2EFHB

Ara7-gdp/atvps9a(d185n)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
152
Chain Sequence
b'SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
molecule tags Transport protein
source organism Arabidopsis thaliana
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
total genus 51
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efhB00
4N0DA 2CNWD 2FFBA 4M1MA 2GCOB 2PBRA 3W5JA 2HYIC 1HUQA 2O0HA 1ZM7A 2ZJYA 3LFUA 4KCGA 1W0KD 5EE5B 1EFCA 2ZRKA 4H1UA 2H17A 1KSJA 2IBMA 2OXCA 2J0VA 4Q4HB 2C95A 5EP1A 4FWTA 2KB0A 1NN0A 1AA9A 2YHSA 5A4JA 1E2QA 2QN6A 1S2MA 2F55A 1NBME 3GJ6A 3FKQA 1E96A 5IDVA 3T12A 1G7TA 3IILA 4TSFD 5C4MA 4OHVA 3MWLA 4EQ6B 2O8BA 1RJ9B 3CRMA 4TLCA 2ZI7A 3PV0A 3PQCA 2GJ8A 2BDTA 1W46A 3KDSE 2JGNA 2BOVA 2V4ZA 3KTAA 3EPLA 4RY2A 4QC2A 5FTNA 4PTLA 3RYTC 2GILA 1VMAA 1U0HC 2Q21A 2AKAB 3CR8A 3IQWA 4URYR 2ZROA 3EIHA 1YZQA 1RC8A 2XZLA 4Q4AA 3IPXA 1MOZA 4NHOA 3QQ5A 2EYQA 2PJZA 1DOAA 2ZR7A 2FF7A 2OSBA 2WJGA 3DMNA 1FMLA 3O8DA 2VSOA 4A9AA 5B58C 1E2NA 2RCNA 1X86B 4NKRA 1XZPA 4RFSB 4JZKA 1KO7A 5B2ZA 1CP2A 1M8PA 4TN1A 4WIAA 5FBLB 5JBQA 1FUUA 4MYUA 1E2EA 2QAGA 4DLTA 1KNQA 2QNRA 2WSSD 3I8SA 4D82A 5J4YA 2AFHE 1OH7A 3RRMA 1PUIA 1COWD 2REBA 1WMSA 2WV9A 3QXJA 4M0LA 5JRZA 3KXLA 2GJSA 3K53A 3RVBA 1J99A 3P32A 3L0IB 4ZPXA 4ZDIA 3A6PC 1JI0A 2XITA 2ZU0C 4BFSA 3IO3A 1R0XA 3TBKA 3KQKA 3ICQB 5K8TA 2HF9A 2Q3FA 1CLUA 1A4RA 1W2HA 6Q21A 2O8FB 2A30A 4ARZA 4JS0A 4Q47A 4HZUA 3U4QA 4Z54A 4BFZA 4KJZA 2CL7X 3IBGA 3H2YA 2HF8A 2ZI9A 4KITB 4QGFA 4A1FA 3CW2A 3W9YA 4B6FA 2XGJA 1I4DD 3EASA 3AQ4A 2CVFA 2OM2A 1OIVA 2FPKA 1E4YA 4KFTA 1XXHA 2O0JA 4ON9A 3SYLA 3TE6A 4AY2A 1QG4A 2OEPA 3D8BA 1WP9A 2OZEA 3WNBA 4C0QC 5B57C 1JR3A 1Q1ZA 2D3WA 4KXFB 1H8HA 1CU1A 2IS1A 1W4RA 2HT1A 3C5HA 4IOLA 3NH9A 3AGPA 1N25A 5L3RA 3KKOA 3OEED 4LHYA 1OIXA 1AK2A 3FHTA 3W90A 4MKGA 3UPUA 4V0NA 1MABA 4MUBA 5KDOA 2J9RA 2RGDA 2EQBA 1SXJC 3CF0A 3C7KA 4IVPA 3CPHA 1KSHA 2W6IA 3DKPA 3W6PA 2DB3A 1VIYA 4YMSA 1OHHD 3VX3A 1RE0A 3CRRA 4PC6A 2VBCA 5EQTA 3K0FA 2EYUA 2PT7A 3B85A 4Q4AB 1UEJA 1E2PA 1XTIA 2QQ0A 1TEXA 2R9VA 2ZEJA 4LC0A 2XOKD 4KSBA 2G3YA 3T1OA 1OB2A 2O8EA 3WP0A 3RSLA 2AD1A 2ZETA 4DXAA 1NBMA 1AQUA 3A8TA 3DL0A 2AKYA 2XTMA 5E4FA 2G1KA 1J7KA 4DCNA 2A2ZA 2WMNB 1Z83A 3TLXA 1WE2A 2O0KA 5FL7D 1TQ6A 1Z0FA 5CB8A 4OKSA 1LV7A 4L9WA 4ZO4A 1DAHA 3DO6A 3KFVA 4FW9A 2ZJ8A 3FYHA 3DZ8A 4E03A 1OH6A 3MLEA 3CBQA 1KSFX 1UJ2A 2FEOA 3ADKA 5EE0A 2P5TB 3NH6A 4UJ3A 2XJ9A 4N1AA 1NMYA 4G5QA 1CXZA 2D7CA 5SZIA 3W6NA 3AKEA 2BJWA 3SI7A 4YC7A 3U3MA 4IDPA 3TJZA 4EUNA 3TUJC 2GA8A 721PA 3CX7A 1HT1E 1F3OA 1SVMA 1KYIA 4JMPA 3K0AB 4M4SA 1AKYA 4M2LA 2CEAA 1E0KA 4B3XA 1GM5A 1YJ5A 2JJ1A 4C4PA 2CDNA 1VPLA 2QMHA 3BB1A 4US0R 4NCNA 2PX3A 2HV8A 1QHGA 2OV2A 3IQXA 2A7QA 3M4YA 1E99A 4XVUA 1RRCA 121PA 1ZCAA 5JCZA 2LWIA 4DSTA 4Z51A 4URVR 4NZYA 4NYIQ 1IOZA 4A2WA 1TADA 2BVNA 4URZR 1N5IA 1GILA 1EGAA 4ZCIA 4BEJA 2XOKA 1PLJA 4NYMR 3KXIA 1AS3A 4IW3B 3PEVA 3QF4A 4D6PA 4Q4HA 1AJEA 1C4OA 2OFOA 4JVLA 2J0UB 3GLFB 2MSDB 3CWZA 1HYQA 3TGPA 4C0BA 5AR1A 3DHWC 2B7CA 4RZXA 4X8HA 4LV5B 2CE2X 3GLHE 1RPZA 1OJLA 3ICEA 2AWNA 2VLIA 2H18A 3HR7A 1W47A 4PPNA 3H84A 2JDID 4IDHA 2TMKA 2VF7A 4DLVA 4JL6A 3PUVA 2X8AA 2GZDA 1XEFA 4PAQA 1EXMA 2F6RA 4B43A 1HE8B 2IHBA 2FDCA 3HJNA 1Q44A 3BWDD 4XD7A 1GNRA 4LJ7A 2G88A 2QMOA 3N5CA 1P3JA 1P60A 2VP5A 3JVUA 3ZZUA 3C16C 2ZM5A 4D0GA 2A5GA 1G3UA 4R98A 1U99A 3TQCA 3P27A 4B35A 5AJWA 3DDCA 3TVDA 1CR4A 1WBBA 5HZHA 2NG1A 2ZPTX 4LJAA 1NIPA 5H1YA 1SKYB 3AEZA 4C3ZA 3I1FA 4M21A 1D2NA 3FMFA 4RFVA 1YZUA 2YOHA 4LC1A 1ONBA 1G17A 4GP7A 2OAQ1 3NWJA 4LHVA 3P4YA 5J47A 4AIIA 2BBWA 3AF2A 4BGDA 1N3BA 3TMKA 4LX0A 4QKQA 4AKHA 1D8TA 2GVDC 3BH0A 2RGAA 3ZVNA 2EWVA 2IT1A 2VHCA 1LB1B 3UMRA 2IF2A 3THOA 5KU1A 4A8JC 1WCV1 1BMFD 3GEEA 2LKCA 