2EFHA

Ara7-gdp/atvps9a(d185n)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
246
structure length
246
Chain Sequence
MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIASNENAPGANEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNMESARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 100
structure length 246
sequence length 246
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain
A PF18151 DUF5601 Domain of unknown function (DUF5601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2efhA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2efhA02
4G01A 2EFEA 2EFDA 2EFCA 4N3ZA 2OT3A 2EFHA 1TXUA
chains in the Genus database with same CATH superfamily
5IQYA 3F6FA 3SIUB 1OE8A 1OKTA 5D7GA 4GDFA 1E7EA 2WVZA 2HSMA 1HK2A 1YKCA 1YDKA 1PX7A 5EY6A 4YQVA 5IJFA 3LFLA 4NHZA 1KBNA 1BG5A 4PNGA 4LB2A 3I69A 2Z8JA 3HJOA 5J4UA 1Y1UA 3VURA 1GSFA 1G6WA 4L5OA 1M0UA 1EV4A 1OYJA 3DGQA 1GLQA 3IC8A 1IJGA 1S4BP 3FYGA 5B7CA 1A0FA 3RBTA 3GH6A 1N5UA 2XSIA 3MHSB 4PURA 4AKIA 4Z69A 5DAKA 2KBZA 2X64A 3LU8A 4TQ1A 1GLPA 1YEWC 5GINA 3G7IA 3ISOA 2HQTA 4O7HA 1JZRA 4YAVA 4HI7A 2WW2A 4BVYA 1Z9HA 2C3NA 2GSSA 4PUAA 5LD0A 22GSA 3IBHA 3CHXC 4MF7A 1GTBA 3BBYA 3VI5A 2ON7A 3QAWA 4TOPA 2D2ZA 1U3IA 2XW1A 2WVXB 4KX4A 6GSTA 4CHSA 5JCWA 5IFOA 3IK9A 1GNWA 4L8UA 1FW1A 3VPQA 4EE0A 3JQZA 2CKXA 1LNSA 4Q5RA 1MIYA 1R5AA 4G0KA 2VO4A 1BJ5A 2BXKA 2EFEA 4J2VA 1K0MA 2K0NA 1M99A 2OACA 4LMVA 2HNLA 4ZB8A 3JRYA 4MDCA 4PXOA 1MA9A 2YV7A 4KSMA 2BXEA 3QAVA 2BXLA 3F6DA 2BX8A 3GQUA 1PL2A 2BXMA 2EFDA 2QHBA 1TU7A 2VDBA 4G04A 4ISDA 5AIXA 2PGTA 3P8WA 4KGIA 4PI0C 1V40A 5D9TA 1EEMA 1GNEA 3PR8A 1LOTA 2FHEA 1GUMA 5J5NA 2O36A 4W4UB 2BXQA 4RI7A 1AQWA 3L0HA 1G7OA 4IBPA 3B9LA 3LG6A 2WVYA 2GSRA 4E8HA 4BVXA 12GSA 1GSDA 1O9XA 3D0ZA 4GCIA 1E6BA 4K0GA 5DALA 4HGMB 4NAWB 5ECQB 2PVQA 1BKEA 4W66A 3ERGA 2I2ZA 4IKHA 4KF9A 4WR4A 5ID7A 5ECIB 4L8EA 5ECRB 1HK1A 5JCUA 3VPTA 4JK4A 3FR9A 3ERFA 3CSIA 1V2AA 1EV9A 1ZGNA 3I6AA 2OA7A 4Q5NA 2DYMA 4DEJA 4F5VA 3LQ7A 1HA2A 2WDUA 1PL1A 1YVLA 2XVUA 3P90A 1TF0A 20GSA 4N3ZA 3UIVA 2I30A 3U6VA 2LOQA 3FY7A 4KAEA 2NTOA 2CAQA 4ZBQA 3TDLA 2HSNB 5ECSA 1MTCA 5B5TA 4L9KA 1KW2A 1PKZA 4EDYA 6GSWA 2OZBB 1E7IA 3B9MA 4OFMA 4BL7A 1GULA 4K0NA 2QM6A 1N25A 5ECKB 4L9QA 1YY7A 1MUHA 1K0OA 3NMUA 4OMVA 4ZBRA 2IMKA 5HOZA 1C72A 4GTUA 3KMNA 4LMWA 1J78A 4EC0A 1B4PA 3N5OA 3RFRC 2YDFA 1GUKA 3TGZA 4USSA 2AB6A 5J41A 1U87A 1SVOA 19GSA 1MIVA 4F5UA 4PO0A 2AHEA 4GDKB 2VCZA 4ZB9A 5J4YA 1KXPD 5D9WA 2F3MA 2LJRA 3EINA 2H1LA 2WZSA 5HFKA 1E7HA 5ECLB 2VUFA 1VF1A 4PI2C 3FWBC 16GSA 2IL3A 3LU7A 5GSSA 1N2AA 5IJEA 1GTUA 2R3XA 3FRCA 6GSXA 4FIPB 2EFCA 1HNCA 1SVLA 5AGYA 4LB9A 1YJ6A 2PBJA 2WRTA 3GSTA 2C3TA 2YV9A 3HKRA 4OR0A 4RI6A 3M1GA 5BPKA 1GSEA 3M0FA 4D7XA 5A4UA 5AIVA 3O76A 2GUTA 4G9HA 4ECIA 5BMUA 1K3OA 2BXHA 4EMXA 3G9KD 2CVDA 4MPFA 1MM8A 1BAYA 3M8NA 4YH2A 5ECHB 3GQXA 3UAPA 1AQVA 2BXDA 4IW1A 5A1NB 4EDZA 4LUFA 5DBYA 5DJLA 4PTSA 4F0CA 4HZ4A 5FHIA 5DQFA 1GSQA 3H1NA 4ZXGA 3MHHB 2AAWA 2YCDA 1EOGA 4LUHA 5F8BA 3UVHA 2DBWA 2WW1A 3BPJA 3Q18A 2Z8IA 2GTUA 1H9ZA 3UARA 4K71A 1JLVA 4KDYA 4NHWA 4K2CA 4F5TA 1USBA 4IS0A 7GSSA 3H37A 4MP4A 3HMJG 4ZUXV 1PD21 1YQ1A 4ACSA 4C31B 1GNIA 1E7FA 1TU8A 1Y6EA 3IE3A 3QR6A 4GSSA 2XW0A 3FWCC 4GDXA 4G0LA 4HOJA 4IQ1A 5KEJA 5IJ5A 3V09A 2VCWA 3CSJA 1IYHA 1ML6A 5A4WA 2BXIA 5ECNB 1FOUA 10GSA 3LSZA 4DM0A 2VCQA 4IVFA 3SWLA 2GSQA 