2EFHB

Ara7-gdp/atvps9a(d185n)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
152
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
total genus 51
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efhB00
5M04A 4OI1A 4LX0A 1RYFA 3R8FA 3T35A 4TT3D 3K53A 5FBQB 4OK6A 4QJ5A 2GCOB 2ZETA 2XGJA 3AF3A 2Z5FA 3AQ4A 4BFXA 4EQ6B 3SHFA 3DOEA 2MMGA 1IY0A 3P4YA 2NO6A 1W0JD 2UZIR 3ZH9B 1OE0A 4PPFA 2GHIA 3GFTA 3OIVA 1EFRD 4JL6A 4QJ3A 3CM0A 1NMYA 1TMKA 1D9ZA 3UWKA 1T3LA 4HB3A 5EXTA 2QL6A 1NVVR 3FHCB 2AX4A 3QI2A 4IHQA 3K8YA 1LY1A 5KNDA 1E1RD 2CXXA 3RLFA 3IEVA 4OK5A 1US8B 1JB1A 2X2EA 4K46A 3FFAA 3ONWA 1ZUHA 2V1XA 2PLFA 4IFBA 4OJQA 4PO8A 3O8BA 5G40A 3TBKA 3TVTA 4JYCA 1HTWA 2ZRCA 2NO1A 4L15A 4N3NA 3THXA 4NYIQ 5JJIA 3SHWA 3U4QB 1RYHA 1XJ0A 3LX8A 2GCPA 2GJSA 1OIWA 1RRGA 2RGGA 4PAOA 3S1AB 5TMPA 2XX3A 1EFRA 1FMJA 1VPLA 3NTUA 1E4YA 3I32A 1I4LD 1G3QA 2CNWA 1TEVA 3EZ7A 4RFSA 3LA6A 1GKYA 3NEJA 3KTAB 1ZMXA 2IHYA 5EJEA 1JALA 1ZCBA 2XTZA 2ZYTX 2QUZA 3TMKA 1KSHA 1KTVA 3FKSD 2QG6A 2BJVA 4C0KA 1MRNA 3LW8A 1TPZA 4BFVA 4DSOA 4V0MA 1SXJA 1BS1A 3QG5A 5AWFC 4M9ZA 3RS4A 1GM5A 2NQ2C 1L2TA 4QFMA 1Z0JA 4TLBA 1XTKA 2PZFA 3KJEA 3RRZA 1FP7A 1SXJD 1Z0IA 1GG2A 1W0KA 1VCMA 1SVWA 3I1FA 1XMVA 5JI2E 2ZTSA 3RC8A 1P2TA 4LC0A 3MJRA 2OFWA 5KHOC 2WJGA 3A4NA 2JDIA 5C1BA 2GXSA 4DB2A 2IF0A 4Q7MB 5K8LA 1DAKA 3U61B 4ZDWA 1KK0A 3TSZA 1XMJA 5JI3E 3DM5A 2FFBA 3EA0A 4M9XA 4Q00A 2PZEA 3AP1A 1ZVQA 2GEVA 1KI1A 4MYCA 2FNAA 3R7WB 4TYWA 4IDHA 2F1IA 3F3YA 2CK3A 4DEXA 3CKLA 1WRBA 3KKPA 1RIFA 2AXNA 2GVDC 2ZE6A 1QZXA 3Q3JB 4DLYA 3PUVA 4JLPA 4Q4HA 3V4FA 3WNBA 2OAQ1 3F5FA 1NIPA 1P9NA 2A5DA 5TV2A 4Q9IA 1W0KD 2IS2A 1DAHA 2ZI5A 2ZYUX 4KBFA 2JIZA 4XD7D 4DIEA 1U90A 2UZ3A 4F92B 2ZJ8A 1OXXK 2J46A 1Z6YA 2RKOA 4Q1EA 4IFEA 2AN9A 4KVGA 2RHDA 3A58B 1DE0A 1N5IA 4RKFA 4QXAA 4BFUA 1JXOA 4FWIB 4TMKA 3SFZA 1QHHB 1CU1A 2C78A 1W1WA 1JBKA 3SFVA 2KB0A 4W7SA 1IJEA 1Q3HA 3FTQA 2FEOA 2Q3FA 1VDZA 1E2QA 3NC0C 4Q9KA 4RSGA 1XCGB 4HDOB 4KFUA 2A30A 2P6UA 2FPLA 2RGXA 1HURA 2WOJA 2NMVA 1IN5A 4A0RA 4Z1MA 2R6CA 3UMSA 2WMOB 3IQXA 4MYHA 4HDQB 4GOKA 3EW9A 3JVVA 2F6RA 2ZJOA 4JBWA 3WMEA 4FMCB 4ZO4A 3GPLA 1P2UA 2J7PA 3FVQA 4ILEA 1NRJB 1DELA 4N0EA 3VAAA 4WIAA 1I4TD 1BH2A 2CK3D 2KI5A 2VP4A 1K5DA 3O8DA 1LF5A 3H1TA 5FPSA 4C0BA 1P4SA 4PHFA 3AGQA 4B2LA 3EX7C 1OT3A 2FN4A 5JEDA 2B8WA 4K81B 2BMDA 5L3SA 4BLPA 1TF5A 2GETA 4BLSA 2QE7A 4DT1A 1KAOA 1T5LA 2QENA 1E1QA 1OIVA 2R6GA 4HLUC 3Q72A 4W5JA 3DM9B 4DLTA 2YOHA 4RD6A 4Q19A 2BM0A 3WMGA 2CL7X 1U8AA 2W6ID 3BXZA 4TYYA 3TAUA 1W0JA 4PHGA 3GJXC 4KFRA 3D8BA 3HPRA 4JT2A 2EW1A 2F43A 3QXHA 1M74A 3R7WA 1GNRA 4LYJA 2EFEB 1I4DD 3MG9A 4M1MA 5CDFE 4FCWA 4D2IA 2OEPA 1KJYA 2IUTA 4RZXA 5EP4A 3FHTA 2WPDA 3GLHB 4B71A 1YJ5A 1FP6A 4PR0A 3O8CA 4BFWA 4WXPA 4UXHA 5CLLA 5BW8A 4G1UC 2WMNB 3J81k 3IHLA 2QA5A 4DLXA 1N6PA 3DOFA 4NHOA 3QKSB 5DYGA 1U8YA 2P6RA 5FOTA 2K5UA 1G6OA 1U81A 2ERYA 4CT4B 3VQTA 3X1XA 2WKPA 1U9IA 3AP2A 4D0NA 1UEIA 1XMIA 1E9SA 2IT1A 2XB4A 2I1QA 1X1RA 2HV8A 3KB2A 4RD4A 1XZPA 2WWIA 1VIAA 2WKQA 4U02A 2FA9A 1VYUA 1RVDA 4FMBB 4B48A 1GFIA 5DHAA 4KSBA 1F5NA 1CTQA 4LHVA 2EQBA 1JXMA 1OJLA 2DFLA 5JCPA 1U99A 1ZD8A 2ODNA 3C8UA 3I8XA 4X8OA 3TAHA 2YC2C 1JR3E 4LOAA 4OBEA 1S4QA 2GKSA 2RGCA 3WMFA 4HB4A 4GP7A 3B1YA 4OJKA 4HAWA 1II8B 1TEXA 4MRSA 3DKPA 5HKKA 3M6AA 2ORWA 1G8PA 2ECKA 3HU2A 4KCGA 3QKSA 4I81A 4CRWB 4KI0A 5ANRB 1Z63A 2WAYA 3KTAA 1G8FA 5H68A 1BYIA 4PX9A 2QQ0A 4RD2A 3WHLA 2IS6A 1ESNA 4IVRA 1TX4B 2VSXA 3IQWA 1CJMA 1MABB 2Q0HA 5A0FA 4A2WA 2V8OA 5FPKA 5L3SB 2XZOA 4XWKA 4JLBA 2OE2A 2OO7A 3VHXA 4IDNA 1YZQA 2YV5A 3C5CA 4BFTA 3C14C 1NSTA 2CVHA 4FINA 4LDJA 1XCMA 2IS4A 1KZ7B 1E2PA 1OFUX 1UKVY 2GRJA 1ZCAA 2VA8A 3CIOA 3B1WA 2AKYA 1X8KA 3IBGA 1T4GA 1O87A 1GL6A 3K0FA 1KO8A 3WYFA 2IXFA 5AJZA 5FTMA 3TGPA 3PEWA 2CE2X 2CLCX 4US1R 3CNNA 4JSYA 1WMSA 2DPXA 3GP8A 5AUOB 3HR8A 4FMDB 3QY0A 1DAFA 4JVLA 1OPXA 1NJFA 4RD3A 4MKIA 3ZIAD 1J7KA 3I73A 4HAZA 1SZPA 1UKEA 4LPSA 1KI7A 3FHOA 3TR5A 2ZI4A 3TRFA 1NJGA 1DAMA 3B7GA 4OQLA 1KZGB 4F4CA 1HE8B 3E1SA 1W4AA 4BRWA 3I5YA 3IPXA 3I4LA 2WSMA 3T1QA 2FFQA 2O8EA 2D7CA 5IF9A 2ZU6A 3VTKA 4GL2A 3AVTA 2QN6A 1M8PA 1C9KA 1TF7A 3L8YA 1G20E 3GJ8A 4FIDA 3RWOA 1YZUA 3Q5DA 4M8NE 3OEEA 4A2PA 4I1OA 1OW3B 5KDDA 1OIXA 5HTKA 1D6JA 4ASUA 2BEJA 5IT5A 4UNPA 4G5GA 3GJ6A 3U3OA 1IONA 2GF0A 3OFNA 3LAWA 3QIAA 3SDZA 4B2IA 4EUNA 4Z1MD 5J47A 1NMZA 2JJ2D 4L4UA 1W36C 1JI0A 1FMLA 4EDHA 1E9CA 1Y63A 1VYVA 3GEEA 4EFMA 1Q0UA 1E4VA 5G3YA 4U00A 4UQOA 1XPRA 1KDPA 4JIMA 5FPHA 1HE1C 3QKTA 2E1RA 4B44A 4KITB 2CVFA 1RKBA 2VHQA 5JJLA 4ITRC 4URUR 1G8YA 3P20A 3QF4A 2BBSA 3LRPA 1YR8A 2GA8A 2GVZC 5GVRA 2A5YB 3M0EA 1KSJA 3BERA 4NCHA 1KNXA 1T0HB 1FUUA 5EP1A 1M7GA 1SGWA 3EPLA 2VIIA 1J70A 1Z0AA 2MSDB 4Q4LA 1Z6AA 3LVQE 1F6BA 1BMFD 1KO5A 1Z6XA 3EWAA 2PH1A 1TQ4A 1IJFA 2QU8A 3AH8A 1JEEA 3AUYA 3K0FB 1FW6A 2W6IA 1LV7A 3K9GA 4B3CA 4XWOA 5L3QA 3B8HA 4V0NA 1D9XA 2V3CC 3A1UA 2IUSA 4JJKA 5IDVA 4M1YA 1G5PA 1J8MF 1ZU4A 4NDZA 1J8YF 1JR3D 1ZRHA 4PC6A 4LSGA 1AQUA 2YHSA 1NVVQ 4IOKA 1UBGA 2VHUA 4YXWD 1GL7A 1EFCA 1MO5A 3U2QA 3DHWC 4URZR 