1UKYA 1GRNA 1KMHA 4RD1A 2QY9A 3QPWA 4TL6A 2UKDA 4FIDA 4LJ8A 3L2OB 2GXAA 2ECKA 5L3SB 2NZ8A 4JLAA 2V1UA 1S1MA 3BS4A 1OSNA 2P65A 2ZR0A 4KYIB 3THWA 1AGRA 1ZVQA 4N0EA 1E9RA 1HQCA 4OYHA 4C7OA 2J7KA 3DEFA 4KBGA 2C04A 4ZKEA 2CLDX 4WW0A 4DSUA 3CO5A 1JAHA 3LRPA 3QBTA 2EW1A 3B13B 4TT3D 1QVAA 4Y0VA 4XD7D 1BS1A 3MSXA 2V55B 1SVKA 1LY1A 2ZJ5A 3CPJB 5FI0B 2IUSA 3BOSA 4IJMA 5DYIA 4UNQA 4P32A 1YZGA 2N1BA 3CNNA 2QM8A 1R0YA 4HLCA 4MYHA 2QSZA 2ZANA 3SQWA 3BFKA 1CEEA 4Q4JA 3NHAA 1SVLA 1IJFA 1R7RA 2W00A 1Q1EA 2DCUA 3BJIC 5TARA 3B9QA 4A92A 2FWRA 1UBFA 3K9NA 2OAP1 3L8ZA 4RD3A 3MJHA 2C8VA 5TMPA 2GXSA 4D4MA 1W2GA 3C41J 3CNOA 5FBWB 1SVWA 2FOLA 5FOXA 2VP6A 1NVVQ 2EWWA 2C98A 2OBMA 5EE3A 3P20A 2OE2A 2A5YB 1VYUA 4PQYA 2NO7A 3WYFA 3U44A 4L16A 2GF9A 1TUEA 4FMCF 1G8HA 1DO0A 1N6HA 1P2UA 1KTVA 5KNCA 2JIZD 1AIPA 1AZTA 4CT4B 4U5XA 2WSSA 3QF7A 1OFHA 221PA 4A15A 2Q3HA 4JT4A 1G7CA 4W5WA 5JHHB 2QE7A 2GXUA 5F3WB 4KFUA 3U3JA 1KJZA 3LAWA 4PC1A 2EFCB 2CHVA 4OHXA 2P6RA 2ZSFA 1GKYA 2QGNA 5AJVB 3IPYA 4BFWA 2XZOA 3OIWA 4FXPA 1EFRA 1ESNA 1G64A 3B1WA 1XWIA 4URWR 3SN6A 4IOKA 4C0AC 2PX0A 4DUGA 4F93B 1GWNA 1KO4A 1CJKC 1X3SA 3UKDA 1E94E 2BEJA 4JL8A 1TAGA 1DAMA 3ASZA 4JLVA 4OI4A 4BE7B 3ZVMA 1E3MA 2WWHA 1XD8A 4FD2A 4TL8A 1BYUA 3RLFA 4EQ6A 1XPOA 1E32A 1YZLA 4PO8A 3SJBA 4AYXA 4LGMA 4XWAA 1DAGA 2HDNB 1E9CA 1W4AA 1YVDA 3EWAA 4Q7MB 4QGAA 1XU4A 2BCGY 4PXAA 4XIGS 4LHXA 3NDPA 1FTNA 1FQKA 4Q48A 5DE3A 1GTVA 3UWKA 3VKHA 1P5ZB 3OEEA 1OFIA 4RVCA 4H1VA 2REXB 2ZRJA 4BFTA 1Q22A 1X8KA 4BFYA 2HLDD 3B2EA 4EJSB 3ZD7A 1M1YE 3R9XA 1F48A 2A5DA 2W0SA 2IYRA 4DLUA 1JEDA 3TR5A 3U60B 1RRFA 1US8A 1ZU4A 1ZUNB 1LFDB 2H5EA 2VRWA 2IXGA 1NIJA 5K8IA 5SZKB 4XH9B 2QBYA 3LXXA 1FX0A 4LBYA 3W3AA 2ERXA 3PVSA 2FN4A 1HH4A 4OI1A 1QHSA 2DHRA 2PL3A 4AURA 4BZXA 3OFNA 2D2FA 3L0SA 4V0KA 4DT1A 1PVOA 1U8YA 5KYKA 4OHYA 5FTJA 1GAJA 2MSCB 1S96A 1WDTA 3MMPA 3N2EA 5HCIA 1R2QA 4QBIA 1R4AA 4A2QA 3QY0A 2W83A 4O2RA 4Q1FA 3CNLA 3THWB 1B23P 3PEYA 1E4VA 4PZYA 2IYWA 4HSEA 3KJHA 4V0OA 1VECA 3QEOA 4ILEA 3KKMA 3BFXA 4JJZA 5FUYA 1KIMA 2QRZA 1LF0A 2DY1A 1G18A 2GXQA 1W0JD 1JEEA 1VG9B 2Y8EA 3TW8B 1NG1A 2GTPA 4TYQA 1UF9A 3AGQA 2CJWA 2ZS8A 1XEWY 3A1WA 4OJQA 2HCBA 1IN4A 4IFEA 5DSZA 4C2TA 1F2TB 1EWQA 1JJVA 2L0XA 2JCSA 2WWWA 3R20A 3WRXC 1KJYA 4RFSA 2G1JA 1Q57A 2V7QA 2FPMA 4AKGA 5FR1A 3DOFA 1G5PA 3BH7A 3RS3A 5HZKA 2ZS7A 3LH5A 3CRW1 4LJYA 1GNQA 2ONKA 1VKJA 4L5BA 1IAQA 5DISB 4HB0A 2F9MA 1ZNYA 1OH5A 4L15A 3AV0B 5JECA 2JLUA 5KPDA 2YINC 3AF4A 2DR3A 4UQOA 1JECA 1XJCA 2GEVA 2JA1A 2RGNC 2R6FA 3EA0A 2Q6TA 4B48A 2P6UA 5FUWA 1K5GA 1ESMA 2O8FA 5HE8A 1NVWQ 1ZP6A 2VH5R 4HAXA 3EZFA 5F9HA 3SDZA 1AZSC 1S3GA 3RANA 5EUQB 1OT3A 4EPWA 5JJIA 4LSGA 3CWQA 1NY6A 2FEMA 4II7A 2XJ4A 4R7ZA 4G5GA 2YVUA 4DDUA 1NJFA 1YRAA 1EFRD 1NVXQ 3THXA 2WHXA 4FN5A 1N6LA 1XD9A 1Z47A 5KHOC 4XSHA 2H16A 3QJYA 2O8CA 1GVNB 4DCVA 3U7GA 1OLOA 1I4LD 3GLHB 1K6MA 1DAIA 5J40A 3GJ4A 2FZ4A 3GLIA 4FMCB 4TQAA 3IIMA 3UXMA 4EPTA 3IUYA 4OQFA 4QM6A 1VHLA 2NGRA 1ZD1A 5CK5A 521PA 4D80A 4JIMA 3K0SA 2IW3A 1E2JA 4C0KA 3FHCB 5FUVA 3KQNA 4L4UA 3BE4A 1DE0A 2O8DA 5SZJA 4PPGA 5KSPA 4MITA 4GL2A 4B44A 4NDZA 1ANKA 1HURA 3QKRB 3C5CA 3RS5A 1P2VA 3RNLA 1R6BX 2JLSA 1TQ2A 1IXRC 3BBPA 1SVSA 3RS0A 4MKIA 2X77A 4NYJR 4KODA 4LCBA 1XMVA 2VP4A 1C9KA 3Q72A 2ZAOA 3FGNA 3FVQA 4FMBB 5FH9A 2XNDA 3GJ8A 1O87A 1OIWA 4TWZA 1N5JA 2GCOA 3NTUA 1IM2A 2IYQA 2WWGA 4TLBA 3DZDA 3KKNA 1ZNZA 3UMSA 3HR8A 3C15C 1G41A 5KDDA 4BLSA 5HKKA 4IDOA 2PCJA 1KDRA 3L0OA 3KQUA 4TLEA 1L7VC 2CJWB 2WWIA 1H8EA 1NVVR 2GK7A 3ZIAD 2VL7A 2WWFA 2ANCA 3GQBA 5HTKA 1ZBDA 5EE1A 1XX6A 1M34E 3NEYA 2MMGA 1G3RA 5DO9A 1KY3A 2RGEA 4KFSA 3B1VA 3SZRA 1HY3A 1YKSA 2CCGA 2ZJ2A 3DPUA 5JWRA 1SULA 1XFAA 2FGKA 3Q7QA 1G19A 4LJ9A 2FFQA 2GHIA 4CEIA 5AJYA 1XMSA 2GJAA 2WIBA 4Z8XA 4P31A 