2EFEB

Ara7-gdpnh2/atvps9a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
165
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
total genus 54
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efeB00
1WE2A 2I1QA 3CF6R 1GRRA 4LX0A 1VYTA 4S35A 2FGKA 1DELA 1N5LA 4LV5B 3SFVA 1FNNA 2ORVA 5LPNA 2FWRA 4MRRA 3VHLB 4DCVA 1YVDA 3VR4A 4A8JA 2ZYTX 3I73A 3RANA 721PA 3REFA 2J59A 5JWRA 1S1CA 2A9KA 2YOHA 3LVRE 4G1UC 4PPFA 3KDSE 4QHSA 1DO2A 4W5HA 3IDQA 4HB2A 1NSFA 1KYIA 2RGAA 2VH5R 3K53A 1W48A 5K8UA 4PSKA 2ZJAA 3SEAA 1Z47A 3LLUA 1CU1A 4KXFB 2XXAB 1IY1A 3RS0A 3R7WA 2W2TA 1VDZA 2AKAB 3WBKA 1AS2A 1JR3E 3K8YA 2F9MA 4NONA 1Z8FA 2IYQA 1MRSA 1COWA 4DJTA 3BD9A 1XPOA 5B2ZA 1WDTA 3FYHA 2FZLA 3QXCA 4OJKA 3VFDA 2O8CB 1P6XA 3ECCA 1AZTA 3QXXA 4IOKA 4IVRA 1S96A 5LBIA 5EP1A 1OKKD 2VP6A 4B44A 4LGMA 2IS1A 3BORA 3LXRA 4BLRA 2F55A 3GEIA 2FN4A 2J45A 1M7GA 3WRXC 5C2JB 2WWXA 4Q7LA 1ZIOA 2WWIA 2OLKA 2R65A 2Y8EA 4LJAA 2NO9A 4JLNA 3MJHA 3QVUA 4OI1A 1RW4A 2OLJA 5CIWA 3GLIA 2ODNA 4M1MA 4Q4HB 4CDGA 3KFVA 2IYTA 2R62A 4LPKA 4WXPA 2IUUA 2R6AA 4GOXA 4BQSA 5JEDA 3IHLA 3VTKA 4PC7A 5J40A 1NN0A 1GP2A 1C1YA 3FWYA 1N6NA 4G5GA 4I1VA 1M2OB 3WNDA 4ESVA 3FPAA 3M1IA 4NCHA 4DT1A 3V4FA 4BECA 3EWSA 1DADA 3K9NA 5EUQB 1KSHA 2CL6X 3E2IA 2CCGA 3I61A 2NO7A 3CNNA 2WSSD 4Q03A 4V0KA 4ZIRA 4MRSA 1L4YA 3P20A 3THWB 3AVYA 4LZZA 3KKQA 821PA 2R9VA 2F3TA 2CL7X 1G5RA 4KAXA 4L8GA 3F3YA 4IXNA 5FOUA 1XEXA 2ZAOA 2DPXA 3O8DA 2R6FA 2QE7A 1PV4A 4GOKA 4P0TA 1CJVC 4NCKA 4PAMA 3LD9A 1NMYA 2RKOA 4PZZA 2VP9A 1HV8A 3B9QA 4JKYA 1T0JB 4B75A 4HAWA 3IO3A 1LS6A 1Z2AA 5B30A 2IWRA 1G7SA 4RD4A 4B73A 3IUYA 4KVAA 1N6LA 2GF9A 2ZJYA 4E07A 3SQXA 3AF2A 5E4FA 1LS1A 2BWJA 2ATXA 2QT1A 3OIUA 4DDVA 4MDFA 3LDAA 1E98A 4N3NA 1QBKC 1OYWA 1CIPA 1T9HA 1KY3A 2CHGA 3VR3A 2EWVA 3OIVA 2PZFA 4B3CA 2QP9X 2J5XA 4OQMA 2KI5A 2A30A 1GIAA 2WJYA 2XNDA 2ZJ2A 2UKDA 2GCOB 4Z54A 2YHSA 4C0HA 1ZD9A 1LF5A 1SVWA 1YU9A 1F2TA 3NEYA 3CX7A 2OZEA 4B34A 4OHZA 4AY2A 1QG2A 3EPHA 1J2JA 5LDDC 1R6BX 1XPRA 3FHTA 4GP7A 4POAA 4OBEA 3VNVA 3H2YA 1VCMA 1UFQA 3GEEA 4PAQA 2CK3A 5JI3E 3VKHA 4PQYA 4UNNA 2EYQA 5HCNA 2IXGA 1A1VA 3AKYA 4DCUA 1Z6XA 3T1VA 4B35A 3EXAA 2EYUA 3L43A 4TMVA 5KNCA 3W8NA 4X8LA 5HR5A 1OPXA 2NO6A 1JXOA 2BM0A 2HT6A 2LWIA 2WMNB 3CR7A 2GF0A 1D5CA 1OH6A 5KOYA 1G8YA 4CZ2A 1EX6A 4Q00A 2BEKA 4DLSA 1TNDA 2REOA 3VR6A 4EPWA 2BIFA 4B76A 1KDTA 3FGNA 1LVGA 1WBDA 3AVWA 4HDCA 2HLDA 3RDPA 4LHYA 2R8RA 4LPSA 2RGEA 3A1SA 4IOMA 1RC8A 1TUEA 2BBSA 2F1RA 1W4AA 2PJRA 3A1UA 3R8FA 1S3GA 2O8BA 2AK2A 2G9NA 3I32A 1E4YA 3UMFA 2CE7A 2NPIA 2REBA 1DARA 3NIBA 3FMFA 3OAAA 4DEYA 3BXZA 2QSYA 3OEEA 1P2SA 3DKPA 4CEIB 4KVGA 3MWJA 1ZIPA 2C95A 3VU9B 1OHHA 2IUTA 3AVVA 1VTKA 3BB3A 4XVUA 2RH5A 4Q1DA 4AIIA 3I62A 2IL1A 4ZI3A 3ZVNA 5DHAA 1G3MA 2FU5C 1II9A 1TF5A 2ZJOA 4FI3C 3LH5A 4XD7D 3SC3A 4ACBA 3GLIB 4KBFA 1Z63A 4GMXA 4B3BA 4JVNA 1IBRA 4EPTA 4HYYA 3K0CA 4M1TA 3D3QA 5FBVB 3T1QA 2LKCA 3K1JA 1OXVA 4M2LA 2GJAA 4LWZA 1W36C 1BH2A 4LUCA 1E2JA 5J4KA 1GVNB 4KODA 5EE0A 3PUZA 3RNLA 2BKEA 3LX5A 4RY2A 5K8LA 2IYLD 1Z6YA 3ND8A 1G18A 4OQXA 3KJGA 1EESA 4HLUA 2ZI5A 3IBGA 2FF7A 1L8QA 1VECA 3ICEA 2AL7A 1Z6TA 1EK0A 1S2MA 3PUVA 5EP4A 1Q12A 4A0HA 1LB1B 1Q44A 1Q1ZA 2HDNB 4JBXA 3L2OB 5DE3A 4F4CA 2E87A 3AF4A 3TQFA 5HZHA 2GK6A 4PC1A 2VHUA 1BKDR 2WV9A 4FIDA 2A5FA 2XGJA 5FOXA 4YXWD 1GNQA 4E5UA 1X3SA 1WA5A 3RRYA 3RWMB 1Z0IA 2P5SA 1W0KD 1FX0A 4V0MA 5G40A 4DEXA 4C0KA 1KK3A 2J87A 4NZYA 5FBRB 4ABYA 4UKDA 3SE0A 3C5HA 3RS3A 1CEEA 3L0SA 2G88A 4TYPA 5FPHA 4QRHA 3RLFA 2VLIA 1Q1BA 3OEED 5AJYA 1OIXA 4MRVA 3GJ0A 3AKDA 5SZJA 1FTNA 1C4OA 2ZAMA 3P4XA 5F9HA 1XMVA 4O0MA 4EPVA 2FX3A 4HLCA 2WWHA 3TQCA 3WBJA 4EFLA 1NRJB 5AUNB 3EPJA 2ZR7A 3GLFA 1GFIA 3MFYA 1BIFA 4FMCB 2EFHB 4R71A 1WB9A 1T8UA 3GFPA 4ILEA 521PA 2ZANA 4EQ6A 5BN4A 5JJIA 2OM2A 1Q20A 1KMHB 3IIKA 3TSOA 1K8RA 4BZPA 2H17A 4OJQA 1SXJA 2D4HA 1JEEA 2WM9B 2O0HA 4ITRC 2YC2C 1EWQA 5FOVA 1ZM9A 4OQNA 2ZPTX 1T0HB 2GTPA 5HE9A 3IEVA 2OBNA 3TR0A 1M8PA 4HSEA 1JR3D 1HA3A 2VPPA 3BS4A 4WZ6A 2EU8A 3C4JA 2X19A 1X1SA 1Q3TA 1A82A 4WIAA 1OSNA 1OH8A 2FPKA 2QG6A 2ZE8A 2WICA 4TMTA 2BMJA 4DSUA 5FH9A 2ZRAA 4JS0A 1E2DA 2ZU0C 1R7RA 2IYUA 4B6FA 2PT7A 1OE0A 2ZM5A 4TZ0A 3AV0B 1F48A 4LOAA 3NXSA 3RS7A 5CYPA 2QBYA 2N42A 5J4VA 2DFLA 4JZKA 4A8JC 8OHMA 2J0VA 4WVFA 1DAFA 1BO6A 3U4QA 1KSJA 2D62A 3OHMA 4MUAA 1XCGB 4UNSA 1G19A 3C14C 4BRWA 2JEOA 3VAAA 2OFXA 3CWQA 1GKUB 1ZM7A 5GVRA 1S1MA 4QGGA 3HU2A 3R8CA 1KMQA 4ACAA 3ZJYA 2ZJ8A 3SR0A 1EFHA 3UMRA 2O8BB 3NVAA 1HQYE 3LA6A 3B8HA 3KTAB 1WBBA 4BE7B 4KV9A 3MAAC 4B32A 3FKSD 1E1QD 4BZQA 3ZIAD 2OCBA 1CR4A 4NH0A 2ZXUA 4URXR 1U94A 1NP6A 4CEHA 2PLRA 4EDHA 3PENA 4AYWA 5F3WB 4OK3A 2JLXA 3HPRA 3EA0A 2DWPA 3QKRA 2ZVPX 2YWHA 2YOGA 4Q66C 3X2SA 4M0LA 4AC9A 5HZKA 4PHFA 2CMKA 4KU4A 2V7QD 1MR3F 4D2IA 3C7KA 3BH7A 4TLDA 1BS1A 4DDTA 2C9YA 4XOIA 3S1AB 3L0IB 2NO1A 2K5UA 3EPLA 3R20A 2PLFA 1FPMA 5G3YA 3CR8A 4FCTA 4HAUA 4B3XA 4B47A 1NVWQ 1X86B 2ZSEA 4D4LA 3BK7A 1G3QA 1KKMA 1XD2B 3VR2A 2XSZD 2V4ZA 1Z07A 4A9AA 5SZIA 5TB5A 1WCV1 2G1JA 2OHFA 3FTQA 1F2UA 4KFRA 3ZVLA 1VCNA 2XZOA 