1II9A 1SVIA 5DISB 2PJZA 2VQSA 1WB9A 2P65A 2VP5A 1R5BA 3QE0A 1IOZA 621PA 3TQCA 4H1UA 2CL0X 1E2FA 1KI8A 2Z4RA 4G0NA 3TE6A 5CM8B 4BECA 4EPVA 2Z4SA 1LS1A 3C5HA 4CEIB 4B2PA 1FTSA 4HZIA 4LHXA 1SVLA 1GRNA 4DUGA 3M4YA 4ZDIA 3FWYA 3K1JA 4NCJA 5C4GB 4MGKR 1PUIA 1IN7A 4TWZA 4A92A 4F38A 1HV8A 1UBCA 4JVSB 1FX0B 1KDOA 3C41J 4URYR 3B85A 1QHGA 1U98A 2ORIA 1ONBA 5P21A 3X1WA 2QBYB 3EIHA 3G82C 4NKRA 3H84A 1IAQA 1Q1QA 1XXHA 5EZ5A 2J1LA 4GBMA 2WBLC 5F9FA 3CRVA 1N6RA 5FTLA 2PJRA 4FMDF 4OL0A 4Q01A 4QC2A 2DFKB 1AM4D 3OZXA 4ZKEA 2DFNA 5SZIA 3SZRA 4DZZA 3R8CA 1ZC3A 4D80A 4GNKA 2FDCA 4LYHA 4PO1A 3W9YA 2NGRA 5HE9A 3NH6A 1GDDA 3GLIE 3OEED 3I5XA 2ODBA 1XTQA 2VP6A 3EARA 4KLNA 4B33A 3CO5A 1E9EA 4ASUD 2CE7A 5CITA 5J4VA 3O8RA 2XTMA 1TUEA 1W2HA 1F2UB 3BC1A 3EC2A 4PAQA 1TF2A 3VKWA 4DDVA 4X8LA 5E7JA 2ZR7A 1KJWA 2VHTA 1S1CA 1DTSA 2YZ2A 3X1YA 4EJSA 1Z0KA 2J0QA 1OH6A 1RRCA 4CEJA 2ZYWX 4JLOA 4C0SA 4D81A 2W6JA 1VG8A 1G19A 3LBHA 2SHKA 2IYTA 2IYQA 2NO9A 1G3MA 5JRZA 2JAQA 1KO4A 1E3MA 1FOEB 2O5VA 2WM9B 3TW4A 3EPJA 1AN0A 1YZTA 1YR7A 4C4PA 4IKEA 2X1VA 1D8TA 3PUXA 5FH9A 1XF9A 4KXFB 4CEHB 4D0GA 2WAXA 1NY5A 4IW3B 4ABYA 5LB4A 4I4LA 4JLVA 2FX3A 2HJGA 5FL7A 5E7MA 1S96A 5JWHA 3P4XA 5FUYA 3SOPA 1PLLA 5KU1A 1GKIA 2XZPA 4NCIA 1GRQA 4HLDA 3UXMA 3OIWA 2FZ4A 4Q03A 4TLEA 5UKDA 2P0EA 3RVBA 3EASA 2JLQA 4QGHA 4ZCLA 3OHMA 4OQNA 4UNRA 2R9VA 4DLZA 1GRRA 2GAOA 2ZRLA 5EE9A 1XCPA 4JL5A 5JWOA 4QGAA 4BZPA 3CR8A 5AR1A 4EJSC 1C1YA 2OILA 3EWSA 2DBYA 2QP3A 3RNLA 2NTYC 4XSHA 2CEAA 2CCKA 4MYUA 3AEZA 3VMFA 2JA1A 2ZS8A 2AXPA 5CK5A 1EK0A 3REFA 4WVFA 4MUAA 3VNVA 2J0VA 4KFTA 5DO9A 4EPXA 3FMFA 1L7VC 1KK3A 1E1RA 2H8KA 5JJKA 3AVVA 3GLGB 1G1MA 4B32A 4AK9A 4QM7A 1GIAA 1WQ1R 1QHXA 4JLDA 5JZVA 1N2CE 4JYBA 1Z6TA 5FUXA 4R2IA 1N0UA 3DDCA 1J90A 3I72A 5EE1A 3TQFA 3ZZTA 2ZJAA 1PVOA 1Z22A 3RS3A 2Q9CA 4CF7A 3RSOA 2CMKA 5EUQB 2FV8A 2R6FA 4Q1CA 3BORA 1CLUA 2ZI3A 4BUJA 4RZ3A 3BB4A 1L4UA 1Q1ZA 2ZRIA 1N0WA 4UXJA 1KGDA 1U9IC 3SQXA 2GJKA 4GMXA 2OBLA 1FPMA 4W5HA 3KKOA 4IDPA 1DS6A 3LH5A 3AVQA 4IEIA 4LGMA 3NVAA 4LZZA 3W8RA 5CB6A 3QXCA 3NEYA 2ATVA 1WA5A 5FL7D 3L0PA 3CNOA 3NH9A 4PTLA 4M4SA 2GEDA 3BJIC 2FPKA 5E3HA 4DC9A 5IK2A 3IDQA 4FW9A 2JLUA 3KKNA 1C4OA 4V0KA 1G3UA 2XZLA 3D31A 4LV6A 4TL7A 2ZR9A 4KAXA 1OXUA 4LJ9A 3K70C 2VP0A 3ZYCA 3KXIA 3QXXA 3G0HA 1KI6A 5JECA 3AF0A 5SZKB 5JSZB 2EYQA 3OAAA 3R20A 1SQ5A 2FGKA 1WCV1 2J59A 2OBNA 1QHIA 1E2KA 1KI4A 1T6NA 1DADA 1DAEA 2F1RA 2GAAA 2ZR0A 3WNDA 2Q9BA 3A37A 5B57C 1XD2A 2YC4C 1MABA 1PV4A 4WZBE 2AL7A 4HLUA 1S8FA 3KB1A 3MAAC 4LJYA 2IF2A 2UVQA 4TN1A 3IILA 3PUYA 3QVUA 3AVXA 3RRNA 4EIWA 3LV8A 3GLGA 4LRWA 1TU3A 2O8CB 5LBIA 2YINC 3AB3A 1XDBA 1YHNA 3LW7A 3LVRE 4L5BA 4C0JA 5KUTA 1WBDA 4DCTA 1PLKA 1Z0DA 2ZJZA 4Q47A 4V0OA 2LWIA 1BOFA 1ZM7A 2BC9A 2OSBA 3FE2A 4TLCA 5JEEA 1RRPA 1V43A 4PPNA 2KJQA 4RD0A 2O0HA 4NYJR 4KLZA 1SXJE 1OLOA 2VEDA 5DSZA 1OFTA 4GRAA 1XD9A 1P5ZB 2ZJBA 1KI6B 4D0LB 1E2JA 3DZDA 4L16A 1NVXQ 4LC1A 3ZS8A 2ZI7A 4CYMA 1SKYE 4WXRA 3D6TB 4E5UA 4C3ZA 4J0QA 2CHVA 2XJ4A 2X19A 2FSIA 4DLUA 2QI9C 4EPYA 3PQCA 1Q20A 2FZLA 3K9LA 5TB5A 4C2TA 1KI9A 1H8EA 4OHVA 3A1SA 1KOFA 2W0SA 3A4LA 1ZAKA 3R9XA 1CRQA 3BGWA 3NHAA 3NHBA 2GCOA 5DN6A 5FR1A 5L3VA 4OHYA 1P7CA 1CR4A 1SVMA 1YZKA 1ETUA 4LBWA 3ZVRA 4DRZA 4A2QA 1E2HA 1ZU5A 2GJ9A 4LHWA 1H8HA 4Q7KA 4H9GA 1ZM9A 3VR5A 5IHPA 2BV3A 2WWFA 4LBZA 1Z29A 4F7WA 2OXCA 2JLRA 3GJ0A 2G88A 3IIJA 2V4ZA 4G3XA 5DLQC 2OV2A 3RRYA 3SJZA 1G3IA 5C46F 2X8AA 1DBSA 3H86A 2QMHA 4TTPA 4S2EA 4DXAA 4B73A 1XPOA 1P73A 1KKMA 1RFLA 1E2MA 3AVUA 3CWQA 4QRHA 3KQHA 2KBEA 3LBIA 3K9NA 4OQFA 4ACBA 5J4KA 5JMTA 5C2JB 4N1AA 2JLVA 2R65A 2CCGA 2ZUBA 5KNBA 2ZRMA 1AS0A 1T91A 2IA5A 1JAIA 4KU4A 4PPGA 4TL8A 1A5TA 1M7BA 2PEYA 2ZJ5A 1VMAA 3KL4A 4EPWA 2ZEJA 4BFSA 1G6HA 5C18A 4D26A 1FQJA 1EFTA 2ZU0C 3VFDA 4D4LA 3DMNA 3E70C 5L8VA 3B1ZA 3KX2A 3QNUA 1W4RA 3N70A 4I1VA 1OHHD 1GNQA 1VIYA 1XD8A 2HEIA 2NG1A 4IDQA 4GOJA 4P32A 4Q5IA 1F48A 2JATA 3ETLA 4X8HA 3MGCA 2ZJ2A 4S35A 5TY0A 4QM6A 2QZ4A 3QQ5A 2Z6VA 1YE8A 5H70A 4LPKA 2D7DA 1HYQA 2HF9A 2N46A 2AHOA 1S0UA 3OAAD 1S9DA 3B60A 4O0MA 1VECA 2GXUA 2HJVA 3GMTA 2RB4A 4KBGA 4TZ6A 1R4AA 4XD7A 1IN4A 2C5LA 2ZRKA 3MJHA 4Q18A 2PMKA 1B23P 1ZD9A 1AA9A 2WTUA 1P9RA 2C95A 2X2FA 5EUMA 1UPTA 3E2IA 1W46A 2W6JD 4HB0A 3UMRA 3IEUA 1OSNA 1YRAA 5B30A 4BPBA 5CIWA 3VKGA 4QNMA 1COWA 1FQKA 1XBTA 5D3QA 1QRAA 3SQWA 1OV4A 3WBKA 1Z8FA 2Z43A 4G01B 3U3KA 4FXPA 5KDOA 2GJAA 1AK2A 4PANA 1NLFA 2HXSA 2YOFA 3MLEA 4Q9JA 2Z83A 3U6BA 1D2EA 4GMDA 3C4JA 2F9LA 5KYKA 4Q4AB 4NTZA 2VH5R 3ZLJA 2QP4A 4ZCMA 2XTNA 3LBNA 4PQYA 3IKJA 2IBMA 4IVQA 4GZLA 1TUIA 1GKUB 721PA 3SJBA 3I62A 1KY2A 4O2LA 3THOA 4NONA 4DLVA 4AYXA 2XITA 1OXVA 3NG1A 2E9SA 4DCVA 1E9DA 2ZVPX 2ZXUA 3B6EA 1EGAA 1LNZA 2QORA 2G77B 2L0XA 2XNDA 1GWNA 1X3SA 4HI0E 3PEYA 2IYZA 2R6DA 1E98A 3KJIA 2ZE7A 1T8UA 5KPDA 4O3MA 1SXJC 3FMPB 3K0AA 4TYPA 1IN8A 1VG0B 1U0LA 4JLKA 1Z2CA 5JCZA 3CRQA 5JWRA 1CKEA 3QBVA 2V6JA 2JIZD 5FBWB 4PZYA 1NIJA 4KYUA 3LXRA 4PHHA 3AVWA 3FFBA 2ZRFA 2Q3HA 1E0KA 1GSIA 1FFHA 1WXQA 2AFHE 2REXB 1W44A 3NIBA 4URVR 3A6PC 1XX6A 5AJYA 1TL7C 