3F8TA 4LI0A 5CITA 1XRJA 1A82A 1KI4A 3UG6A 1S9HA 3QKTA 4M1SA 4GOJA 4LYJA 1UKZA 4IEEA 3UWOA 3WHLA 1RRPA 1U0LA 5E7IA 3U2QA 2GZHA 2WOOA 4HB4A 3LW7A 5KOYA 1ZW6A 1TF7A 2YOGA 4X8LA 1EK0A 1Z3IX 4D2IA 1HV8A 3Q85A 4W5HA 4US1R 3ND9A 1TPZA 2VHUA 4Q4LA 4BWYA 4D4JA 2P5SA 2IYUA 2QROA 5A0FA 2GDJA 5CJPA 4DB4A 2KI5A 1XMJA 1TNDA 2HCJB 2KBFA 5L3SA 3U61B 4HUTA 4XTRA 2F3TA 1T8TA 3RC8A 1FZQA 4B34A 2AK3A 4CYMA 1OXUA 1G7RA 4Q7KA 1E2GA 3GPLA 2IF0A 4I81A 4GFDA 3GJ7A 1KO1A 4P33A 5HKKD 4TTRA 1KO5A 4XVQA 3MUFA 3DM5A 2VSFA 5TXGA 4EDHA 1ZAKA 4OI0A 2C9YA 4WZBE 1M74A 1IJEA 4MRNA 3SYNA 3OE7D 3B9PA 1CULC 1L4YA 4TYWA 1W0KA 5G40A 3OE7A 2DFTA 3K09C 4HI0E 5AK0A 3VX4A 4AYWA 4PC7A 2LKDA 2YWFA 4TMZA 3B6EA 5H68A 1ZYUA 1TU4A 3MD0A 5JEDA 4NBSA 4NP6A 4PPFA 1SZPA 3MWYW 1NNEA 2V3CC 2GCNA 2Z6VA 3UANA 5FBQB 4DCUA 3ZH9B 1IXZA 5AUPB 2ZUDA 4LJ4A 2N46A 2DWPA 3E5HA 2G9NA 4F38A 3V00A 2AR7A 1E0JA 3OIYA 1OH8A 1IN5A 4IDQA 3B60A 1XPRA 2GEDA 3FWYA 4ERNA 4ZCMA 2NO9A 3T5DA 3KQLA 3K9HA 3SBEA 1RW4A 1E2IA 1Z0KA 2XSZD 5KSYA 4DEXA 4B47A 2V9PA 4LBVA 3B1XA 2JJ1D 3DOEA 3SHFA 1VYVA 2V7QD 3VAAA 3GLIE 4HAUA 3AP1A 2FU5C 2GZAA 4DCTA 1II0A 5FR2A 1XTKA 4M9QA 4IXMA 2ZRHA 4OK6A 3IHWA 3KUDA 4XJXA 4ZDWA 4Q1BA 3VR4A 4A4DA 2W0MA 1UAAA 1VDZA 3NIBA 3FB4A 2WKQA 5BXQC 1NSTA 1JPNA 1BKDR 2BBTA 1KI2A 5EZ5A 4AK9A 5JJKA 1VTKA 4G5SA 2GBLA 1EWRA 3N70A 4LYAA 4LUCA 4TMTA 3CKLA 4P4SB 2C96A 3BB3A 2LCFA 3WRYC 1DAFA 4YMWA 1FMJA 3AF0A 2YC4C 4OQNA 4E09A 4YXWD 3X1XA 3U4QB 1MV5A 3VR1A 2ZRNA 5H70A 3CX8A 4CEIB 2RKOA 2VIIA 3TQFA 2B92A 1U8AA 3NHBA 5CDFE 1QG2A 1JNYA 3MGCA 2QQEA 4TYYA 2F1RA 1WQ1R 2F1HA 2I1VB 3BB4A 2R2AA 3M1IA 1II9A 4HAZA 1DG3A 1N0WA 1NRJB 1UDXA 3HU2A 1DO2A 2W2TA 4YMVA 2BKEA 1ZUHA 3LD9A 1V43A 4RD2A 2QT0A 1XDBA 3U5ZB 5IRCD 2XTNA 3KL4A 4LHWA 4ESHA 1XCPA 2P6NA 1U90A 4BRWA 2PCLA 3A4MA 3GEHA 4NL4H 3UATA 4M8NE 2QRNA 3AM1A 1MH1A 2BHRA 1G8YA 4WZ6A 1C1YA 3R8CA 2ZUCA 2R62A 5CB6A 5J4VA 3CF2A 3RRNA 4O3MA 1UKVY 3W34A 4QHYA 5CM8B 3ADDA 2OCYC 3EC2A 5CM9C 3LVQE 4Q01A 2HEIA 2NZJA 1MRNA 2J0UA 3K0AA 2BCJQ 3TVTA 4MDEA 3FDIA 5JCPA 4YMTA 2QGZA 2BMEA 5IK2A 2C77A 4BFXA 4LYFA 3D3QA 4B2IA 4JLJA 1BYIA 1GIAA 421PA 2OUKA 4V02A 4HEJA 4OQMA 1EESA 3I5XA 4C0JA 1NKSA 4IFBA 2ZI6A 2A5JA 4GOKA 1KZ7B 5EXXA 4NYMQ 5J5CA 1UBCA 3QUSA 3VKWA 2QA5A 3ZVLA 3WY9A 4AC9A 2J45A 4B3DA 2QU8A 4IRUB 1T5LA 4U7DA 4S2EA 1HA3A 2B8WA 3H1TA 4GZLA 2ZVPX 4G5OA 1JXOA 1G5RA 2ZJZA 3PIRA 3RHFA 3RWMB 3KKPA 1F2UA 1II8A 1G9XA 4DIDA 2IX3A 2OLKA 3IO5A 3RABA 2OLJA 3W8RA 3TAHA 3X1WA 4Q9JA 3ZDQA 2PJRA 4D0NA 2ZRMA 1W5SA 1WF3A 3PUYA 2F43B 3B8HA 3K8YA 2ATXA 4NH0A 3DM9B 2ZRBA 1KZGB 4LBWA 1OYWA 4QNMA 5DI9A 3GD7A 3VHLB 2ORIA 4JLNA 4G01B 1N6IA 2FNAA 2XSZA 1ETUA 2GWHA 3HDTA 3ETLA 4V03A 2QMEA 4GSYA 2VEDA 3Q5EA 4IKEA 3ZGXA 1GL6A 4X8MA 3RRZA 1TF2A 4ZI3A 4P0TA 3O8RA 2C78A 2QTFA 2ZI5A 5BWMA 2Q0HA 2ZIAA 1ZCBA 4DLZA 4WAUA 1XJQA 2GK6A 4MUAA 2X1VA 3GFPA 3QENA 4I4LA 2QMUA 3ZZTA 1GUAA 1XB2A 4FCVA 1KKMA 4KLNA 4KI0A 1RRGA 3O8CA 5LB2A 1R8QA 4B3FX 2IUTA 3QXHA 4TLAA 5TVKA 3TSOA 5EXPA 1WRBA 2WWXA 4TYNA 2HT6A 3CR7A 3NDBB 5UKDA 3WHKA 5F98A 5J4HA 1L8QA 2OXRA 3A1TA 2YYZA 3I92A 1T5IA 3EPJA 1PJRA 1XTRA 1FP6A 2FFHA 3MJRA 5TB5A 4B75A 1KOFA 4AG6A 1XZQA 2OFXA 3TR0A 3R7WA 3VKGA 2DBYA 2D7DA 4NE2A 2QAGC 2AFIE 3ECCA 4ZV4A 4GDFA 3NEJA 1GP2A 2BEKA 2Z5FA 2OBLA 1XPUA 2F3RA 1FNNA 2CLCX 4MRPA 4TSFA 5DIFA 1GL7A 3ONWA 1W4CA 2A78A 1E2HA 1ZM9A 2ZYUX 1MKYA 1P61B 1SXJE 3OAAD 5CIQA 1F2TA 2ZRLA 1MO6A 3KJGA 1V5WA 3ZS9A 1I2DA 2AHOA 3QXCA 3FOZA 4TMXA 4TTQA 1CS4C 1P2SA 1A7JA 5EZ6B 1G5TA 4YDHB 1Q20A 4TMKA 2ZRGA 4C7OB 1ZUIA 4WXPA 3NBFA 3FTQA 2CBZA 3W6OA 1TTTA 1XTSA 4QHSA 1QVRA 1M2OB 2IEYA 1S9DA 4PHHA 3QXSA 2W6JA 2ZJBA 2EFDB 5J4KA 3KJEA 2ZRDA 4TZ6A 4M1TA 1CIPA 3MRSA 5G3YA 3GMTA 4B2LA 2BKUA 4BLOA 1VG1A 3RSOA 2AD5A 2QENA 2QT1A 1XTQA 