1P60A 4YLGA 4LJ5A 3PITA 2ZRLA 1E9RA 4JVSB 2CCKA 1MO6A 1P9WA 3GMTA 2WTUA 3MUFA 1YKSA 4D25A 2Q3HA 3KL4A 5AUPB 1MRNA 3SYLA 4FMDB 3AKCA 1CJMA 1UKVY 3QUSA 4H1VA 1AZSC 3A4LA 1G16A 3TR5A 4Q1EA 3T1OA 5BW8A 1MO5A 1T5IA 2IWHA 4B3DA 4PHHA 2VEDA 2WWYA 1W0JD 1VYUA 1KAOA 1G7RA 2ASEA 1OHHD 1DS6A 2OV2A 4WW0A 5C1BA 4LBVA 1EFUA 5JCZA 3A1WA 3WRYC 1UBCA 2NZ8A 2V6IA 2CLCX 1S9HA 4G5QA 2X77A 3ZH9B 3QG5A 1QHNA 2FSFA 4CF7A 4XJXA 2ZE6A 2Z4RA 1W4RA 1FQJA 1FNMA 4QNRA 3UXMA 2IUSA 1OXUA 2BBOA 4TLEA 1A7JA 2JCSA 5FPSA 1COWD 1BMFA 2ZITA 3IQXA 3MLEA 1YR8A 1S9DA 4JJKA 4A0FA 2RGCA 2WWGA 2FPLA 4V0ME 3GLGE 3WMEA 3AP3A 1ZP6A 2GDJA 2OSBA 3EARA 3W6PA 1FUKA 1XXHA 4RSGA 4L9WA 4B3GA 3NHAA 3CKLA 3PXGA 3TMKA 4RD2A 1XFAA 5HCIA 1JEDA 3R9IA 1IQPA 5AJVB 1JAIA 2GBLC 1CJUC 4XIGS 4RD6A 3BJIC 4A15A 1L4UA 1KO7A 4AWXA 3PFIA 3WHLA 4ARZA 4ZO4A 1ZW6A 2XTZA 3ASYA 2KWIA 4MYHA 3K0FB 4KHZA 4RKEA 2KBEA 4YXWA 4V0NA 3TW4A 1CXZA 3N2EA 2SHKA 2XNDD 3HPQA 1UADA 4GSYA 5DN6A 5FOWA 1EFRD 1KK1A 1KOFA 3TLXA 1R8SA 2FSHA 1Q0UA 3QQ5A 4P4SA 4B71A 1Z08A 2ZUCA 4IVPA 3AVPA 4M1WA 2X2EA 4K81B 1J70A 1G20E 2OBMA 3CIOA 5FTKA 1BYIA 4LBZA 1KO5A 3NKVA 4M9ZA 1E2IA 5BN3A 3HDTA 4A92A 3RVBA 2CJWB 2E9SA 4QG7A 3SZRA 4AG6A 4M53A 1AK2A 2AD1A 2ZR0A 4XTCS 5L3QB 1QG4A 1XTJA 5B57C 4GDFA 1JB1A 3TUZC 4OHXA 2V1UA 2NMVA 5JRJA 2CL0X 3QIAA 3I72A 2DCUA 2GZDA 2W6JA 4DUGD 4I1UA 1AGRA 2GAOA 1IY0A 4DT1B 4NPHA 4Q9HA 2IYXA 2V3CC 2HF8A 4YMSA 1E96A 1TEXA 1Z6GA 2WJIA 3UG6A 4ZIRB 2RGGA 4X8OA 4LY6A 4QL3A 3UMSA 3FMOB 4TL8A 4C0QC 3MWYW 3U61B 1GL9B 3P1JA 2O0KA 3RS2A 2QMUA 2ZS8A 4K46A 1YE8A 2QA5A 1KI6B 2UVQA 2VF7A 1I4TD 4UXIA 2XSZA 5FUYA 3TH5A 5JHGB 1XTKA 2XZLA 3K0AA 1GDDA 3LRPA 4PSAA 3ZQ6A 1QHIA 2J0UA 4OQLA 4HUQA 4PHGA 3TE6A 4F7WA 4TMZA 3B85A 5JSZA 2ANBA 1W2HA 1XD2A 1QHGA 3EC1A 2QM8A 2AN9A 4HDOB 2J0SA 2BKUA 1R10A 1VG1A 4QGAA 3CF2A 3KJEA 1E4VA 5KDDA 4C2TA 1R8QA 2ZRPA 2VQSA 3R9WA 1UDXA 3MG9A 1D8TA 1F2UB 1FQKA 3FFAA 5C4MA 1Z28A 4DZZA 2RGNA 4EIWA 4BLOA 5FUWA 4F38A 2B8WA 2PX3A 1DAMA 4LJ7A 3U2QA 1LNZA 4B2IA 5KSYA 2ZRFA 1CR2A 3DM5A 3ADDA 5JWHA 1VIAA 3SNHA 3QF4B 1N0UA 4MGZR 4TTRA 3AVQA 3AQ4A 1OB5A 2WIBA 4DLRA 1R0YA 4EAQA 3FKSA 5DGXA 1ETUA 1U2RA 1U8ZA 4XD7A 1ZNWA 2A7QA 4J0QA 3W5IA 3RC3A 4B43A 3ADKA 4P33A 3KXIA 4EUNA 1KJZA 3IQWA 5GADl 1CR0A 1G3IA 4LJ8A 1Z0DA 4ZI2A 2IYVA 1GRNA 1XU4A 3T5GA 2JIZA 1YRBA 3B9PA 2HXSA 1NVVR 1UKEA 4ZCMA 4L4UA 3IKJA 4H1UA 4LHZA 4XSHA 1KHTA 1SZPA 2J7PD 3T34A 3LNCA 1SVSA 4QKQA 3RS5A 2XTNA 4DCTA 4D26A 2WVJA 2QQEA 4JT4A 3FMIA 3LBHA 3KFXA 2D7CA 3T35A 5SZHB 2IYRA 2GZHA 2ZUDA 2OCPA 3I3SR 1OYYA 1G8HA 1K6MA 1GRQA 1ZD8A 3DVLA 2B7CA 2HXYA 4TQUS 1YZKA 1PVOA 2FFQA 4M9SA 1NSTA 1E0KA 4HZUA 5EE3A 1A2KC 1S8FA 1SKYE 4NCIA 1P3JA 4Q1FA 4QBGB 1N5KA 3U3JA 3FFBA 3EX7C 3A4NA 1U0JA 3CO5A 5K8TA 3VKWA 2WHXA 4D0GA 4EFMA 2ORWA 2YOFA 4A82A 3UIEA 1KSGA 3KQLA 1HQCA 4HLQB 1QHYA 3QKSA 1YZTA 4IDNA 1AS3A 1KK0A 4NYMR 3WP1B 3EZ7A 2GEDA 2YINC 4CEIA 2ZREA 3V9PA 4AYTA 1F6BA 4KITB 3FHOA 2NZJA 2O52A 1G5PA 1ZC4A 4MQBA 2YV5A 3KKNA 2XOKA 2C78A 1G8FA 1NKTA 2TMKA 3GLIE 3A4MA 2O0JA 4HI0E 4M8NE 4CW7A 4BEJA 1WQ1R 3PG5A 1RVDA 5L3QA 4M22A 4C30A 3TUJC 2QNRA 2RHDA 2V8OA 2O8FB 1OXXK 3TGPA 4JL6A 3HU1A 3U44A 2J7PA 1XMSA 2QAGA 2GESA 2J0QA 2PMDA 3PQCA 4B3FX 2QT0A 3GLFE 4KLZA 5FBLB 5FBWB 1UF9A 1W7AA 1XZQA 4H9GA 4LK2A 4O3MA 1IXRC 3ONWA 2X1VA 4GZLA 4HB4A 4Z8XA 3IPXA 3LBIA 4DHEA 1AA9A 4PTLA 4QHTA 4CEJA 3QNUA 2G0TA 3H1TA 5BQ5A 5EXSA 4G5SA 2EVWX 3CUEF 4JL5A 1S3SA 3PUWA 4IFBA 1F5NA 3I5YA 1CP2A 4DLVA 3QPUA 3L8ZA 3W6OA 5JJKA 4Z1MD 2VHJA 2LKDA 2WOOA 1U9IC 1X8KA 1P72A 4QXAA 1G291 3IBYA 2MMGA 2VHCA 4CRWB 2VA8A 2ZI9A 3TJZA 1XTIA 4TMKA 4DVGA 3GJ8A 2QAJA 1KI9A 2C5LA 4PHTA 1U9IA 4D4JA 1NVVQ 2CLDX 2CE2X 5CLQA 4U02A 4Q4AB 5EZ5A 4C9BA 1LF0A 1ZAKA 2O8DB 2QU8A 1HYQA 3W34A 2XX3A 3U6KA 4MKGA 1SXJC 4HB3A 1KK2A 1ONBA 1D9ZA 1J8YF 4B6EA 3GLFB 3E1SA 1W5SA 3QF4A 4FN5A 4M1YA 4QFMA 2XITA 1UKZA 4ZKEA 3U5ZB 4CT5A 4GP6A 4EQ6B 4WXRA 4GPTA 3PEVA 2DFTA 4FWIB 6Q21A 1RPZA 4BFUA 2FJUA 1XMIA 1LTQA 3GJ5A 3QBVA 3QPWA 3KQNA 4MYUA 2YWGA 1VMAA 3P27A 1JQLB 4TQ9A 2ZRIA 1MO4A 2NGRA 1X8LA 5J4YA 4EFNA 1W1WA 5FUXA 3AUXA 3ETLA 2OBLA 2P6NA 3WNCA 2HYIC 2W6ID 3K9LA 4L9SA 4MYTA 1TQ6A 3TIFA 3B6EA 3RS4A 4GOJA 2FZ4A 4QHYA 3ZD6A 1GILA 4AURA 5IT5A 5GJCA 1UJ2A 4KSBA 3VHXA 3LW7A 2ZRMA 3T5DA 4QBHA 1P7CA 1NN1A 2OUKA 1II8B 5FPTA 2VIIA 3QBTA 3W3AA 2GWHA 2IF2A 2ONKA 4PR0A 1PJRA 5TDHA 3HWSA 3JVUA 4LDJA 4GL2A 3SJCA 4QM7A 2JLYA 4M9XA 5BYKA 2O8EA 4OI0A 4DCSA 3U3KA 4E03A 1AS0A 3TK1A 4HAZA 1B0UA 4FD2A 1ZM4A 2GJSA 1G6OA 4M1KA 5EE1A 1OXTA 1G41A 4Q01A 2G3YA 2QMHA 4Q21A 4JYBA 1G1MA 2V7QA 4E09A 4AG5A 2PZEA 1XJCA 4Q1AA 3AEZA 3ASZA 1XEFA 1XP8A 4KO8A 4MITA 2V54A 3O8CA 1A5TA 1G9XA 3CPJB 1YR9A 4IEEA 3C8UA 4URYR 3W8RA 1VG8A 2JLQA 3UPUA 2ORIA 3A1VA 221PA 1P61B 3T61A 3QE0A 4PO1A 1YJ5A 5TARA 1JQJC 3QVVA 1SULA 5KUTA 1G4UR 1UDWA 4UNRA 3TVTA 2HCJB 2GXAA 4XH9B 4M1SA 3B7GA 1KI4A 2FNAA 4EJSB 3ZZ0A 2NO0A 2WJVA 1US8A 1KTVA 1OF1A 4UXHA 4BFTA 4G5RA 4AD8A 3TAUA 2NOAA 1CJTC 4A4DA 2J3EA 2AHOA 4RJLA 1F2TB 3GFOA 3NBXX 5ANRB 1QHSA 5JBQA 4TN1A 5EXXA 2ZRJA 