2DFTA 3FMOB 4V0ME 3EAQA 4F91B 3ZGXA 2OBMA 2YOGA 2AK2A 2OCPA 2QGZA 4BFZA 4PC2A 2N42A 1W5TA 3THYA 3SNHA 2OLJA 3EG5A 3D3QA 4NYJQ 3CRW1 2UKDA 2BKEA 3AKEA 1E2EA 4HLQB 4NPHA 2GTPA 2V7QD 1ELOA 4BEJA 1WF3A 2XNDD 2W2XA 4XVRA 2QTVB 5B2ZA 2BBTA 2AFIE 4L8GA 4QBIA 2JJ8A 5J4LA 4FI3C 3BE4A 4M9QA 1GUAA 3GQBA 4TSFA 3P1JA 4GZMA 4QHSA 4BZXA 1G8GA 1KI3A 4Z51A 1W48A 2V9PA 3W6PA 5FI0B 1YVDA 2H17A 3GFPA 3HP1A 1AS2A 4ZPXA 1UADA 1S1MA 3OF5A 3U7HB 3NBXX 5IRCD 2QE7D 1Z3IX 1GP2A 2ZE5A 1CR0A 1YQTA 1Z5ZA 2FSFA 4PPQA 2BM1A 521PA 4E07A 5LDDC 4QKQA 2RH5A 1W49A 2J45A 3Q9LA 4KHZA 1G7TA 2VHCA 1K6MA 2QAGB 4DLRA 2F3TA 2JJ1D 2ZRJA 1YZLA 2WICA 1II0A 5F3WB 3B82A 3P26A 4MRVA 4LBYA 1KY3A 4RFSB 4FD2A 1KO1A 5KSZA 1X8JA 2P6NA 5KSOA 4D6PA 1TADA 2IYVA 3MUFA 2WWXA 2QSZA 1R10A 4R7ZA 4P4SA 3BFVA 4A8JA 1E2IA 3BWDD 2A2ZA 2OUKA 3CONA 3LD9A 3B78A 3GEHA 4IRUB 4KJZA 5KSPA 4US0R 3VHLB 1WDTA 4ARZA 4MUBA 2ZUDA 4DSTA 1Z28A 5CYOA 2F9MA 3SJAA 2YJTD 3V9PA 1DEKA 2PT5A 2VSFA 3MWLA 2WIBA 1VG9B 2AWOA 2Q3MA 2NZ8A 3PFIA 3FGNA 1FNNA 1HH4A 1ZNWA 3FYHA 3EZ6A 2XXAA 1DOAA 4JT4A 1OB2A 4II7A 2CHGA 3KDSE 1NN1A 4DUGD 1W4BA 5AUNB 3H2YA 1NVWQ 2N1BA 4G5OA 4PZLA 5H8WA 2QAGA 3RHFA 1IY2A 1X6VA 2E87A 1XEWY 2GILA 3EZFA 1CRPA 3V4RA 2IW3A 2WWGA 3W3ZB 4PAMA 4MITA 2ZRHA 3WRXC 1NKSA 3BD9A 4RKEA 4ZIRB 2G9NA 1CXZA 4MRRA 2P5TB 1AGPA 3K09C 4BASA 2HT1A 4BLTA 4K8OA 1AGRA 1AKYA 2VLIA 3D7MA 3LX5A 1R6BX 2WSSA 1B0UA 2C9OA 4HZUA 4PC1A 3GJ3A 2ZREA 4ERNA 1OF1A 2OM2A 2FF7A 4TL9A 1XTRA 4OQMA 3SYLA 3EA5A 2V6IA 5FBRB 2JLXA 1MO6A 1T8TA 2WVJA 3GJ5A 4M2LA 3UG7A 4AC9A 3R9WA 5DGXA 2QROA 2YWEA 3QF7A 3UATA 3B2EA 4MGIR 1T0JB 1VKJA 1G7RA 1XXHB 3CRMA 3DO6A 4A36A 5JHHB 1EWRA 3QEOA 3PV0A 1W2GA 4NYMR 5FFMA 1E2NA 2J0UB 2ZROA 3I8SA 4LYAA 5CB8A 5KNCA 2ZAMA 3UKDA 4RY2A 1MR3F 3KUDA 1M34E 4P4UA 5CJPA 4B3GA 2C04A 1U0HC 3KXLA 4TMVA 5BWMA 2YKGA 1V5WA 4BLQA 3SR0A 1R0YA 1BYUA 4Q1DA 1Z06A 2YWFA 3BBPA 1IM2A 3CNLA 2QMOA 3QJYA 3BH0A 2IC5A 5F98A 4FN5A 4LJ4A 2ZSEA 1ZUNB 4QBGB 4FCVA 5CLQA 4WBSA 2QMUA 4LK2A 2IS1A 1N6OA 1VHLA 2ZRAA 3PCRB 4D4KA 4TMZA 5FOUA 5JSZA 3OFND 2ZUCA 1NI3A 4HATA 3MFYA 2HLDA 1TAGA 3KKMA 5DNYB 2H1LA 3CPHA 3IPYA 2WJJA 2NIPA 4XTCS 4ZV4A 2HCBA 2OT3B 1Q12A 1US8A 1MV5A 2IYLD 3G5UA 4UKDA 4MDEA 2QSYA 1LVGA 2GESA 1NF3A 4BQSA 5B64A 3T5DA 2Q9AA 3EIQA 1RJ9B 3JZAA 4C2UA 4CEJB 2PCJA 3B1VA 3RAPR 1TU4A 4D82A 1DG3A 1JR3A 2CBZA 2VF7A 4UNNA 1UM8A 4XIGS 4UXIA 4DIDA 2BEKA 1Z2AA 1G291 3W6OA 2NZJA 5AUPB 1HUQA 1RPZA 3AVPA 1KK2A 2R8RA 5H1YA 2VSOA 2RAPA 3WXMA 1LFDB 2ZIAA 2ZJYA 4YMWA 2RCNA 4XTRA 2P2LA 1SKYB 3ASZA 3NBFA 3Q85A 3GLHE 1H65A 4ZDJA 4B75A 4E22A 1M6NA 4HAVA 2QQEA 2CJWB 2XOKA 1Q22A 3CF0A 3X2SA 1E0AA 4YLGA 2PBRA 4H1VA 1J99A 4KV9A 4NYIR 5DHFA 4D4MA 4JLMA 2C8VA 2RGEA 2D2FA 3ZQ6A 1VCOA 2QT1A 1A4RA 2LKDA 1TQDA 2HF8A 2JEOA 2XSZA 3HR7A 2V55B 3PUWA 4ZKDA 3ADDA 4GP6A 3RWMB 2G83A 4NH0A 5A4JA 3KFXA 8OHMA 2J5XA 4KVAA 1KSFX 1E6CA 1P2VA 4R9UC 2HLDD 5EZ6B 3GEIA 2R2AA 3FB4A 1G64A 5FTKA 2W58A 2BIFA 1P60A 3MRSA 4F4JA 4WZ6A 4R2HA 1A2KC 3SI7A 2J0SA 1U2RA 1FL9A 3K0EA 4MQBA 2PX3A 4YQFA 5B58C 1GAJA 1N5JA 2BVNA 4C0QC 4GPTA 2IUUA 5HZHA 2ZRDA 2AK3A 3ADCA 4OQXA 1CIPA 1FX0A 5TXGA 2BKUA 5FUWA 3VKHA 4M21A 1OB5A 1DARA 3KFVA 3L0SA 1F2TA 2G0TA 2ASEA 3CPJB 1JQJC 1ANKA 2O8BA 4KYIB 3U3MA 1P3JA 1G5RA 1QBKC 1CBUA 1IHUA 2DY1A 4JZKA 4NP6A 4HUTA 4GFDA 1XEXA 4RZ2A 1Q1BA 3QSYA 2NO0A 4MRPA 5SZJA 1Y3AA 2H5EA 4DBLC 4QHYA 1H8ED 4Z54A 1R5NA 3AGPA 3AUXA 3WHKA 3TIFA 4ARZB 1JPJA 1EXMA 3KQLA 5DYIA 2QPTA 4E09A 4XSGA 4Q4AA 1ZNYA 4IJMA 4V02A 3KUCA 1G5TA 4CIDA 3DVLA 4ZI3A 1KKLA 2OFXA 2XB2A 4A8JB 4HYYA 2G0NA 1UKZA 5K8UA 1E32A 4NL4H 3V00A 1VCNA 1JQLB 3L0OA 3JVUA 3VR3A 2CLSA 4B43A 3W3AA 3LFUA 3JZMA 2GNOA 1CJTC 2QPAA 5C4MA 4TMTA 2DWQA 1XFAA 1IBRA 1XTSA 2OCYC 3WP1B 5LB2A 1L8QA 1HQYE 3ICQB 2JJ2A 1CP2A 1NLZA 1XD2B 2D3WA 3SN6A 5EXSA 4C7OB 1M7HA 1W7AA 5KTYA 1OH7A 1G3RA 5FPTA 2PEZA 4NBSA 4LV8B 3T06B 1E0JA 1OH5A 1QVAA 2FWRA 1LW7A 1XP8A 3WNCA 4DEYA 5BQ5A 1N3BA 3DZ8A 1KSGA 3F0TA 3OEHA 3L8ZA 4WA7A 3IO5A 3UMFA 2G3YA 1GITA 1X1SA 4JL8A 2AD5A 2HXYA 1G16A 1WE2A 1VG1A 2VL7A 3N2IA 1L4YA 1XB2A 4JJZA 1CR1A 2FMXA 5J4YA 4JKIA 2YWHA 5L3RA 4PO9A 2RMKA 2CDNA 2I1VB 3Q7QA 821PA 3WYAA 3THYB 2ZRNA 1R8SA 3NC1C 2JGNA 1XMSA 3W8NA 4URXR 1M1YE 1TNDA 4NYMQ 4B74A 2LCFA 3CBQA 5DI9A 1E9FA 4MA4A 1UJ2A 1QG4A 3R9IA 2ODWA 2PCLA 3PEUA 3A36A 4TQ9A 4LJ6A 2W2TA 4P4TA 3GLFE 3LO5A 2QMEA 2IYXA 2QM8A 4PQFA 4RJLA 2F7SA 3LQQA 3IO3A 3W90A 2IYSA 1P6XA 4BZQA 3ADBA 2A5JA 2BWJA 2P5SA 4EFLA 1XXHE 3SE0A 3GLGE 4JBXA 3LLUA 4MKFA 3LWNA 4DDWA 3C16C 4MGZR 1BO6A 1XRJA 4TSFD 4PXAA 3FDIA 3DPUA 3OEHD 4I1SA 1W4CA 3U44B 2ZITA 3QOFA 5EP3A 4NE2A 1OFIA 1VTKA 1NBMA 5EE0A 4EPRA 1U0JA 2IX3A 2WJIA 1T5IA 2JASA 3QVVA 2EVWX 4GT1A 1G18A 1R7RA 2IWRA 1XTJA 5LD2C 2BDTA 5FOXA 3GJ4A 4ESHA 4DDTA 2IYYA 4OK3A 3PITA 1N6NA 3K0CC 4Q48A 4DHEA 5FOSA 3SYNA 4XJXA 1ZD1A 3H0KA 4HEJA 4YMSA 2F3RA 4NCKA 1EESA 5SZHB 2OCAA 4RD1A 3E5HA 2ZPTX 1P62B 4PC7A 4JVNA 1RW4A 3ND8A 2QAJA 3CX7A 5LD2B 3PR1A 3BFXA 4YONB 2IEZA 2HDNB 5GJCA 3LY5A 4RZUA 3QG1A 2H16A 2VF8A 3HWSA 3Q7PA 4PSVA 2QTFA 5KPJA 2WWYA 