2ZE5A 1DG1G 1BO6A 3F3YA 4ZDJA 4C0HA 3U6KA 4JBWA 1Z63A 1P2TA 2BBSA 2F43A 4GZMA 1YZTA 4XVRA 4B76A 2Z4RA 2KE5A 1G16A 2GRJA 3K09A 3AVVA 4W5JA 1S1CA 4WZAE 2ZE6A 1TQ4A 1NLFA 1SVOA 4IDNA 4DSNA 1W48A 2WKRA 1KI8A 4MA4A 1RKBA 3NVAA 4BECA 1N6RA 1XD2B 4D0LB 2IL1A 1P75A 5DN6A 4DKXA 3LBIA 2ZE8A 1EX7A 4IOMA 3RS7A 5C46F 1T8UA 3GFTA 2C9CA 4DEYA 1EFTA 4DT1B 4ZCLA 5BYJA 1TX4B 4OHZA 1W0JA 5GJCA 1AS0A 2EFGA 4CF7A 4Q7JB 1EFUA 4W9MC 1EFHA 2VF8A 3TSZA 3LXRA 1QDEA 2O8BB 2ZS9A 3LNCA 4F4IA 3M6AA 4JVMA 3VNUA 5GJVC 1KDTA 2N42A 3QG1A 3OZXA 4B73A 2R44A 2F1IA 1E79A 3EZ9A 3NBYC 2B21A 3OESA 5FTLA 4GP6A 4M53A 5GVSA 3GCGA 1NVUQ 1S3SA 4DCSA 1P72A 4GNKA 3T35A 1W36C 3G82C 4JLPA 3Q5DA 2GESA 3R9IA 5IT5A 4HAYA 1G8FA 4AG5A 1YR8A 4FINA 1G3QA 2WJIA 3LVRE 4NU0A 4PFSA 3CUEF 4DZZA 3SFVA 3AVOA 3I32A 4LY6A 3TK1A 4C0SA 1T4GA 5B64A 2IWRA 3T5GA 1NI3A 3I72A 5DH9A 5CLLA 5KNDA 2AK2A 2G6BA 2NQ2C 4R2IA 4U00A 3RRYA 1Q12A 2R6DA 3UK6A 3WYAA 2ZRFA 1JR6A 3BC1A 2VSXA 4X8OA 2RGGA 2NIPA 3LO5A 1G4UR 4BZPA 4MGZR 4WBSA 2PEZA 1TMKA 4FCWA 4Q18A 1WXQA 3PG5A 4DB2A 4HLQB 3BERA 1OYYA 3MWJA 4EPRA 5JS8A 4JLDA 1G3MA 2ZVQX 1G6OA 4RD6A 2DFKB 4PC2A 4HLDA 1U9IC 1W4BA 2CLSA 3U3KA 4AWXA 1X1RA 4JLKA 4ZKDA 1KMHB 2NOAA 5D3MA 2P3SA 1N6NA 3HWSA 4TT3A 4A82A 2FE4A 2NO0A 2Q9AA 4B3BA 3R8FA 3AVTA 1MRSA 2WJHA 1CJTC 3WYGA 1NN3A 1XF9A 1KHTA 3O8BA 4EFLA 2GETA 3D7MA 3GLHA 2BC9A 4Z1MA 1VCMA 1LF5A 1NN1A 2J1LA 3CH4B 3VFDA 1KDPA 4JLMA 1RVDA 4J0QA 5FPTA 1UPTA 4LJ6A 3B78A 1D5CA 5AJZA 3AP2A 3C4JA 2IXEA 3R7WB 1YQTA 5BN3A 1E2LA 2B7BA 4EPYA 2WOJA 2WTUA 5CYOA 3QVVA 2WZQA 4RD4A 3LQQA 4KVGA 1Z6YA 4W7SA 1ZD9A 1I4TD 2V6JA 3EA5A 1CJMA 2OESA 2OCBA 3NC1C 3L82B 1PLLA 1H8ED 2CK3A 2QAJA 1G21E 2G83A 1K5DA 2W58A 1TU3A 3P4XA 1BMFA 5BQ5A 4B71A 4CEJA 3NBZC 3TUZC 4LPSA 1OXSC 1XMIA 5FL7A 3T1TA 1HTWA 4AKIA 1R0ZA 3AP3A 4PHGA 1QF9A 1NMZA 1FX0B 1NY5A 4QL3A 5TDHA 1HE1C 3AKCA 4BZQA 3TRFA 2UZ3A 4OBEA 2YZ2A 4E5UA 1Z8FA 2IHYA 1IY2A 3PCRB 2AL7A 5FOWA 1MR3F 5CIWA 3O47A 2QL6A 3FHOA 4QBHA 3UIEA 2WBLC 3GEIA 3LQRA 2ZI4A 4JKYA 3CONA 4YLGA 4Q9IA 4URXR 3QF4B 4PSAA 4DLSA 2MMCA 1QHHA 1X6VA 1J70A 4JVNA 3VR5A 3GLFA 1QBKC 2ZR9A 1N5KA 2YOFA 2ODEA 5AUOB 1SXJD 1ELOA 2QM7A 4BUJA 4MRVA 4ASUA 5LD2B 1SXJA 1ZC3A 1JALA 2IA5A 2ORWA 3GP8A 2WJYA 3V4RA 1XD2A 4A8JA 2QBYB 2IXFA 2RHDA 4HATA 5BW8A 4IHQA 3LBNA 3OF5A 3PUXA 2WSMA 2XNSA 4Q4JB 3VMFA 3VHXA 2DFLA 4UXJA 2KWIA 3G5UA 1KDOA 2D62A 1N6PA 1H65A 1E1QD 3EXAA 1GRRA 2FSIA 3ZLJA 2AXNA 1KK0A 3H86A 1E1QA 1G291 3LA6A 3UMFA 2WWYA 1GITA 5EXTA 4P4SA 2ZRCA 2UVQA 3KJIA 3SNHA 2GNOA 2G0TA 2QE7D 1SVIA 2JJ8A 1YR7A 4PANA 1YRBA 2QORA 2VP0A 2J7PD 3AF3A 3S1AB 1W7AA 2J3EA 4JVSB 3VU9A 5FTKA 4E22A 5DN6D 1EX6A 2JDIA 1NKTA 4GPTA 2RB4A 3BRWD 4TQUS 1E69A 4XSGA 3MWKA 3EAQA 1M6NA 3A36A 2VHQA 1A2KC 3U3OA 2WAXA 1D6JA 1OF1A 1CJVC 2BIFA 4M1OA 4AKEA 4M9ZA 5ELXA 3OEHD 4O25A 3ZD6A 5FPKA 4PHFA 4RKFA 5FL3A 3AVYA 3RAPR 1E9BA 5KTYA 1QHIA 1VG0B 1J8YF 4P3YA 3KQHA 2QTVB 2OFWA 2GAOA 4TMVA 1CRQA 1QHNA 1SKYE 4MGKR 1GNPA 1D9ZA 5AUNB 3REFA 1MO4A 4URUR 5HPYB 5CYPA 1FL9A 4CZ2A 1Y3AA 3IBYA 1LS1A 1JXMA 3K0FB 1GL9B 4YDSA 4A6PA 5A5GA 1VCOA 4QOSA 3PUZA 5FOTA 1HT2E 4ESVA 3LWNA 1E2MA 4YMUA 3U6BA 1ZINA 2WPDA 4EKDA 1RYFA 1KY2A 2OILA 2R6AA 1YZKA 2XNDD 1XJ0A 4KVAA 2IK8A 3GJ0A 4B3GA 2PZFA 8OHMA 1TUIA 5JLJA 4Z8YA 3X1ZA 2R8RA 1Q3HA 2H92A 2IYVA 5DYGA 5IK2D 4HUQB 4R71A 2PH1A 1IQPA 2BM1A 2J5XA 2AX4A 3GLGE 3UG7A 5GADl 1S8FA 2CL6X 1P4SA 3A1SA 4LK2A 4AD8A 3GLIB 3EIQA 3QG5A 1D9XA 5EJEA 1OE0A 2OG2A 3THYA 3A4LA 2I3BA 3DKVA 3JVVA 2JLWA 1MO5A 2RGBA 4UNPA 2WKPA 5JWHA 1KGDA 2Q3MA 3VR2A 3DMDA 2FGJA 4Y0AA 2J41A 2W2VA 4RCYA 5EP2A 3HYRA 4HAWA 4Q1CA 5CJ2A 4PO9A 1SHZA 2OCAA 2ODBA 3WBJA 4Q1EA 2JAQA 3E2IA 5FFMA 3PEWA 2J0QA 1F6BA 5E3HA 1DBSA 2EVWX 2EFHB 2V1XA 5E95A 1E0SA 4RD0A 4Z1MD 2QI9C 3Q9LA 