2A3RA 2ATVA 2VP2A 2EFEB 3NEJA 1ZNZA 4IDPA 2AD5A 4BLPA 2XZPA 1QHHB 3HYTA 2AX4A 4TSFD 3JZAA 1L7VC 3UATA 4DSOA 5EJEA 5JS8A 1D2EA 2G77B 3Q85A 1XBTA 5A5GA 1IN4A 1IXZA 1WF3A 4HATA 4UNQA 5FR2A 1OLOA 1LFDB 4LHXA 4LSGA 1E9AA 4C7OA 4D4MA 4UJ3A 1E2NA 2IEYA 2WMOB 1Z22A 4TMXA 4ASUD 1E9CA 1XZPA 5FI0B 4M21A 4B33A 1E2GA 1CULC 3EC2A 4NHOA 2N1BA 1J7KA 4BRUA 3EIQA 1VG9B 1N0VC 3D31A 2WJJA 3LY5A 2VHQA 4JIMA 2BJVA 1IHUA 2BMEA 3CPHA 4ZV4A 3N2IA 2WKQA 4DSTA 3NC0C 1GTVA 2VP0A 2XOKD 3LVQE 5EQTA 4TYYA 1NKSA 4TL6A 3FHCB 4E22A 1JALA 1ZRHA 5J5CA 1JXMA 2H92A 3WMFA 2O5VA 2GZAA 3GEHA 4V03A 1TL7C 4IOLA 3CBQA 1MOZA 4C0BA 2QGZA 4NMMA 1E99A 2FDCA 1P4SA 5KYKA 1EX7A 4RCZA 3SS8A 3QPVA 4S2EA 5G3ZA 1YZQA 2QL6A 3X1ZA 2DB3A 3WYFA 1NMZA 3ZS9A 2VF8A 1ZU5A 2GEUA 3NDPA 3QEJA 4MKFA 2GCPA 2EQBA 4YC7A 3WP0A 3AF0A 1PUJA 2I4IA 1G6HA 3JZMA 4JKIA 2XXAA 1G7CA 5CDFA 4LJYA 1RRPA 1J8MF 2VSOA 1AQUA 3CH5A 3D7MA 2VYFA 4QBFA 1HE8B 1EGAA 2ANCA 2D74A 4OI2A 4A1FA 2BHRA 2H18A 3TW8B 1L2TA 4DKXA 2HF9A 2Q6TA 5EZ6B 2ZYVX 1EFTA 2NPFA 3ICQB 2C9OA 5HPYB 3C16C 4MGYR 3RRMA 1NLYA 3TSZA 2I1VB 1XWIA 4NU0A 1G3UA 2HJVA 2R2AA 3EZFA 3KJIA 3PVSA 4OKSA 3VMFA 3OEHD 5F9FA 1E94E 1DAHA 1ZUIA 4ZCLA 4D4KA 3SHFA 3DO6A 5B58C 1II0A 4P4TA 1E79A 2QQ0A 3ND9A 2PCLA 1YRAA 3DEFA 4LV6A 1T3HA 2WWWA 2RGDA 3VKGA 4PC3A 1KI7A 1YZNA 1JPJA 3F8TA 5HTKA 1G64A 4US0R 2GHIA 1OV4A 4Q4HA 4RFVA 5JS7A 3A1TA 2P67A 4Q4JB 5GJWC 1QVRA 2D2EA 1TF2A 4M9QA 1TU3A 3CZPA 2JIZD 5AUQA 2H5EA 4LI0A 4OQFA 4R7ZA 4C0LA 4RZ2A 2DBYA 4Q7JB 3CNLA 3KQUA 4U7DA 1S0UA 4WA7A 1E6CA 1SKYB 1PUIA 1CTQA 2BVNA 2HLDD 2JAQA 2VO1A 1SHZA 4FWTA 1OFIA 1TQ2A 1Q21A 5L3RA 4URUR 1T4GA 2QP3A 1N6RA 3CH4B 1HURA 1NLZA 1ELOA 1FMJA 4Z8YA 2G0NA 2X2FA 3NHBA 1IN6A 2CNWA 4PQRA 621PA 3FB4A 1UEJA 2GAAA 1XJ0A 3CX6A 5CDFE 2QP4A 1DVRA 1E2QA 5CB8A 1ZD1A 2ZJ5A 4ZPXA 2OCYC 3AF3A 2FSGA 1UAAA 2GXSA 3KUCA 1US8B 1E69A 421PA 4RFSA 1N6IA 1M34E 3BB1A 4CGZA 4JLAA 2KB0A 3GJ3A 4TZ6A 3X1DA 5K8IA 3W3ZB 2JA1A 2XJ4A 1TAGA 4NYJR 3GFTA 1E1RD 3G5UA 4JVLA 2D06A 3A8TA 1DAEA 1W0JA 1XRJA 4TLBA 3GJXC 5JWOA 3BFXA 2WKPA 5F98A 2Z6VA 1XD9A 3LXXA 2WIAA 3B1WA 4YMVA 1RYFA 1U0LA 1KDPA 2ZUBA 2FEOA 1XCMA 5ELXA 3QXSA 1O87A 2F9LA 5AJZA 1Q3HA 5KHOC 1NBMD 1E2HA 1GAJA 1NY6A 2AWOA 2OFWA 2XAUA 4PX9A 4DLXA 3IIMA 2DWQA 1NG9A 2UZ3A 4XWAA 4CT4B 3KB2A 3PEUA 1KNXA 3EWAA 4FCWA 2W58A 3GLGA 3U6BA 1A4RA 2IXEA 2A5DA 3A37A 4KI0A 3THYA 1R0ZA 1IAQA 2IXFA 4RVCA 4DUGA 1I2MA 1D6JA 1E9BA 4JJZA 2FFAA 3IIJA 5EXTA 5FTNA 3K70D 2PH1A 4TLCA 1XMJA 4OK5A 4LYJA 1GNRA 5KNDA 2QENA 3DL0A 4D80A 1TQ4A 2C03A 2QMOA 3K0EA 4L5BA 3CRVA 2QY9A 3H4MA 4Q9IA 1KIMA 3I8XA 4B2LA 4QM6A 4EJSC 2CNWD 1G4AE 2BDTA 4O25A 5CM9C 3RSLA 1CJKC 2HYDA 5AUOB 3UWOA 4JLKA 3B60A 2P65A 4TLAA 3U3RA 1DAGA 1NN5A 1W0KA 1T6NA 4D81A 1DTSA 2H8KA 2QMEA 2H1LA 3QI2A 1BOFA 4OHWA 1GL7A 3IHWA 4EPXA 4NL4H 3RHFA 4RZ3A 2KJQA 2ZSBA 3DHWC 2QRNA 4KBGA 4JLMA 4PQFA 2QN6A 4Q9LA 5LB4A 3W90A 1YR7A 3LO5A 4D6PA 2P3SA 1OFUX 1OFHA 2Q9CA 1SVOA 3V4RA 4JVMA 5D3MB 3TUIC 4D82A 1SVMA 2OESA 2W2VA 3CM0A 5IRCD 3MWLA 3H86A 4GZMA 2P5TB 4TYQA 3A6PC 3REGA 3I5XA 1K5DA 2XNSA 3PIRA 1FW6A 5JEEA 2DFKB 4NCJA 1AM4D 1E2EA 2A2ZA 3CW2A 3K9HA 2FSIA 3ADBA 2ZRNA 5JJLA 4Q4LA 2WBLC 2FGJA 2HUPA 4X8MA 3Q5DA 1FUUA 4Z51A 2D2FA 5CITA 3B1ZA 2FPMA 5DO9A 3VX4A 2GBLA 2ZYUX 1AKYA 1NF3A 1SXJD 1VPLA 4JSTA 4LBYA 4BZXA 4LRWA 4KJZA 4DSNA 3CRRA 1U81A 4PAOA 3TKLA 3H0KA 3F0TA 3GLHB 3SI7A 4R2IA 1KY2A 5DI3A 1VCOA 3SBEA 2IF0A 4Q4JA 4FMDF 3OESA 2VP4A 2BJWA 2GXUA 4N0DA 1HY3A 1I4LD 3ZYCA 5DYIA 4JLDA 3QXJA 2WWFA 3TRFA 1OKKA 2NTYC 4EKDA 1E0SA 1T5LA 1DPFA 2HEIA 1Z0JA 4LHWA 2AR7A 2L0XA 2ZI3A 1SVLA 4Q5IA 1P75A 4BFXA 3NDBB 1SQ5A 1UKYA 5CB6A 5KNBA 3N70A 3T15A 3U7EB 4PO8A 4YMWA 3X1XA 2ZJBA 5J4HA 3PEWA 4FCVA 4NBSA 3HYRA 3EZ2A 4FMBB 1FZQA 1OB2A 3U7GA 3BH0A 3M4YA 5GJVC 4N0EA 1XF9A 5G53C 1BYUA 1NMXA 1O3YA 1U90A 4IVQA 2OG2A 3LWNA 5KO2A 4BASA 4AKGA 1XPUA 2RAPA 1XD8A 3LV8A 1CBUA 4I1OA 4JLVA 1DO0A 1U8AA 3Q5EA 4RFSB 5H68A 4TQAA 3LQRA 3RAPR 2GRJA 3SDZA 4US1R 4KSCA 1KNQA 2JASA 1RJ9B 3U3OA 3IILA 3DPUA 3MJRA 3OEHA 3V00A 4C2UA 5CLLA 1KJWA 1RYHA 4XSGA 2YC4C 1NBMA 1MT0A 4TYNA 3SJBA 3GP8A 2MSDB 3CLVA 1AGPA 4CYMA 4US2R 2PCJA 5DIFA 1NLFA 2NG1A 2G83A 3LAWA 5KDOA 1U8YA 1VKJA 4Q4AA 2IYYA 1KZGB 2FOLA 3KB1A 3BAFA 3DZ8A 4IDHA 4DDUA 4DB4A 4Q19A 2FE4A 1P5ZB 3UK6A 1H8HA 4OL0A 1MABB 1GWNA 3FOZA 2DHRA 4JLBA 5FL7A 2DR3A 2C2HA 2ODEA 3K0FA 1UEIA 1EG7A 4DLZA 3KZ1E 2N46A 4KFTA 3A36A 2WJGA 3A58B 4HLUC 1SVIA 2OFOA 2R44A 1N6PA 4ZDKA 5A0FA 3SBDA 1KKLA 2AFHE 2F7SA 4Q18A 2ZQ5A 3BERA 3QKTA 2ZI6A 2PEYA 4Q48A 1NVUQ 3UG7A 5KU1A 2YZ2A 2IS4A 2D7DA 5KTYA 3OE7A 2CJWA 4UNPA 2O8CA 2IT1A 1JECA 4JT2A 1E32A 1EWRA 2YVUA 2B92A 2ERYA 5EP2A 3J81k 1GOTA 2QTVB 5C18A 5LD2C 1NNEA 2AWNA 2ZJZA 2EW1A 4IJMA 3SQWA 2AXNA 4GI7A 5A4JA 3DMNA 2R6GA 1VHLA 1Z5ZA 1H8EA 2B21A 1N2CE 2BV3A 2JLVA 5CK5A 1R0WA 2QAGC 4II7A 1KO1A 2GK7A 1II8A 2HJGA 2J1LA 2ZEJA 3EZ9A 3NTUA 1A2BA 1DOAA 3K09A 4PXAA 3AUYA 1OIWA 4A6PA 4RCYA 4X8HA 2C8VA 3K0SA 3AF1A 4V02A 3WXMA 3B2EA 2JLZA 1QDEA 1TU4A 2EFCB 4BFVA 1U98A 3UANA 3KTAA 3FVQA 1N25A 4TWZA 1BMFD 