1A2BA 1WP9A 2J7KA 1JECA 3TVDA 3OE7A 3X1DA 1OFHA 1P9WA 1BKDR 2HYDA 3IHWA 1OYWA 3QKRA 4QL3A 1XJCA 2EFGA 3BK7A 4ON9A 4A8JC 2EU8A 4OHXA 1KJZA 1NLYA 1AZTA 3RDPA 3SBEA 1UBEA 1WBBA 3EPHA 1ZW6A 1XU4A 2BCJQ 3I61A 1DO2A 4LHYA 3LQRA 1UF9A 1W47A 3CW2A 2VO1A 4YC7A 5BYKA 4AURA 4AG5A 2D2EA 2F43B 1TTTA 2GXAA 3QPVA 4CEHA 4KODA 2FPMA 1Z07A 3GLIB 5DI3B 1I2MA 2FSGA 4A0GA 1G4AE 5BYJA 2KSQA 5FOVA 2F1HA 2J3EA 2DR3A 3T1TA 1NMXA 2OESA 1DG1G 5HZKA 1E69A 1F2TB 1I2DA 4HZUB 2FFAA 4MYTA 4QGFA 4OHWA 4HB2A 1RZ3A 4OYHA 2XJ9A 2WWHA 4BWYA 2ONKA 1Z47A 3OESA 2J0UA 2X77A 1FNMA 2C9YA 1ZBDA 2BOVA 3P27A 3U44A 2DWPA 2C2HA 4M53A 3U60B 4V0LA 1EX7A 2JDID 2B92A 3U3JA 3UIEA 5FPYA 4C0LA 4MRNA 1N6IA 2J41A 3PEVA 4I1UA 2IYWA 2QEQA 4P0TA 2QPOA 3S1AA 5DN6D 2O8FA 4QGGA 3QF4B 1NN3A 4FCTA 2C96A 2JLWA 3CX8A 4Q4JA 4TT3A 3FMIA 5E95A 2QM7A 1DAGA 2Q21A 2ZYVX 4Q7JB 4AKGA 1DO0A 2IL1A 1R0XA 2YWGA 4POAA 3RABA 4CT5A 3SJCA 4AG6A 3RSLA 2HCJB 3ZVNA 1G4UR 4LJAA 2REOA 5AJVB 2G1KA 2B7BA 3K0SA 1G17A 5EE5B 4EFNA 3HPQA 3IBYA 1T9HA 3AKYA 4JLAA 2PZGA 3BB1A 3N5CA 1CF4A 1DVRA 1P61B 3UK6A 5JFGA 2GEUA 2F1JA 1KAGA 3GJ7A 4TQAA 2FJUA 3QBTA 2IK8A 3EPKA 1QVRA 2GXQA 4Q1FA 3C15C 3K0CA 1UEJA 4XH9B 4FWTA 3MWYW 2OAP1 1E9AA 3QPWA 2O8FB 1AIPA 3P32A 5CDFA 3ICEA 4B47A 1CEEA 5AK0A 4TMXA 1AZSC 2AWNA 4CEIA 4GSYA 4DCNA 4Q4HB 1HT2E 1KO7A 3W34A 4V03A 4WAUA 1HQCA 5F2EA 3SBDA 4LBVA 2ZSBA 4R98A 1SKQA 5HR5A 2F55A 2B7CA 3HJNA 3BS4A 1W36D 3WBJA 2I4IA 4IXNA 2C98A 2XOKD 2ZRBA 3PJRA 4DCUA 3RS7A 1ODFA 1YZNA 2G6BA 3CH5A 3AVOA 2DWOA 4JSTA 1UDXA 1IXSB 1KMHA 5G53C 3TR0A 4JMPA 5G3ZA 3AM1A 1N0VC 121PA 1KDTA 4BE7B 2VPPA 1BMFA 1E9BA 5JHGB 3A1WA 4AD8A 4LJ8A 4QJ4A 3U7FB 3TUIC 1R0ZA 5FTJA 1ZM2A 4PC3A 2QRNA 3B5JA 3CZPA 3VX3A 3I92A 5G41A 3NBYC 1F60A 3IIKA 3SYKA 4IXMA 1FTNA 3GLFB 5DH9A 2GCNA 5FI1B 4DDUA 3TJZA 2WOOA 3TH5A 1QHHA 4EPTA 221PA 3ZVMA 4RVCA 5GADl 4HLCA 4UJ3A 4MKHA 1F2UA 3DKVA 2Q6TA 3L82B 3AV0B 3FKQA 1NSFA 3IUYA 4F4IA 5TARA 1HA3A 2O8BB 2WJVA 1EX6A 4A4DA 1ZINA 1K8RA 1CJUC 3O47A 4TL6A 4YMUA 4LV5B 1XEXB 2EFCB 4RCYA 2ONJA 3ZJYA 1NKTA 3TKLA 3U4QA 1KMHB 4B3XA 1DPFA 1E9RA 2P3SA 3TUJC 3BRWD 1VHTA 2QAGC 4M1TA 2NPIA 3U7GA 1NP6A 3TNFA 3L2OB 3TSWA 4G5QA 1IY1A 1SHZA 3W5JA 2D06A 1A82A 4AKIA 4B76A 2O8CA 1HY3A 2IXGA 4P3YA 4TLDA 3T1VA 4KSCA 3QUSA 4ESVA 2GK7A 2OLKA 2DCUA 1ESMA 3FKSA 1TQ2A 4C30A 1DAIA 4L9SA 2RGBA 1W36B 1Z08A 3PG5A 2CCJA 1OH8A 1ZNXA 1VYTA 1RC8A 4BEBA 1G41A 2FGJA 2EYUA 3CF6R 1JR6A 4M1WA 4DB4A 4P33A 2JCSA 2FEMA 2REBA 3QKRB 2JJ1A 3EZ9A 4TYNA 4W9MC 1OHHA 2NOAA 3CUEF 2EFDB 1W5SA 1D5CA 1QG2A 2ZSAA 1CULC 4B3DA 3DMDA 5GJWC 5JBQA 4C7OA 1UKYA 4DKXA 4ZDKA 2OFOA 2KBFA 4EAQA 5HE8A 1AKEA 1E99A 5FUVA 2FG5A 3FPAA 3CX6A 2ANBA 3KJGA 1FZQA 4CDGA 3THWB 2Z0MA 2IWHA 4AKHA 1D2MA 2PMDA 4TTRA 3Q8XB 3KXKA 1NG1A 2IYUA 3T5GA 1IN6A 2PT7A 1ZM4A 4QHTA 1XZQA 2HYIC 3BFKA 1P2SA 2RGDA 3RRMA 1NBMD 2ATXA 3VU9B 3PENA 4HAYA 1KHTA 3T15A 1XPUA 1ZNZA 3AKCA 1UFQA 2GBLA 1YRBA 3CRRA 4LUCA 4R71A 4OI2A 3HU1A 3HYTA 1E94E 5BN4A 1XJQA 1R2QA 1YR9A 4YMVA 2RGNC 4RFVA 1S9HA 4PQRA 3HU3A 1AQYA 3I3SR 3UG6A 2AD1A 3OIYA 3TLXA 2ZAOA 2ZI9A 1KIMA 2W0MA 2H18A 3QENA 4G5SA 1U94A 1EG7A 4Z8XA 2G1JA 1X8LA 2WKRA 1Q57A 2AKAB 2J87A 4O2RA 4B6EA 1R8QA 4KFSA 5DE3A 3WP0A 4P4SB 2QNRA 1Z0FA 3GCGA 2BJWA 2WV9A 5FR2A 4IVPA 1EWQA 3PXGA 4Q4JB 3NBZC 5TVKA 3T12A 2D4HA 3ZDQA 4B34A 4JVMA 3Q5EA 2V54A 3VR4A 1MRSA 1MO3A 3ASYA 4Q1BA 3DEFA 5DIFA 4DSUA 1AJEA 4OI4A 3EC1A 3ZS9A 1GNPA 5EP2A 2YYZA 4GI7A 2NPFA 2PL3A 3QPUA 5EE3A 2QTHA 4A0FA 1E2GA 3MMPA 3C7KA 3LDAA 4DJTA 4M1SA 3KQNA 3RS0A 3PIRA 5HKKD 3BB3A 5J4HA 5F9HA 1G21E 2C99A 4DLWA 4AYWA 3B13B 4D25A 4DT1B 3AF2A 1Z6GA 5FOWA 1CR2A 1JNYA 3NWJA 3ECCA 2V7QA 3THWA 2EFHB 3BOSA 4Q1AA 4LJ5A 4OKSA 2XSZD 3NXSA 4HDCA 4BFYA 2J7PD 4EQ6A 3B9PA 3OE7D 3K9HA 5JLJA 4AKEA 2O8EB 3DL0A 1CJVC 1N5LA 3TSOA 3ZD7A 3UANA 2KWIA 1SHKA 2ZQ5A 3QEJA 3NDBB 5GJVC 1EFUA 4NU0A 5KDLA 4AWXA 5KOYA 1N6KA 4BGDA 4X8MA 2W00A 1P72A 1XTIA 1E79D 2O52A 1G7SA 2WJYA 1GZSA 2B21A 4JBYA 1FUKA 2OXRA 1TQ6A 1XEWX 1LS6A 1OKKA 4DCSA 3AKDA 5FTNA 1T3HA 5J40A 5JS8A 3RANA 3A1TA 1LTQA 4TLAA 4P31A 4W5WA 3ZZ0A 4AIIA 2DHRA 1ZIPA 3KQKA 3EIEA 4BRUA 3LLMA 2TMKA 3AVYA 1S3GA 1N6HA 5DI3A 1SVSA 2XNSA 3MSXA 4G5RA 3CPEA 2FE4A 2OG2A 2BHRA 4ZI2A 2ZSFA 3H4MA 2BMEA 2NO7A 2VP2A 2C9CA 1HEIA 2ZANA 4A6PA 3GD7A 3SEAA 3SU8A 2B8TA 1OYYA 1J2JA 4NZYA 1ZC4A 4U7DA 4QOSA 1ZYUA 2HT6A 3U5ZB 4GDFA 4QBFA 4M9SA 4B3BA 4HAUA 4YMTA 3RS2A 5LPNA 1E2LA 2A5GA 4Q21A 2RGNA 4NMMA 2O0JA 4Q7LA 1ZP6A 2WWWA 4M22A 1II8A 5CIQA 4CVNA 3CB4A 4ZCIA 4HUQA 4A82A 4M1KA 4B3FX 1UDWA 2GJ8A 4M1OA 2R62A 2A9KA 1MH1A 2ZE8A 2VP9A 4MH0R 4LI0A 2VRWA 1COWD 1GL9B 1NY6A 5BN5A 2CHQA 4AI6A 4C0HA 1H8HD 3ADKA 5FL3A 5K8IA 2WZQA 4QBHA 5E4FA 1S2MA 1IQPA 4A6XA 3L0IB 3RS5A 2CJWA 1U8ZA 1JJVA 4WZAE 2MSCB 2RHMA 3CF2A 3ND9A 2GK6A 2VTKA 2R44A 2CLDX 3AF1A 4LYFA 3N2EA 3WYGA 4LWZA 1OXSC 1YU9A 1YKSA 1KDRA 1ZIOA 1BIFA 1IXZA 4L9WA 1RRFA 1NG9A 2XXAB 2IYRA 1JPNA 5BXQC 4FMCF 2QBYA 1HT1E 1Q21A 1GOTA 4LY6A 5CM9C 3KZ1E 3ZZUA 2FH5B 2GDJA 2WSSD 4D4JA 3T34A 1QHYA 4DLSA 2Y8EA 2GBLC 2W2VA 5KSYA 4AYTA 2ERXA 