4G0IA 4E68A 4F5SA 5AISA 2WJUA 4I97A 4YAPA 5GIOA 5EVOA 3ECPA 4GSTA 5ECPB 3GTUB 1SB0A 2LXTA 2C4JA 2HRKB 2J9HA 4YQMA 5ECOB 1VF3A 3WD6A 3IR4A 1VF4A 2DSAA 2VKZG 1M9AA 4J2FA 1TW9A 2LXSA 1BF5A 3GA9L 4HGKA 1MIWA 3LXTA 14GSA 5A34B 3MAKA 3LU6A 3KJLA 3ZMLA 4N0FD 3Q19A 4Q5QA 1PGTA 1TXUA 4OTUA 1JNBA 4IJIA 3VLNA 1E7GA 3SQJA 2GLRA 3VK9A 2HSMB 1DUGA 4MK3A 5FT3A 4F0BA 1AQXA 2WVXA 3KM6A 2BXFA 2NQOA 17GSA 3V08A 1K0CA 4OT2A 2C8UA 3WHRA 1LBKA 4FXYP 2XVWA 2BXBA 3LYPA 2BXPA 1UA5A 2O5VA 2V6KA 3M3MA 1PN9A 3FNMA 2PMTA 3NIVA 3ZFLA 1PA3A 4N0UD 4MBEC 2BXGA 4KDUA 3RGBC 2DYOA 6GSYA 4N0VA 4WA6B 2PERA 2CZ3A 1J7EA 6GSUA 1GTAA 2JUHA 2E0XA 5GZZB 4Z9OA 3LJRA 4GLTA 4BVYB 3PPUA 4OFNA 2VCXA 5DDLA 5A4VA 2GDRA 3C8EA 3H3AA 4GG2A 1VZSA 4ZBKA 4ZBDA 5LCZA 3W1SA 1PKWA 1XWGA 1GTIA 4OFTA 2O3EA 2BXNA 3GURA 3TOUA 5ECMB 1NT2B 4AGSA 3WHSA 3CWGA 4PQHA 4ECBA 1ZL9A 2EFHA 2E0YA 2HRKA 2BXOA 18GSA 4KE3A 5ID9A 1GWCA 3ICXA 4G19A 4KDXA 4ZB6A 5A5HB 3M99C 1F2EA 4WR5A 6GSVA 3A75A 2DBUA 4AKXB 2VD0A 3DD3A 3AY8A 1K0NA 5D9XA 3F63A 4MPGA 4PHZC 4ECCA 5FWGA 3LYKA 5A34A 4IW2A 2VCVA 4EXJA 1GSUA 4M70B 1B48A 1HK3A 2CAIA 4QMKA 4AKGA 4O92A 4AKHA 2LQHA 3EE2A 5F06A 1HK4A 3PGTA 2QMCA 1IYIA 4FK5B 1B8XA 1LJRA 2R6KA 3R2QA 4ECJA 5IIUA 1MD3A 3ZFBA 1AXDA 1OE7A 1U88A 2WW3A 3UBKA 2N5FA 4PNFA 2XVQA 4BVXB 2JL4A 3VI7A 4ZCGA 2OADA 1FHEA 5AN1A 2HSNA 2BXAA 4GF0A 5J47A 2IMIA 5DALB 1I1IP 3NVIA 1K0AA 3FR6A 2XVVA 5A5KA 1GNJA 2VUEA 2HRAA 4PGTA 1VF2A 2FNOA 3W8SA 3LXZA 1BX9A 2A2RA 1GSYA 2R4VA 5ELAA 1UORA 1F3BA 1XW6A 2ON5A 3GUSA 3R3EA 5J40A 4OTTA 1F3AA 4ZBBA 1H5WA 2GSTA 3PLAA 4ZC6A 4E99A 1TDIA 3GX0A 4Q5FA 1E7BA 3SIVB 4MF6A 5D73A 2AGHB 3CRUA 5G5FA 2AJEA 4MZWA 5DJMA 1K0DA 1E78A 3IK7A 2VCTA 4DHXB 1G6YA 5ELGA 3KJYA 4HJ2A 5A5HA 2WS2A 4E8EA 1E7AA 4G01A 1AW9A 3QAGA 4ID0A 4JZQA 4GSNA 3Q74A 3ZMKA 2C80A 2UV8G 4PX1A 5FUOA 1K0BA 1BYEA 1M9BA 4AI6A 3UBLA 4BL7B 13GSA 3GSSA 2CA8A 4S1YA 1BG1A 1Q4JA 5EL8A 1EOHA 9GSSA 2C3QA 5GIPA 4FQUA 5IIXA 4HZ2A 4FJCB 5DQSA 3CX9A 3KXOA 3VQIA 1GSSA 3FR3A 2WB9A 4I9OA 5G5EA 1E7CA 1JLWA 1AO6A 4G03A 4KH7A 3CRTA 5A1NA 4L5LA 3A73A 3V03A 11GSA 2OT3A 1MUSA 4ZBAA 5GSTA 1PMTA 1RK4A 1K3LA 3WYWA 1PX6A 4IELA 1XWKA 2NNWA 3TOTA 2ROHA 3KMOA 3WHQA 5F07A 3CBUA 3TU3B 2VD1A 2DG5A 3HJMA 3O3TA 1XW5A 4LA0A 5DAKB 5F0GA 5GHKA 2DC5A 4JBBA 4NAXA 4F03A 2XMOA 5J4VA 4PQIA 1MD4A 1K3YA 4GDLB 1SVMA 2F8FA 3KIKA 5IIHA 2A2SA 1BM0A 5BMUB 1HQOA 2R5GA 3KTLA 4MF5A 4JEDA 5F05A 4YQUA 4BKEA 5DCGA 8GSSA 4ZB7A 5D9VA 1HNAA 1VFIA 3CSHA 1HK5A 1KDXA 2LQIA 3N9JA 3NVKA 4TQ0A 3GTUA 4G10A 4IGJA 4QQ7A 4BY9C 3MDKA 6GSSA 1GUHA 3G7JA 4IW9A 4IQAA 2BXCA 2WW0A 3NVMA 2KWFA 2V36A 2CZ2A 1HNBA 3VWXA 2Z8KA 2DBXA 1NHYA 2UZ8A
chains in the Genus database with same CATH topology
5IQYA 3F6FA 3SIUB 1OE8A 1OKTA 5D7GA 4GDFA 1E7EA 2HSMA 1HK2A 1YKCA 1YDKA 1PX7A 5EY6A 4YQVA 5IJFA 3LFLA 4NHZA 1KBNA 1BG5A 4PNGA 4LB2A 3I69A 2Z8JA 3HJOA 5J4UA 1Y1UA 3VURA 1GSFA 1G6WA 4L5OA 1M0UA 1EV4A 1OYJA 3DGQA 1GLQA 3IC8A 1IJGA 3FYGA 5B7CA 1A0FA 3RBTA 3GH6A 1N5UA 2XSIA 3MHSB 4PURA 4AKIA 4Z69A 5DAKA 2KBZA 2X64A 3LU8A 4TQ1A 1GLPA 3G7IA 5GINA 3ISOA 2HQTA 4O7HA 1JZRA 4YAVA 4HI7A 4BVYA 1Z9HA 2C3NA 2GSSA 4PUAA 5LD0A 22GSA 3IBHA 4MF7A 1GTBA 3BBYA 3VI5A 2ON7A 3QAWA 4TOPA 2D2ZA 1U3IA 2XW1A 4KX4A 6GSTA 4CHSA 5JCWA 5IFOA 3IK9A 1GNWA 4L8UA 1FW1A 3VPQA 4EE0A 3JQZA 2CKXA 1LNSA 4Q5RA 1MIYA 1R5AA 4G0KA 2VO4A 1BJ5A 2BXKA 2EFEA 4J2VA 1K0MA 1M99A 