4LCBA 1KI6A 1UBGA 5GJBA 1C9KA 4YMUA 1KAGA 4W5WA 2ZTSA 1TX4B 3HR8A 2Q9AA 1E9SA 4LHVA 4MKIA 2QE7D 1KDOA 4I1SA 3ZLJA 4UJ5A 1Y3AA 4PC2A 2B6HA 2ZR9A 4MGIR 1ZNYA 3ZGXA 2X8AA 1E9EA 2CCJA 2MSCB 3DM9B 1GKIA 1ANKA 4IOJA 4RD3A 1PLLA 4IEIA 4DC9A 4HUTA 2BCGY 3O8RA 1ZBDA 1CF4A 1EFCA 3VR5A 3KXLA 3WNBA 1W36D 2BMDA 3GD7A 1NY5A 2W6IA 2HT1A 1I4DD 1XEXB 3HP1A 3S1AA 1YZLA 4JLJA 5LB2A 4MGKR 5DLQC 4ON9A 4O2RA 1D2NA 2BC9A 3ZS8A 4MUBA 3ZZUA 3C5CA 3CF0A 1IN8A 1EFRA 3BE4A 4RZXA 2EFDB 5KSZA 2MSEB 3EZ6A 2P6RA 2GCNA 3AP1A 3BC1A 3I4LA 2KE5A 1KI8A 1X6VA 3UWKA 1HEIA 2YYZA 1QRAA 4LYAA 4W9MC 1ZCBA 1LW7A 2F1JA 4DB2A 1E0JA 3CRW1 3WYAA 1TEVA 1FFHA 3ZVMA 2AK3A 2CVFA 2ZSDA 1H8ED 4LJ6A 3PR1A 3K70B 2C98A 2QM7A 3PUXA 3Q7QA 2UZIR 3B78A 1E79D 4HDQB 3T06B 1UBEA 1XX6A 3AGQA 1Z3IX 2IHYA 4GNKA 4F93B 1YZUA 2JLRA 3KQKA 4I99A 2WSMA 3JVVA 2ZIAA 5DSZA 4LBWA 2H16A 4F91B 2CVHA 2OT3B 1ZCAA 3L8YA 2BCJQ 4JMPA 5H1YA 4F4IA 4QJ3A 2VRWA 3OFND 5FTLA 3EA5A 4HLDA 1RJ9A 4I4LA 4B74A 2QBYB 2QPTA 3E5HA 3QY0A 1NN3A 2JGNA 5DHFA 3ZDQA 5AR1A 4WOPA 5CK4A 4EPRA 3VQTA 2XB2A 1RFLA 4URVR 2VP5A 4U5XA 4QNMA 2NIPA 3RABA 3PV0A 2QI9C 2AKYA 3L0OA 2QUZA 3L0PA 2VSFA 3CRQA 2QZ4A 4A0GA 3BH6A 4NYIR 3ZVRA 1CLUA 3HU3A 2PBRA 2OILA 4ESHA 1G5TA 4IKEA 2GKSA 2Z5FA 3ADCA 2XTMA 1TADA 2NQ2C 3RRZA 4KCGA 4GRAA 2YWFA 3WHKA 2C96A 4TMWA 1TF7A 4OK6A 4A0RA 4MDEA 3AH8A 3OF5A 3RRNA 1Q1QA 3B13B 1IM2A 2VBCA 1K5GA 3OE7D 4DDWA 1N3BA 1D2MA 2W00A 3QKRB 1G3RA 1ZNXA 4IDQA 4WZAE 4XWOA 3QSYA 5JMTA 4BLSA 3EAQA 3SOPA 1I2DA 3OAAD 2F1IA 1XTRA 4BLTA 2JJ2A 3KJHA 4ZDIA 3QXHA 2EFGA 3PUYA 4HAXA 2IA5A 1E1QA 1AQYA 3B82A 3P26A 2WZQA 4JLOA 1IJFA 5JI2E 1R2QA 2ZRCA 3QKUA 4IHQA 4KFSA 4LC0A 4ASUA 2QRZA 5J4LA 3LX8A 5L8VA 1X8JA 2JDIA 3OIWA 1P9RA 3TNFA 4NP6A 1UPTA 1KGDA 2P2LA 1IJEA 1XXHE 2QAGB 2W6JD 3K0CC 3VU9A 4DXAA 1E2LA 2QEQA 1VYVA 4A2QA 1GKYA 3GPLA 2J41A 4HAVA 4HAYA 3DOEA 2I3BA 4IFEA 1Q57A 1Z0KA 3QF7A 5LD2B 3L82B 2GVDC 5M04A 3FMPB 2FFBA 3CNOA 2ZRDA 5JHHB 2DFNA 4BFWA 2C77A 3MCAA 5EP3A 4M1OA 4XVRA 3SYNA 4AKEA 5CJPA 5FFMA 1GSIA 1OIVA 2XB4A 4W7SA 4DWJA 2MMCA 1W4BA 4FINA 2CHVA 4OHVA 5FUVA 4Q1BA 3THXA 4ZDJA 3IEUA 5DI9A 1YQTA 3Q8XB 1XDBA 3ZQJA 1JPNA 3O47A 1NJGA 1G7TA 2JJ1A 1HUQA 4A8JB 5C46F 3EG5A 2GXQA 4KYUA 1G8PA 1E1RA 2WPDA 2W2XA 3I8SA 4P3YA 1LV7A 4W5JA 1YZGA 2W0MA 1HT1E 3G82C 3K0AB 3CZQA 3LQQA 1V43A 2GNOA 3DZDA 1NIJA 5FL3A 5IK2D 1M1YE 1N6KA 2QPAA 3LW8A 4HUQB 1E2PA 3U7FB 2IHBA 1U99A 2FV8A 3AGPA 5FTMA 3U60B 3KUDA 3MRSA 1QVAA 4B48A 4K8OA 4Q7KA 1OH7A 3QG1A 1RKBA 4OHYA 4DLTA 1J90A 1ZJ6A 1AIPA 1Y63A 4HEJA 2FG5A 1ZVQA 5CJ2A 5EUMA 1U0HC 3I1FA 1XTQA 2ZSFA 4QGHA 1IN5A 3AKEA 4PSVA 4YDSA 2A5YB 3HR7A 2OO7A 3Q7PA 4GFDA 1HE1C 5CIQA 5SZKB 2G6BA 4HB0A 4MH0R 3M6AA 5P21A 5TY0A 3KKOA 4Q7MB 3RSOA 1ESMA 2BOVA 1X1RA 4ARZB 2JLUA 1JI0A 3NC1C 2YKGA 3VNUA 4Q1CA 3CWZA 1ESNA 3THYB 1M7BA 4TT3A 5JZVA 2QTFA 2W0SA 2V1XA 1B23P 4NE2A 1P2VA 4BUJA 1RRCA 2Z0MA 4P4UA 4DLWA 3SFZA 1M7HA 1OFTA 5E7IA 4TTQA 1G8GA 3VX3A 2IS6A 3IGFA 1OJLA 1GNPA 2RGNC 3BB4A 1FOEB 3GJ7A 3QEOA 4C0JA 2IYSA 5E7JA 1J99A 2BBTA 2VL7A 4PPGA 2DWOA 5E7MA 4JBYA 5DISB 1MKYA 2ODBA 1XEWX 4Q47A 3G0HA 3Q3JB 3UKDA 4G0NA 2WPDD 1T91A 1UBFA 3CX8A 4XTRA 1RZ3A 1FTSA 1MO3A 2W83A 2CK3D 3GQBA 4TL9A 2ZSAA 1Z83A 3MGCA 3PCRB 4RD0A 1T3SA 3X1WA 4L15A 1E2FA 3NG1A 2GA8A 2PZGA 3O8BA 1F60A 2JDID 3FKQA 5D3MA 2J7KA 1ZINA 4HZUB 4ZKDA 1DAIA 2YJTD 1PLJA 3SHWA 1M74A 1W49A 1NIPA 2ZETA 5HE8A 5FPKA 4URZR 1GZSA 3C15C 1EXMA 2WAYA 1KSFX 3DDCA 3IO5A 1TPZA 5IDVA 2QPOA 5FOSA 4O2LA 3AP2A 1WMSA 1W36B 3LFUA 4MKHA 2ZROA 5EXPA 3AVTA 1G21E 3EW9A 1JNYA 4NKRA 4U00A 2KBFA 2ZRHA 4NCNA 1H8HD 2C04A 1WRBA 1WP9A 3EIHA 2PJZA 3VR1A 5JFGA 3LBNA 2ZYWX 4A6XA 2HV8A 2HCBA 2GEVA 1NVXQ 1QHHA 3W5JA 4MA4A 4R2HA 1R5NA 3BOSA 4BPBA 1HH4A 3GLHA 4PZYA 4D0NA 1ZU4A 4Q9KA 1FP7A 4G3XA 2CHQA 4PZLA 4GMDA 4OYHA 3SYKA 2IS2A 4TSFA 4AI6A 1KI2A 2IBMA 2ERXA 1N5JA 1W44A 1S4QA 3MSXA 2CXXA 3RWOA 1YR6A 4C3ZA 1OH5A 2AXPA 5L3VA 2ZRKA 3BRWD 3THXB 5H8WA 1H65A 4JL8A 1JJ7A 4CIDA 3FDIA 2Z4SA 3NH9A 1JBKA 4QJ5A 3GCGA 5L3SB 1NI3A 3RC8A 1VCIA 2CDNA 2IX3A 4FW9A 2A5JA 1GUAA 2ZRBA 5FBQB 2B7BA 3CONA 2Q3MA 4URWR 1E9FA 2Z83A 2JLSA 3CB4A 4F92B 5TVKA 3E70C 3BFKA 2JATA 4BEBA 3EPKA 2GETA 1GITA 1FMLA 1VIYA 4YMTA 3AM1A 1IY2A 1RE0A 1Z06A 3AVOA 5UKDA 4FMCF 1W4CA 4YQFA 1YHNA 1SXJE 2RMKA 1Z6AA 2OE2A 1N6HA 5FR1A 3P32A 4GT1A 2EWWA 1T3LA 2OAP1 2R6CA 5FI1B 1NJFA 2Q9BA 4PFSA 4JLPA 2ZE7A 2B8TA 4PPNA 1LY1A 4F4JA 5GVSA 2J46A 1NG1A 2FMXA 2R6DA 1F3OA 1KO8A 3KX2A 4R98A 4TTPA 3U7HB 5IF9A 4TT3D 1Z0AA 3N5CA 1MABA 2IC5A 3BIFA 1ZMXA 1W2GA 3B1XA 2C99A 3M0EA 4C0AC 3T12A 3B5JA 3QKSB 4IXMA 1P73A 2JJ1D 3DMDA 5BYJA 1FP6A 1XXHB 4PO9A 1CR1A 1RRFA 2CBZA 3EIEA 3SJAA 3MWKA 2BM1A 2F43A 1KI1A 1AJEA 4ZDWA 2Q3FA 3TBKA 3NH6A 2ECKA 1AN0A 1QF9A 1SHKA 5CYOA 5KPJA 5G41A 1N0WA 4IRUB 3AVUA 4NDZA 3Q72A 1PZNA 3EASA 5IK2A 3WY9A 3ZD7A 3ZIAA 1N5IA 2BBWA 5D3QA 4BFYA 3B1VA 2BMFA 3CPEA 4LYFA 4BFSA 2WJHA 4QGFA 5E95A 2ONJA 4C4PA 1XJQA 1T8TA 4WZBE 2O8FA 3SJZA 2FFHA 4RZUA 1R5BA 2XJ9A 3W6NA 1P2UA 4P4SB 1PLKA 2V9PA 3D6TB 1N6OA 4QOSA 4WBSA 5BWMA 3NBYC 4AKIA 