGKA 3SIUB 2YCDA 4IGJA 3ZFLA 4IW2A 3GQXA 4JK4A 17GSA 3MHHB 3U6VA 4DEJA 4NHWA 3VQIA 5ECOB 1J78A 1VF3A 1PGTA 2VCWA 5ELGA 3G7IA 4MP4A 2OACA 1E6BA 1GSFA 3IE3A 5ECKB 3FR3A 3Q19A 2O36A 2C80A 3H1NA 1KXPD 1RK4A 3W1SA 2A2RA 3KXOA 4OFTA 5IJFA 2IMIA 5A4VA 1GSQA 4PQIA 3KTLA 4OTUA 1PX6A 3D0ZA 3KJYA 3MAKA 1E7IA 2NNWA 5GHKA 1B8XA 5D7GA 1VF2A 5J47A 1F2EA 2DSAA 2E0XA 1GUKA 5BPKA 2WVYA 4G01A 3KM6A 3NMUA 2YV7A 4KF9A 2I2ZA 3ICXA 1PN9A 14GSA 4E8HA 4ECCA 4G9HA 1MIVA 5A1NA 4MPGA 4LMWA 1G7OA 4AGSA 2VDBA 1GUMA 3GTUA 3A73A 6GSWA 4S1YA 3DGQA 1GNIA 4KH7A 4DM0A 4MBEC 1PA3A 1KBNA 1N25A 5J41A 2DG5A 1LOTA 3CRUA 2ROHA 4GF0A 4L8UA 2BXEA 5A5HB 4L9QA 2PERA 2OT3A 2BXQA 2QMCA 5ECNB 2XMOA 5FHIA 2KWFA 3KMOA 4BL7A 1FOUA 1AO6A 1GNJA 1YDKA 1EEMA 3TGZA 4F5SA 6GSSA 3F63A 4IVFA 2BX8A 2BXNA 4N0FD 2YV9A 1E7FA 3N5OA 1M99A 5KEJA 5IIUA 1M0UA 2BXHA 3QAGA 5A4WA 2HRAA 3LXTA 1UORA 4ISDA 1EV4A 3CBUA 4BVYA 2BXPA 2WW2A 3RFRC 6GSTA 4OR0A 5IFOA 4F5UA 1BX9A 4KDYA 1BG1A 4GG2A 2JL4A 2WB9A 3M1GA 3JRYA 3PR8A 1AQWA 4GDXA 2XW0A 2VCZA 2X64A 3VK9A 3ZMLA 4AKXB 16GSA 3ZMKA 4ZB8A 4YQVA 1MUSA 4G10A 5F8BA 4ZCGA 2WS2A 2OA7A 3LXZA 4LB2A 1BYEA 1BM0A 3F6FA 1HK1A 4K0NA 4JZQA 4MDCA 4ZXGA 6GSUA 5A4UA 2WZSA 1E7CA 2V36A 2FHEA 3I69A 4KGIA 1U88A 5J4YA 2NTOA 1E78A 4KE3A 7GSSA 4G0IA 6GSVA 4PURA 3KMNA 3O76A 2UV8G 4GSSA 3LYKA 4KDXA 4KX4A 5DALB 4ECIA 4IJIA 2C4JA 1MM8A 4MF6A 2HRKA 3SWLA 1C72A 2AAWA 4PXOA 1H9ZA 1EV9A 5GSSA 4TQ0A 1F3BA 1GNEA 1B4PA 1K0CA 4GSTA 1MA9A 3LQ7A 5G5FA 4Z69A 5IIXA 3C8EA 4ECJA 1NT2B 2PGTA 1DUGA 1GWCA 4HZ2A 1MIYA 4L8EA 1E7EA 5BMUB 1E7BA 2XVQA 4NAXA 2XW1A 1V2AA 4PQHA 3PPUA 2DYOA 4HGMB 2D2ZA 5ECHB 2CAIA 3V09A 2HSNA 2HQTA 2PBJA 4PUAA 5GINA 4YAPA 5G5EA 1IYHA 1BG5A 2WW3A 2F3MA 2XVUA 1BKEA 4ZC6A 2VO4A 4G0KA 2VCXA 3GSSA 3DD3A 4PO0A 3GSTA 5DBYA 3IK9A 1TU7A 3IBHA 1H5WA 3CSJA 4GLTA 3HJMA 5F0GA 1GLQA 1V40A 1O9XA 1AQVA 4E8EA 3FRCA 4PHZC 6GSXA 2OADA 4IQ1A 1YEWC 4GCIA 4Q5QA 3ISOA 1BJ5A 2CA8A 4JEDA 3KJLA 5D9WA 1LJRA 1IYIA 5DAKB 1K0AA 3UAPA 2ON5A 3WD6A 4LUHA 3FNMA 2LOQA 4QMKA 1E7AA 3TDLA 2V6KA 3R3EA 3FWCC 4IW9A 4FJCB 4PTSA 3H37A 4K71A 4JBBA 1GSUA 2EFHA 3SQJA 5EL8A 4Q5RA 5A34B 1M9AA 2GDRA 1GULA 4J2FA 3UBLA 1KW2A 1JLWA 3RGBC 2VCQA 5J4UA 4Q5FA 3IK7A 3WHRA 4IW1A 2O3EA 3FR9A 3F6DA 3GQUA 3EE2A 5LD0A 5ECLB 4BY9C 5A5KA 3VPTA 2CVDA 5GZZB 1AW9A 4E68A 2LQHA 2PMTA 2CZ2A 4TQ1A 5D9TA 2CKXA 1GTUA 5FT3A 4IKHA 3L0HA 1J7EA 1TDIA 3FR6A 2ON7A 1I1IP 2GSTA 3VI7A 4ZBQA 4WA6B 3QR6A 3BBYA 4ECBA 2BXGA 3VWXA 3PLAA 4D7XA 2IMKA 2NQOA 3IC8A 4USSA 4PX1A 3VI5A 5J40A 1PMTA 1HA2A 3G9KD 5DJMA 2WVXA 1TU8A 2UZ8A 3GA9L 2VCVA 2CZ3A 3ECPA 1YKCA 2AHEA 2GSSA 4ZUXV 4LMVA 1BF5A 2HSMA 4BVXA 1YQ1A 3TOUA 3HKRA 2WW0A 5IJEA 5F07A 1BAYA 4ZBDA 4NAWB 1G6YA 4M70B 1GSDA 4ZBBA 2BXFA 5A1NB 4ZBRA 4EMXA 1Y6EA 4KAEA 4AKGA 3BPJA 4OTTA 3GTUB 2QM6A 5B5TA 1GLPA 1HNAA 5DDLA 1PL2A 4HOJA 1N2AA 4ZB9A 4OT2A 4F5TA 1AXDA 1JLVA 3R2QA 1MD3A 11GSA 4F5VA 1Q4JA 2OZBB 3GUSA 3LSZA 3LFLA 4Z9OA 2R6KA 1K3OA 3HJOA 2DYMA 1K3LA 1OYJA 4BL7B 4AKIA 3N9JA 4G04A 4MF7A 19GSA 1HQOA 5AIVA 3FWBC 3NIVA 1MTCA 4HJ2A 2WRTA 5LCZA 1HK4A 5D9XA 1JZRA 5ID7A 1A0FA 2N5FA 5DCGA 1K0DA 4E99A 4KDUA 