2OACA 4LMVA 4ZB8A 2HNLA 3JRYA 4MDCA 4PXOA 1MA9A 2YV7A 4KSMA 2BXEA 3QAVA 2BXLA 3F6DA 2BX8A 3GQUA 1PL2A 2BXMA 2EFDA 2QHBA 1TU7A 2VDBA 4G04A 4ISDA 5AIXA 2PGTA 3P8WA 4KGIA 1V40A 5D9TA 1EEMA 1GNEA 3PR8A 1LOTA 2FHEA 1GUMA 5J5NA 4W4UB 2BXQA 4RI7A 1AQWA 3L0HA 1G7OA 4IBPA 3B9LA 3LG6A 2GSRA 4E8HA 4BVXA 12GSA 1GSDA 1O9XA 3D0ZA 4GCIA 1E6BA 4K0GA 5DALA 4HGMB 4NAWB 5ECQB 2PVQA 1BKEA 4W66A 3ERGA 2I2ZA 4IKHA 4KF9A 4WR4A 5ID7A 5ECIB 4L8EA 5ECRB 1HK1A 5JCUA 3VPTA 4JK4A 3FR9A 3ERFA 3CSIA 1V2AA 1EV9A 1ZGNA 3I6AA 2OA7A 4Q5NA 2DYMA 4DEJA 4F5VA 3LQ7A 1HA2A 2WDUA 1PL1A 1YVLA 2XVUA 3P90A 1TF0A 20GSA 4N3ZA 3UIVA 2I30A 3U6VA 2LOQA 3FY7A 4KAEA 2NTOA 2CAQA 4ZBQA 3TDLA 2HSNB 5ECSA 1MTCA 5B5TA 4L9KA 1KW2A 1PKZA 4EDYA 6GSWA 2OZBB 1E7IA 3B9MA 4OFMA 4BL7A 1GULA 4K0NA 2QM6A 1N25A 5ECKB 4L9QA 1YY7A 1K0OA 3NMUA 4OMVA 4ZBRA 2IMKA 5HOZA 1C72A 4GTUA 3KMNA 4LMWA 1J78A 4EC0A 1B4PA 3N5OA 2YDFA 1GUKA 3TGZA 4USSA 2AB6A 5J41A 1U87A 1SVOA 19GSA 1MIVA 4F5UA 4PO0A 2AHEA 4GDKB 2VCZA 4ZB9A 5J4YA 1KXPD 5D9WA 2F3MA 2LJRA 3EINA 2H1LA 5HFKA 1E7HA 5ECLB 2VUFA 1VF1A 3FWBC 16GSA 2IL3A 3LU7A 5GSSA 1N2AA 5IJEA 1GTUA 2R3XA 3FRCA 6GSXA 4FIPB 2EFCA 1HNCA 1SVLA 5AGYA 4LB9A 1YJ6A 2PBJA 2WRTA 3GSTA 2C3TA 2YV9A 3HKRA 4OR0A 4RI6A 3M1GA 5BPKA 1GSEA 3M0FA 5A4UA 5AIVA 3O76A 4G9HA 4ECIA 5BMUA 1K3OA 2BXHA 4EMXA 3G9KD 2CVDA 4MPFA 1BAYA 3M8NA 4YH2A 5ECHB 3GQXA 3UAPA 1AQVA 2BXDA 4IW1A 5A1NB 4EDZA 4LUFA 5DBYA 5DJLA 4PTSA 4F0CA 4HZ4A 5FHIA 5DQFA 1GSQA 3H1NA 4ZXGA 3MHHB 2AAWA 2YCDA 1EOGA 4LUHA 5F8BA 3UVHA 2DBWA 3Q18A 2Z8IA 2GTUA 1H9ZA 3UARA 4K71A 1JLVA 4KDYA 4NHWA 4K2CA 4F5TA 1USBA 4IS0A 7GSSA 3H37A 4MP4A 3HMJG 4ZUXV 1PD21 1YQ1A 4ACSA 4C31B 1GNIA 1E7FA 1TU8A 1Y6EA 3IE3A 3QR6A 4GSSA 2XW0A 3FWCC 4GDXA 4G0LA 4HOJA 4IQ1A 5KEJA 5IJ5A 3V09A 2VCWA 3CSJA 1IYHA 1ML6A 5A4WA 2BXIA 5ECNB 1FOUA 10GSA 3LSZA 2VCQA 4IVFA 3SWLA 2GSQA 4G0IA 4E68A 4F5SA 5AISA 2WJUA 4I97A 4YAPA 5GIOA 5EVOA 4GSTA 5ECPB 3GTUB 5ECOB 2C4JA 2HRKB 2J9HA 4YQMA 1VF3A 3WD6A 3IR4A 1VF4A 2DSAA 2VKZG 1M9AA 4J2FA 1TW9A 1BF5A 3GA9L 4HGKA 1MIWA 3LXTA 14GSA 5A34B 3MAKA 3LU6A 3KJLA 3ZMLA 4N0FD 3Q19A 4Q5QA 1PGTA 1TXUA 4OTUA 1JNBA 4IJIA 3VLNA 1E7GA 3SQJA 2GLRA 3VK9A 2HSMB 1DUGA 4MK3A 5FT3A 4F0BA 1AQXA 3KM6A 2BXFA 2NQOA 17GSA 3V08A 1K0CA 4OT2A 2C8UA 3WHRA 1LBKA 2XVWA 2BXBA 3LYPA 2BXPA 1UA5A 2O5VA 2V6KA 3M3MA 1PN9A 3FNMA 2PMTA 3NIVA 3ZFLA 1PA3A 4N0UD 4MBEC 2BXGA 4KDUA 2DYOA 6GSYA 4N0VA 4WA6B 2PERA 2CZ3A 1J7EA 6GSUA 1GTAA 2JUHA 2E0XA 5GZZB 4Z9OA 3LJRA 4GLTA 4BVYB 3PPUA 4OFNA 2VCXA 5DDLA 5A4VA 2GDRA 3C8EA 3H3AA 4GG2A 1VZSA 4ZBKA 4ZBDA 5LCZA 3W1SA 1PKWA 1XWGA 1GTIA 4OFTA 2BXNA 3GURA 3TOUA 5ECMB 1NT2B 4AGSA 3WHSA 3CWGA 4PQHA 4ECBA 1ZL9A 2EFHA 2E0YA 2HRKA 2BXOA 18GSA 4KE3A 5ID9A 1GWCA 3ICXA 4G19A 4KDXA 4ZB6A 5A5HB 3M99C 1F2EA 4WR5A 6GSVA 3A75A 2DBUA 4AKXB 2VD0A 3DD3A 3AY8A 1K0NA 5D9XA 3F63A 4MPGA 4ECCA 5FWGA 3LYKA 5A34A 4IW2A 2VCVA 4EXJA 1GSUA 4M70B 1B48A 1HK3A 2CAIA 4QMKA 4AKGA 4O92A 4AKHA 3EE2A 5F06A 1HK4A 3PGTA 2QMCA 1IYIA 4FK5B 1B8XA 1LJRA 2R6KA 3R2QA 4ECJA 5IIUA 1MD3A 3ZFBA 1AXDA 1OE7A 1U88A 3UBKA 2N5FA 4PNFA 2XVQA 4BVXB 2JL4A 3VI7A 4ZCGA 2OADA 1FHEA 5AN1A 2HSNA 2BXAA 4GF0A 5J47A 2IMIA 5DALB 3NVIA 1K0AA 3FR6A 2XVVA 5A5KA 1GNJA 2VUEA 2HRAA 4PGTA 1VF2A 2FNOA 3W8SA 3LXZA 1BX9A 2A2RA 1GSYA 2R4VA 5ELAA 1UORA 1F3BA 1XW6A 2ON5A 3GUSA 3R3EA 5J40A 4OTTA 1F3AA 4ZBBA 1H5WA 2GSTA 3PLAA 4ZC6A 