2J9RA 4Z8YA 6Q21A 5JS7A 1YR6A 2EWWA 3WRYC 2QT0A 4OHZA 4DWJA 1NL3A 5CJ2A 3AF4A 4UJ5A 1VCIA 2EWVA 3EXAA 1Z83A 2A5FA 4YXWA 2GZHA 2IXEA 1F3OA 1R5OA 2R6AA 4MDFA 4XWAA 5AJWA 4QNRA 4ACAA 3U3RA 1O3YA 4E03A 1N25A 1JAHA 3CR7A 1A1VA 4LCBA 5GJBA 1MO4A 1ZUIA 4YDHB 2ZS9A 1QF9A 2ZI6A 3U7EB 3WY9A 3ZQJA 1E1QD 1NN0A 5GVSA 3MCAA 3HYRA 1NVUQ 1PUJA 3HDTA 4EKDA 1GTVA 1UBFA 5EXPA 3AP3A 2YVUA 3THXB 4Y0AA 2QY9A 1G8HA 4JLJA 3LNCA 3MD0A 3CH4B 3A1VA 4ZIRA 2O0KA 1KK1A 5HCIA 1LF0A 1SVKA 3GLFA 3B9QA 2FU5C 4HUQB 3IGFA 2ZRPA 4I99A 5FBLB 2C03A 4YDSA 2YNMA 4N0DA 2FFHA 3W5IA 4Q9HA 4XOIA 3MWKA 2GWHA 2ORVA 3SS8A 3B1XA 2WJHA 3ZD6A 2PX0A 1NN5A 4OI0A 3K70D 1K5GA 4IEEA 4XVQA 5HCNA 3RYTC 4JKYA 3A8TA 4PHTA 3K70B 1P75A 5L3QB 3BH7A 2WPDD 1AS3A 4O25A 3QXSA 1E79A 1ZJ6A 1KMQA 4UNSA 1D2NA 5CYPA 3GLHA 4UNQA 1R0WA 1NBME 1GILA 2FSHA 2W83A 4Q02A 1RJ9A 2P67A 1S3SA 5A5GA 5D3MA 1N6LA 1G7CA 3VX4A 3KJHA 1MT0A 4HAXA 3SC3A 3LXXA 4IOMA 1PZNA 2MMCA 5BN3A 1SVOA 4US2R 5AJXA 3GLIA 4DSNA 3NDPA 2GZAA 2I3BA 2O8DB 1KI2A 2IHBA 2V1UA 4TZ0A 1A7JA 2IEYA 5FBVB 2XEXA 2BMFA 5KO2A 1XNJA 2BBWA 2H57A 1SULA 2PLRA 3PUZA 3PVSA 5EXXA 5K8TA 2H7VA 1XEFA 4MGYR 3ZVLA 2QRZA 4NCNA 3L43A 1OKKD 4A9AA 1JJ7A 2RGAA 3IIMA 4TTQA 4WW0A 4BLRA 4PSAA 5JRJA 1PJRA 5IK2D 2OCBA 4B35A 4AY2A 4F93B 5TDHA 421PA 3OIUA 4IOLA 2A78A 2BCGY 3T61A 3BAFA 1T3SA 2OZEA 2QP9X 4KO8A 5E7IA 3W6NA 1RE0A 3NKVA 2H92A 3UWOA 3GFOA 3FOZA 3VR6A 1Q1EA 5HPYB 3KQUA 1G9XA 1QDEA 4QG7A 4CW7A 1MKYA 1PLJA 4WOPA 3T1OA 1MOZA 3VU9A 1XWIA 4C9BA 1KYIA 2ODEA 2OHFA 4PZZA 5ELXA 2DYKA 4DVGA 4U5XA 1E96A 4TMWA 3K09A 1EFHA 3TW8B 1CS4C 3CWZA 2VHJA 2B6HA 5EQTA 1M2OB 5J5CA 3VR1A 4URWR 4IDOA 2ZM5A 4A0HA 4B6FA 2A3RA 4LHZA 4C0AC 1CJKC 2AR7A 4PSKA 3CLVA 1KNQA 2ANCA 1LB1B 1OXTA 4PFSA 2MSEB 2QGNA 1JEDA 1ZM3A 4Q9LA 2CL6X 4JS0A 3U6KA 4LJ7A 1YZGA 2CNWD 3KKQA 2HUPA 3VR2A 4EJSB 3QXJA 2JLZA 3UPUA 1GVNB 3M1IA 1UAAA 3BH6A 3K0AB 4BLOA 4HSEA 3EZ2A 2JLYA 2GF9A 3ZIAA 2ZVQX 4XVUA 5CK4A 3TK1A 4A1FA 3QKUA 3RC3A 2JLSA 2WHXA 1Q3TA 2O8DA 3TUZC 4JLNA 5D3MB 1SXJB 2FOLA 4CZ2A 2C77A 4CGZA 1IXRC 3F8TA 2BBOA 2ZS7A 1E0SA 2BMJA 5AUQA 1NNEA 4IOJA 3A4MA 2A7QA 4MKGA 1E2DA 3VNUA 1QHSA 4GOXA 4Y0VA 2D62A 2D74A 4A15A 2XAUA 1N5KA 3BIFA 3MWJA 4Q66C 3REGA 2LKCA 2VBCA 1QHNA 2VYFA 2ZRGA 4TQUS 4TYQA 2WIAA 2DB3A 4RCZA 2KE5A 3CZQA 4M0LA 1Q44A 2ZSDA 1X86B 3X1ZA 2GZDA
chains in the Genus database with same CATH superfamily
2CZCA 4OI1A 3V80A 3DOUA 2J5KA 2ILVA 2SNIE 4BKOA 3T35A 3NIFB 2FN7A 4XSVA 4OK6A 3FDZB 4EY6A 3RTGA 5TVGA 5KX5A 1N2HA 3HA3A 3MGGA 4LWOA 3KR2A 4KDEA 4ZVPA 1I33A 2Z5FA 3GGOA 4KQXA 1YRQA 3DFIA 1KS9A 3P4YA 5F51A 1C14A 4QDXA 1Z7EA 3GFTA 3HL4A 4G9EA 4JL6A 5HBRA 2W6NA 3CM0A 3IAEA 4QJ3A 5B4UA 1SBZA 2O7RA 2RHJA 1JPVA 1X94A 4PR3A 2AX4A 5LQNA 4MKZA 5JNVA 5TIIA 1XZLA 5KKNB 4FX2A 4MS1A 1N4DA 3ZVKA 2O3TA 3IS3A 3Q0IA 3FFAA 1CK4A 3ONWA 4OJQA 4RENA 4DA8A 3TVTA 2DKNA 1PV2A 1HTWA 1NFFA 3KJNA 1W6RA 4IZHA 4LS3A 4ILKA 5ALWA 1C7EA 3CWCA 4X97A 1ZK4A 4RK0A 2GJSA 1T0PA 4BNWA 4R8VA 1I7NA 3S1AB 1FMJA 2H1SA 1VPLA 1YACA 2PSHA 2YRFA 3NTUA 4YRGA 1LLFA 1E6WA 2A4KA 3S81A 3LQ2A 4TKZA 2VQEB 1GGNA 2Q2VA 5LKRA 3JD2A 1EP2B 4YROA 1GFSA 4MA0A 3VHXB 2ZJ1A 3R44A 4GZ6A 1U04A 2XTZA 2G40A 5LZ7A 5SYAA 5FLXA 1IOWA 4BMYA 3BHNA 2WJWA 1MRNA 4EVQA 3TQOA 1OFUA 4BFVA 4DSOA 1WY7A 4V0MA 3GP3A 3UJHA 3VKVA 1JQKA 1OGYA 1MA0A 1SXJA 5I6DA 3HQ4O 1FCJA 4C4XA 1GDTA 4M9ZA 4ZEVA 3HP4A 3PHGA 1TM5E 3SF0A 1OZHA 4XQ9A 1KA9H 1VXRA 1C3JA 4O1MA 2BFNA 1DEOA 2G4VA 3JWEA 4IUDS 4TLBA 3V55A 1A96A 4BC1A 4QDZA 2IGBA 4KAJA 1QQ6A 1SXJD 4EYGA 5IZCA 2PUAA 1GG2A 1MG5A 3JQAB 2HIHA 4KJXA 5JI2E 1UXGA 3ANSA 1KDZA 1YAJA 1Z75A 1NQVA 1J23A 2WAAA 3DLBA 4P9NA 1RHRA 2R5FA 4LDPA 4P86A 5GQSA 4JQOA 5IAJA 7REQA 3L5KA 3A4NA 2JDIA 3PNMA 3AUKA 1LW6E 2JAOA 2XHEA 3LT1A 5CB4A 1DKUA 1ZG3A 3U61B 1DAKA 2WP0A 1ORRA 2COEA 1JVSA 2I6QA 3WE7A 4IQ0A 2I7TA 4URHA 1ODIA 3C3AA 1K86A 4HBGA 4ZEMA 5L51A 2FFBA 4Q00A 5JARA 1WABA 1XVVA 1ZVQA 4GWLA 1HDZA 4PN3A 1GL3A 1WF6A 3QSGA 2FNAA 4K6FA 4K9LA 1OJ7A 1QRDA 2R3SA 3F3YA 4IDHA 3UAVA 1Q91A 1YZ3A 3J7TA 4TWJA 1RAFA 5ALIA 1P3DA 5JCXA 3EVCA 5CVUA 3ORQA 3GH3A 3U39A 2HRQA 1KP9A 2INGX 3PUVA 1WD7A 1N2XA 1GLGA 2H00A 2QM0A 3G89A 4Q05A 4Q4HA 5IFLA 3E2PA 2B3DA 3WNBA 1KGSA 2OAQ1 4GKKB 4PGFA 5C7IO 4OP1A 1NIPA 1LVUA 1QQ7A 2C2ZA 3UMJA 3M4XA 4Q9IA 5TQVA 1W0KD 4IXWA 1DAHA 1K75A 3QLTA 2XWQA 3TR6A 2C88A 3AWIA 4N82A 1CUYA 3AFHA 3TFOA 4R0NA 3OQMA 3LPAA 4LIPD 3BWMA 2PS0A 3ZDXB 1H2FA 3NR2A 5JSQA 5FUQA 1JMVA 3AIIA 4FGKA 1FFSA 1WCYA 3BBLA 1EE1A 1F4PA 2XNHA 4QXAA 2IY7A 4BFUA 3AI7A 3NM4A 2C78A 5EJFA 1DUIA 3G7UA 1K4KA 4IS3A 4PO3X 4ZVRA 1IJEA 1Q3HA 3K32A 4RAOA 3NAMA 4HNHA 2VFAA 1E2QA 3STHA 4V0RA 1WX1A 3T3EA 4U63A 3E7DA 4HDOB 4KFUA 2WB2A 4XWTA 4W1QA 2FPLA 2RGXA 1HURA 1SOAA 1R8XA 4Z1MA 5CFMA 4FOPA 3TIVA 4HY3A 5K8VA 3L41A 2PYZA 4P3NA 4MW4A 1U0NA 4NU5A 3WI7A 3GDHA 2DEUA 2XMQA 5H16A 1RFGE 3L7LA 5ERXA 3JVVA 2BGIA 5HA5A 4QDJA 5DNEA 1U1EA 3P94A 3A11A 3RSHA 3IUEA 2J7PA 2ID8A 3LPMA 4F45A 4ZU6X 2XW6A 5GPBA 4ZA2A 1J09A 4JENA 1WW8A 3DMGA 3MWGA 1DBVO 3TS1A 1K5DA 4O63O 4WVLA 3L4SO 4C0BA 5FPSA 