4L5OA 4BVYB 1K0BA 3Q74A 2BXDA 2BXKA 1U87A 3PGTA 13GSA 5ECMB 3NVMA 4FK5B 4FIPB 2C3NA 2BXBA 1MIWA 5DQSA 4GDFA 5GIOA 1XWKA 5JCWA 2DBWA 1MD4A 3MDKA 4QQ7A 4F03A 4DHXB 1HK5A 4I9OA 2AJEA 2VD1A 3WHQA 5FUOA 5J5NA 5J4VA 3V03A 5ELAA 2C3TA 4OFMA 3VPQA 1FW1A 1XW5A 4RI6A 4K2CA 5HFKA 4EC0A 3KIKA 2EFEA 4L9KA 2LXSA 3GX0A 2HNLA 2J9HA 3A75A 1GSEA 1XW6A 1MUHA 5DJLA 1VF1A 4PI0C 4IQAA 2Z8IA 1SVMA 2WJUA 1EOHA 1GUHA 2HRKB 1S4BP 2BXMA 5ECRB 3GURA 2VKZG 1AQXA 5F06A 3LU7A 1YJ6A 5EY6A 4HZ4A 4L5LA 2VUEA 4W66A 4WR5A 4IS0A 9GSSA 2GSQA 1F3AA 2GSRA 5AISA 2WVZA 4IBPA 3UVHA 5B7CA 4K0GA 1N5UA 1VF4A 3UBKA 1ML6A 2HSNB 1GNWA 1HK3A 2C3QA 1UA5A 3CSHA 2R4VA 2DC5A 4ZB7A 5A5HA 3AY8A 3CRTA 4EDYA 3QAWA 4GTUA 4G19A 4YH2A 1HNBA 5ECPB 3Q18A 5D9VA 1OE8A 1OKTA 4FQUA 2YDFA 3NVIA 4G0LA 5ECQB 4KSMA 3IR4A 2C8UA 2CAQA 4NHZA 2XVWA
chains in the Genus database with same CATH topology
1TXUA 2A2SA 5FWGA 2EFCA 12GSA 1K0MA 3I6AA 3RBTA 5HOZA 3O3TA 2BXAA 3VURA 2FNOA 3WYWA 1B48A 5D73A 3CX9A 2R5GA 3M99C 1K0NA 5IJ5A 3P8WA 4ID0A 2BXOA 2BXLA 5ID9A 1GTIA 3FYGA 4TOPA 2VUFA 2Z8KA 2BXIA 5AGYA 4J2VA 4RI7A 4G03A 5AIXA 4ZB6A 4ACSA 3G7JA 3LU8A 1E7HA 1U3IA 1LNSA 4EXJA 3HMJG 4OFNA 4C31B 1PX7A 1ZGNA 3FY7A 4AI6A 3CSIA 2H1LA 2I30A 1NHYA 3M3MA 1ZL9A 4N3ZA 2WDUA 5IIHA 2E0YA 2JUHA 3ERGA 3QAVA 5EVOA 1SVOA 4AKHA 1OE7A 5DALA 5AN1A 1GSSA 4LUFA 1K0OA 5GIPA 1SVLA 4PGTA 18GSA 3LJRA 4GDKB 4OMVA 1PD21 5GSTA 2XVVA 3LU6A 4EE0A 1VFIA 2IL3A 4MF5A 1Y1UA 4EDZA 1YVLA 3LG6A 2PVQA 3ERFA 5BMUA 3B9LA 2LJRA 4O92A 2DBUA 1K3YA 1EOGA 4MK3A 4YQUA 4PNGA 3EINA 3H3AA 5F05A 4MZWA 1GTAA 3TU3B 3B9MA 1TW9A 2GLRA 3GH6A 3WHSA 4CHSA 1E7GA 3LYPA 1TF0A 5DQFA 1USBA 2HSMB 1PKZA 4BVXB 2AB6A 4YAVA 2VCTA 3CWGA 3SIVB 1XWGA 3JQZA 2O5VA 1VZSA 4Q5NA 3V08A 2Z8JA 3VLNA 5JCUA 2EFDA 1Z9HA 4W4UB 4ZBAA 4BKEA 4LB9A 2QHBA 1YY7A 2BXCA 1GTBA 5ECIB 3ZFBA 4GSNA 1R5AA 1HNCA 4IELA 5DAKA 1HK2A 3UIVA 4I97A 4YQMA 3MHSB 1PKWA 4MPFA 1JNBA 1GSYA 4HI7A 6GSYA 10GSA 1G6WA 1FHEA 2GTUA 4N0UD 20GSA 2F8FA 4PNFA 3W8SA 2VD0A 4F0CA 2DBXA 5ECSA 3NVKA 4O7HA 1IJGA 2XSIA 3M0FA 3M8NA 5A34A 8GSSA 2KBZA 1LBKA 4LA0A 4N0VA 1PL1A 3UARA 3TOTA 5IQYA 4ZBKA 22GSA 1M9BA 4GDLB 3P90A 4WR4A 2R3XA 4F0BA 4HGKA 3SIUB 2YCDA 4IGJA 3ZFLA 4IW2A 3GQXA 4JK4A 17GSA 3MHHB 3U6VA 4DEJA 4NHWA 3VQIA 5ECOB 1J78A 1VF3A 1PGTA 2VCWA 5ELGA 3G7IA 4MP4A 2OACA 1E6BA 1GSFA 3IE3A 5ECKB 3FR3A 3Q19A 2C80A 3H1NA 1KXPD 1RK4A 3W1SA 2A2RA 3KXOA 4OFTA 5IJFA 2IMIA 5A4VA 1GSQA 4PQIA 3KTLA 4OTUA 1PX6A 3D0ZA 3KJYA 3MAKA 1E7IA 2NNWA 5GHKA 1B8XA 5D7GA 1VF2A 5J47A 1F2EA 2DSAA 2E0XA 1GUKA 5BPKA 4G01A 3KM6A 3NMUA 2YV7A 4KF9A 2I2ZA 3ICXA 1PN9A 14GSA 4E8HA 4ECCA 4G9HA 1MIVA 5A1NA 4MPGA 4LMWA 1G7OA 4AGSA 2VDBA 1GUMA 3GTUA 3A73A 6GSWA 4S1YA 3DGQA 1GNIA 4KH7A 4MBEC 1PA3A 1KBNA 1N25A 5J41A 2DG5A 1LOTA 3CRUA 2ROHA 4GF0A 4L8UA 2BXEA 5A5HB 4L9QA 2PERA 2OT3A 2BXQA 2QMCA 5ECNB 2XMOA 5FHIA 4BL7A 3KMOA 1FOUA 1AO6A 1GNJA 1YDKA 1EEMA 3TGZA 4F5SA 6GSSA 3F63A 4IVFA 2BX8A 2BXNA 4N0FD 2YV9A 1E7FA 3N5OA 1M99A 5KEJA 5IIUA 1M0UA 2BXHA 3QAGA 5A4WA 2HRAA 3LXTA 1UORA 4ISDA 1EV4A 3CBUA 4BVYA 2BXPA 6GSTA 4OR0A 5IFOA 4F5UA 1BX9A 4KDYA 1BG1A 4GG2A 