4E99A 1TDIA 3GX0A 4Q5FA 1E7BA 3SIVB 4MF6A 5D73A 3CRUA 5G5FA 2AJEA 4MZWA 5DJMA 1K0DA 1E78A 3IK7A 2VCTA 4DHXB 1G6YA 5ELGA 3KJYA 4HJ2A 5A5HA 2WS2A 4E8EA 1E7AA 4G01A 1AW9A 3QAGA 4ID0A 4JZQA 4GSNA 3Q74A 3ZMKA 2C80A 2UV8G 4PX1A 5FUOA 1K0BA 1BYEA 1M9BA 4AI6A 3UBLA 4BL7B 13GSA 3GSSA 2CA8A 4S1YA 1BG1A 1Q4JA 5EL8A 1EOHA 9GSSA 2C3QA 5GIPA 4FQUA 5IIXA 4HZ2A 4FJCB 5DQSA 3CX9A 3KXOA 3VQIA 1GSSA 3FR3A 2WB9A 5G5EA 1E7CA 1JLWA 1AO6A 4G03A 4KH7A 3CRTA 5A1NA 4L5LA 3A73A 3V03A 11GSA 2OT3A 4ZBAA 5GSTA 1PMTA 1RK4A 1K3LA 3WYWA 1PX6A 4IELA 1XWKA 2NNWA 3TOTA 2ROHA 3KMOA 3WHQA 5F07A 3CBUA 3TU3B 2VD1A 2DG5A 3HJMA 3O3TA 1XW5A 4LA0A 5DAKB 5F0GA 5GHKA 2DC5A 4JBBA 4NAXA 4F03A 2XMOA 5J4VA 4PQIA 1MD4A 1K3YA 4GDLB 1SVMA 2F8FA 3KIKA 5IIHA 2A2SA 1BM0A 5BMUB 1HQOA 2R5GA 3KTLA 4MF5A 4JEDA 5F05A 4YQUA 4BKEA 5DCGA 8GSSA 4ZB7A 5D9VA 1HNAA 1VFIA 3CSHA 1HK5A 3N9JA 3NVKA 4TQ0A 3GTUA 4G10A 4IGJA 4QQ7A 4BY9C 3MDKA 6GSSA 1GUHA 3G7JA 4IW9A 4IQAA 2BXCA 3NVMA 2V36A 2CZ2A 1HNBA 3VWXA 2Z8KA 2DBXA 1NHYA 2UZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G01 A;  2EFE A;  2EFD A;  2EFC A;  4N3Z A;  2OT3 A;  2EFH A;  1TXU A; 
#chains in the Genus database with same CATH topology
 5IQY A;  3F6F A;  3SIU B;  1OE8 A;  1OKT A;  5D7G A;  4GDF A;  1E7E A;  2WVZ A;  2HSM A;  1HK2 A;  1YKC A;  1YDK A;  1PX7 A;  5EY6 A;  4YQV A;  5IJF A;  3LFL A;  4NHZ A;  1KBN A;  1BG5 A;  4PNG A;  4LB2 A;  3I69 A;  2Z8J A;  3HJO A;  5J4U A;  1Y1U A;  3VUR A;  1GSF A;  1G6W A;  4L5O A;  1M0U A;  1EV4 A;  1OYJ A;  3DGQ A;  1GLQ A;  3IC8 A;  1IJG A;  1S4B P;  3FYG A;  5B7C A;  1A0F A;  3RBT A;  3GH6 A;  1N5U A;  2XSI A;  3MHS B;  4PUR A;  4AKI A;  4Z69 A;  5DAK A;  2KBZ A;  2X64 A;  3LU8 A;  4TQ1 A;  1GLP A;  1YEW C;  5GIN A;  3G7I A;  3ISO A;  2HQT A;  4O7H A;  1JZR A;  4YAV A;  4HI7 A;  2WW2 A;  4BVY A;  1Z9H A;  2C3N A;  2GSS A;  4PUA A;  5LD0 A;  22GS A;  3IBH A;  3CHX C;  4MF7 A;  1GTB A;  3BBY A;  3VI5 A;  2ON7 A;  3QAW A;  4TOP A;  2D2Z A;  1U3I A;  2XW1 A;  2WVX B;  4KX4 A;  6GST A;  4CHS A;  5JCW A;  5IFO A;  3IK9 A;  1GNW A;  4L8U A;  1FW1 A;  3VPQ A;  4EE0 A;  3JQZ A;  2CKX A;  1LNS A;  4Q5R A;  1MIY A;  1R5A A;  4G0K A;  2VO4 A;  1BJ5 A;  2BXK A;  2EFE A;  4J2V A;  1K0M A;  2K0N A;  1M99 A;  2OAC A;  4LMV A;  2HNL A;  4ZB8 A;  3JRY A;  4MDC A;  4PXO A;  1MA9 A;  2YV7 A;  4KSM A;  2BXE A;  3QAV A;  2BXL A;  3F6D A;  2BX8 A;  3GQU A;  1PL2 A;  2BXM A;  2EFD A;  2QHB A;  1TU7 A;  2VDB A;  4G04 A;  4ISD A;  5AIX A;  2PGT A;  3P8W A;  4KGI A;  4PI0 C;  1V40 A;  5D9T A;  1EEM A;  1GNE A;  3PR8 A;  1LOT A;  2FHE A;  1GUM A;  5J5N A;  2O36 A;  4W4U B;  2BXQ A;  4RI7 A;  1AQW A;  3L0H A;  1G7O A;  4IBP A;  3B9L A;  3LG6 A;  2WVY A;  2GSR A;  4E8H A;  4BVX A;  12GS A;  1GSD A;  1O9X A;  3D0Z A;  4GCI A;  1E6B A;  4K0G A;  5DAL A;  4HGM B;  4NAW B;  5ECQ B;  2PVQ A;  1BKE A;  4W66 A;  3ERG A;  2I2Z A;  4IKH A;  4KF9 A;  4WR4 A;  5ID7 A;  5ECI B;  4L8E A;  5ECR B;  1HK1 A;  5JCU A;  3VPT A;  4JK4 A;  3FR9 A;  3ERF A;  3CSI A;  1V2A A;  1EV9 A;  1ZGN A;  3I6A A;  2OA7 A;  4Q5N A;  2DYM A;  4DEJ A;  4F5V A;  3LQ7 A;  1HA2 A;  2WDU A;  1PL1 A;  1YVL A;  2XVU A;  3P90 A;  1TF0 A;  20GS A;  4N3Z A;  3UIV A;  2I30 A;  3U6V A;  2LOQ A;  3FY7 A;  4KAE A;  2NTO A;  2CAQ A;  4ZBQ A;  3TDL A;  2HSN B;  5ECS A;  1MTC A;  5B5T A;  4L9K A;  