1G38A 2W6CX 1IUPA 1SBNE 2CXSA 1E60A 2O7NA 4CL0A 4R8SA 4BQQA 2BMDA 4RFLA 3O7MA 3SKXA 4BLSA 3T5AA 2BSAA 1VZ2A 2QE7A 1M76A 2QQGA 4D8WA 3FCEA 5HYVA 4LCEA 1YB7A 1D5WA 2HJ9A 2PQ0A 2ZBFA 3I6YA 3M1AA 3Q72A 4HLUC 3DM9B 2DZDA 1S6YA 1FJ2A 1P9OA 3CEJA 1C3EA 2P1DA 3AJEA 3PSHA 4Q19A 2HY7A 4DCJA 2H7YA 4BYGA 3BXZA 4H6PA 1NW6A 4RIHA 3CISA 3TAUA 4QTYA 1Z26A 2F3QA 4FEGA 4PLYA 1RWOA 1D2AA 3HEBA 4KFRA 4G5YA 4LHEA 4CTJA 1KJQA 4UBMA 3MOIA 1CV2A 3LO8A 2R8EA 4EO7A 3H9GA 3OCVA 1U8UA 3B3FA 3SYMA 3R7WA 2X4GA 4BJHB 2EFEB 4D98A 2ZXUA 1I4WA 3VYWA 2OEPA 1G6KA 1KJYA 2IUTA 3M3DA 4D2IA 4EI7A 4F56A 2WPDA 3IP1A 2Q1UA 3ONNA 4HF7A 4TS3A 4DBVO 1EEXB 4BNXA 3GUCA 9LDTA 1IDN1 3WKBA 4LYDA 4BFWA 5A4AA 4UU1A 4PS0A 2DERA 2RDMA 3F3MA 4HPWA 1KFBB 4X9XA 1J8QA 1KFEB 2VRCA 2K2QB 3QTLA 4HDSB 5EJAA 2F17A 3RCBA 1YA4A 4DE5A 1P7YA 2QA5A 2Q5OA 4JP3A 2ZYRA 5EMKA 3VO8A 4DLXA 5JQGA 4UUMA 2VQDA 3E58A 5FOTA 1G6OA 2PANA 1QFXA 4JJ8A 4KZKA 3ROPA 3B6MA 2VRCD 1L7DA 1HDGO 2EZ4A 2PE5A 5TE9A 4HAOA 1A71A 5EJ4A 3DHNA 1L5WA 1EGVB 1UBKS 2LNDA 3DMFA 1XMIA 4LF8B 3B9BA 3OOSA 4D4GA 2I1QA 1I2BA 3WS7A 4BCCA 3OKAA 3W5VA 2E1PA 3KB2A 3OZCA 2WWIA 1VIAA 3C6QA 3GGDA 2VDQB 3VDRA 4GUAA 3O9MA 5LQDA 1V11A 4K88A 4DIBA 1F5NA 1J49A 3SSMA 4LOLA 3KV3O 2G9VA 4V0SA 1FYVA 1JXMA 3K4QA 1OJLA 4MB0A 3RC2A 3WSTA 1Y4DE 2B0JA 1ZD8A 3I8XA 2PFKA 4RVOA 4A10A 1RLMA 3F98A 2QUHA 4IV0A 3CUUA 3V4ZA 3ZI0A 1S4QA 2C97A 4JT8A 3WMFA 2RGCA 1Y3HA 5FWDA 1ZLYA 1UEXC 1SUPA 1JI3A 4YEDA 3WLJA 3M6AA 3VBEA 4MW5A 2Y66A 1Z63A 1G6Q1 1QU3A 1F0KA 2R6R1 4ZOLB 4KACA 4PX9A 3WHLA 3MT9A 2Z8YA 2IS6A 4IVRA 3DEZA 1TX4B 2BP7A 3R6TA 5FPKA 2V8OA 3DCYA 3RPEA 6CHYA 5U9CA 2OO7A 3D54D 5AHRA 1H2RS 2AG6A 4XI9A 3VHXA 1YZQA 1ZL0A 1PNTA 1RXUA 3NUZA 4LZPA 2CVHA 2VYND 2QJRA 4LDJA 3TECE 4KWCA 3C6KA 3QVMA 4KXNA 4NV1A 2G5CA 1RQRA 8ADHA 2HWYA 3AUFA 3BRCA 5ESWA 1R4MA 1RJDA 3CX4A 3BAZA 4ZVUA 3WYFA 3PEWA 1PW5A 3NOXA 2HB6A 4ZOCA 2CE2X 4GL4A 5B6PA 3TYXA 3SD7A 3L77A 4MICA 2RAVA 2C2MA 1EG2A 3R0QA 5AUOB 1EPUA 3H7AA 4ZYLA 3HR8A 1MB0A 5AKKA 1FC0A 2XDWA 3BMQA 5CVDA 4H7EA 3IB3A 4XM2A 3TM4A 1JR2A 4MKIA 2DSNA 4R8KA 2YRWA 1J7KA 4QWWA 4OP3A 3JQPA 2ZI4A 1NJGA 3FHTA 2QTLA 1RAEA 1KZGB 1HE8B 3PQEA 3W1WA 1J0AA 1V4BA 1O54A 4HDNA 3I4LA 1B0AA 4BRWA 3HUEA 4YRMA 3T1QA 3B9RA 4EENA 4KPYA 2O8EA 2D7CA 3DDZX 3AVTA 3GAFA 3BEDA 4EY8A 1C9KA 2IEBA 3TIIA 3L8YA 4FQ5A 1I6MA 1N2IA 4HEHA 1YZUA 1HSZA 3HDQA 2EEPA 3OEEA 4M8NE 1Z4OA 2HIAA 2CLEB 5IC5A 4EZEA 4O2BA 1ISSA 2Q5LA 1JN0A 2PD6A 4N9QA 1P5HA 4ASUA 1NQXA 3AHDA 2VPYA 1HYBA 3GJ6A 3OFNA 3DBHB 3FVTA 4N9WA 3REQB 3SDZA 1HG1A 1RI3A 1ZQ9A 5J47A 4DKJA 1TI7A 2YHUA 3NTRA 3H4TA 1U0GA 1ND6A 2WYVA 1Q0UA 1E4VA 1NXWA 2VG8A 1IG3A 1XPRA 3TRJA 4JIMA 5AW3A 1NMQA 4KITB 1EWTA 3DEYX 5AVXA 1IUOA 1AHNA 3R7DA 2VHQA 1MEJA 1X7XB 3FNGA 3WK7A 3DB2A 4J4BA 1NP3A 3LX4A 4URUR 2ZLBA 3LRPA 1MFZA 2GA8A 2GVZC 1T5HX 3PWZA 4DCPA 2A5YB 3FIJA 3BERA 1GLNA 3H5VA 2WPNA 1JEQA 5AHOA 1GZ4A 1KNXA 2GBIA 4Z1OA 5LZ9A 3DLCA 4G0YA 1RWVA 5AQEA 3MB8A 1R15A 4X20B 4S0ZA 2R96A 3EUEA 2CV1A 3G1TA 5SY4A 4O8ZA 4F3CA 1HDYA 4FYWA 5I5EA 2HRBA 2QG4A 1NMEA 3AH8A 4ZOBA 1BROA 1JEEA 1QE0A 1FW6A 3ET4A 5L3QA 4B3CA 1U7OA 2Y3IA 3OZEA 4XWOA 4V0NA 5DHTA 5HG0A 4HNVA 5BSHA 5JNWA 3D0RA 3EFEA 2G76A 2I2CA 9LDBA 2X9GA 3ZE0B 1XDUA 3KVYA 3CZMA 4KQHA 1YS4A 4NDZA 3TGWA 4I9FA 1QIDA 4Q93A 1P2BA 1JMYA 1J25A 1UZNA 3UPDA 1M34A 1TLFA 1C2YA 3WYDA 1ADBA 2VHUA 2PVCA 2X1MA 1EFCA 1WXGA 1TJYA 1U2PA 1DO8A 2CKDA 2OV3A 3DHWC 3HXLA 4XW2A 2JCVA 4YT2A 4RE6A 5DISB 2PJZA 4RUKA 3PQ4A 1OY1A 1R5BA 2VDRB 1GLVA 2ZTLA 4I4NA 3UAWA 3FYTA 4NC9A 1NW8A 4YCLA 1XLTC 3RU7A 3TE6A 5D84A 2QT9A 4U2DA 4EPVA 3LPLA 4RMJA 2NXWA 2P27A 4DXHA 1H2YA 3V8QA 4FBMA 1LS1A 1EVYA 1NF9A 3C5HA 2A9PA 4CEIB 4B2PA 3PVZA 2YCBA 3IDFA 4BTVA 3DZBA 4PS1A 4LHXA 5KWVA 4RPJA 5IMBA 4TRJA 3GV0A 4ZDIA 1YHZA 1OI7A 4G1EB 4ENVA 1JWBB 1PUIA 3R74A 1L7AA 4YJ2A 5AKLA 1UBCA 4JVSB 8ABPA 1UMBA 1FX0B 2PUTA 4J4TA 1KQFA 4BUZA 2GASA 4R2KA 4LTMA 4EG4A 4URYR 3O4IA 4A0QA 5A2GA 1QHGA 2NN3C 2XBMA 2RHGB 2VDKB 4Y2SA 4B84A 1H22A 4R41A 3IQHX 3PNKA 1AQLA 1EJ6A 3NANA 4BN5A 1KF0A 1W85A 1USWA 4AZTA 3ZW7A 3H84A 1XXHA 2B4AA 1VRCA 4IIYA 2ZB2A 4RDCA 4JEIA 3ZBUA 2PUEA 1KOGA 2YJ4A 3VR6D 1C3XA 1Y7PA 3GVCA 3CRVA 3DV2A 1CQIA 3IXQA 4KYTA 4C08A 3MCWA 5CCXA 5F9FA 2W22A 4B6QA 1AUQA 3A4VA 1W87A 3D3EA 2A7XA 1FFBA 2DFNA 5ARDA 3RUEA 3A1NA 4LYHA 4PO1A 3W9YA 1EGMB 1TKCA 1HYGA 2XIJA 1MW8X 1O08A 3B5EA 1XJ5A 1H1TA 2VP6A 2AKEA 2NWQA 2QTMA 5EIEA 5FQOA 1MXFA 5J4VA 2XTMA 3QFFA 4I4TA 2LE0A 2NUAA 4GOOD 4GVPA 3EC2A 3KUXA 4PAQA 4UOQA 4QQRA 3V1UA 2O3RA 4NARA 4E5DA 5KYXB 1KJWA 3KJZA 1N36B 4DQDA 3AR5A 5MFZA 2V6BA 1Z0KA 3D3WB 2XEDA 3GRFA 1WUHS 2OVFA 3NFYA 3VUFA 2IPNA 2ZYWX 4JLOA 3RVDA 3WIDA 3DDSA 1QRTA 4H7KA 4R9VA 4RKQA 1SQFA 3LBHA 2EJTA 1EFPA 1PEYA 1AHHA 3GU3A 3QFHA 5K3FB 1KFCB 2IYTA 4BO8A 3BKWA 1G3MA 3AERA 1VHJA 3THSA 2JAQA 1TO1E 4JJ7A 4XCQA 4OCZA 4YRNA 1E3MA 2O5VA 3O2QB 2LPMA 3TW4A 1AN0A 1KEPA 1MTOA 1YZTA 3L8FA 5M29A 3ORFA 1YR7A 3JZIA 2X1VA 1D8TA 3EEFA 1O57A 3ETDA 4KXFB 4W4TA 2NUPB 3R5FA 4D0GA 4K6HA 1Q7TA 1NY5A 3AILA 4XLZA 3RFFA 5T7BA 2DXIA 