2JL4A 2WB9A 3M1GA 3JRYA 3PR8A 1AQWA 4GDXA 2XW0A 2VCZA 2X64A 3VK9A 3ZMLA 4AKXB 16GSA 3ZMKA 4ZB8A 4YQVA 4G10A 5F8BA 4ZCGA 2WS2A 2OA7A 3LXZA 4LB2A 1BYEA 1BM0A 3F6FA 1HK1A 4K0NA 4JZQA 4MDCA 4ZXGA 6GSUA 5A4UA 1E7CA 2V36A 2FHEA 3I69A 4KGIA 1U88A 5J4YA 2NTOA 1E78A 4KE3A 7GSSA 4G0IA 6GSVA 4PURA 3KMNA 3O76A 2UV8G 4GSSA 3LYKA 4KDXA 4KX4A 5DALB 4ECIA 4IJIA 2C4JA 4MF6A 2HRKA 3SWLA 1C72A 2AAWA 4PXOA 1H9ZA 1EV9A 5GSSA 4TQ0A 1F3BA 1GNEA 1B4PA 1K0CA 4GSTA 1MA9A 3LQ7A 5G5FA 4Z69A 5IIXA 3C8EA 4ECJA 1NT2B 2PGTA 1DUGA 1GWCA 4HZ2A 1MIYA 4L8EA 1E7EA 5BMUB 1E7BA 2XVQA 4NAXA 2XW1A 1V2AA 4PQHA 3PPUA 2DYOA 4HGMB 2D2ZA 5ECHB 2CAIA 3V09A 2HSNA 2HQTA 2PBJA 4PUAA 5GINA 4YAPA 5G5EA 1IYHA 1BG5A 2F3MA 2XVUA 1BKEA 4ZC6A 2VO4A 4G0KA 2VCXA 3GSSA 3DD3A 4PO0A 3GSTA 5DBYA 3IK9A 1TU7A 3IBHA 1H5WA 3CSJA 4GLTA 3HJMA 5F0GA 1GLQA 1V40A 1O9XA 1AQVA 4E8EA 3FRCA 6GSXA 2OADA 4IQ1A 4GCIA 4Q5QA 3ISOA 1BJ5A 2CA8A 4JEDA 3KJLA 5D9WA 1LJRA 1IYIA 5DAKB 1K0AA 3UAPA 2ON5A 3WD6A 4LUHA 3FNMA 2LOQA 4QMKA 1E7AA 3TDLA 2V6KA 3R3EA 3FWCC 4IW9A 4FJCB 4PTSA 3H37A 4K71A 4JBBA 1GSUA 2EFHA 3SQJA 5EL8A 4Q5RA 5A34B 1M9AA 2GDRA 1GULA 4J2FA 3UBLA 1KW2A 1JLWA 2VCQA 5J4UA 4Q5FA 3IK7A 3WHRA 4IW1A 3FR9A 3F6DA 3GQUA 3EE2A 5LD0A 5ECLB 4BY9C 5A5KA 3VPTA 2CVDA 5GZZB 1AW9A 4E68A 2PMTA 2CZ2A 4TQ1A 5D9TA 2CKXA 1GTUA 5FT3A 4IKHA 3L0HA 1J7EA 1TDIA 3FR6A 2ON7A 3VI7A 2GSTA 4ZBQA 4WA6B 3QR6A 3BBYA 4ECBA 2BXGA 3VWXA 3PLAA 2IMKA 2NQOA 3IC8A 4USSA 4PX1A 3VI5A 5J40A 1PMTA 1HA2A 3G9KD 5DJMA 1TU8A 2UZ8A 3GA9L 2VCVA 2CZ3A 1YKCA 2AHEA 2GSSA 4ZUXV 4LMVA 1BF5A 2HSMA 4BVXA 1YQ1A 3TOUA 3HKRA 5IJEA 5F07A 1BAYA 4ZBDA 4NAWB 1G6YA 4M70B 1GSDA 4ZBBA 2BXFA 5A1NB 4ZBRA 4EMXA 1Y6EA 4KAEA 4AKGA 4OTTA 3GTUB 2QM6A 5B5TA 1GLPA 1HNAA 5DDLA 1PL2A 4HOJA 1N2AA 4ZB9A 4OT2A 4F5TA 1AXDA 1JLVA 3R2QA 1MD3A 11GSA 4F5VA 1Q4JA 2OZBB 3GUSA 3LSZA 3LFLA 4Z9OA 2R6KA 1K3OA 3HJOA 2DYMA 1K3LA 1OYJA 4BL7B 4AKIA 3N9JA 4G04A 4MF7A 19GSA 1HQOA 5AIVA 3FWBC 3NIVA 1MTCA 4HJ2A 2WRTA 5LCZA 1HK4A 5D9XA 1JZRA 5ID7A 1A0FA 2N5FA 5DCGA 1K0DA 4E99A 4KDUA 4L5OA 4BVYB 1K0BA 3Q74A 2BXDA 2BXKA 1U87A 3PGTA 13GSA 5ECMB 3NVMA 4FK5B 4FIPB 2C3NA 2BXBA 1MIWA 5DQSA 4GDFA 5GIOA 1XWKA 5JCWA 2DBWA 1MD4A 3MDKA 4QQ7A 4F03A 4DHXB 1HK5A 2AJEA 2VD1A 3WHQA 5FUOA 5J5NA 5J4VA 3V03A 5ELAA 2C3TA 4OFMA 3VPQA 1FW1A 1XW5A 4RI6A 4K2CA 5HFKA 4EC0A 3KIKA 2EFEA 4L9KA 3GX0A 2HNLA 2J9HA 3A75A 1GSEA 1XW6A 5DJLA 1VF1A 4IQAA 2Z8IA 1SVMA 2WJUA 1EOHA 1GUHA 2HRKB 2BXMA 5ECRB 3GURA 2VKZG 1AQXA 5F06A 3LU7A 1YJ6A 5EY6A 4HZ4A 4L5LA 2VUEA 4W66A 4WR5A 4IS0A 9GSSA 2GSQA 1F3AA 2GSRA 5AISA 4IBPA 3UVHA 5B7CA 4K0GA 1N5UA 1VF4A 3UBKA 1ML6A 2HSNB 1GNWA 1HK3A 2C3QA 1UA5A 3CSHA 2R4VA 2DC5A 4ZB7A 5A5HA 3AY8A 3CRTA 4EDYA 3QAWA 4GTUA 4G19A 4YH2A 1HNBA 5ECPB 3Q18A 5D9VA 1OE8A 1OKTA 4FQUA 2YDFA 3NVIA 4G0LA 5ECQB 4KSMA 3IR4A 2C8UA 2CAQA 4NHZA 2XVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXU A;  2EFE A;  2EFC A;  4N3Z A;  2OT3 A;  2EFD A;  4G01 A;  2EFH A; 
#chains in the Genus database with same CATH topology