2WAXA 3GJ6A 5AK0A 3KQHA 2O8EB 2FA9A 2E1RA 3OFNA 2V55B 4L16A 4NYIQ 5EE9A 2REXB 1IN7A 4WAUA 4RKFA 5EE5B 4NYMQ 1NBME 2PEZA 2JLWA 1CRPA 5FL7D 2ZI4A 3QENA 2F1HA 4OI4A 4BLQA 4CEJB 3BBPA 3NBFA 2V6JA 1P9NA 5AJWA 1SGWA 5FPYA 4B2PA 3D8BA 1XNJA 3DKVA 4G01B 3SN6A 4DBLC 1FX0B 1Z2CA 2IEZA 121PA 1E0AA 5F2EA 3MD0A 4G5OA 1NL3A 4DIDA 2KSQA 2DY1A 4JBWA 4KYIB 1XTSA 5IHPA 1DBSA 2RB4A 4JSYA 3THOA 2QROA 5HKKD 4MRNA 5JRZA 2VTKA 5KPDA 3WMGA 1FL9A 4KFUA 1W5TA 2VSXA 1JR6A 2A5GA 1IOZA 2IW3A 4P31A 2ZI7A 4TL7A 1DEKA 1M6NA 1Z0FA 4EJSA 3T1TA 2DYKA 5DNYB 1D9XA 2PL3A 3SU8A 3OIYA 2ZS7A 4LJ4A 4QC2A 3PEYA 2O8DA 1JJVA 1KI3A 1GM5A 2P0EA 4Z1MA 1QZXA 5BN5A 2F6RA 2J0UB 4QBIA 1TUIA 2XEXA 2QSZA 2RGXA 1KMHA 4N1AA 2D3WA 2JJ2D 5DYGA 3GJ4A 5H70A 5JSZB 3GLGB 1ZM3A 5AWFC 3X1YA 1SXJB 5JLJA 1DG3A 2GILA 1DAKA 2GJKA 1UM8A 2IYWA 1ZC3A 4Y0AA 2WOJA 3H84A 1KZ7B 3R7WB 1IXSB 1E2KA 4A2WA 2Q0HA 3C41J 4V0OA 5L3SA 2RCNA 4LYHA 1W47A 1HT2E 2GVZC 1SKQA 3F5FA 4V0LA 2PX0A 2VHTA 3IPYA 5KSPA 3PJRA 2OXCA 2P6UA 4HZIA 3QOFA 1CKEA 2C9CA 4PANA 2OXRA 1P62B 1G17A 4Q9JA 3WYGA 3NWJA 1CS4C 4A36A 3BFVA 4DCNA 3BWDD 4Q02A 2GJ9A 4XVQA 5DH9A 4RD1A 2Q21A 5KDLA 2F3RA 2G1KA 3U4QB 2BEJA 1HTWA 2H57A 2ZS9A 2QTHA 1VHTA 5B64A 3B1YA 1DE0A 3LLMA 1XB2A 3I92A 4PC6A 4QJ4A 4CVNA 1OT3A 2PMKA 1XCPA 1XEWY 3DOFA 1Q22A 3U3MA 5E3HA 4YDHB 5FOTA 4DLUA 4BWYA 2QORA 2WKRA 1KDRA 1OXSC 2JJ8A 2OCAA 1WXQA 3NBZC 1DG1G 2IYZA 3HJNA 1TTTA 4AKHA 4CEHB 1RIFA 1R5OA 2OEPA 4ERNA 2FH5B 2OAQ1 1ZUNB 4KLNA 1V5WA 5KSOA 1R4AA 3THWA 1P2TA 2ZE5A 3MMPA 4AK9A 4PPQA 1IONA 3GLHE 4A2PA 3P4YA 1JAHA 1TMKA 4EPYA 2F43B 3K9GA 5DI3B 1ZUHA 3CRMA 1W46A 2PT5A 4DLYA 3R9XA 1CRQA 1KJYA 2ODWA 3KXKA 2A78A 1E3MA 3FE2A 4FXPA 5TV2A 5J47A 5JECA 4IW3B 2GJ8A 1VG0B 1ZM2A 2WSSA 1GL6A 5BXQC 2ZVQX 2FEMA 4JYCA 3KKPA 3RYTC 2ZU6A 4NTZA 2YWEA 4IDOA 4DIEA 4P32A 2YNMA 1JR3A 4C0SA 2RGBA 4LC1A 1Q1EA 3K09C 1ZYUA 4BFZA 5TMPA 4GBMA 4M4SA 3W9YA 4Y0VA 1R0XA 3BGWA 2CEAA 4LJ9A 5C4GB 2J9RA 1SVKA 1E2MA 1QHXA 1E9DA 1GG2A 2CLSA 3Q9LA 3TVDA 1ODFA 4XWKA 3TSWA 5HKKA 1AKEA 4MYCA 2ZRGA 3ZZTA 4LV8B 3AB3A 4UQOA 4I81A 3KKMA 2RHMA 2GCOA 4R9UC 2QGNA 1Z29A 4NYJQ 2IK8A 5CM8B 1RRGA 4MRPA 4C7OB 2AFIE 3K70C 4AYXA 4D0LB 2H7VA 2LCFA 2Z43A 1KO4A 5AJXA 5JCPA 3U44B 5DN6D 4ZCIA 4BGDA 3QJYA 1TQDA 1OW3B 3TAHA 4DRZA 3AVXA 3OZXA 5TXGA 4TYWA 1MV5A 1MH1A 4UXJA 5FTJA 4YONB
chains in the Genus database with same CATH superfamily
4F4UA 1KEKA 4R83A 1ESEA 1WG8A 2Q1UA 1WNFA 2V7PA 3CF6R 3GUCA 4LX0A 4WEQA 5KVSA 4X41A 4LFBB 2H6EA 5CH8A 1CZUA 4NZMA 3SFVA 3ZJ5A 1QE3A 4RQAA 4BB6A 3GO4A 3L0YA 5DV9A 3WKBA 1H3NA 2E4AA 1NQXA 2J59A 3C3PA 5JWRA 2JKZA 2N0SA 4LYYA 1UOEA 4G1UC 1Y3BE 5K3AA 2O2YA 3HSSA 4PPFA 5JATA 2L69A 4QHSA 3DULA 1JU9A 4MA5A 2BGJA 9LDBA 2AV6A 2D00A 3PQ6A 5K45A 2WHPB 5BVGA 5AMXA 5IASA 1PHPA 4PSKA 2BGMA 4CMCA 3SEAA 5AOBA 3LLUA 4Q37A 1IY1A 4D56A 2ZUEA 2GS9A 4LG1A 1IK6A 2W2TA 1VDZA 3PS9A 1TIPA 3K15A 3K8YA 5AT1A 2IYQA 1JKMA 5K2MA 4C04A 2VJBA 4FFPA 2YJ5A 5CVTA 1BOOA 4DJTA 4I08A 2B83A 3AG6A 4UATA 1XPOA 1JEYB 2FZLA 5FFNA 4TX1A 3ZU3A 1NNUA 1P6XA 4CIWA 1KVUA 3ETHA 3LUFA 3WDMA 4P98A 5EP1A 4ARSA 3ZWQA 1OKKD 2VP6A 4JJ8A 4B44A 3FFXA 2R5FA 3BORA 4O2BB 4O4JF 4X1OA 4QASA 1EVLA 2DPYA 3GRUA 2FN4A 4R9RA 3MEQA 5K0JA 2UUBB 4JJIA 1XA4A 3NVMB 2WFMA 3HL0A 4HAIA 1I4EB 4MW6A 2WWXA 1LI4A 4Q7LA 1G60A 5BN3B 5C8YB 1GUFA 3AR6A 2NO9A 2P4UA 3MRVA 5JO0A 4X65B 4JLNA 3R7SA 1MOQA 4OI1A 1VMEA 1T2DA 1ZJZA 4GMHA 4DYDA 3EIWA 1QANA 2XDQB 5CIWA 4BN5A 4D8YA 1EMDA 2ODNA 4M1MA 5D7BA 2OY0A 3JQDA 1UK8A 4K7JA 2G9QA 4UHJA 2YS7A 1L7RA 4FONA 4GX1A 3QMWA 2R6AA 5C1DA 3I83A 1PJTA 2BP7A 3K9FC 2PUAA 2FZEA 2ZUSA 3CLKA 2ZB3A 4DT1A 5I01A 2W6QA 4BECA 4DMRA 1OLXA 2GVNA 3FH0A 3L7MA 2VAXA 4XCVA 3JASA 3MHTA 3HXMA 4P4NA 1TI7A 3WJAA 2NO7A 4CTNA 1U8FO 4RF4A 1E8DA 1Y7TA 2Z56A 2Z95A 3CJTA 3P20A 4RLFA 3DUWA 5AI6A 4CR6A 5K0FA 2H07A 2HK7A 4UPVA 5EQDA 2VUSA 1BRMA 821PA 2ZJ6A 1JA1A 1O0SA 1YJBA 4MR7B 2F4NA 3I05A 4L8GA 5BP7A 5FOUA 1BD3A 3ELYA 1K7FB 1XEXA 1M6VB 4I36A 1YS2X 4IJVA 2JGFA 3NV7A 2QE7A 2Y0BA 1I7QB 1QOQB 1CJVC 3DC7A 2PD3A 1P91A 1G55A 3IKVA 1P3Y1 1SCIA 1UDBA 2FPRA 4I7EA 4PZZA 3BL8A 3Q40A 4PCLA 1YVRA 2ZW9A 2OCXA 5KTNA 2ZZKA 3HI4A 4DA0A 1DKOA 3DYIA 4OB8A 3KPYA 1Z2AA 4BAGA 4C7BA 1QGOA 5B30A 4TUYF 4B73A 3E9QA 3IUYA 3K92A 3PXAA 4KVAA 1GZVA 1NXTA 2R96A 2GF9A 4M0UA 3ET4A 4E07A 3AF2A 4ER5A 1EGMB 2JZNA 2Q8QA 1LS1A 2HA7A 2CHUA 3EVCA 3LUBA 3OIUA 3BFJA 3F96A 1E98A 4N3NA 4U7JA 3HJAA 1WHTA 4MXDA 2XZDA 1QBKC 3ZU5A 3IMKA 1OYWA 3UJ9A 2CHGA 2GPJA 3I04A 2CY0A 1IWPB 3T5CA 4DV1B 4OQMA 2RDMA 4ZOLA 3D6JA 2HA6A 3DBHA 1T34A 4WL0A 3T1NA 1VJTA 2YHSA 3D0OA 4G84A 4C0HA 4GS5A 2IBTA 1LF5A 1SVWA 4PPYA 2OZEA 5B12A 3ND6A 1QYDA 3UH0A 4G1EB 3DE1X 4UQPA 5JH7A 1QG2A 4KQJA 1XPRA 1HTBA 3FHTA 3HVUA 3PQ4A 1K6EA 4BJ3A 2RAVA 2CNOA 2OFFA 1VCMA 1Y8CA 4PAQA 2CK3A 3VKVA 2QQGA 1MX3A 1K97A 3RVNA 3FTFA 3BSFA 1OGYA 1XK6A 4IHAA 5BT9A 1LQUA 3DD1A 5THKA 3R7NA 2R1TA 3HLKA 5J5AA 3U39A 1SM4A 3EBOA 1L0BA 4UBJA 4DCUA 2J32A 4HVAA 1PL7A 1VJCA 3TKYA 3L43A 3NYQA 2Q2QA 3C87A 1HX7A 3W8NA 4IIUA 2PR7A 1LLQA 3E1GA 3KPUA 4AECA 2BM0A 