1ONOA 5LB4A 4G1FA 1HZZA 4ML3A 5JAOA 1GGJA 5KJFA 4RLHA 1O94C 1S96A 3I2JA 4IIVA 1E3WA 2XZPA 1B4DA 1FTWA 4GMKA 4KMSA 4HLDA 1WDMA 3IAM1 5ALFA 3UXMA 3W7VA 4E2FA 3HUUA 4FNGA 4Q03A 3ULKA 3WDMA 2Y93A 2P0EA 2V45A 5AKGA 1Z45A 1HPLA 4TM8A 3IAS1 3UHFA 2R9VA 1PDWA 5CVCA 5AXCA 5I7WA 1GRRA 1RXIA 2GAOA 3KWFA 5ALRA 4BNIA 3N28A 1Q50A 4XFJA 2X15A 2QX8A 4QUJA 4WA8A 4ZTBA 1OOEA 4NATA 3LUFA 3KDAA 1ZXXA 4DCOA 2WZCA 3TKAA 1PTJC 1ULZA 4FYXA 2W7TA 3DWEX 2QP3A 4O33A 3RHTA 3RNLA 2CCKA 1SKAA 2SCUB 4MYUA 2JA1A 2ZS8A 4FTWA 5FWXB 1QGAA 2RB5A 1T3TA 5CK5A 3VNQA 4WVFA 4Y6SA 1N5DA 1QYWA 2L17A 2YFKA 4EPXA 2BH2A 3FMFA 1L7VC 1E1RA 5JJKA 1MT3A 2QS9A 1I51A 4JJEA 2CFCA 1Y7TA 4AK9A 1TAQA 2Z08A 3DFFA 5EKUA 2YN0A 3N2KB 2A57A 2XMCA 4DQKA 1QHXA 3GLKA 3ABIA 3PX2A 1N2CE 4JYBA 2GO7A 2HRRA 5FUXA 1QCCA 3PDIA 1J90A 4XCVA 4ZCSA 5HK8A 1GTSA 1E8DA 5KNCD 1Z22A 1IN1A 4M60A 2Q9CA 4G26A 4YRCA 1XZHA 1U7TA 1J24A 2VJNA 5EUQB 2AOVA 2UUPA 4MGHA 4YRJA 4Z7JA 3EGIA 4IIUA 1UIMA 1NXQA 1WPGA 1ZPDA 4C20A 5ALTA 2ZI3A 3GIDA 3PF8A 1T8PA 2EBFX 4KN6A 4L4SA 3B52X 4I9GA 5FKJA 3G8BA 1THGA 5F1KA 1AH2A 1PZMA 2CZQA 1LJUA 2QWXA 4FFPA 4Y6GB 3P52A 5D86A 2JZNA 2CYAA 2AG0A 2OBLA 2WDZA 3O95A 3I34X 4KG7A 3KKOA 1JFTA 4OLJA 3DONA 3WMWA 3L05A 1GGEA 5LXTF 4LGMA 3NVAA 3W8RA 1BWQA 3H16A 1EVKA 3C39A 3NEYA 3K6KA 3BE5A 4RQUA 1U4NA 5FL7D 3L0PA 3NH9A 4EL0A 1JGTA 2GEDA 2KYRA 2XUHA 4OHCA 5IK2A 4CCYA 1NVAA 1NWCA 3U13A 3VU8A 1T9DA 1WQ3A 1M2HA 1C4OA 3KKNA 3NHMA 4LSZA 1L4NA 3U0VA 1W6UA 5FNVB 4KGDA 3JRXA 4Q34A 2R86A 2RFLA 3TLGB 5JZ9A 1YTLA 3L46A 1FRZA 4HWPA 1OXUA 4ABTA 5DBFA 3WQHA 2VP0A 3G0HA 1QR6A 2Y0PA 2ZXFA 4NNPA 4JOQA 5SZKB 2F3SA 5JSZB 3RS9A 2EYQA 1T2AA 5IJ0A 2J59A 1E2KA 5LJLA 3CURA 1DAEA 2F1RA 4C0WA 3VZDA 4CCAA 3B3JA 3SR3A 1UKAA 3A37A 2B9VA 4D99A 3B1KA 2BP7B 1TUBB 1BU8A 2C9MA 2AL7A 4HLUA 2HLNA 4WZBE 4XM0A 2RAUA 4EUEA 1U2GC 1QXSA 3QVUA 1M2EA 4M9CA 1YMUA 2MYNA 1NTOA 1NR1A 3A05A 3GLRA 4PY2A 1LV8A 1IVSA 4M89A 4NV3A 4P3OA 4J7AA 4FHGA 4MSUA 2IYEA 5DYTA 1XDBA 4K6GA 4ZJUA 4L5BA 4Y1GA 1JIKA 3OC0A 5KUTA 4CV3A 4IVNA 4M0EA 1Z0DA 3NHZA 5JFOA 4O8CA 5IAKA 5CT4A 2XQIA 1MC1A 3FE2A 1N2BA 3A6LA 2PD3A 7ABPA 5LYJB 3TG8A 1MJGM 4P4GA 2PIDA 3D7LA 3EDMA 3KOWA 1OLOA 2VEDA 2B20A 3GNSA 3HB0A 1P5ZB 1ISMA 1E5LA 2ID7A 5I7SA 3IPCA 3RUPA 2QTGA 1H6CA 1PR5A 3CCCA 2WT9A 2Y1XA 1YK0A 4CYMA 1XFDA 2OZLA 4QOFA 2E4VA 3DMRA 5GY7A 4J0QA 2RHCA 1UMBB 2BN4A 1F6DA 1JDUA 2QI9C 2FCAA 4EPYA 2W4QA 4GR9A 3T9BA 4K7JA 2FZLA 5HIIA 1NFRA 1WWKA 2DJ5A 4W9NC 5TB5A 3WKCA 1JH8A 1H8EA 3KSAC 2FWAA 1KOFA 2C83A 2NX2A 4DREA 2EKPA 2ZZNA 4Y7CA 5DNVA 3FPGA 3NHBA 5BSWA 3ZLBA 3KYCB 4J3FA 3MT8A 1ZU5A 2IYAA 4RVFA 1H8HA 3NNSA 1QGUA 4GBGA 4XR4A 5CX1B 5JALA 1RAGA 3VR5A 5IHPA 2BV3A 1MVOA 5CLJA 2JHFA 4YFYA 5FA8A 1SY7A 2OXCA 4EITA 4L73A 4YECA 5EMLA 3F6BX 4L9RA 4F97A 5KI6A 3KPUA 2G7ZA 4GRDA 2Z9BA 3HVIA 1P18A 2OCGA 3KLNA 1P3Y1 2ADOA 2Y0EA 4DXAA 3H65A 1F1JA 3G2JA 3HVRA 3O82A 3ZYZA 4BO3A 1RFLA 1E2MA 3WWPA 3CWQA 3QEKA 3MMSA 1X7YB 4JBHA 3T1NA 1HL3A 1DRKA 1TUBA 4DRXA 4NI5A 2J0QA 3D1LA 3FNBA 2WU4A 4C6RA 1KY4A 2Z04A 2OMKA 2IKSA 2CD7A 3I5AA 2J6HA 3GRKA 4PPGA 1JAIA 1L1EA 4KU4A 5ICGA 3IVMA 3LQ1A 3F74A 2I1LA 4BFSA 1G6HA 1OLSA 1R0RE 2IUYA 4NBVA 5F76A 1RQXA 3SZGA 4N41A 3QPDA 4BN4A 1LQUA 2MSNA 4D4LA 1FJXA 3DMNA 3KSUA 4N12A 4IFIA 4JR1A 4WY5A 4C5CA 2AMYA 2XKBA 4WZZA 3DBLA 5EKXA 4AMBA 4DRYA 3X1JA 3QNUA 4FSXA 4QPCA 3N70A 1NATA 3NYIA 4FHCA 4QQFA 4U2CA 4E4YA 3GNLA 2HEIA 4RMNA 3DDOA 2JATA 2DQZA 2RGWA 4LVCA 3BJRA 4AVYA 4G1MB 1PIWA 1GPJA 2H9IA 2QZ4A 2RGUA 3OEWA 3QQ5A 3TQRA 4OP2A 3UENA 2N46A 2D7DA 2IVFA 4KPEC 4BU1A 5J9FA 1CUCA 3VZRA 3PNPA 3UMYA 2QTNA 2P40A 5JSFA 2GXUA 2HJVA 4R2WA 5IC4A 5C3UA 1CZUA 1A1SA 2C5LA 2J3HA 3P71T 2HOQA 1FVFA 2AEEA 1GFZA 4YV0A 4F11A 3ZXYA 4M38A 1IQ0A 3WLKX 2D2IA 4BBJA 4LDAA 1UPTA 2IBTA 1CSEE 1DT3A 4HB0A 3UMRA 4N03A 1YRAA 3HG7A 3GOHA 3C97A 4MJLA 5CIWA 1PDOA 4BX3A 3VKGA 2E89A 4IQFA 2O1WA 1E89A 1AXRA 1DQYA 3Q7TA 2JJMA 1OV4A 3FPBA 3L7YA 3P2KA 3PKJA 3KHKA 4ZO7A 1R9JA 2O23A 4X20A 1AF7A 5ADUS 2R8OA 2G80A 1JG7A 1NLFA 2HXSA 3GQBB 1CNEA 4AMZA 4MW7A 1XAHA 3ENNA 3U6BA 3IEPA 5AVKA 1KBQA 3EH2A 2BGGA 5KYKA 3DVAB 3EZGA 1KP3A 3HB4X 2LTAA 2QVLA 2EF1A 1P0QA 2XTNA 3G2HA 3ZOZA 1ZGCA 4QNNA 4ARVA 3UYLA 5GV8A 4LDZA 2ZZMA 4CKEA 3QYPA 721PA 4IVQA 1KAEA 1TUIA 4HRXA 4ZVOA 3SJBA 3ZLVA 1KY2A 3QKIA 3E9NA 1XTPA 5KIAA 3AXSA 4NONA 1H5QA 4MUHA 4AYXA 1EDDA 2CDAA 4UPDA 2QTWB 2ZVPX 3T7IA 1UJ5A 4CF3A 3HXQA 2OXTA 1EGAA 1LNZA 3JU3A 1JIVA 1XK7A 2QORA 1RXEA 2AQHA 2HMAA 2G77B 3A9VA 2XNDA 3EDQA 1KRXA 1X3SA 4MQUA 1DJQA 3PEYA 3R5KA 4RSHA 3VUEA 3I42A 3FUTA 1B16A 2FZWA 4DJDC 5KPDA 2XA2A 2BGRA 3ECSA 1SXJC 3FMPB 4PX2A 1VG0B 1VL6A 3MOGA 4GF5A 1Z2CA 1RCFA 2AB0A 1CKEA 2D1QA 4WK4B 5DTEA 2V6JA 1BHSA 2JIZD 3A2KA 3UC9A 1NIJA 1T25A 4FZ3A 3DTYA 5AKEA 1W34A 2DSTA 2VR1A 1XK6A 3IQFA 4PHHA 2I7CA 4MNTA 4L76A 5WRFA 1E0KA 1FFHA 2RK3A 3PX3A 1WXQA 4R2JA 1T2UA 5KTPA 2BGJA 2REXB 2WIDA 2ZIEA 5E0OA 4D56A 4DV7B 3A6PC 4C78A 4IQ8A 3I2FA 5C8YA 3E18A 1MLDA 1E3SA 1TL7C 4YH1A 1Z5NA 2BZ0A 4LQCA 4EJFA 5K6TA 2YOGA 1K66A 2A1TR 4L6AA 3MWDA 1JYEA 4RVDA 4PC2A 