 1TXU A;  2A2S A;  5FWG A;  2EFC A;  12GS A;  1K0M A;  4PI2 C;  3I6A A;  3RBT A;  5HOZ A;  3O3T A;  2BXA A;  3VUR A;  2FNO A;  3WYW A;  1B48 A;  5D73 A;  3CX9 A;  2R5G A;  3M99 C;  1K0N A;  5IJ5 A;  3P8W A;  4ID0 A;  2BXO A;  2BXL A;  3CHX C;  5ID9 A;  1GTI A;  3FYG A;  4TOP A;  2VUF A;  2Z8K A;  2BXI A;  5AGY A;  4J2V A;  4RI7 A;  2LQI A;  4G03 A;  5AIX A;  2GUT A;  4ZB6 A;  4ACS A;  3G7J A;  3LU8 A;  1E7H A;  2AGH B;  1U3I A;  1LNS A;  4EXJ A;  3HMJ G;  4OFN A;  4C31 B;  1PX7 A;  1ZGN A;  3FY7 A;  4AI6 A;  3CSI A;  2H1L A;  2I30 A;  1NHY A;  3M3M A;  1ZL9 A;  4N3Z A;  2WDU A;  5IIH A;  2E0Y A;  2JUH A;  3ERG A;  3QAV A;  4FXY P;  1SVO A;  5EVO A;  4AKH A;  1OE7 A;  5DAL A;  5AN1 A;  1GSS A;  4LUF A;  1K0O A;  5GIP A;  1SVL A;  4PGT A;  18GS A;  3LJR A;  4GDK B;  4OMV A;  1PD2 1;  5GST A;  2XVV A;  3LU6 A;  4EE0 A;  1VFI A;  2IL3 A;  4MF5 A;  1Y1U A;  4EDZ A;  1YVL A;  3LG6 A;  2PVQ A;  3ERF A;  5BMU A;  3B9L A;  2LJR A;  4O92 A;  1KDX A;  2DBU A;  1K3Y A;  1EOG A;  4MK3 A;  4YQU A;  4PNG A;  2K0N A;  2WW1 A;  3EIN A;  3H3A A;  5F05 A;  4MZW A;  1GTA A;  3TU3 B;  3B9M A;  1TW9 A;  2GLR A;  3GH6 A;  2WVX B;  3WHS A;  4CHS A;  1E7G A;  2LXT A;  3LYP A;  1TF0 A;  5DQF A;  1USB A;  2HSM B;  1PKZ A;  4BVX B;  2AB6 A;  4YAV A;  2VCT A;  3CWG A;  3SIV B;  1XWG A;  3JQZ A;  2O5V A;  1VZS A;  4Q5N A;  3V08 A;  2Z8J A;  3VLN A;  5JCU A;  2EFD A;  1Z9H A;  4W4U B;  4ZBA A;  4BKE A;  4LB9 A;  2QHB A;  1YY7 A;  2BXC A;  1GTB A;  5ECI B;  3ZFB A;  4GSN A;  1R5A A;  1HNC A;  4IEL A;  5DAK A;  1HK2 A;  3UIV A;  4I97 A;  4YQM A;  3MHS B;  1PKW A;  4MPF A;  1JNB A;  1GSY A;  4HI7 A;  6GSY A;  10GS A;  1G6W A;  1FHE A;  2GTU A;  4N0U D;  20GS A;  2F8F A;  4PNF A;  3W8S A;  2VD0 A;  4F0C A;  2DBX A;  5ECS A;  3NVK A;  4O7H A;  1IJG A;  2XSI A;  3M0F A;  3M8N A;  5A34 A;  8GSS A;  2KBZ A;  1LBK A;  4LA0 A;  4N0V A;  1PL1 A;  3UAR A;  1SB0 A;  3TOT A;  5IQY A;  4ZBK A;  22GS A;  1M9B A;  4GDL B;  3P90 A;  4WR4 A;  2R3X A;  4F0B A;  4HGK A;  3SIU B;  2YCD A;  4IGJ A;  3ZFL A;  4IW2 A;  3GQX A;  4JK4 A;  17GS A;  3MHH B;  3U6V A;  4DEJ A;  4NHW A;  3VQI A;  5ECO B;  1J78 A;  1VF3 A;  1PGT A;  2VCW A;  5ELG A;  3G7I A;  4MP4 A;  2OAC A;  1E6B A;  1GSF A;  3IE3 A;  5ECK B;  3FR3 A;  3Q19 A;  2O36 A;  2C80 A;  3H1N A;  1KXP D;  1RK4 A;  3W1S A;  2A2R A;  3KXO A;  4OFT A;  5IJF A;  2IMI A;  5A4V A;  1GSQ A;  4PQI A;  3KTL A;  4OTU A;  1PX6 A;  3D0Z A;  3KJY A;  3MAK A;  1E7I A;  2NNW A;  5GHK A;  1B8X A;  5D7G A;  1VF2 A;  5J47 A;  1F2E A;  2DSA A;  2E0X A;  1GUK A;  5BPK A;  2WVY A;  4G01 A;  3KM6 A;  3NMU A;  2YV7 A;  4KF9 A;  2I2Z A;  3ICX A;  1PN9 A;  14GS A;  4E8H A;  4ECC A;  4G9H A;  1MIV A;  5A1N A;  4MPG A;  4LMW A;  1G7O A;  4AGS A;  2VDB A;  1GUM A;  3GTU A;  3A73 A;  6GSW A;  4S1Y A;  3DGQ A;  1GNI A;  4KH7 A;  4DM0 A;  4MBE C;  1PA3 A;  1KBN A;  1N25 A;  5J41 A;  2DG5 A;  1LOT A;  3CRU A;  2ROH A;  4GF0 A;  4L8U A;  2BXE A;  5A5H B;  4L9Q A;  2PER A;  2OT3 A;  2BXQ A;  2QMC A;  5ECN B;  2XMO A;  5FHI A;  2KWF A;  3KMO A;  4BL7 A;  1FOU A;  1AO6 A;  1GNJ A;  1YDK A;  1EEM A;  3TGZ A;  4F5S A;  6GSS A;  3F63 A;  4IVF A;  2BX8 A;  2BXN A;  4N0F D;  2YV9 A;  1E7F A;  3N5O A;  1M99 A;  5KEJ A;  5IIU A;  1M0U A;  2BXH A;  3QAG A;  5A4W A;  2HRA A;  3LXT A;  1UOR A;  4ISD A;  1EV4 A;  3CBU A;  4BVY A;  2BXP A;  2WW2 A;  3RFR C;  6GST A;  4OR0 A;  5IFO A;  4F5U A;  1BX9 A;  4KDY A;  1BG1 A;  4GG2 A;  2JL4 A;  2WB9 A;  3M1G A;  3JRY A;  3PR8 A;  1AQW A;  4GDX A;  2XW0 A;  2VCZ A;  2X64 A;  3VK9 A;  3ZML A;  4AKX B;  16GS A;  3ZMK A;  4ZB8 A;  4YQV A;  1MUS A;  4G10 A;  5F8B A;  4ZCG A;  2WS2 A;  2OA7 A;  3LXZ A;  4LB2 A;  1BYE A;  1BM0 A;  3F6F A;  1HK1 A;  4K0N A;  4JZQ A;  4MDC A;  4ZXG A;  6GSU A;  5A4U A;  2WZS A;  1E7C A;  2V36 A;  2FHE A;  3I69 A;  4KGI A;  1U88 A;  5J4Y A;  2NTO A;  1E78 A;  4KE3 A;  7GSS A;  4G0I A;  6GSV A;  4PUR A;  3KMN A;  3O76 A;  2UV8 G;  4GSS A;  3LYK A;  4KDX A;  4KX4 A;  5DAL B;  4ECI A;  4IJI A;  2C4J A;  1MM8 A;  4MF6 A;  2HRK A;  3SWL A;  1C72 A;  2AAW A;  4PXO A;  1H9Z A;  1EV9 A;  5GSS A;  4TQ0 A;  1F3B A;  1GNE A;  1B4P A;  1K0C A;  4GST A;  1MA9 A;  3LQ7 A;  5G5F A;  4Z69 A;  5IIX A;  3C8E A;  4ECJ A;  1NT2 B;  2PGT A;  1DUG A;  1GWC A;  4HZ2 A;  1MIY A;  4L8E A;  1E7E A;  5BMU B;  1E7B A;  2XVQ A;  4NAX A;  2XW1 A;  1V2A A;  4PQH A;  3PPU A;  2DYO A;  4HGM B;  2D2Z A;  5ECH B;  2CAI A;  3V09 A;  2HSN A;  2HQT A;  2PBJ A;  4PUA A;  5GIN A;  4YAP A;  5G5E A;  1IYH A;  1BG5 A;  2WW3 A;  2F3M A;  2XVU A;  1BKE A;  4ZC6 A;  2VO4 A;  4G0K A;  2VCX A;  3GSS A;  3DD3 A;  4PO0 A;  3GST A;  5DBY A;  3IK9 A;  1TU7 A;  3IBH A;  1H5W A;  3CSJ A;  4GLT A;  3HJM A;  5F0G A;  1GLQ A;  1V40 A;  1O9X A;  1AQV A;  4E8E A;  3FRC A;  4PHZ C;  6GSX A;  2OAD A;  4IQ1 A;  1YEW C;  4GCI A;  4Q5Q A;  3ISO A;  1BJ5 A;  2CA8 A;  4JED A;  3KJL A;  5D9W A;  1LJR A;  1IYI A;  5DAK B;  1K0A A;  3UAP A;  2ON5 A;  3WD6 A;  4LUH A;  3FNM A;  2LOQ A;  4QMK A;  1E7A A;  3TDL A;  2V6K A;  3R3E A;  3FWC C;  4IW9 A;  4FJC B;  4PTS A;  3H37 A;  4K71 A;  4JBB A;  1GSU A;  2EFH A;  3SQJ A;  5EL8 A;  4Q5R A;  5A34 B;  1M9A A;  2GDR A;  1GUL A;  4J2F A;  3UBL A;  1KW2 A;  1JLW A;  3RGB C;  2VCQ A;  5J4U A;  4Q5F A;  3IK7 A;  3WHR A;  4IW1 A;  2O3E A;  3FR9 A;  3F6D A;  3GQU A;  3EE2 A;  5LD0 A;  5ECL B;  4BY9 C;  5A5K A;  3VPT A;  2CVD A;  5GZZ B;  1AW9 A;  4E68 A;  2LQH A;  2PMT A;  2CZ2 A;  4TQ1 A;  5D9T A;  2CKX A;  1GTU A;  5FT3 A;  4IKH A;  3L0H A;  1J7E A;  1TDI A;  3FR6 A;  2ON7 A;  1I1I P;  2GST A;  3VI7 A;  4ZBQ A;  4WA6 B;  3QR6 A;  3BBY A;  4ECB A;  2BXG A;  3VWX A;  3PLA A;  4D7X A;  2IMK A;  2NQO A;  3IC8 A;  4USS A;  4PX1 A;  3VI5 A;  5J40 A;  1PMT A;  1HA2 A;  3G9K D;  5DJM A;  2WVX A;  1TU8 A;  2UZ8 A;  3GA9 L;  2VCV A;  2CZ3 A;  3ECP A;  1YKC A;  2AHE A;  2GSS A;  4ZUX V;  4LMV A;  1BF5 A;  2HSM A;  4BVX A;  1YQ1 A;  3TOU A;  3HKR A;  2WW0 A;  5IJE A;  5F07 A;  1BAY A;  4ZBD A;  4NAW B;  1G6Y A;  4M70 B;  1GSD A;  4ZBB A;  2BXF A;  5A1N B;  4ZBR A;  4EMX A;  1Y6E A;  4KAE A;  4AKG A;  3BPJ A;  4OTT A;  3GTU B;  2QM6 A;  5B5T A;  1GLP A;  1HNA A;  5DDL A;  1PL2 A;  4HOJ A;  1N2A A;  4ZB9 A;  4OT2 A;  4F5T A;  