2KBEA 1US8B 1XTJA 2A5FA 2F7SA 3LY5A 2I1QA 4JSYA 1UKEA 4JLOA 4TTPA 5FOUA 4DDVA 2ZSEA 3QSYA 2XXAA 1XXHE 3A58B 3FMOB 3K0CA 4KBFA 5EP3A 1U94A 2QP9X 3QVUA 5D3QA 4JJKA 1R5BA 2VPPA 4JL5A 4ASUD 4Q19A 5P21A 4K46A 5DI3A 1ZNXA 4BLPA 1XBTA 4YONB 2BM0A 2E87A 2FG5A 1SGWA 2KJQA 3IGFA 4HYYA 2VP2A 2B6HA 4MRRA 3CLVA 1KI3A 3THYB 4OL0A 2H57A 1RIFA 2ONJA 5JS7A 3GJXC 2QAGB 1G6HA 1VG8A 3RC3A 3EPHA 1GKUB 3B1YA 1AQYA 2Q9CA 3MCAA 4HZIA 3KB2A 2YV5A 4PO1A 2PLFA 1VIAA 4PC3A 3K9GA 1W36B 3AVQA 4ZI2A 2E9SA 2X2FA 2QP4A 2GBLC 5EE9A 3V4FA 3SFZA 2DFNA 3ASYA 3QKUA 4NMMA 3RDPA 5CLQA 3PXGA 4EAQA 1NN5A 1P9WA 4UJ5A 3PJRA 3T06B 2FV8A 4WVFA 4F92B 3ADCA 4S35A 2QPOA 1M7GA 3QBVA 2RGCA 1AM4D 1ZM2A 3FFAA 3QEJA 4LV8B 5GJWC 2YKGA 5KSZA 3FKSA 1B0UA 1P6XA 1KNXA 3KFXA 4QGHA 3ZS8A 5KSOA 2D4HA 2CE7A 1PZNA 2O5VA 4OHWA 1X8LA 1SXJB 1UADA 1Z6TA 1IY1A 2FX3A 5EP4A 2FSFA 3AVUA 5IF9A 4JKIA 3MG9A 1Z0JA 2P0EA 3CZQA 1N2CE 4Q5IA 3IIJA 5DNYB 2YWHA 1Q1BA 2ZJAA 3HU1A 4O2LA 1HEIA 3S1AA 1CRPA 3J81k 4Q21A 4NYIR 1NP6A 3WP1B 1E2KA 3FMIA 4FMDF 1S0UA 3EARA 4DIEA 1OFTA 1I2MA 2IC5A 5C2JB 4Q03A 4KO8A 2W6JD 2OO7A 4D4KA 3SJZA 4TL9A 3KTAB 5JRJA 2HXYA 1D2EA 3SQXA 2QEQA 5FPHA 4C30A 3BK7A 5B30A 4BLRA 1VCIA 3I62A 2FA9A 2FMXA 1FTSA 1W49A 2ZQ5A 3A4NA 1Z5ZA 3C14C 4EPVA 3CPEA 1SQ5A 1SHKA 4B32A 2RGNA 3VR3A 4D25A 2DPXA 2NMVA 1KI6B 3ZIAA 5JI3E 2ZRAA 3EW9A 3Q8XB 4DLRA 4I99A 2W2XA 1OW3B 1FUKA 2XTZA 2QZ4A 1Z06A 3KB1A 4A2PA 4UXHA 2XB2A 2H7VA 1TL7C 4OQXA 1ZRHA 3U44B 2ZITA 2QUZA 4PSKA 3I3SR 4D4LA 2JLRA 3SHWA 2GCPA 5C18A 4JSTA 3T15A 1JAIA 1KI1A 2OT3B 1TF5A 1YHNA 2X19A 5HR5A 3GLGA 3VNVA 2JJ2D 3ZZ0A 4PSVA 1EG7A 1UDWA 3BH6A 4US2R 4EJSC 5L3QB 4MGIR 1U98A 2DYKA 1OXTA 4P4TA 4KU4A 1DELA 1MT0A 1Z0IA 1FP7A 1GRQA 3BIFA 1KAOA 5JEEA 3W5IA 5JZVA 5FBVB 1NLZA 4CEJB 1F5NA 4RZUA 3N2IA 1K8RA 2RMKA 2Z0MA 2F9LA 4LRWA 4R2HA 3RS4A 4BRUA 1E1RA 1HQYE 1T9HA 4DDTA 1TQDA 5FUXA 621PA 2OBNA 2PZEA 2C2HA 4CDGA 5DI3B 4DRZA 4JBXA 5LB4A 4CGZA 2VQSA 4JT2A 3BAFA 3TH5A 2J46A 1FW6A 3AVPA 3KZ1E 1Z2CA 3K0EA 2IS2A 1DS6A 4MYTA 3EX7C 5TV2A 2CCKA 2VTKA 5J4LA 1BOFA 3ZQ6A 4HB3A 1GSIA 3QPUA 1G4AE 4HZUB 4QGGA 1T3HA 4A36A 1IN6A 4CEHA 2FH5B 3PUWA 5GJBA 3QNUA 2VHTA 4I1UA 3QPVA 3K70C 1GOTA 4EFNA 1P73A 1ZJ6A 4OK3A 4Q9HA 5L3QA 1Q21A 2A9KA 1T0JB 3AH8A 5CDFA 1KK1A 4MKFA 4AYTA 2AXPA 2YNMA 3T61A 2R6GA 5K8LA 3SJAA 1G3IA 2BWJA 2JLVA 4OJKA 3NG1A 4HAVA 4M1YA 3SS8A 4AI6A 4LWZA 2O8CB 5JMTA 3SEAA 3PITA 3PFIA 3X1YA 1IHUA 1CR1A 2FZLA 2NPFA 4E07A 1JR3E 1PUJA 1J90A 2EU8A 4DUGD 3QKSB 1Q3TA 2WMOB 5AUQA 3WMEA 4P4UA 3LLUA 4NCHA 3I8XA 5D3MB 1XEXA 1U2RA 3F0TA 3AF1A 2V8OA 1IBRA 4O0MA 5JSZB 3H0KA 4QFMA 4UNRA 4GT1A 1CBUA 1R5OA 1XNJA 1M7HA 2B8TA 4A0HA 2JLYA 3BORA 3JZMA 4CT5A 1Z08A 2JLQA 1D2MA 4MQBA 4KSCA 1ZM4A 3GJ5A 4NCJA 2FJUA 3AVWA 3NKVA 1IN7A 4A0RA 2HJGA 1ZMXA 2R6CA 1ODFA 1UM8A 2ATVA 4DLXA 1Y63A 5EUMA 4HDOB 2PEYA 4Q00A 3X2SA 2BMJA 3VTKA 4LJ5A 1S4QA 3I5YA 2ODWA 3SOPA 4ZIRB 1DTSA 4DC9A 1VCNA 3EC1A 2ZYWX 1FNMA 1JQLB 4WA7A 2V6IA 4ACBA 2GJKA 4B74A 2WAYA 4TL7A 1R8SA 2CVHA 3OIUA 4LZZA 3SR0A 5LD2C 4PR0A 1F60A 3TSWA 1CF4A 1UBEA 5FI1B 2IS4A 3DVLA 2H8KA 4CW7A 1YU9A 1T3SA 4GMXA 5DLQC 5SZHB 2AWOA 1P7CA 2FSHA 1DVRA 2G0NA 4LV6A 3W3ZB 3KXKA 1ZM3A 4PHTA 4D81A 2X2EA 4GI7A 1KK3A 3B5JA 5LPNA 4BLQA 4IEIA 2PLRA 1DADA 4WOPA 4TQ9A 4XOIA 2RH5A 5KO2A 1N6KA 4FMDB 1NSFA 1G8PA 3A37A 2ERYA 1T91A 3Q7PA 2XX3A 1R0WA 3FMPB 1DPFA 5FBRB 4B2PA 1Z6GA 4L9SA 1FFHA 2IYTA 3PEUA 4KLZA 5HCNA 1E9SA 3QXXA 4QXAA 3IKJA 4YXWA 1FPMA 2KSQA 2XZPA 3TW4A 4JYBA 4NTZA 3C8UA 2HUPA 4PPQA 2XXAB 4PQFA 1GKIA 1BIFA 4F4JA 3GLFE 3TKLA 2ZSBA 4QJ5A 5KPJA 1M7BA 1O3YA 4KHZA 2Z83A 3OAAA 1NF3A 4UXIA 2ZTSA 4OI2A 2JATA 4IXNA 3H4MA 5G3ZA 1DEKA 2V54A 5C4GB 1WA5A 3IHLA 4B33A 3CM0A 5F9FA 4OQLA 1JJ7A 1R10A 1R5NA 4KAXA 1KI7A 1W44A 2ZYVX 3U7EB 1LNZA 3I4LA 