1KW2 A;  1PKZ A;  4EDY A;  6GSW A;  2OZB B;  1E7I A;  3B9M A;  4OFM A;  4BL7 A;  1GUL A;  4K0N A;  2QM6 A;  1N25 A;  5ECK B;  4L9Q A;  1YY7 A;  1MUH A;  1K0O A;  3NMU A;  4OMV A;  4ZBR A;  2IMK A;  5HOZ A;  1C72 A;  4GTU A;  3KMN A;  4LMW A;  1J78 A;  4EC0 A;  1B4P A;  3N5O A;  3RFR C;  2YDF A;  1GUK A;  3TGZ A;  4USS A;  2AB6 A;  5J41 A;  1U87 A;  1SVO A;  19GS A;  1MIV A;  4F5U A;  4PO0 A;  2AHE A;  4GDK B;  2VCZ A;  4ZB9 A;  5J4Y A;  1KXP D;  5D9W A;  2F3M A;  2LJR A;  3EIN A;  2H1L A;  2WZS A;  5HFK A;  1E7H A;  5ECL B;  2VUF A;  1VF1 A;  4PI2 C;  3FWB C;  16GS A;  2IL3 A;  3LU7 A;  5GSS A;  1N2A A;  5IJE A;  1GTU A;  2R3X A;  3FRC A;  6GSX A;  4FIP B;  2EFC A;  1HNC A;  1SVL A;  5AGY A;  4LB9 A;  1YJ6 A;  2PBJ A;  2WRT A;  3GST A;  2C3T A;  2YV9 A;  3HKR A;  4OR0 A;  4RI6 A;  3M1G A;  5BPK A;  1GSE A;  3M0F A;  4D7X A;  5A4U A;  5AIV A;  3O76 A;  2GUT A;  4G9H A;  4ECI A;  5BMU A;  1K3O A;  2BXH A;  4EMX A;  3G9K D;  2CVD A;  4MPF A;  1MM8 A;  1BAY A;  3M8N A;  4YH2 A;  5ECH B;  3GQX A;  3UAP A;  1AQV A;  2BXD A;  4IW1 A;  5A1N B;  4EDZ A;  4LUF A;  5DBY A;  5DJL A;  4PTS A;  4F0C A;  4HZ4 A;  5FHI A;  5DQF A;  1GSQ A;  3H1N A;  4ZXG A;  3MHH B;  2AAW A;  2YCD A;  1EOG A;  4LUH A;  5F8B A;  3UVH A;  2DBW A;  2WW1 A;  3BPJ A;  3Q18 A;  2Z8I A;  2GTU A;  1H9Z A;  3UAR A;  4K71 A;  1JLV A;  4KDY A;  4NHW A;  4K2C A;  4F5T A;  1USB A;  4IS0 A;  7GSS A;  3H37 A;  4MP4 A;  3HMJ G;  4ZUX V;  1PD2 1;  1YQ1 A;  4ACS A;  4C31 B;  1GNI A;  1E7F A;  1TU8 A;  1Y6E A;  3IE3 A;  3QR6 A;  4GSS A;  2XW0 A;  3FWC C;  4GDX A;  4G0L A;  4HOJ A;  4IQ1 A;  5KEJ A;  5IJ5 A;  3V09 A;  2VCW A;  3CSJ A;  1IYH A;  1ML6 A;  5A4W A;  2BXI A;  5ECN B;  1FOU A;  10GS A;  3LSZ A;  4DM0 A;  2VCQ A;  4IVF A;  3SWL A;  2GSQ A;  4G0I A;  4E68 A;  4F5S A;  5AIS A;  2WJU A;  4I97 A;  4YAP A;  5GIO A;  5EVO A;  3ECP A;  4GST A;  5ECP B;  3GTU B;  1SB0 A;  2LXT A;  2C4J A;  2HRK B;  2J9H A;  4YQM A;  5ECO B;  1VF3 A;  3WD6 A;  3IR4 A;  1VF4 A;  2DSA A;  2VKZ G;  1M9A A;  4J2F A;  1TW9 A;  2LXS A;  1BF5 A;  3GA9 L;  4HGK A;  1MIW A;  3LXT A;  14GS A;  5A34 B;  3MAK A;  3LU6 A;  3KJL A;  3ZML A;  4N0F D;  3Q19 A;  4Q5Q A;  1PGT A;  1TXU A;  4OTU A;  1JNB A;  4IJI A;  3VLN A;  1E7G A;  3SQJ A;  2GLR A;  3VK9 A;  2HSM B;  1DUG A;  4MK3 A;  5FT3 A;  4F0B A;  1AQX A;  2WVX A;  3KM6 A;  2BXF A;  2NQO A;  17GS A;  3V08 A;  1K0C A;  4OT2 A;  2C8U A;  3WHR A;  1LBK A;  4FXY P;  2XVW A;  2BXB A;  3LYP A;  2BXP A;  1UA5 A;  2O5V A;  2V6K A;  3M3M A;  1PN9 A;  3FNM A;  2PMT A;  3NIV A;  3ZFL A;  1PA3 A;  4N0U D;  4MBE C;  2BXG A;  4KDU A;  3RGB C;  2DYO A;  6GSY A;  4N0V A;  4WA6 B;  2PER A;  2CZ3 A;  1J7E A;  6GSU A;  1GTA A;  2JUH A;  2E0X A;  5GZZ B;  4Z9O A;  3LJR A;  4GLT A;  4BVY B;  3PPU A;  4OFN A;  2VCX A;  5DDL A;  5A4V A;  2GDR A;  3C8E A;  3H3A A;  4GG2 A;  1VZS A;  4ZBK A;  4ZBD A;  5LCZ A;  3W1S A;  1PKW A;  1XWG A;  1GTI A;  4OFT A;  2O3E A;  2BXN A;  3GUR A;  3TOU A;  5ECM B;  1NT2 B;  4AGS A;  3WHS A;  3CWG A;  4PQH A;  4ECB A;  1ZL9 A;  2EFH A;  2E0Y A;  2HRK A;  2BXO A;  18GS A;  4KE3 A;  5ID9 A;  1GWC A;  3ICX A;  4G19 A;  4KDX A;  4ZB6 A;  5A5H B;  3M99 C;  1F2E A;  4WR5 A;  6GSV A;  3A75 A;  2DBU A;  4AKX B;  2VD0 A;  3DD3 A;  3AY8 A;  1K0N A;  5D9X A;  3F63 A;  4MPG A;  4PHZ C;  4ECC A;  5FWG A;  3LYK A;  5A34 A;  4IW2 A;  2VCV A;  4EXJ A;  1GSU A;  4M70 B;  1B48 A;  1HK3 A;  2CAI A;  4QMK A;  4AKG A;  4O92 A;  4AKH A;  2LQH A;  3EE2 A;  5F06 A;  1HK4 A;  3PGT A;  2QMC A;  1IYI A;  4FK5 B;  1B8X A;  1LJR A;  2R6K A;  3R2Q A;  4ECJ A;  5IIU A;  1MD3 A;  3ZFB A;  1AXD A;  1OE7 A;  1U88 A;  2WW3 A;  3UBK A;  2N5F A;  4PNF A;  2XVQ A;  4BVX B;  2JL4 A;  3VI7 A;  4ZCG A;  2OAD A;  1FHE A;  5AN1 A;  2HSN A;  2BXA A;  4GF0 A;  5J47 A;  2IMI A;  5DAL B;  1I1I P;  3NVI A;  1K0A A;  3FR6 A;  2XVV A;  5A5K A;  1GNJ A;  2VUE A;  2HRA A;  4PGT A;  1VF2 A;  2FNO A;  3W8S A;  3LXZ A;  1BX9 A;  2A2R A;  1GSY A;  2R4V A;  5ELA A;  1UOR A;  1F3B A;  1XW6 A;  2ON5 A;  3GUS A;  3R3E A;  5J40 A;  4OTT A;  1F3A A;  4ZBB A;  1H5W A;  2GST A;  3PLA A;  4ZC6 A;  4E99 A;  1TDI A;  3GX0 A;  4Q5F A;  1E7B A;  3SIV B;  4MF6 A;  5D73 A;  2AGH B;  3CRU A;  5G5F A;  2AJE A;  4MZW A;  5DJM A;  1K0D A;  1E78 A;  3IK7 A;  2VCT A;  4DHX B;  1G6Y A;  5ELG A;  3KJY A;  4HJ2 A;  5A5H A;  2WS2 A;  4E8E A;  1E7A A;  4G01 A;  1AW9 A;  3QAG A;  4ID0 A;  4JZQ A;  4GSN A;  3Q74 A;  3ZMK A;  2C80 A;  2UV8 G;  4PX1 A;  5FUO A;  1K0B A;  1BYE A;  1M9B A;  4AI6 A;  3UBL A;  4BL7 B;  13GS A;  3GSS A;  2CA8 A;  4S1Y A;  1BG1 A;  1Q4J A;  5EL8 A;  1EOH A;  9GSS A;  2C3Q A;  5GIP A;  4FQU A;  5IIX A;  4HZ2 A;  4FJC B;  5DQS A;  3CX9 A;  3KXO A;  3VQI A;  1GSS A;  3FR3 A;  2WB9 A;  4I9O A;  5G5E A;  1E7C A;  1JLW A;  1AO6 A;  4G03 A;  4KH7 A;  3CRT A;  5A1N A;  4L5L A;  3A73 A;  3V03 A;  11GS A;  2OT3 A;  1MUS A;  4ZBA A;  5GST A;  1PMT A;  1RK4 A;  1K3L A;  3WYW A;  1PX6 A;  4IEL A;  1XWK A;  2NNW A;  3TOT A;  2ROH A;  3KMO A;  3WHQ A;  5F07 A;  3CBU A;  3TU3 B;  2VD1 A;  2DG5 A;  3HJM A;  3O3T A;  1XW5 A;  4LA0 A;  5DAK B;  5F0G A;  5GHK A;  2DC5 A;  4JBB A;  4NAX A;  4F03 A;  2XMO A;  5J4V A;  4PQI A;  1MD4 A;  1K3Y A;  4GDL B;  1SVM A;  2F8F A;  3KIK A;  5IIH A;  2A2S A;  1BM0 A;  5BMU B;  1HQO A;  2R5G A;  3KTL A;  4MF5 A;  4JED A;  5F05 A;  4YQU A;  4BKE A;  5DCG A;  8GSS A;  4ZB7 A;  5D9V A;  1HNA A;  1VFI A;  3CSH A;  1HK5 A;  1KDX A;  2LQI A;  3N9J A;  3NVK A;  4TQ0 A;  3GTU A;  4G10 A;  4IGJ A;  4QQ7 A;  4BY9 C;  3MDK A;  6GSS A;  1GUH A;  3G7J A;  4IW9 A;  4IQA A;  2BXC A;  2WW0 A;  3NVM A;  2KWF A;  2V36 A;  2CZ2 A;  1HNB A;  3VWX A;  2Z8K A;  2DBX A;  1NHY A;  2UZ8 A; 
#chains in the Genus database with same CATH homology
 5IQY A;  3F6F A;  3SIU B;  1OE8 A;  1OKT A;  5D7G A;  4GDF A;  1E7E A;  2HSM A;  1HK2 A;  1YKC A;  1YDK A;  1PX7 A;  5EY6 A;  4YQV A;  5IJF A;  3LFL A;  4NHZ A;  1KBN A;  1BG5 A;  4PNG A;  4LB2 A;  3I69 A;  2Z8J A;  3HJO A;  5J4U A;  1Y1U A;  3VUR A;  1GSF A;  1G6W A;  4L5O A;  1M0U A;  1EV4 A;  1OYJ A;  3DGQ A;  1GLQ A;  3IC8 A;  1IJG A;  3FYG A;  5B7C A;  1A0F A;  3RBT A;  3GH6 A;  1N5U A;  2XSI A;  3MHS B;  4PUR A;  4AKI A;  4Z69 A;  5DAK A;  2KBZ A;  2X64 A;  3LU8 A;  4TQ1 A;  1GLP A;  3G7I A;  5GIN A;  3ISO A;  2HQT A;  4O7H A;  1JZR A;  4YAV A;  4HI7 A;  4BVY A;  1Z9H A;  2C3N A;  2GSS A;  4PUA A;  5LD0 A;  22GS A;  3IBH A;  4MF7 A;  1GTB A;  3BBY A;  3VI5 A;  2ON7 A;  3QAW A;  4TOP A;  2D2Z A;  1U3I A;  2XW1 A;  4KX4 A;  6GST A;  4CHS A;  5JCW A;  5IFO A;  3IK9 A;  1GNW A;  4L8U A;  1FW1 A;  3VPQ A;  4EE0 A;  3JQZ A;  2CKX A;  1LNS