1AXD A;  1JLV A;  3R2Q A;  1MD3 A;  11GS A;  4F5V A;  1Q4J A;  2OZB B;  3GUS A;  3LSZ A;  3LFL A;  4Z9O A;  2R6K A;  1K3O A;  3HJO A;  2DYM A;  1K3L A;  1OYJ A;  4BL7 B;  4AKI A;  3N9J A;  4G04 A;  4MF7 A;  19GS A;  1HQO A;  5AIV A;  3FWB C;  3NIV A;  1MTC A;  4HJ2 A;  2WRT A;  5LCZ A;  1HK4 A;  5D9X A;  1JZR A;  5ID7 A;  1A0F A;  2N5F A;  5DCG A;  1K0D A;  4E99 A;  4KDU A;  4L5O A;  4BVY B;  1K0B A;  3Q74 A;  2BXD A;  2BXK A;  1U87 A;  3PGT A;  13GS A;  5ECM B;  3NVM A;  4FK5 B;  4FIP B;  2C3N A;  2BXB A;  1MIW A;  5DQS A;  4GDF A;  5GIO A;  1XWK A;  5JCW A;  2DBW A;  1MD4 A;  3MDK A;  4QQ7 A;  4F03 A;  4DHX B;  1HK5 A;  4I9O A;  2AJE A;  2VD1 A;  3WHQ A;  5FUO A;  5J5N A;  5J4V A;  3V03 A;  5ELA A;  2C3T A;  4OFM A;  3VPQ A;  1FW1 A;  1XW5 A;  4RI6 A;  4K2C A;  5HFK A;  4EC0 A;  3KIK A;  2EFE A;  4L9K A;  2LXS A;  3GX0 A;  2HNL A;  2J9H A;  3A75 A;  1GSE A;  1XW6 A;  1MUH A;  5DJL A;  1VF1 A;  4PI0 C;  4IQA A;  2Z8I A;  1SVM A;  2WJU A;  1EOH A;  1GUH A;  2HRK B;  1S4B P;  2BXM A;  5ECR B;  3GUR A;  2VKZ G;  1AQX A;  5F06 A;  3LU7 A;  1YJ6 A;  5EY6 A;  4HZ4 A;  4L5L A;  2VUE A;  4W66 A;  4WR5 A;  4IS0 A;  9GSS A;  2GSQ A;  1F3A A;  2GSR A;  5AIS A;  2WVZ A;  4IBP A;  3UVH A;  5B7C A;  4K0G A;  1N5U A;  1VF4 A;  3UBK A;  1ML6 A;  2HSN B;  1GNW A;  1HK3 A;  2C3Q A;  1UA5 A;  3CSH A;  2R4V A;  2DC5 A;  4ZB7 A;  5A5H A;  3AY8 A;  3CRT A;  4EDY A;  3QAW A;  4GTU A;  4G19 A;  4YH2 A;  1HNB A;  5ECP B;  3Q18 A;  5D9V A;  1OE8 A;  1OKT A;  4FQU A;  2YDF A;  3NVI A;  4G0L A;  5ECQ B;  4KSM A;  3IR4 A;  2C8U A;  2CAQ A;  4NHZ A;  2XVW A; 
#chains in the Genus database with same CATH homology
 1TXU A;  2A2S A;  5FWG A;  2EFC A;  12GS A;  1K0M A;  3I6A A;  3RBT A;  5HOZ A;  3O3T A;  2BXA A;  3VUR A;  2FNO A;  3WYW A;  1B48 A;  5D73 A;  3CX9 A;  2R5G A;  3M99 C;  1K0N A;  5IJ5 A;  3P8W A;  4ID0 A;  2BXO A;  2BXL A;  5ID9 A;  1GTI A;  3FYG A;  4TOP A;  2VUF A;  2Z8K A;  2BXI A;  5AGY A;  4J2V A;  4RI7 A;  4G03 A;  5AIX A;  4ZB6 A;  4ACS A;  3G7J A;  3LU8 A;  1E7H A;  1U3I A;  1LNS A;  4EXJ A;  3HMJ G;  4OFN A;  4C31 B;  1PX7 A;  1ZGN A;  3FY7 A;  4AI6 A;  3CSI A;  2H1L A;  2I30 A;  1NHY A;  3M3M A;  1ZL9 A;  4N3Z A;  2WDU A;  5IIH A;  2E0Y A;  2JUH A;  3ERG A;  3QAV A;  5EVO A;  1SVO A;  4AKH A;  1OE7 A;  5DAL A;  5AN1 A;  1GSS A;  4LUF A;  1K0O A;  5GIP A;  1SVL A;  4PGT A;  18GS A;  3LJR A;  4GDK B;  4OMV A;  1PD2 1;  5GST A;  2XVV A;  3LU6 A;  4EE0 A;  1VFI A;  2IL3 A;  4MF5 A;  1Y1U A;  4EDZ A;  1YVL A;  3LG6 A;  2PVQ A;  3ERF A;  5BMU A;  3B9L A;  2LJR A;  4O92 A;  2DBU A;  1K3Y A;  1EOG A;  4MK3 A;  4YQU A;  4PNG A;  3EIN A;  3H3A A;  5F05 A;  4MZW A;  1GTA A;  3TU3 B;  3B9M A;  1TW9 A;  2GLR A;  3GH6 A;  3WHS A;  4CHS A;  1E7G A;  3LYP A;  1TF0 A;  5DQF A;  1USB A;  2HSM B;  1PKZ A;  4BVX B;  2AB6 A;  4YAV A;  2VCT A;  3CWG A;  3SIV B;  1XWG A;  3JQZ A;  2O5V A;  1VZS A;  4Q5N A;  3V08 A;  2Z8J A;  3VLN A;  5JCU A;  2EFD A;  1Z9H A;  4W4U B;  4ZBA A;  4BKE A;  4LB9 A;  2QHB A;  1YY7 A;  2BXC A;  1GTB A;  5ECI