4R16A 2LWIA 1HT3A 1P4JA 2WUDA 2O2SA 1Y9JA 2Q0QA 1P1BA 3ICWA 4NBRA 3TDKA 1E1NA 1EX6A 1WZIA 1ZMRA 5K0NA 4DBLE 4DLSA 5JADA 2WLTA 2WHEA 5FWYB 2REOA 3VR6A 2JFBA 1I14A 3GIDA 1L7QA 2BIFA 3KQQA 3PDJA 4QLAA 4W63A 1DHTA 4MIKA 5LP6C 1Y42X 3RKSA 4CQMD 3VSDA 2PXAA 2F90A 3ROQA 3AVWA 2HLDA 3VH1A 3RDPA 4LHYA 2R8RA 1NQAO 2RGEA 3EBPA 3C3EA 3I6IA 1SOMA 4IOMA 2M6LA 3VZDA 1GL3A 4EG4A 4C78A 1AO0A 2F1RA 2P3LA 4H35A 2C9DA 3EIFA 4XWTA 4GQIA 4JEIA 1GU0A 3R8FA 2IU3A 4MV9A 9ABPA 1O95D 5A71A 3SEFA 4IP0A 4HQRA 4JROA 1EZ4A 1JHYA 2CE7A 3LFHA 4BOYA 2NPIA 5FHQA 3N8GA 2REBA 1KHHA 4BQOA 4J6FA 2D3TA 1DARA 3NIBA 3FMFA 3OLYA 4MKZA 3UBTA 4OFWA 1DINA 3BXZA 3VUFA 1C7IA 3HKDB 2VDPB 3ZY2A 4CEIB 2PS9A 4HDAA 3KSAC 3MWJA 1JQ3A 4XFDA 1GNLA 1HNXB 2Z5GA 2UUPA 4JT8A 4IIFA 1R4MA 1Z5OA 3O8NA 1GEEA 3VU9B 2PVCA 1S8OA 2IUTA 3NBKA 3QFTA 5JZBA 1BXZA 1JX6A 2OOKA 4J1SA 3UJDA 4OBXA 2B5WA 1C9JA 2IL1A 3DEJA 4G9EA 3SKYA 1ODSA 1CETA 4AMZA 2HMTA 2YFHA 2MSLA 4EHAA 3IHKA 2H1SA 2NU8A 2ZJOA 3TLJA 1ZSYA 3GLIB 4ZANA 4NPAA 2PSDA 4I5DA 4B3BA 3GT0A 4EPTA 1DX9A 1KU0A 1F0YA 4HYYA 4OTZA 3DG9A 4RK6A 4TRMA 3WAGA 4I5EA 4YQZA 5B2FA 1LWNA 1KQPA 2LKCA 3PXDA 4UEOA 3Q9NA 1W36C 3EHDA 4WXEA 3N8NA 1E2JA 4RHEA 1XVUA 3B5IA 4KODA 4FU0A 1NR7A 4QYXA 1PWYE 1YNSA 2WYOA 4HCJA 2QRGA 4PG8A 1DP4A 1Z6YA 4AN1A 5EJ9A 4WOKA 2WUGA 1NLUA 1VECA 4XRGA 3EIOA 3PPYA 3CZMA 1S2MA 1YGPA 2QN3A 4JC5A 3DOCA 3A2NA 2JIRA 1FC0A 1Q44A 2FI1A 2HDNB 2VDOB 2IDJA 4P3NA 3S7ZA 2GX6A 3TI9A 3AF4A 2A4KA 1VBFA 2DUWA 3GN2A 3PD1A 4PC1A 4QDXA 1N7JA 4WZAB 5HZHA 2VHUA 4FIDA 4CM9A 3EA4A 1IPFA 1P45A 2I1LA 1DQYA 2ZIXB 3KJXA 4RQTA 5DSTA 5A02A 5LQRA 1GHTA 3G2PA 5FOXA 1R4NA 5B1SA 4CHGA 6REQB 4ICIA 5JARA 5IVDA 3PQDA 3Q9UA 1X3SA 2FQXA 3M6WA 3N86A 3RWMB 2WI8A 2BUAA 2P5SA 2NZ2A 1FX0A 1NUSA 4V0MA 5T4FA 5I7OA 3PC8C 1VB3A 5ENVA 1KK3A 5FBRB 5IAJA 2IBSA 2JCXA 4ABYA 1KYTA 3S2EA 4D9FA 1BWPA 3RS3A 2OD9A 1CEEA 4TYPA 5FPHA 3GH1A 4EABA 4KR2A 4HRVA 2OVFA 4L9AA 2JANA 1UQUA 2V6GA 3GJ0A 4MRVA 4YR9A 5SZJA 4BNJA 1C4OA 2FQ1A 1XMVA 5KYWA 5F7ZA 4PNZA 4HLCA 3GZ4A 3WBJA 3LVBA 4CKBB 4EPVA 5JXWA 2UYCA 1NFRA 3IMEA 1AXRA 4HT3B 4FMCB 3BKXA 3LT2A 4D0SA 4PZAA 2EFHB 3OZTA 2UXDB 5EQJB 1N2XA 3SQMA 3KJNA 4C4TA 1ADJA 521PA 2CDAA 3CZ4A 1J25A 1WQ4A 3HM2A 2UYHA 5EZQA 2G72A 4RM2A 4U7GA 1Q20A 3KZNA 1W5EA 3TSOA 2DQ4A 2H17A 4DOMA 4YP5A 4DCCA 3SC2A 1CT9A 5JE8A 3O82A 2J31A 1K6XA 4GQAA 5A3RA 1VHWA 4CLDA 1EWQA 3RWBA 1FFXB 1FTQA 1D5WA 2BT4A 3OT1A 2ZBVA 1M8PA 2BJHA 2OHGA 1JR3D 2C7VA 1X7WB 4HQLA 3Q98A 4HSEA 1Q92A 1GFSA 3FN4A 4WZ6A 5E4TA 1X1SA 2CFSA 5BOVA 5K0LA 3HV2A 1T4DA 2PS0A 2WQZA 3VNSA 4B4KA 3E8SA 2ZE8A 5E3IA 3OZBA 5T3UA 1BN6A 5FH9A 3A0RB 2GAJA 4NBNA 4EY6A 3PGVA 4XGRA 4RXTA 5E0OA 2ZM5A 5JAHA 5JYEA 3QV2A 1TB4A 3NU1A 3NXSA 3KYCA 4RGBA 4L4ZA 1F06A 1U0NA 1WHSA 2X4DA 4HRYA 1Q0QA 2OZLB 5K51A 1ZD5A 3GQBB 1A5AB 3GOQA 2ZWIA 4MVJM 2Q7XA 1JQ5A 2D7JA 2N1MA 3ZWAA 4AWAA 3TL3A 3U4QA 3MS4A 1KSJA 4UNSA 4CKCA 4BRWA 1P29A 3FG9A 1O5OA 5HX7A 1SUAA 5AVRA 4N48A 2FN8A 1E3DA 2EBFX 2UYYA 4IIGA 1KMQA 3W9SA 2VP3A 3ZJYA 2BRUC 2HZ7A 2YRFA 4C43A 1GR0A 1T9KA 1HQYE 2VLBA 2Z2ZA 3FTCA 1QLWA 3B8HA 4EB3A 3HUTA 4KL8S 4KV9A 2HAEA 4BE7B 5A7HA 1Z25A 5I9MA 2HX1A 1E1QD 4GWLA 3W06A 5IDYA 5LJIA 4XLTA 4BNTA 4DTCA 3ZGVA 2HRBA 1CR4A 4XYGA 4FSHA 2PKEA 3R9KA 4CKEB 3PENA 5KC9A 4LNUA 2JLXA 3W5AA 2IPOA 3EA0A 2AZ4A 2YOGA 2NZYA 3TE7A 4R8SA 2K4MA 3FZEA 1X7GA 3FIUA 2CMKA 2PO7A 3IB6A 3DMGA 2AG6A 3NIFB 4KU4A 4YYZA 1C0LA 1MR3F 1PT6A 1FYWA 3KQPA 4OGWA 2FPGB 1YI1A 4FDMA 1JBEA 2GD2A 3C7KA 5B58T 3J81A 1GDTA 3SR3A 4XRRA 4C5AA 1IY8A 1BS1A 2HRRA 3SF8A 1U28A 4KAJA 3AX6A 2DC1A 3ONNA 5CGZA 5LZ5A 1RBQA 4PY2A 4ZXFA 1JLKA 4QPZA 1K8YB 2XBLA 5KCZA 3JYLA 2VZEA 3R20A 5G3YA 5KAPA 4HAUA 4HNAB 4BNFA 4LJRA 2ZSEA 4E0BA 1G3QA 1KKMA 3PC2A 3OZSA 1AKNA 4DIFA 1T2VA 2XSZD 1XZBA 2QVZX 3HRHA 3MCZA 3WKEA 4A0SA 4W5QA 1C0KA 2BD0A 4WN3A 4JR1A 1PNRA 4JD5A 3MMNA 3FTQA 1TZJA 2XW6A 5DGTA 4E7OA 4AZ0A 4KFRA 3BBLA 2BKAA 5G02A 3ZHYA 3F5QA 1E77A 3NAGA 2AOUB 2WD8A 4YQEA 4O08A 2D2XA 1J21A 4YLGA 1QUEA 2GK3A 4JVSB 2CCKA 3MUFA 1FXWF 1PEYA 2Q3HA 3GDFA 3LKZA 1SIOA 3OCJA 1MRNA 3SYLA 4YT4A 1DZIA 5H80A 4JFAA 1CJMA 1UKVY 3CFYA 5ED0A 3U4HA 3ZUPA 3QVWA 4BO7A 3SFTA 1ENZA 4C3OB 5FIUA 4MULA 2B1QA 2IWHA 1ZO8A 1DC5A 2RI6A 3BKWA 4IL5A 4CTMA 2HB6A 4MARA 1VYUA 2EX1A 3EVDA 4BKQA 1WKCA 3GVCA 3GU3A 4QEZA 3L6OO 1F12A 4LBVA 1RAAA 5K3SA 3T9BA 5KQGA 5JCZA 3A1WA 1OBFO 3ETDA 4UBNA 2NZ8A 3PEEA 4RV5A 3FCSB 1KQOA 4G89A 4FGJA 3AESB 3JWHA 5B1HA 1T9CA 4E11A 4K03A 2M1ZA 3FNRA 1W4RA 5JRDS 1PQYA 2QTTA 1A97A 4WKBA 3EEBA 3UFXB 5DRYA 2IUSA 3I4FA 4PCAA 2BBOA 4PG6A 2RBEA 4TLEA 1XMQB 2PJUA 1A7JA 2JCSA 3L6DA 3TQTA 1TFRA 1QGZA 3MLEA 1AUPA 1MC4A 4R7GA 2RGCA 2RJNA 4KIGA 2SCUB 4MWEA 2DBZA 3JD4A 3O03A 4O5AA 2J3LA 3AP3A 5KREA 3ADPA 5DTMA 5KYYB 3Q0TA 1I4WA 2D59A 4RHXA 1GDHA 2POQX 3PHBE 4JQYA 4J3JA 5EHNA 3VR2D 2Y2VA 4DR1B 3L1HA 1R12A 3DP9A 3FOBA 5T64A 3PXGA 4HDRB 1TLLA 3R9IA 4M8LA 1SZDA 4MUHA 4BB0A 1ONNA 1JAIA 2QD1A 4N6NA 1CJUC 3B8EA 3OA0A 4XIGS 5DCUA 4RD6A 3BHJA 1ADCA 1T9AA 4DLAA 1KO7A 1P9OA 3ABIA 1R0BA 1EWTA 2CLKB 3C43A 1ZW6A 