3QKSA 1ZC4A 3V9PA 5LDDC 2ZJOA 1Q0UA 5JJLA 3U3RA 2AN9A 3CRQA 4NCKA 5JSZA 4BQSA 3WXMA 1UFQA 4OK5A 1E9DA 1CJUC 3CF6R 2HXSA 4K81B 4L8GA 2CXXA 3AKYA 3B1ZA 3L43A 3EZ7A 4UNNA 1ZU5A 1MO3A 1ZD8A 3LV8A 1YZNA 4BFUA 4F91B 2D06A 4LBZA 2QG6A 4QJ3A 4M1KA 1CTQA 3THXB 3A1UA 2J0SA 3TIFA 4CEHB 1OB5A 3ZYCA 1P62B 1A5TA 2BMDA 2ASEA 3D31A 3LLMA 3OFND 1WBDA 1QZXA 1E98A 1Z29A 2C5LA 3Q3JB 4FCTA 4LOAA 2CNWA 4RKEA 1W5TA 1FOEB 4RCZA 4ACAA 1GDDA 4M9XA 2ZXUA 1AS2A 2ZUBA 1X8JA 3QE0A 4GMDA 1OKKA 4ZDKA 4YQFA 4N3NA 5JHGB 2C9OA 3IDQA 4DBLC 2ZRIA 1PV4A 2RHMA 2J87A 2UZIR 5E7MA 2IS6A 3T1QA 3HYTA 3HP1A 2D2EA 4LPKA 3WBKA 4M1WA 4DLYA 1Z6XA 1E2FA 4CIDA 1SKQA 2XAUA 5K8UA 5DGXA 3HPRA 2NO6A 1NL3A 2SHKA 3OEHA 3ZVRA 1NJGA 5CK4A 2CMKA 1Z0AA 1P9NA 1U9IA 4LYHA 2JLZA 3FFBA 4XWOA 3WNDA 2WIAA 5FTMA 5GVRA 1GG2A 4HDQB 2XEXA 5DHAA 2ZI3A 2C03A 3PR1A 4NONA 5LBIA 4G5RA 4ITRC 1YR9A 1GZSA 3NXSA 4QJ4A 1YR6A 3BFVA 3QIAA 1RFLA 4IVQA 1LTQA 2OCPA 2WM9B 3MFYA 1MABB 2E1RA 3CB4A 4MRSA 4Q7LA 4HLUC 1ZIPA 3TUIC 5BN4A 1XCGB 3K9LA 3ADBA 2IYSA 4EPXA 3VR6A 1N0VC 1UEIA 4EIWA 3K70D 2Q9BA 1JB1A 4M22A 4QM7A 2BMFA 4BPBA 3FE2A 3KKQA 2CHGA 4HUQA 2ZAMA 4EFMA 5FPSA 1AGPA 4DSOA 2VP9A 3CRVA 1WB9A 4TYPA 2QSYA 1BH2A 1Z22A 5DHFA 5JWOA 2CK3D 4IVRA 3SYKA 3TNFA 5G53C 3FPAA 2GEUA 4GRAA 3LW8A 1AKEA 2WJVA 2F1JA 4JBYA 1CR0A 3TAUA 4G1UC 3GLGB 2IEZA 3LDAA 2I4IA 1DARA 1KKLA 3HPQA 2Z43A 1OKKD 3B82A 1NG9A 4KFRA 1FQJA 3CZPA 4QRHA 3K0CC 4B3CA 5JFGA 5BN5A 1G7SA 2REOA 3CX6A 4MH0R 2VO1A 3D6TB 2RGXA 3ZJYA 1AN0A 1W1WA 5H8WA 4HLUA 3T34A 2QPAA 3I61A 1LW7A 4DJTA 2HYDA 3LX5A 4CRWB 4POAA 1LS6A 2GF0A 4CVNA 3EWSA 5KDLA 4A8JB 2G77B 3SBDA 1T3LA 1T6NA 4RSGA 2P2LA 4C9BA 5BYKA 1RZ3A 5E7JA 3EG5A 1G8GA 1A1VA 1A2BA 2YWEA 5AJXA 2EFEB 1E79D 2PMKA 3F5FA 3AUXA 3NBXX 2PZGA 2ZRPA 4QBGB 1E2DA 1IXSB 2JASA 3QI2A 4GBMA 5EXSA 2DWOA 1NLYA 2ZREA 3VQTA 4DWJA 3AKDA 2OHFA 2XB4A 3AB3A 4D26A 2JEOA 3OIVA 1U8ZA 1OHHA 3CH5A 4PZZA 3SC3A 4I1SA 1QHHB 2Z4SA 4UKDA 1W36D 3BD9A 3EZ2A 3A1VA 1U81A 3K1JA 2FSGA 5L8VA 1N5LA 1N0UA 1U0JA 1X1SA 4UNSA 1JPJA 2QP3A 3R9WA 2WVJA 3E1SA 2GVZC 1PLKA 3JZAA 2H1LA 4BLTA 3U7HB 4MYCA 4Q1AA 3BGWA 5FOSA 4C0LA 4QG7A 3CIOA 4XTCS 1KSGA 4DLWA 4MDFA 4TLDA 5KUTA 2DWQA 1XP8A 5HE9A 5ANRB 2IWHA 1G1MA 1N6OA 4KYUA 2CL0X 3G0HA 1XEXB 4GOXA 1Z0DA 2GJ9A 4Q1DA 4ABYA 5AWFC 5C1BA 2P67A 2WICA 3U7FB 2O52A 1CR2A 4DHEA 2O8EB 4U02A 3B7GA 1Z6AA 3RS2A 2GKSA 5G41A 3IEVA 3KX2A 4QHTA 3NC0C 3REGA 4A0GA 5IHPA 1OFUX 1KAGA 4A6XA 3LBHA 1IN8A 1JBKA 821PA 2FFAA 1KJWA 3L0PA 3LX8A 4BFVA 2QTHA 1E9FA 2ZU6A 1Z2AA 1RYHA 1L2TA 2WJJA 2J59A 4I1OA 2VHJA 1UBGA 3WMGA 3ZQJA 2A3RA 3WMFA 2O8DB 4R9UC 3AUYA 4XWKA 4TMWA 4H9GA 3SJCA 4A0FA 1Q1QA 4G0NA 4I1VA 4NPHA 1DAEA 3L8YA 2PMDA 4DDWA 1OPXA 3I73A 2GAAA 2WPDD 4RZ2A 4WXRA 5TY0A 2BBOA 4QNRA 2D74A 1GFIA 4C2UA 1KK2A 1J2JA 2W6ID 2YC2C 4G3XA 3MAAC 3X1DA 4V0MA 2ZYTX 4MKHA 4KV9A 1E6CA 4FI3C 2ODNA 3P26A 3W8NA 4M9SA 2ZSAA 4FWIB 3HU3A 2CCJA 2JIZA 1XXHB 4NCIA 5L3VA 3IEUA 1G20E 4TZ0A 2NTYC 2C99A 1KI6A 4B6EA 5M04A 1T0HB 1QHYA 2ZSDA 3RWOA 2JLXA 1QHXA 5KNBA 1F2UB 1II8B 1YE8A 3OHMA 1VHTA 2J7PA 1E9EA 1J8MF 3E70C 4LDJA 1ZNWA 2IYXA 4ARZB 2YWGA 1Z07A 2BV3A 4Q9LA 4NYJQ 1Z28A 4PQRA 4JYCA 4PZLA 3BXZA 4EJSA 1XEWX 4V0LA 3WNCA 2ORVA 2VYFA 3QOFA 3FKSD 1P9RA 1OV4A 2R65A 1CKEA 2JJ2A 3ND8A 3IIKA 2IYYA 3VU9B 1XCMA 3GFOA 4F4CA 2CHQA 1QRAA 1OXVA 1LVGA 1KI9A 4LHZA 1H8HD 4HDCA 1L4UA 1JR3D 3EIEA 4JLBA 4PAOA 4DVGA 1OXXK 2IYLD 2K5UA 1E9AA 2IYZA 5F2EA 2MSEB 2RAPA 1TEVA 2VA8A 4IOJA 4F7WA 3K70B 1E1RD 3P1JA 2QPTA 1E0AA 4BASA 3M0EA 3EZ6A 2PT5A 4MGYR 1RJ9A 4RZ3A 3AVXA 2ZE7A 2HLDA 4ZIRA 3T1VA 4Q66C 4PAMA 4BEBA 2YJTD 4V0ME 1JQJC 2NO1A 2IUUA 1KMQA 1KO8A 1DAKA 2ANBA 1NMXA 2NPIA 4Q02A 4PX9A 1IONA 3QKRA 4HB2A 5FOVA 3GJ3A 4K8OA 4RJLA 4Q9KA 5FPYA 1IY0A 3EPKA 3KUCA 4QBFA 2HJVA 3PENA 1NBMD 1COWA 5JI2E 1VYTA 3SE0A 3SU8A 2FPLA 1ZIOA 2BJVA