B;  3ZFB A;  4GSN A;  1R5A A;  1HNC A;  4IEL A;  5DAK A;  1HK2 A;  3UIV A;  4I97 A;  4YQM A;  3MHS B;  1PKW A;  4MPF A;  1JNB A;  1GSY A;  4HI7 A;  6GSY A;  10GS A;  1G6W A;  1FHE A;  2GTU A;  4N0U D;  20GS A;  2F8F A;  4PNF A;  3W8S A;  2VD0 A;  4F0C A;  2DBX A;  5ECS A;  3NVK A;  4O7H A;  1IJG A;  2XSI A;  3M0F A;  3M8N A;  5A34 A;  8GSS A;  2KBZ A;  1LBK A;  4LA0 A;  4N0V A;  1PL1 A;  3UAR A;  3TOT A;  5IQY A;  4ZBK A;  22GS A;  1M9B A;  4GDL B;  3P90 A;  4WR4 A;  2R3X A;  4F0B A;  4HGK A;  3SIU B;  2YCD A;  4IGJ A;  3ZFL A;  4IW2 A;  3GQX A;  4JK4 A;  17GS A;  3MHH B;  3U6V A;  4DEJ A;  4NHW A;  3VQI A;  5ECO B;  1J78 A;  1VF3 A;  1PGT A;  2VCW A;  5ELG A;  3G7I A;  4MP4 A;  2OAC A;  1E6B A;  1GSF A;  3IE3 A;  5ECK B;  3FR3 A;  3Q19 A;  2C80 A;  3H1N A;  1KXP D;  1RK4 A;  3W1S A;  2A2R A;  3KXO A;  4OFT A;  5IJF A;  2IMI A;  5A4V A;  1GSQ A;  4PQI A;  3KTL A;  4OTU A;  1PX6 A;  3D0Z A;  3KJY A;  3MAK A;  1E7I A;  2NNW A;  5GHK A;  1B8X A;  5D7G A;  1VF2 A;  5J47 A;  1F2E A;  2DSA A;  2E0X A;  1GUK A;  5BPK A;  4G01 A;  3KM6 A;  3NMU A;  2YV7 A;  4KF9 A;  2I2Z A;  3ICX A;  1PN9 A;  14GS A;  4E8H A;  4ECC A;  4G9H A;  1MIV A;  5A1N A;  4MPG A;  4LMW A;  1G7O A;  4AGS A;  2VDB A;  1GUM A;  3GTU A;  3A73 A;  6GSW A;  4S1Y A;  3DGQ A;  1GNI A;  4KH7 A;  4MBE C;  1PA3 A;  1KBN A;  1N25 A;  5J41 A;  2DG5 A;  1LOT A;  3CRU A;  2ROH A;  4GF0 A;  4L8U A;  2BXE A;  5A5H B;  4L9Q A;  2PER A;  2OT3 A;  2BXQ A;  2QMC A;  5ECN B;  2XMO A;  5FHI A;  4BL7 A;  3KMO A;  1FOU A;  1AO6 A;  1GNJ A;  1YDK A;  1EEM A;  3TGZ A;  4F5S A;  6GSS A;  3F63 A;  4IVF A;  2BX8 A;  2BXN A;  4N0F D;  2YV9 A;  1E7F A;  3N5O A;  1M99 A;  5KEJ A;  5IIU A;  1M0U A;  2BXH A;  3QAG A;  5A4W A;  2HRA A;  3LXT A;  1UOR A;  4ISD A;  1EV4 A;  3CBU A;  4BVY A;  2BXP A;  6GST A;  4OR0 A;  5IFO A;  4F5U A;  1BX9 A;  4KDY A;  1BG1 A;  4GG2 A;  2JL4 A;  2WB9 A;  3M1G A;  3JRY A;  3PR8 A;  1AQW A;  4GDX A;  2XW0 A;  2VCZ A;  2X64 A;  3VK9 A;  3ZML A;  4AKX B;  16GS A;  3ZMK A;  4ZB8 A;  4YQV A;  4G10 A;  5F8B A;  4ZCG A;  2WS2 A;  2OA7 A;  3LXZ A;  4LB2 A;  1BYE A;  1BM0 A;  3F6F A;  1HK1 A;  4K0N A;  4JZQ A;  4MDC A;  4ZXG A;  6GSU A;  5A4U A;  1E7C A;  2V36 A;  2FHE A;  3I69 A;  4KGI A;  1U88 A;  5J4Y A;  2NTO A;  1E78 A;  4KE3 A;  7GSS A;  4G0I A;  6GSV A;  4PUR A;  3KMN A;  3O76 A;  2UV8 G;  4GSS A;  3LYK A;  4KDX A;  4KX4 A;  5DAL B;  4ECI A;  4IJI A;  2C4J A;  4MF6 A;  2HRK A;  3SWL A;  1C72 A;  2AAW A;  4PXO A;  1H9Z A;  1EV9 A;  5GSS A;  4TQ0 A;  1F3B A;  1GNE A;  1B4P A;  1K0C A;  4GST A;  1MA9 A;  3LQ7 A;  5G5F A;  4Z69 A;  5IIX A;  3C8E A;  4ECJ A;  1NT2 B;  2PGT A;  1DUG A;  1GWC A;  4HZ2 A;  1MIY A;  4L8E A;  1E7E A;  5BMU B;  1E7B A;  2XVQ A;  4NAX A;  2XW1 A;  1V2A A;  4PQH A;  3PPU A;  2DYO A;  4HGM B;  2D2Z A;  5ECH B;  2CAI A;  3V09 A;  2HSN A;  2HQT A;  2PBJ A;  4PUA A;  5GIN A;  4YAP A;  5G5E A;  1IYH A;  1BG5 A;  2F3M A;  2XVU A;  1BKE A;  4ZC6 A;  2VO4 A;  4G0K A;  2VCX A;  3GSS A;  3DD3 A;  4PO0 A;  3GST A;  5DBY A;  3IK9 A;  1TU7 