4ZO4A 3TXAA 3WDLA 4PGHA 4I6EA 3V46A 1VGVA 2HUNA 5B3LA 1TK2A 2G36A 1TIBA 2KBEA 2V5UA 4KWEA 4RKEA 2PQ0A 4QD3A 3N2EA 2PMCA 1UADA 3IAEA 5DN6A 5FOWA 1EFRD 3EGDB 3HGQA 1YJQA 3AQIA 3NWBA 4P4SA 3OM8A 4R6XA 1Z08A 2ICAA 1CG6A 3BPSA 2ZBGA 4M1WA 4V0SA 5J2UB 1BWSA 4K81B 3TEMA 3RYFB 3HDJA 4DQXA 1G20E 3X3HA 1ZMBA 3CIOA 4HBGA 5CBPA 2F3PA 3H5IA 3NKVA 4C7JA 1E2IA 1YA6A 2PVSA 1XU7A 3D5QA 1GYPA 2IH4A 2FG7C 4A92A 4L95C 3SZRA 3JQ9A 4L5JA 1LX6A 1QWSA 5FB3A 1ZGAA 5L3QB 1TAHA 3OHPA 3CH7A 3GYGA 4X93A 2W8BA 1M6YA 4WERA 1QG4A 4KR0A 1UAYA 4G0ZA 2CEKA 4OOEA 1HM5A 2V1UA 2D5CA 4OHXA 2NMVA 1VA4A 2CL0X 5JRJA 3I72A 3FTNA 1H0KA 4C7KA 1SCDA 1AGRA 1P2BA 3OWOA 1G21A 1Z3CA 1G20B 1FYDA 4H3KB 1QQ5A 4GWGA 4FCCA 1NR5A 4YMSA 3HMKA 3RFTA 5I8WA 2C84A 4HWPA 3WNQA 4DQVA 1TEXA 1Z6GA 2WJIA 4DIUA 3UG6A 2D0OB 2QM3A 3LY9A 1PJZA 1BEUB 3LY7A 5L3ZA 4X8OA 3WL6A 5JAZA 2JFHA 5DX1A 4TL8A 5ERXA 2IIPA 3U61B 2O0KA 1JEOA 1Q16A 2ZS8A 3C6ZA 3CB2A 3H8SA 4K46A 2I7VA 3ER8A 3V8PA 2CLLB 4D57A 4EDFA 2XWQA 5HF6A 1KI6B 1PW5A 4UCFA 5CX1A 2UZAA 4XDHA 2GZ3A 3GQVA 3NT2A 5T6BA 2JF0A 4E5MA 2O14A 1XTKA 4MROA 2BHSA 3ZLVA 3WIBA 4GLFA 1SBCA 1B14A 4NU8X 1GDDA 4PSAA 3CLSC 2I7XA 3D2AA 2J0UA 3TPZA 1RZVA 1E6MA 3IQEA 3HP4A 2GHQA 2VDJA 2XRFA 3JARB 2P11A 3B85A 4G8DA 2ANBA 1U7OA 3N0TA 3BMCB 2BKUA 2F3SA 3JW8A 4QGAA 4YXFA 3CF2A 2JFVA 1E4VA 4C2TA 2C2KA 3CVOA 1M5RA 2AS0A 1D8TA 1F2UB 4KK3A 4LXQA 4AY4A 5C4MA 2OKCA 4POOA 2CJXA 4BLOA 4FBMA 4Y9UA 1FY2A 1SBYA 3PXXA 3OICA 4J1NA 5EMHA 4I3HA 4LJ7A 5KSYA 1XKTA 3MM4A 3TEJA 1V7QA 4QJIA 4ZT4A 4LXYA 4OP3A 4CUZA 5C5CA 1GTG1 1CY2A 5C7YA 4JQSA 2VJKA 4KDFA 1EVZA 4U9IS 1B74A 3TMYA 4ZCRA 3IQFA 4DLRA 1R0YA 5J1SB 4DFDA 3WB1A 3TCNA 1Y8RA 2ET6A 3ZYZA 5ALZA 3ADKA 4Z9BA 4B43A 4DR6B 4EUNA 1YC2A 1QK5A 5GADl 1G3IA 4U2KA 3BSYA 3H2JA 3AI7A 3ILSA 1EFDN 2XE8A 3CG0A 3CRNA 2X0EA 3VOSA 3RYIA 1YRBA 3NHWA 3EGVA 3PA6A 1U5BA 3OCUA 3S2UA 4ZVNA 1X39A 3EZGA 4D9MA 4XSHA 3U49A 2I1WA 4WPGA 1Z68A 5CW1A 4B5KA 2J7PD 2BISA 1PU2A 3SSNA 4QKQA 1QU2A 3E8MA 1GTL1 4U9UA 2PUBA 3K4PA 1JTVA 1U80A 5EEHA 4BLVA 4BV2A 2NAPA 3E53A 3FMIA 3I8OA 4LZAA 3LTNC 4O5OA 2PSHA 4KBYA 1G5FA 2Y99A 3X0DA 2GZHA 4ZYLA 4HQ6A 2PGJA 2ZZMA 3I3SR 3LOQA 4ETWA 1Q15A 1QDUA 3N3AC 3OEWA 3DHVA 1G8HA 1EBFA 4K9SA 4QVGA 4WUVA 2ZIVB 4CN9A 1OYVA 3W0LB 2F3UA 4NZNA 4FTWA 3PTLA 1YFKA 2O8VA 4GC5A 3T3MB 3N74A 2JHFA 4II2A 1CY1A 1SU6A 1WEKA 4Z7JA 1MQ9A 3UBMA 3AW9A 4NCIA 4NEGA 3EX7C 2IKQA 3F5MA 4O02B 3A4NA 4PGGA 4WGFA 1U0JA 1TIKA 4WV3A 2WYHA 1FZTA 1YHYA 4JZYA 2X0IA 4TV9A 1D4OA 4DSZA 2GN0A 2Q5JA 2ORWA 1PFUA 4NQRA 1BVRA 2QQFA 4EFMA 3T7RA 3UIEA 3UOGA 4QYIA 1DV2A 3PDIA 3OZDA 4IDNA 4NR0A 5EWMA 2A0FA 4L1KA 4KC0A 1N2IA 1LNQA 2HJWA 4MI1A 1NXPA 1JJIA 1BQ4A 3GA0A 4LRQA 5C3MA 4V1CA 5K6TA 1YUMA 2YINC 4MPJA 5E6SA 1YR3A 3VZQA 5CXXA 1F6BA 1IZ0A 2BZSA 4J7XA 4WN9A 4N0QA 5FUMA 5JY6A 1Z62A 1ZC4A 1L1RA 3DKKA 1WCYA 2OR3A 3EH1A 1R88A 3BCUA 4FFNA 2XOKA 4O4JA 2XIQA 1G8FA 1L4BA 3TECE 2TMKA 2XA2A 3MS2A 2D1QA 3A4MA 4JSRA 4RK5A 4NCXA 3RC1A 4HI0E 1QG6A 4M8NE 3OTWA 3R3WA 1UK9A 1G63A 4FLMA 4UVHA 3UJ7A 4C30A 2HK6A 2V8OA 3AUAA 2J6BA 3EVEA 1OXXK 1Y5IA 2OV4A 3HU1A 2BGGA 1YMQA 1M10A 2V7VA 3ETNA 4RH0A 4AN0A 1CY7A 2GESA 1THZA 3R0VA 1N2CA 1GTZA 3PQCA 4J2HA 4QTTB 1N4DA 4B3FX 1U0BB 3HDGA 2ZTUA 1ZI8A 1Y7PA 4B40A 3FUWA 1IXRC 1CJSA 1HGXA 2FRDC 4L3VA 1CUIA 4L0DA 4RJIA 4BJ5A 4ZGBA 4FFBB 5SV2A 1O54A 3P9QA 2PUCA 4DHEA 2XTJA 3QFCA 1U2SA 1V11A 4FYHA 4QHTA 1D04A 3THXA 5IJ0A 1AXEA 1ULAA 3DB2A 4PR3A 3UYLA 1XA0A 2LP4Y 5REQA 3I76A 3I12A 4BX2A 5KVCA 2WIGA 3KLMX 4Z1MD 1IC6A 2UYGA 5BOSB 3QWFA 4LZLA 5H3CA 1USVA 1BWQA 4RULA 1D4FA 2VRCD 2ZI9A 2NTEA 3TD6A 1XTIA 1JIXA 1C3LA 4YHHB 1J2EA 4NEHB 2VYVD 3PWSA 4IMJB 1YTUA 1B8OA 1IB6A 1JQBA 1YQUA 4JXZA 3UAWA 2E21A 1QE5A 1XXLA 4D4JA 4QXOA 1UAGA 1ID8A 3II6X 4L5IA 5C81A 1FP4B 4HNVA 4UOQA 1OC2A 3AY0A 1CZKA 1HYQA 3T99A 3UJPA 2XX3A 4YA6A 3GRAA 1O94C 4HB3A 1YDMA 3K9QO 1ILWA 1XAHA 3H65A 5NLLA 4B6EA 3AJAA 3L18A 1SUBA 4J9UE 4PONA 1V8PA 1RTTA 3MN1A 3SLGA 2YNMD 1NU8A 2XITA 2BTQB 4IZ6A 4PLYA 2YJGA 1LBQA 5IWAB 2VNAA 1XZNA 16PKA 4E21A 4G1CA 4PZUA 1IUOA 3LPAA 1MIOA 4G0WA 2NW6A 4FWIB 3NEAA 5CCEA 3FI0A 6Q21A 2XNKA 4BFUA 1C29B 1EUCB 2W4IA 2FJUA 1QAMA 4AWBA 1XMIA 1EK2A 1KZ6A 1FSSA 2P1ZA 3GJ5A 5I8ZA 1RP1A 4MYUA 5D1NA 2ARKA 3C1UA 2VF2A 3R3VA 4TKVB 1T3TA 2NGRA 2QX6A 1XZGA 2C5GA 2JAWA 1JHVA 2Q41A 1DWOA 1U8CB 2QY6A 3PDHA 1Y8QA 1JT9A 1X8LA 5D6OA 1NJ5A 3I2HA 1OREA 5FUXA 1X7HA 3I37X 1QYXA 2WSYB 3O26A 4B4UA 3KT8A 2HYIC 3K9LA 4MYTA 4EMSA 3KQWA 4HH1A 4QHYA 1EB8A 3D6VA 1XA3A 2DULA 3F8SA 4KPYA 1N5OX 4HEA1 1E6KA 5GJCA 1UJ2A 4ANFA 3R5KA 4OFBA 4L07A 1IN1A 3F4KA 5I5GA 4KR6A 3NJ8A 1N2OA 2VIIA 3QBTA 3W3AA 3NBMA 3IRVA 5TDHA 5MF6A 4M6WA 3IALA 4LDJA 2PU7A 5BYKA 1ZWLA 4F1WA 2O8EA 2EBWA 3AHDA 1OFUA 3UCXA 4DCSA 1K8QA 2CWDA 4J7UA 5KJ6A 4L4YA 2Z6AA 1Z4LA 3MJDA 1RMTA 3LSTA 1Y6GA 3LUKA 1BNCA 3NYIA 2WAAA 4DR5B 3RVOA 4R1QA 4M1KA 4M9UA 5DJ5A 5DYNA 1O58A 1BEZA 5EE1A 4Q01A 5COAA 2G3YA 2QMHA 3LUGA 2BKVA 1G1MA 2D2VA 1S2NA 1FYXA 2JK0A 3AHJA 4M86A 3KS9A 4P6VF 4WX2B 1QO0A 4GD3Q 1JIIA 1D1QA 2LR0A 2PR2A 5JJBA 1G9XA 