A;  4Q5R A;  1MIY A;  1R5A A;  4G0K A;  2VO4 A;  1BJ5 A;  2BXK A;  2EFE A;  4J2V A;  1K0M A;  1M99 A;  2OAC A;  4LMV A;  4ZB8 A;  2HNL A;  3JRY A;  4MDC A;  4PXO A;  1MA9 A;  2YV7 A;  4KSM A;  2BXE A;  3QAV A;  2BXL A;  3F6D A;  2BX8 A;  3GQU A;  1PL2 A;  2BXM A;  2EFD A;  2QHB A;  1TU7 A;  2VDB A;  4G04 A;  4ISD A;  5AIX A;  2PGT A;  3P8W A;  4KGI A;  1V40 A;  5D9T A;  1EEM A;  1GNE A;  3PR8 A;  1LOT A;  2FHE A;  1GUM A;  5J5N A;  4W4U B;  2BXQ A;  4RI7 A;  1AQW A;  3L0H A;  1G7O A;  4IBP A;  3B9L A;  3LG6 A;  2GSR A;  4E8H A;  4BVX A;  12GS A;  1GSD A;  1O9X A;  3D0Z A;  4GCI A;  1E6B A;  4K0G A;  5DAL A;  4HGM B;  4NAW B;  5ECQ B;  2PVQ A;  1BKE A;  4W66 A;  3ERG A;  2I2Z A;  4IKH A;  4KF9 A;  4WR4 A;  5ID7 A;  5ECI B;  4L8E A;  5ECR B;  1HK1 A;  5JCU A;  3VPT A;  4JK4 A;  3FR9 A;  3ERF A;  3CSI A;  1V2A A;  1EV9 A;  1ZGN A;  3I6A A;  2OA7 A;  4Q5N A;  2DYM A;  4DEJ A;  4F5V A;  3LQ7 A;  1HA2 A;  2WDU A;  1PL1 A;  1YVL A;  2XVU A;  3P90 A;  1TF0 A;  20GS A;  4N3Z A;  3UIV A;  2I30 A;  3U6V A;  2LOQ A;  3FY7 A;  4KAE A;  2NTO A;  2CAQ A;  4ZBQ A;  3TDL A;  2HSN B;  5ECS A;  1MTC A;  5B5T A;  4L9K A;  1KW2 A;  1PKZ A;  4EDY A;  6GSW A;  2OZB B;  1E7I A;  3B9M A;  4OFM A;  4BL7 A;  1GUL A;  4K0N A;  2QM6 A;  1N25 A;  5ECK B;  4L9Q A;  1YY7 A;  1K0O A;  3NMU A;  4OMV A;  4ZBR A;  2IMK A;  5HOZ A;  1C72 A;  4GTU A;  3KMN A;  4LMW A;  1J78 A;  4EC0 A;  1B4P A;  3N5O A;  2YDF A;  1GUK A;  3TGZ A;  4USS A;  2AB6 A;  5J41 A;  1U87 A;  1SVO A;  19GS A;  1MIV A;  4F5U A;  4PO0 A;  2AHE A;  4GDK B;  2VCZ A;  4ZB9 A;  5J4Y A;  1KXP D;  5D9W A;  2F3M A;  2LJR A;  3EIN A;  2H1L A;  5HFK A;  1E7H A;  5ECL B;  2VUF A;  1VF1 A;  3FWB C;  16GS A;  2IL3 A;  3LU7 A;  5GSS A;  1N2A A;  5IJE A;  1GTU A;  2R3X A;  3FRC A;  6GSX A;  4FIP B;  2EFC A;  1HNC A;  1SVL A;  5AGY A;  4LB9 A;  1YJ6 A;  2PBJ A;  2WRT A;  3GST A;  2C3T A;  2YV9 A;  3HKR A;  4OR0 A;  4RI6 A;  3M1G A;  5BPK A;  1GSE A;  3M0F A;  5A4U A;  5AIV A;  3O76 A;  4G9H A;  4ECI A;  5BMU A;  1K3O A;  2BXH A;  4EMX A;  3G9K D;  2CVD A;  4MPF A;  1BAY A;  3M8N A;  4YH2 A;  5ECH B;  3GQX A;  3UAP A;  1AQV A;  2BXD A;  4IW1 A;  5A1N B;  4EDZ A;  4LUF A;  5DBY A;  5DJL A;  4PTS A;  4F0C A;  4HZ4 A;  5FHI A;  5DQF A;  1GSQ A;  3H1N A;  4ZXG A;  3MHH B;  2AAW A;  2YCD A;  1EOG A;  4LUH A;  5F8B A;  3UVH A;  2DBW A;  3Q18 A;  2Z8I A;  2GTU A;  1H9Z A;  3UAR A;  4K71 A;  1JLV A;  4KDY A;  4NHW A;  4K2C A;  4F5T A;  1USB A;  4IS0 A;  7GSS A;  3H37 A;  4MP4 A;  3HMJ G;  4ZUX V;  1PD2 1;  1YQ1 A;  4ACS A;  4C31 B;  1GNI A;  1E7F A;  1TU8 A;  1Y6E A;  3IE3 A;  3QR6 A;  4GSS A;  2XW0 A;  3FWC C;  4GDX A;  4G0L A;  4HOJ A;  4IQ1 A;  5KEJ A;  5IJ5 A;  3V09 A;  2VCW A;  3CSJ A;  1IYH A;  1ML6 A;  5A4W A;  2BXI A;  5ECN B;  1FOU A;  10GS A;  3LSZ A;  2VCQ A;  4IVF A;  3SWL A;  2GSQ A;  4G0I A;  4E68 A;  4F5S A;  5AIS A;  2WJU A;  4I97 A;  4YAP A;  5GIO A;  5EVO A;  4GST A;  5ECP B;  3GTU B;  5ECO B;  2C4J A;  2HRK B;  2J9H A;  4YQM A;  1VF3 A;  3WD6 A;  3IR4 A;  1VF4 A;  2DSA A;  2VKZ G;  1M9A A;  4J2F A;  1TW9 A;  1BF5 A;  3GA9 L;  4HGK A;  1MIW A;  3LXT A;  14GS A;  5A34 B;  3MAK A;  3LU6 A;  3KJL A;  3ZML A;  4N0F D;  3Q19 A;  4Q5Q A;  1PGT A;  1TXU A;  4OTU A;  1JNB A;  4IJI A;  3VLN A;  1E7G A;  3SQJ A;  2GLR A;  3VK9 A;  