A;  3IBH A;  1H5W A;  3CSJ A;  4GLT A;  3HJM A;  5F0G A;  1GLQ A;  1V40 A;  1O9X A;  1AQV A;  4E8E A;  3FRC A;  6GSX A;  2OAD A;  4IQ1 A;  4GCI A;  4Q5Q A;  3ISO A;  1BJ5 A;  2CA8 A;  4JED A;  3KJL A;  5D9W A;  1LJR A;  1IYI A;  5DAK B;  1K0A A;  3UAP A;  2ON5 A;  3WD6 A;  4LUH A;  3FNM A;  2LOQ A;  4QMK A;  1E7A A;  3TDL A;  2V6K A;  3R3E A;  3FWC C;  4IW9 A;  4FJC B;  4PTS A;  3H37 A;  4K71 A;  4JBB A;  1GSU A;  2EFH A;  3SQJ A;  5EL8 A;  4Q5R A;  5A34 B;  1M9A A;  2GDR A;  1GUL A;  4J2F A;  3UBL A;  1KW2 A;  1JLW A;  2VCQ A;  5J4U A;  4Q5F A;  3IK7 A;  3WHR A;  4IW1 A;  3FR9 A;  3F6D A;  3GQU A;  3EE2 A;  5LD0 A;  5ECL B;  4BY9 C;  5A5K A;  3VPT A;  2CVD A;  5GZZ B;  1AW9 A;  4E68 A;  2PMT A;  2CZ2 A;  4TQ1 A;  5D9T A;  2CKX A;  1GTU A;  5FT3 A;  4IKH A;  3L0H A;  1J7E A;  1TDI A;  3FR6 A;  2ON7 A;  3VI7 A;  2GST A;  4ZBQ A;  4WA6 B;  3QR6 A;  3BBY A;  4ECB A;  2BXG A;  3VWX A;  3PLA A;  2IMK A;  2NQO A;  3IC8 A;  4USS A;  4PX1 A;  3VI5 A;  5J40 A;  1PMT A;  1HA2 A;  3G9K D;  5DJM A;  1TU8 A;  2UZ8 A;  3GA9 L;  2VCV A;  2CZ3 A;  1YKC A;  2AHE A;  2GSS A;  4ZUX V;  4LMV A;  1BF5 A;  2HSM A;  4BVX A;  1YQ1 A;  3TOU A;  3HKR A;  5IJE A;  5F07 A;  1BAY A;  4ZBD A;  4NAW B;  1G6Y A;  4M70 B;  1GSD A;  4ZBB A;  2BXF A;  5A1N B;  4ZBR A;  4EMX A;  1Y6E A;  4KAE A;  4AKG A;  4OTT A;  3GTU B;  2QM6 A;  5B5T A;  1GLP A;  1HNA A;  5DDL A;  1PL2 A;  4HOJ A;  1N2A A;  4ZB9 A;  4OT2 A;  4F5T A;  1AXD A;  1JLV A;  3R2Q A;  1MD3 A;  11GS A;  4F5V A;  1Q4J A;  2OZB B;  3GUS A;  3LSZ A;  3LFL A;  4Z9O A;  2R6K A;  1K3O A;  3HJO A;  2DYM A;  1K3L A;  1OYJ A;  4BL7 B;  4AKI A;  3N9J A;  4G04 A;  4MF7 A;  19GS A;  1HQO A;  5AIV A;  3FWB C;  3NIV A;  1MTC A;  4HJ2 A;  2WRT A;  5LCZ A;  1HK4 A;  5D9X A;  1JZR A;  5ID7 A;  1A0F A;  2N5F A;  5DCG A;  1K0D A;  4E99 A;  4KDU A;  4L5O A;  4BVY B;  1K0B A;  3Q74 A;  2BXD A;  2BXK A;  1U87 A;  3PGT A;  13GS A;  5ECM B;  3NVM A;  4FK5 B;  4FIP B;  2C3N A;  2BXB A;  1MIW A;  5DQS A;  4GDF A;  5GIO A;  1XWK A;  5JCW A;  2DBW A;  1MD4 A;  3MDK A;  4QQ7 A;  4F03 A;  4DHX B;  1HK5 A;  2AJE A;  2VD1 A;  3WHQ A;  5FUO A;  5J5N A;  5J4V A;  3V03 A;  5ELA A;  2C3T A;  4OFM A;  3VPQ A;  1FW1 A;  1XW5 A;  4RI6 A;  4K2C A;  5HFK A;  4EC0 A;  3KIK A;  2EFE A;  4L9K A;  3GX0 A;  2HNL A;  2J9H A;  3A75 A;  1GSE A;  1XW6 A;  5DJL A;  1VF1 A;  4IQA A;  2Z8I A;  1SVM A;  2WJU A;  1EOH A;  1GUH A;  2HRK B;  2BXM A;  5ECR B;  3GUR A;  2VKZ G;  1AQX A;  5F06 A;  3LU7 A;  1YJ6 A;  5EY6 A;  4HZ4 A;  4L5L A;  2VUE A;  4W66 A;  4WR5 A;  4IS0 A;  9GSS A;  2GSQ A;  1F3A A;  2GSR A;  5AIS A;  4IBP A;  3UVH A;  5B7C A;  4K0G A;  1N5U A;  1VF4 A;  3UBK A;  1ML6 A;  2HSN B;  1GNW A;  1HK3 A;  2C3Q A;  1UA5 A;  3CSH A;  2R4V A;  2DC5 A;  4ZB7 A;  5A5H A;  3AY8 A;  3CRT A;  4EDY A;  3QAW A;  4GTU A;  4G19 A;  4YH2 A;  1HNB A;  5ECP B;  3Q18 A;  5D9V A;  1OE8 A;  1OKT A;  4FQU A;  2YDF A;  3NVI A;  4G0L A;  5ECQ B;  4KSM A;  3IR4 A;  2C8U A;  2CAQ A;  4NHZ A;  2XVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...