chains in the Genus database with same CATH superfamily
5EI5A 4LOIA 5PGMA 2G7ZA 2BGJA 2HNAA 4EHKA 2FP3A 3VR4H 5LMCA 5A03A 1HUQA 3GEPA 5CA0F 1UK9A 4IDAA 5FNVB 1M6VB 1BXRB 5J23A 1EFCA 2ZRKA 4KPUB 1QO7A 1KSJA 3WGZA 5I9BA 4P7KA 4Q24A 4A10A 1WXWA 2C95A 4JUAA 5JROA 1ZZGA 1FZTA 1O96A 2IW1A 2QTMA 4M7OA 3SZOA 1ZOIA 1RJWA 4II2A 3T7KA 2J9GA 2EAUA 4TTTS 4E6PA 2QTBA 2PWBA 5JMPA 5K3SA 4OHVA 4BC1A 3HO1A 3U4MA 2G09A 2O8BA 1DRWA 1W0CA 3VVLA 1YIAA 2GF2A 3LQYA 4X6XA 4E4YA 4MWCA 4N5DA 1W46A 3KDSE 1JZSA 5CVVA 3JYQA 1XELA 4PXYA 1J1UA 4B3MB 2QZZA 1FMTA 5FKJA 2GILA 1FFEA 1AF4A 1E3TA 2HFJA 2O3QA 3AEUA 3CR8A 3P96A 2XI4A 4Q4AA 4Z7QB 3BQMB 5DT9A 1KERA 4MW7A 3JD3A 3GU3A 2EYQA 2E7ZA 2G80A 4JEHA 5JH7B 4DG5A 1Z8HA 4EB6B 3V2HA 5B6IA 5A9SB 3DMNA 3O8DA 1B93A 5B58C 2GZSA 3GLUA 1QK5A 5EY5B 3IT1A 5K3AA 4F21A 3MINA 4OATA 3JYHA 4ZAGA 4JLWA 2DPGA 2VJMB 5FBZA 4FZJA 3H8SA 4YWJA 1E2EA 4RM3A 1BA3A 5JAIA 1E5TA 2AXQA 2BFOA 1FYWA 1VJ1A 1LXCA 2AFHE 3NJ8A 3IKMB 3RRMA 4W9NA 1ZFNA 2QX4A 3TLJA 5JAPA 1HPLA 1KFCB 1NR5A 1COWD 2REBA 1WMSA 3E9NA 4QTUB 1WTAA 3A9CA 1EAMA 3P32A 3R3UA 2HADA 5GY7A 4B4KA 1JI0A 2BSXA 3VI4B 2QTAA 3Q9SA 1P0IA 1R8JA 2Y2VA 5LKRA 2HF9A 5GONF 5D3KA 4UE6A 3DQQA 4JIGA 6Q21A 3ITKA 2B1QA 1L1EA 3FCOA 1ND6A 4HZUA 3K6SB 1J23A 4DA9A 4D56A 5B7NA 3LLCA 4L8VA 2CL7X 2OORA 4IZ6A 2CFCA 1GQRA 2JANA 3N76A 4MQEA 3VYWA 2B1JA 4KITB 4KKXB 3CW2A 2NVOA 2FR8A 3RUDA 2PM8A 3FCXA 3KOZA 5AHXA 1HNWB 1M1UA 4LZOA 4K9MA 3HHEA 3HQ4O 2OM2A 2DUWA 4L8FA 3TE6A 1IHOA 2XD4A 4RPKA 5ALDA 3WB9A 1PNRA 4CMEA 4EGFA 3BTOA 3WNBA 4C0QC 5B57C 4REQA 5EQJB 3M5CA 1FRZA 4KXFB 4TRNA 1ORDA 2ZLBA 2IS1A 2HT1A 3G6WA 4IOLA 3RARA 1HR0B 1Y8RB 5F2NA 1O8CA 4IXTA 1FTGA 2JGKA 2P9FA 2NVUB 1SJ9A 5FLEX 2JK0A 3OEED 1WP4A 5KTTA 1TKCA 4TWIA 4V0NA 1J21A 4TTAA 4BZWA 4MUBA 3UPUA 2B4KA 4LXXA 4N7BA 2XAAA 4QEDA 5A3SA 4URFA 2OHGA 1U2PA 5IM4F 1SXJC 4IVPA 4R9VA 4YGXB 4HKTA 1A9PA 1C3OB 2DB3A 2MSKA 2IX9A 4HFMA 4TPKA 1PAUA 1POXA 4LNAA 3VX3A 3WMXA 3DAFA 4FS8A 4GZ3A 1T9CA 4PC6A 1F8FA 1KZ6A 3IJ5A 2VBCA 5KKNB 4X94A 3GCXA 3K0FA 3HJFA 1MB9A 1QE0A 2EKQA 4Q4AB 1YQWA 2ZEJA 5JJ5A 1B73A 4A6EA 2XOKD 4YBZA 3E3LA 3RSLA 2ZETA 3GIWA 4MR7A 3W5SA 2O2DA 3QFSA 1EUYA 4EI2A 3V42A 3PP8A 2IGTA 2P0AA 2QX8A 3IXLA 3MINB 4OM8A 4R7GA 3H04A 4W1QA 3UCXA 2ZP1A 4DCNA 4URHA 2WMNB 3GO4A 5FL7D 3U7JA 2Y0EA 3MJSA 1QYVA 2H1FA 3TM4A 3R1IA 2OPHA 4CUJA 3WYBA 3BE8A 1DLIA 1RWVA 3MAJA 4W8HA 3QPDA 1ZNQO 3FI9A 5CNKA 1J7JA 4ZO4A 2I3AA 1NBAA 2G06A 3DO6A 2A67A 4FW9A 3FYHA 1M5UA 3RJZA 3DZ8A 2JFYA 3AHJA 3FRJA 4IAOA 4D74A 2GBCA 5CFZA 1CDDA 3CBQA 1KSFX 2CZQA 3ZTYA 1R50A 5EE0A 4WY8A 4N1AA 5ITVA 4TLLB 3G23A 5IAGA 5I6DA 3VZRA 2ZWMA 3JQRA 3EY9A 4QD3A 3SI7A 2EP5A 3T5AA 3H83A 3TJZA 1Z7EA 2NM0A 2GA8A 3TUJC 721PA 3CX7A 1HT1E 4BNXA 4P5DA 1U8FO 2BAGA 5DHSA 4M2LA 2KW5A 2CEAA 1E0KA 4G8JA 5C0OE 2KQUA 4UD2A 1HDIA 1QU2A 4K2AA 3TLZA 1VPLA 1SQFA 4Q1VA 1IK6A 4DDHA 4LY0A 1QHGA 2OV2A 2G70A 5AKZA 1RRCA 1HOTA 3ZV3A 4HSGA 3NP9A 3G7UA 3P9SA 2A59A 5JCZA 1Y3BE 4HNAA 3UWSA 3LOPA 2X0RA 3I2YX 4G9EA 4WWHA 5KJFA 2IHVA 3R0IA 4MULA 5D85A 3QYPA 4BKRA 1PX2A 1TADA 3TW0A 4URZR 1WD5A 5ALUA 3LGAA 3EGDB 5KYTA 4Y1RB 2H54A 5EL0A 4C43A 3ZTWA 1CHNA 2O2YA 2ZDQA 3KXIA 4O2AB 4P58A 3PEVA 3DA8A 1M0WA 1XA0A 3VJKA 4S24A 1O58A 4L4RA 2VAMA 4LVCA 1C4OA 3DW1X 1RI4A 2OFOA 2J0UB 2OMEA 2MSDB 3CUWA 3CWZA 3WWYA 4K1XA 2BR5A 4QT0A 4RY9A 5AR1A 4HCJA 3DHWC 4C0BA 6REQB 4X8HA 1A8IA 5A6SA 3BD6A 3MJFA 3QY9A 2OORC 3P2JA 3IR6A 1VC2A 3WI7A 3O9VA 5C35A 1RPZA 2CXOA 3ICEA 1T3ZA 2H18A 1W47A 1UBHS 1K7SN 5K6AC 3BZWA 1J22A 2ACVA 4DLVA 3TPZA 1XXLA 2P9EA 5M7EA 1DG9A 1QH0A 2X3FA 5BSGA 2OCGA 1CNMA 3RFFA 4MVJD 3O7MA 3OPYB 1KY5A 1EXMA 4ZVKA 2JFZA 4B43A 2XRZA 4GPD1 2FDCA 2ATIA 3W5VA 3BXOA 1PHRA 1EWKA 