1JXQA 3N0WA 5MGBA 4DDKA 1CNFA 3VISA 4BPRA 1LC3A 3PI6A 5IN5A 3W8RA 2JLQA 3ZXSA 4EY5A 4HX5A 1H0SA 4Q0MA 3SZOA 5IJXA 5EJ7A 4CG1A 3N6VA 3UPUA 3TWOA 5CBKA 3A1VA 1SBQA 3JWEA 2PUTA 3PE3A 1W85B 1UODA 1YJ5A 2GN6A 4I50A 1JPUA 4PO1A 1SULA 3T61A 1G4UR 1UDWA 4U2DA 4ZRNA 4UNRA 3HDVA 3TVTA 4KWIA 5BY2A 4I5FA 4IH4A 2HWKA 1DG9A 1RFGE 5ALJA 5J1TB 4EJSB 4JI2B 1VBNA 2FJ0A 1NBEA 4X6LA 2ZWVA 2FUKA 3HA5A 3W5CA 1O9GA 4HFJA 4N3BA 4G2TA 2X58A 4A4DA 3L40A 3PIIA 3R5SA 2O19A 4JHLA 1K6IA 2B0JA 3KCNA 4JP1A 4OJYA 3GFOA 4JR0A 4ZOCA 3TTUA 3W8DA 5BN5B 2VSYA 4K05A 5JBQA 3H9BA 4TN1A 4EHFA 4FNGA 1CFJA 3E22A 3P0HA 4JOQA 3GT3A 2A3RA 3P9PA 4MVJI 3TXXA 1CY8A 2VP2A 4B3MB 2XMBA 3OJXA 5LFAA 3NEJA 1AHHA 2R8BA 1BSVA 2QYTA 2WUEA 5A3VA 3OCWA 3RVRA 1O6FA 2XZPA 3HYTA 4WLFA 1BXRA 4TSFD 5KKAA 1RP7A 4NAHA 1QCYA 3EGXA 3DVRX 5A06A 4AX8A 1XBTA 1IXZA 2OL4A 3FSEA 2X0NA 3O95A 4LHXA 4LSGA 1PG0A 3PBKA 2QV7A 1E9AA 3K8OE 3LUPA 3L6CA 3HEBA 1ZHHA 1A95A 4TMXA 1E5TA 4B33A 1E2GA 1LPNA 4RZQA 1U4NA 3GAMA 4PICA 2Q3BA 2PLAA 3D31A 3OKFA 3LY5A 4MVJD 3D7KA 1D4AA 4KO4S 2VHQA 4BKRA 5BRJA 4JIMA 1BDJA 3LPMA 4E5KA 3REOA 1V7ZA 3DCNA 1XQ1A 1BXGB 3NC0C 1WW2A 2JPDA 2OKGA 5EQTA 3TLGA 1PR0A 3PUHA 1FFBA 4PYRA 3SXUB 1NKSA 2NO4A 3OCYA 2FZVA 4N8SA 4TL6A 2JBWA 3G02A 4E22A 3U1BA 5DGHA 1OZAA 2EZUA 1OR8A 2P9GA 3L7AA 4M55A 4AS2A 2P8SA 3GLTA 3D6NB 1BE6A 1DOZA 4IOLA 2A9JA 3N2NA 5LLDA 4Q12A 4C0BA 1SUPA 3ONVA 2A4MA 4NMLA 1EB9A 3N2GA 2WIDA 3Q7TA 1JYEA 3F1LA 2RONA 1GGFA 4JYAB 1XTTA 1YZQA 4Q82A 1AF4A 3X1ZA 1AGYA 1NMZA 2XQGA 3O73A 4RA9A 2GEUA 3EZYA 3ZS9A 3HYLA 2GCPA 4UFOA 5C1OA 2F8MA 3WP0A 3MCWA 4B6GA 2Q5FA 4NY1A 1NBWB 3IEXA 4OREX 5D1HA 2EF1A 4EYKA 4WBNA 3OQ6A 3AJ9A 3R7DA 2HO4A 5CDFA 1PFYA 4ZZ0A 1PJSA 3P0RA 3MQFA 3D0RA 6AT1A 1IU9A 1HMPA 2QXUA 3PNKA 5JJCA 3L7JA 5BSWA 2B2XA 4OI2A 5IBRA 1P2GA 2H2IA 1EJ6A 3M3PA 5DBIA 3ZWOA 2J6CA 2BHRA 1IBMB 4B3TB 5F64A 3P5SA 1FX1A 1NNI1 1NMSA 2VF4X 2VUIB 4DMKA 1OAOA 3WGNA 5EZ6B 2Q6TA 3CISA 1K7EB 4O4LA 2NPFA 4V38A 2C9OA 4TM7A 4YAKA 3HBLA 1NBIA 2YL2A 4HDMA 4EHNA 2K7ZA 4MGYR 3JY6A 1KEPA 4RHYA 3TSZA 3TZBA 1PV1A 1XWIA 3EQ7A 1G3UA 2R2AA 3AR5A 5B3KA 4RVSA 1E94E 1DAHA 4BNUA 1N36B 2FUG6 3UFBA 2DLCX 4Y2YA 1QFXA 2XCIA 1II0A 2YY5A 2QQ0A 1ATZA 3PNQA 4XXHA 3S2SA 4HDKB 2VRCA 2G8LA 5K99A 4G1BA 2HH9A 2WWWA 4NICA 4F8JA 2ALJA 1NFQA 2AJLI 3VM6A 1RWQA 1PDOA 2V7XA 2Z8ZA 3CLTD 3F8TA 2V7TA 4US0R 1OV4A 4FOLA 3DE4X 1XQYA 3A1TA 5JS7A 2P67A 4Q4JB 5GJWC 4DJJA 1QVRA 1CUDA 4M9QA 3CZPA 4MUIA 2DMRA 3JX9A 2LCIA 4KH0A 3TIGA 4OQFA 4C0LA 2FMUA 2C2WA 4V39A 4P93A 2P4SA 4V24A 5EWJA 5GV7A 3LOUA 4Q7JB 3SK0A 3KQUA 3S7TA 2I4NA 1S0UA 4O29A 2BVNA 2VO1A 3ORFA 4YRLA 3KBOA 2HLDD 4TRRA 1H2WA 5K3OA 4FWTA 3C2QA 1OOEA 2GN9A 1DJQA 5BUQA 4D3FA 4UMFA 1RYDA 2O1SA 1TLTA 4KMOA 2CFOA 1ELOA 2BHNA 5BUZA 3CNQS 4IUBS 4LF6B 2X2FA 2JFFA 2DETA 3UXYA 1IN6A 3IP3A 1Y3FE 3WRXA 2GLXA 2QVBA 4UHBA 2Y68A 4XDYA 2Q2WA 4W5RA 4YEDA 4DF3A 3G68A 1IH8A 1ZD1A 2ZJ5A 4LRSB 4ZPXA 5IT9A 2BI4A 3AF3A 3R5TA 1NZDA 2OO5C 2Q46A 1ID1A 2QRUA 1RJGA 1EBUA 5E3JA 1L5RA 4QDTA 2P90A 1E69A 1FFSA 1KYZA 5G4KA 2R2GA 421PA 3RADC 1JLLA 1M34E 3IMFA 3RIGA 2Q6KA 4ZI7F 4CGZA 5BPHA 5JC8A 1MQSA 1N77A 2JBAB 4EEZA 3X1DA 1D2HA 1ZMTA 4HDNB 2QYOA 3W3ZB 1C1XA 1GV1A 2XJ4A 3O4IA 4NYJR 2BFEB 1X9IA 2RC5A 3W2GA 3AETA 5K1ZA 4C07A 5AW3A 1W0JA 1XRJA 3FIJA 1YB1A 3G3EA 3BFXA 2BE7A 3KT6A 4TLBA 1TOAA 3LXXA 4UNIA 3T3EA 4B46A 5KJ1A 3BT7A 2RHHA 3B1WA 3DQZA 3AJEA 4YMVA 1DRKA 1X94A 2H54A 1RYFA 2PD6A 3FSGD 1KDPA 3K2EA 4PX2A 2YUTA 1ML3A 2ZUBA 1M1YA 1XCMA 2FEOA 4IF4A 3QXSA 1RWVA 4LXTA 1YDWA 5CUQA 2FX2A 5KHOC 1QH8A 5JYDA 3IAM1 2C7QA 3LRXA 2V03A 3W9BA 2AMYA 3CMMA 3BF7A 2DWQA 2VHZA 4I5GA 1HEYA 2PBZA 4F5ZA 3EYWA 1Y9EA 2UZ3A 4N8DA 1NA5A 4FYJA 3HXTA 4FFLA 4J91A 4FCWA 4CT4B 5JH7B 3EWAA 3ODPA 4HFNA 4MWOA 5LLSA 2CKDA 4WJKB 4LY9A 1KY5A 3U6BA 3W5BA 2UYOA 4KI0A 5JBIA 4BC1A 1XEAA 1RAHA 2QZJA 4EYOA 5JCJA 4I9GA 4JJZA 1M34A 2NT3A 1AX9A 3IS3A 5DW3A 1WB6A 1PJAA 1IRIA 1PIWA 1SOVA 2X2OA 4K9OA 3UTCA 5KTOA 3MGGA 2QMOA 3CRVA 3DLIA 3LDGA 4WLOA 3E7DA 3UW1A 2ROQA 1RMQA 5AW9A 1FXUA 1NXVA 4U5QA 4EJSC 4PYJA 3V8MA 3RSLA 4GI5A 1CJKC 1JV2B 1INLA 2HYDA 3BG5A 4PX3A 4YGYA 2SBTA 2VATA 4RK1A 1ONSA 2JFOA 4MV1A 4TLAA 3U3RA 1T6NA 3DFMA 4PYOA 4N7MA 2V4UA 1GRVA 3EDCA 3NVDA 4FBLA 5D86A 4X7PA 5CA0B 2FMTA 1GL7A 3AEQA 3IHWA 4FDLA 1WUHS 4NL4H 3RHFA 4CLRB 2Y1LA 5E2IA 3D7NA 1WMEA 4OKIA 1ZK0A 4N40A 1E3SA 4N41A 3W90A 4D6PA 3BMQB 4XB6B 1GO2A 4Z5XA 1Z7BA 1TD1A 3ESXA 3PHCA 5K6AA 3I9V1 5BUCA 4PHCA 3EFBA 1SXPA 1X92A 1YD7A 1T8YA 1U3VA 1SVMA 2QJOA 3GGSA 4J03A 4JODA 4HGZA 4QQFA 3R4CA 4D82A 3MWLA 2NTVA 3H86A 5CLIA 4ZVMA 2P77A 3ZHRA 2ZUUA 3I0MA 2P5TB 5JISA 3ESYA 5LVAA 1ZRMA 3PNYA 2R5NA 5LSAA 5KJCA 1K5DA 3PIRA 4C14A 3T3OA 4P7BA 5C31A 4A8PA 2XKAA 3L77A 2DFKB 2AVNA 1WPXA 1PSWA 3WYBA 2FSIA 3O0TA 3SCZA 1F8UA 4NECA 5HJ7A 4D43A 3UJBA 1Z26A 2RHRA 1PS9A 5JG7A 4BTLA 1T26A 3MQ2A 3SQDA 2FGJA 4Z4EA 4X8MA 2VRNA 2YMQA 5JPCA 3QMVA 1HYEA 2D2FA 1CUFA 1D2RA 3E82A 4GOOD 3ZTWA 4DIMA 5CITA 3QPDA 5CHEA 2YXBA 2BFMA 2PGXA 3I0NA 2C4HA 2X9QA 2Q5OA 1KJ9A 5CNKA 1VPLA 4LBYA 1I2AA 3F3MA 3M89