2HSM B;  1DUG A;  4MK3 A;  5FT3 A;  4F0B A;  1AQX A;  3KM6 A;  2BXF A;  2NQO A;  17GS A;  3V08 A;  1K0C A;  4OT2 A;  2C8U A;  3WHR A;  1LBK A;  2XVW A;  2BXB A;  3LYP A;  2BXP A;  1UA5 A;  2O5V A;  2V6K A;  3M3M A;  1PN9 A;  3FNM A;  2PMT A;  3NIV A;  3ZFL A;  1PA3 A;  4N0U D;  4MBE C;  2BXG A;  4KDU A;  2DYO A;  6GSY A;  4N0V A;  4WA6 B;  2PER A;  2CZ3 A;  1J7E A;  6GSU A;  1GTA A;  2JUH A;  2E0X A;  5GZZ B;  4Z9O A;  3LJR A;  4GLT A;  4BVY B;  3PPU A;  4OFN A;  2VCX A;  5DDL A;  5A4V A;  2GDR A;  3C8E A;  3H3A A;  4GG2 A;  1VZS A;  4ZBK A;  4ZBD A;  5LCZ A;  3W1S A;  1PKW A;  1XWG A;  1GTI A;  4OFT A;  2BXN A;  3GUR A;  3TOU A;  5ECM B;  1NT2 B;  4AGS A;  3WHS A;  3CWG A;  4PQH A;  4ECB A;  1ZL9 A;  2EFH A;  2E0Y A;  2HRK A;  2BXO A;  18GS A;  4KE3 A;  5ID9 A;  1GWC A;  3ICX A;  4G19 A;  4KDX A;  4ZB6 A;  5A5H B;  3M99 C;  1F2E A;  4WR5 A;  6GSV A;  3A75 A;  2DBU A;  4AKX B;  2VD0 A;  3DD3 A;  3AY8 A;  1K0N A;  5D9X A;  3F63 A;  4MPG A;  4ECC A;  5FWG A;  3LYK A;  5A34 A;  4IW2 A;  2VCV A;  4EXJ A;  1GSU A;  4M70 B;  1B48 A;  1HK3 A;  2CAI A;  4QMK A;  4AKG A;  4O92 A;  4AKH A;  3EE2 A;  5F06 A;  1HK4 A;  3PGT A;  2QMC A;  1IYI A;  4FK5 B;  1B8X A;  1LJR A;  2R6K A;  3R2Q A;  4ECJ A;  5IIU A;  1MD3 A;  3ZFB A;  1AXD A;  1OE7 A;  1U88 A;  3UBK A;  2N5F A;  4PNF A;  2XVQ A;  4BVX B;  2JL4 A;  3VI7 A;  4ZCG A;  2OAD A;  1FHE A;  5AN1 A;  2HSN A;  2BXA A;  4GF0 A;  5J47 A;  2IMI A;  5DAL B;  3NVI A;  1K0A A;  3FR6 A;  2XVV A;  5A5K A;  1GNJ A;  2VUE A;  2HRA A;  4PGT A;  1VF2 A;  2FNO A;  3W8S A;  3LXZ A;  1BX9 A;  2A2R A;  1GSY A;  2R4V A;  5ELA A;  1UOR A;  1F3B A;  1XW6 A;  2ON5 A;  3GUS A;  3R3E A;  5J40 A;  4OTT A;  1F3A A;  4ZBB A;  1H5W A;  2GST A;  3PLA A;  4ZC6 A;  4E99 A;  1TDI A;  3GX0 A;  4Q5F A;  1E7B A;  3SIV B;  4MF6 A;  5D73 A;  3CRU A;  5G5F A;  2AJE A;  4MZW A;  5DJM A;  1K0D A;  1E78 A;  3IK7 A;  2VCT A;  4DHX B;  1G6Y A;  5ELG A;  3KJY A;  4HJ2 A;  5A5H A;  2WS2 A;  4E8E A;  1E7A A;  4G01 A;  1AW9 A;  3QAG A;  4ID0 A;  4JZQ A;  4GSN A;  3Q74 A;  3ZMK A;  2C80 A;  2UV8 G;  4PX1 A;  5FUO A;  1K0B A;  1BYE A;  1M9B A;  4AI6 A;  3UBL A;  4BL7 B;  13GS A;  3GSS A;  2CA8 A;  4S1Y A;  1BG1 A;  1Q4J A;  5EL8 A;  1EOH A;  9GSS A;  2C3Q A;  5GIP A;  4FQU A;  5IIX A;  4HZ2 A;  4FJC B;  5DQS A;  3CX9 A;  3KXO A;  3VQI A;  1GSS A;  3FR3 A;  2WB9 A;  5G5E A;  1E7C A;  1JLW A;  1AO6 A;  4G03 A;  4KH7 A;  3CRT A;  5A1N A;  4L5L A;  3A73 A;  3V03 A;  11GS A;  2OT3 A;  4ZBA A;  5GST A;  1PMT A;  1RK4 A;  1K3L A;  3WYW A;  1PX6 A;  4IEL A;  1XWK A;  2NNW A;  3TOT A;  2ROH A;  3KMO A;  3WHQ A;  5F07 A;  3CBU A;  3TU3 B;  2VD1 A;  2DG5 A;  3HJM A;  3O3T A;  1XW5 A;  4LA0 A;  5DAK B;  5F0G A;  5GHK A;  2DC5 A;  4JBB A;  4NAX A;  4F03 A;  2XMO A;  5J4V A;  4PQI A;  1MD4 A;  1K3Y A;  4GDL B;  1SVM A;  2F8F A;  3KIK A;  5IIH A;  2A2S A;  1BM0 A;  5BMU B;  1HQO A;  2R5G A;  3KTL A;  4MF5 A;  4JED A;  5F05 A;  4YQU A;  4BKE A;  5DCG A;  8GSS A;  4ZB7 A;  5D9V A;  1HNA A;  1VFI A;  3CSH A;  1HK5 A;  3N9J A;  3NVK A;  4TQ0 A;  3GTU A;  4G10 A;  4IGJ A;  4QQ7 A;  4BY9 C;  3MDK A;  6GSS A;  1GUH A;  3G7J A;  4IW9 A;  4IQA A;  2BXC A;  3NVM A;  2V36 A;  2CZ2 A;  1HNB A;  3VWX A;  2Z8K A;  2DBX A;  1NHY A;  2UZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...