3VR0A 2N42A 3H83A 6LDHA 3EG5A 2M9MA 3AJ8A 4NYJQ 3F1KA 5CDYA 3RQSA 2UKDA 1B00A 3AKEA 1NYLA 4CJXA 4HLQB 5KTKA 2FY8A 4BEJA 3OUUA 3AZOA 4HGOA 1JLKA 3UJ7A 2CXHA 3IOBA 3ILSA 2IJGX 1EZZA 5BV8A 1SIOA 2BBTA 4P8RA 4ROSA 4F3NA 4TKUA 4D3DA 5J4LA 1WAMA 3AB7A 3BE4A 2V7WA 2J0EA 1E3EA 3GQBA 3P1JA 2IZZA 3K8QA 4GX5A 1HOTA 3GZ4A 3IVGA 3WKDA 1JFFA 1XDGA 1VKZA 5MGBA 1O0CA 1L7PA 5E0KB 3AONB 1BC5A 1CVLA 3W6PA 4YP9A 4ZEXA 4AJPA 1F9EA 3K96A 4ITVA 4K9DA 4PZEA 4J6FA 5I4CA 4L5CA 5IRCD 2AW3A 4JBNA 1J5PA 5LOVA 1GP2A 2Z3ZA 1E20A 2ZE5A 2O59A 1CR0A 1Z5ZA 2R8BA 2RH5A 3UGKA 4W9RA 1RU3A 5IHXA 2J45A 3Q9LA 1QYCA 1T5SA 2VHCA 1K6MA 2DLDA 4GRIA 4RTRA 2JJ1D 5TSDA 1BX0A 2WE7A 4LGVA 1I8TA 4M49A 4LBYA 1JBEA 3NRJA 2WMYA 4RFSB 2P4EA 1KH2A 1WHSA 1KO1A 3BDVA 3JQ9A 1JWAB 5JFTA 4E13A 5KSZA 5NULA 1WXEA 1W5FA 1NRWA 1YZFA 1TADA 2AJTA 1PL7A 4GICA 2R5NA 2FYTA 2QSZA 2KPOA 4W7IA 1X2BA 4A8JA 3BWDD 2A2ZA 2PA0A 1NOIA 2KX7A 3UQZA 4KHPB 1T2CA 1Z13A 3MT0A 1FNCA 3E8MA 4US0R 3WO1A 3IUQA 4MUBA 4PZUA 2ZUDA 1I3CA 1EUDB 2XDQB 3GG2A 4P38A 1M8FA 2CKMA 2F9MA 1YBAA 2FHPA 3PRHA 5AXDA 1RHMA 3N2GA 3V9PA 3W6UA 6REQB 4P34A 3JZFA 5BR4A 4TSKA 4KSYA 1KEWA 5CH5A 5D00A 2NZ8A 1QAQA 5B12A 3IV7A 1KU0A 1LPMA 4X66B 3IQGX 1ZNWA 2XXAA 3EZ6A 1J07A 1DOAA 4ZHSA 4JT4A 1WSBA 3B38A 3AHIA 2H5IA 3GRZA 4H3HB 4KK3A 5BOSA 3GN2A 3Q3CA 3A2MA 2N1BA 2Q8NA 2GPYA 5AKJA 3RHFA 1XEWY 2GILA 4WECA 1CRPA 4N7JA 4REQB 2IW3A 3HVJA 3OF3A 3V4RA 2IDZA 3KQWA 3D6VA 3W3ZB 1A04A 2PXCA 4JDUA 4XYEA 1P44A 2I76A 1C9DB 4BP8A 1CXZA 5JSUA 4EYKA 3WLOA 3DD5A 2HT1A 1MN6A 4UMDA 4UDNA 3D7MA 5ESRA 2E48A 3C3YA 2EDAA 5IM5A 3GJSA 3N0RA 4CG2A 4PNEA 4PCLA 2WVHA 3CXUA 2QRVB 2E2WA 2F3PA 4L3WA 4RTOA 1L4FA 2NSLA 1MRZA 4OQMA 3SYLA 3NAZA 4IS2A 3MRXA 1NQTA 4IDAA 4L78A 5E8JA 2EEZA 1T8TA 3E5NA 4ZVNA 4AC9A 3U1VA 5DGXA 2G09A 3B2EA 3JAMA 4MGIR 4QATA 1AY0A 4WLUA 3HWWA 5IDWA 3B1JA 5JHHB 3V48A 3QEOA 4NYMR 1W2GA 5FFMA 1ECCA 2ZIUB 5LSAA 5KX5F 2RJOA 3I8SA 3L1UA 2IY8A 4LYAA 5CX4A 1NSYA 1YBVA 4ZT5A 4CG3A 1QP0A 3WV4A 4B3IA 3KUDA 3QV1A 4K3VA 5CJPA 4QVGA 4B3TB 1P4HA 4NULA 4F9GA 2WF8A 2RBGA 2C54A 4TTAA 1UK8A 4BLQA 2IP1A 2C2YA 3H42B 3DTTA 4RHCA 4Q1DA 1RKVA 3I1IA 3PYXA 3R6WA 4PG7A 3HN7A 4EOGA 1YVPA 3ME5A 4V38A 1UXIA 1JT9A 3CNLA 4OBBA 2IC5A 4RSRA 5F98A 4LJ4A 4Q0MA 2ZSEA 4QBGB 2NSHA 4DADA 4WASA 4WBSA 3INGA 4LK2A 4RMGA 1O95A 1ZS9A 3VR4H 2IS1A 3W3AH 3U5TA 4KFCA 4TMZA 3NU1A 1TZKA 1OTHA 1QG0A 3HCOA 1ZEMA 4A8HA 4YYZA 1XWFA 1W9MA 2X4IA 2YIVX 2NIPA 3CPHA 4BN0A 1FTGA 2IDKA 2OT3B 1Q12A 2NZXA 4G4IA 4UKDA 5BO5A 4MDEA 2QSYA 3I04M 2HD4A 3DC2A 4L0DA 3SZOA 1NF3A 3KQOA 4CR8A 4EMSA 2Q9AA 2QVBA 1RJ9B 3EVZA 4C2UA 3B1VA 1YQDA 2QD4A 4D82A 5MN5A 1GTG1 1JR3A 2M2IA 2DFVA 2XLBA 4UXIA 1H6DA 4YJ3F 2BEKA 1G291 2W8BA 2HPHA 1EP1B 1T6ZA 4WZAB 5JZBA 1EK2A 1SIBE 2XA9A 2XRYA 3AVPA 1ST3A 3TTTA 1RDFA 1SA0B 4KIFA 5COAA 2V7GA 1WZ2A 3C24A 4KVZA 1VP3A 3HA5A 1RD4A 2P2DA 2VDMB 1ENPA 2AFHB 1UM9B 3EMVA 3NBMA 4HX5A 4YMWA 4RESA 2VUTA 1UXJA 5DGIA 3E27A 2PWBA 1IWOA 1M0TA 3AMVA 4O5AA 3RG8A 1T4BA 3Q85A 2HSGA 4MV3A 5A06A 1ZN8A 1X7YA 2ZT5A 3BD8A 2HW8A 4B09A 4OUDB 2WQ6A 2NUTB 3I2KA 1BJTA 1JEOA 4IZ6A 5JASA 1KORA 1DAPA 2QQEA 2CNLA 1Q22A 2XOKA 1E0AA 1XZJA 1G8KA 3LF1A 3OJXA 4FDUA 4PZ9A 5C5CA 4FYIA 4PM4A 2ZUVA 3HC7A 4KE9A 4O0LA 3MELA 3PWTA 3RUIA 4Y6PA 1J99A 5DHFA 5C35A 2VA9A 1I4OA 4JLMA 4YJFB 1E77A 4FFBB 2BR5A 1DKPA 2IV2X 3VO1A 2LKDA 2HF8A 2JEOA 3PUWA 2EBUA 4GP6A 2H4JA 3RWMB 3R9XB 2JFBA 1X1DA 3KFXA 3PC8C 8OHMA 1B3BA 2JZCA 1P2VA 4KVAA 3ZCXA 2ZT7A 1PSZA 2NU8B 3FB4A 3TL3A 4DDHA 3BD7A 1G64A 5KNBD 1MAHA 1N1GA 1P60A 2W58A 3KYJB 3L1IA 3TRDA 3U4GA 3ETJA 4G4GA 4WZ6A 4FQ8A 5FEMA 3ROGA 4BTEA 2QZZA 1N92A 1U2RA 2O0MA 2PX3A 3O93A 4AUNA 4REMA 4A3SA 4ZI7B 2BVNA 1UJ6A 4GPTA 2IUUA 4C0QC 1TCUA 1BKYA 2RHLA 5IC6A 3VAZA 1YNSA 4OQXA 4XCXA 1CIPA 2TS1A 2P9BA 2ZBUA 2B30A 2BKUA 5FUWA 5HFJA 5TXGA 4RJJA 3DGFC 3VKHA 4M21A 2C3UA 3AM3A 3SHVA 3WZ2A 1FXWF 3LOPA 2IV3A 4QE3A 1SD1A 2ERCA 3L0SA 5HW0A 5IJWA 5AI5A 1UMCB 1HI9A 3O4FA 1RMQA 1ANKA 4HC4A 5EIBC 4TV9A 3U3MA 4RLQA 1VGRA 3D5TA 2PU7A 4JLUA 4CLDA 1CBUA 2DY1A 1VCHA 4E08A 2PLAA 4GFDA 4RZ2A 1Q1BA 5AIBA 1Q7CA 2NO0A 5F52A 3DLHA 5LVAA 4F3KA 5BNWA 5SZJA 1WZEA 4KLCA 2H5EA 4N5NA 2O07A 2G6TA 5DWQA 4BMOB 1NNLA 4BFLA 4DBLC 2G1PA 1KHHA 1PJBA 4Z54A 3AR3A 5KNCH 1R16A 4HNRA 2WU8A 3GDGA 3AUXA 5EKTA 3WHKA 4G0MA 4F6CA 1JPJA 3KQLA 1Y34E 2B8JA 2H9AA 3W5DA 1Q0LA 1NUTA 2R25B 4BBZA 4Q4AA 1ZNYA 1VLZA 5DK6A 4JWKA 3M7IA 1U0RA 1CIJA 4NV0A 1KKLA 2HHAA 3WL4A 1ZCFA 4A8JB 2ROQA 1H3EA 3UGQA 3H9EO 1VCNA 1S7CA 1JQLB 3UTDA 2RI1A 3VR3A 1GQRA 1NW4A 1GKKA 1W0CA 2NU7A 1SUBA 4CM9D 1OAOA 1QK3A 2E55A 1QQBA 4S1NA 1IBRA 3P0FA 4TVBA 4YJKA 2Z09A 4CIYA 1HQYE 3ICQB 3I2YX 5AP9A 3RWBA 3SN6A 4NNJA 1XD2B 2JD1A 1VPTA 1OH7A 2I65A 1DCFA 3ESBA 3N0TA 4ME6A 1PFUA 5FPTA 3Q12A 5GONB 2NYAA 3SZMA 1FYFA 4Z5XA 1Q5PA 1W1IA 2O0LA 3SNKA 1VOTA 3LT4A 3T06B 1QPZA 1LW7A 1T9AA 2EC5A 5BQ5A 1BA3A 4B8ZA 5JAUA 1K92A 3S2UA 2JGMA 2WT8A 3VSEA 4PYKA 4S12A 1G42A 3ZDRA 4FFOA 4Q16A 4WA7A 2HDOA 3IO5A 3NM5A 4GXNA 3MWEB 4B6SA 2ZG6A 4OLFA 4E33A 3FOFC 5ALXA 2HDWA 1QH0A 1U3TA 4RK5A