4LNUA 3BWDD 2Z57A 1GNRA 2WAAA 3BGVA 3BFJA 3N5CA 4DV0B 1PJTA 3GT7A 5K3BA 1XJWA 4LRXA 3DZGA 1K89A 2QLNA 3F3MA 1XE3A 4OUKX 3EUAA 1J5EB 4UHCA 3FNEA 1QGOA 1KH3A 2ZWVA 1PD0A 4R98A 2ZUTA 4B35A 1JAXA 4RPCA 4RTOA 3TKAA 3VDQA 3NGLA 1LK5A 5HZHA 2NG1A 4UUOA 3L4JA 1NIPA 1VPTA 3O93A 2VXBA 4XXHA 5H1YA 1PKXA 4J0FA 1KP9A 1Z4PX 3OLXA 1D2NA 3JALA 4F4HA 3IOEA 4O2AF 5FWXB 2YOHA 3UUGA 1RM5A 1B14A 2AC4A 4DN6A 5IXJA 5IEBA 1ONBA 2GNPA 3DBRB 4XVHA 1IZZA 3NONA 3NWJA 4LHVA 5J47A 5GV7A 5CEJA 4BGDA 3TMKA 1THGA 4AKHA 2A14A 2IUYA 3AWIA 5L3SB 4NSNA 2GVDC 2VPTA 3T52A 1ESZA 1E1KA 3ZVNA 3H8VA 2HLPA 2DFDA 3DFKA 1SPXA 2IT1A 1FDIA 2ZWIA 1ULUA 4FJ2A 4YO8A 5ALKA 4NDAA 1AKNA 3THOA 4GBJA 3W3AD 3M6UA 2ZWOA 2WIGA 3DBHB 3MHPA 3KIPA 3Q8WA 4OUDA 4R6WA 4DREA 5DNUA 1ES9A 1RLIA 2QRLA 2XQKA 4HAOA 1M66A 1OPRA 2Z4TA 4R5MA 3MYRA 3QPWA 2UKDA 3TZEA 2VJMA 1RACA 4LJ8A 2JI8A 4PRZA 1WPRA 1YFZA 3D5TA 2O20A 3ZJTA 1Q1GA 3A6GA 2X8WA 3BS4A 3IR7A 1OSNA 3VBEA 5KTOA 1V3QE 4L4ZA 5LA6A 3TRIA 4PIPA 3UTCA 5CAEA 2BD0A 1ZS9A 2ARKA 1U0NA 1J9EA 3KVVA 4NV1A 1VBMA 2CF6A 5C31A 3OPVA 4ND1A 1W93A 3Q5GA 4ZKEA 1JAHA 3OBIA 4CLEA 4O59O 4IHJB 3M1YA 4P6VF 2B61A 2EW1A 4Y0VA 1BFKA 3KV3O 1GD1O 3SC2A 8GPBA 2JKZA 1BS1A 1W5AA 1E3JA 3AILA 2HPHA 3OJWA 2ZJ5A 4FFSA 3PQ6A 4ZK2A 4JJGA 3KOXA 4IJMA 5BMVB 1N75A 5F3RA 4I55F 3I2HA 3T5BA 3OFKA 1CUBA 4MYHA 2ZANA 5E8JA 2Z1DA 3NWBA 2JVKA 3OUTA 2EV9A 1IJFA 2R4TA 2H11A 1NUTA 3I2KA 3KDAA 2NU9A 4ZZ1A 1F1JA 4MA0A 3MWDB 4RK5A 1F51E 1V4NA 4C89A 1UBFA 2EIHA 2ZKLA 1T6BY 3G2PA 1PL0A 3L8ZA 3MJHA 4A4DA 4EY8A 3D6NB 3TDNA 3C41J 3I8OA 5FBWB 3ZEIA 4XJTA 2FOLA 1CY4A 4NVRA 4HXYA 1WEKA 1R12A 3UAGA 2ES4A 2EWWA 1D1PA 1NQTA 1RYEA 2IHTA 2OBMA 2WU1A 4GLOA 4MPRA 4AMBA 2ADOA 1FC0A 2XR1A 2H1WA 3VJMA 1VYUA 3WYFA 2CYAA 1TUEA 1J07A 2VRNA 4FMCF 1G8HA 4FYIA 2PRZA 3LUBA 4C7BA 4YMUA 3T3HA 4BNLA 5KNCA 2UU9B 1AIPA 1LBEA 1TM4E 1VPEA 1R88A 221PA 3JXEA 2Q3HA 5CVCA 2OL4A 2YH2A 4MUKA 4W99A 4NNJA 4WZAA 2W6MA 3KM0A 1L5ZA 2HWWA 2QE7A 2X0KA 4KFUA 4DCGA 1C3LA 3U3JA 4KIGA 1KJZA 2GH1A 4W8GA 2EFCB 4I66A 2VDJA 3CHYA 3KS9A 3S68A 3ZOKA 3CSSA 2HW8A 3IPYA 2XWSA 3ZWYA 1C7JA 3PQ4A 4ALNA 1RABA 1HE4A 3IEMA 5I9LA 1E5QA 2ZWAA 1I9CA 1EFRA 3BDVA 3CLTC 5K5EA 3FNIA 4YY3B 1ESNA 1G64A 3EVZA 3A0RB 2QI9F 3A28A 1THMA 3BRWA 4P1ZA 1K4YA 3GOHA 2QD2A 4C78A 5GONA 1GWNA 4F93B 1Z12A 1KO4A 3TNDA 2AIRA 1Q6YA 3DNPA 3KOOA 3LI2A 3FLEA 3KEMA 2GM9A 4RC9A 3LHKA 2OBBA 2PIAA 4FD2A 4G4JA 1UDBA 3RLFA 2FFJA 1XKQA 2VRBA 1IIRA 3VOAA 5DEIA 3SJBA 1C50A 4IV8A 2N1MA 3A2NA 3MS2A 3OOSA 1C2YA 2CUKA 3QFTA 4Y2VA 1CF9A 5FBKA 1CZLA 1W4AA 4JQOA 2BCGY 1JT2A 4D9GA 1VJ5A 1A95A 4LHXA 4NBRA 5E2AA 4FHZA 2FSSA 2YXBA 4Q48A 4UCWA 4TUYB 2DUMA 2G4LA 3ZV6A 1EHYA 5DEOA 1P2GA 3D4LA 4XIIA 4H1VA 1UZNA 2REXB 2VBGA 3WIEA 1UT5A 4QYSA 1A71A 4UCQA 5K0JA 3SWWA 3DKIA 3EMVA 1NXSA 2L42A 3SP1A 4BFYA 4EJSB 1M1YE 4DM7A 3PLAE 2A5DA 1QH8A 1FYEA 5J5AA 2HXGA 4DLUA 4ZXFA 4CF5A 2D1FA 3RSQA 2ADFA 1OVMA 1TKBA 4R2XA 4OY3A 4PRKA 2OAEA 4KNVA 3MBKA 1G20B 3SSOA 1EVEA 5EIEA 3GRCA 3PNOA 3T3GA 3CJTA 1QHSA 2DHRA 3WO0A 3ZWKA 4BP3A 1YSCA 2Y76A 4TMYA 3BJEA 3DF9A 2VQEB 1ECCA 2XYQA 1ZH0A 4DT1A 1PVOA 4WK4B 4M8KA 3K6RA 5EUCA 2C5BA 4YJFA 1QAMA 4AMUA 3WJ7A 5KYKA 1GAJA 2VNAA 3F3KA 3FWKA 1S96A 4YQZA 1WDTA 1D04A 1TCCA 1TCVA 1TT5A 2IQ5A 2E21A 3SZMA 3P9RA 2FPRA 4A2QA 1YZYA 3OU7A 3DC2A 4Q1FA 1D2HA 1B23P 2GZ3A 3TZKA 3GUZA 5CFQA 1Y48E 3AUJB 1XRLA 2O5RA 1ISJA 1JKFA 3QEOA 4XR4A 4JJZA 2LBPA 5DXJA 5E2IA 4RZQA 1CJBA 1OXMA 5L4SA 5TRTA 1W0JD 3STYA 1JEEA 4AZWA 3HKDB 1IQRA 1IATA 1NG1A 3TW8B 3U39A 4D0SA 2P77A 2JLBA 3NPMA 2PBLA 4DCPA 5ER9A 2L18A 3MT7A 1BWQA 3AGQA 2HGSA 4TWRA 3IJEB 2ZS8A 3HP7A 3T7AA 3V7NA 4MVJE 1HLPA 3G5AA 5CT8A 4C2TA 3NHWA 5BWCA 1SD2A 5KREA 1Y7PA 3N5KA 4RAQA 3COZA 3R20A 5H9WA 2HH9A 1WZCA 2GA9A 1IWOA 3PNMA 3D5QA 2L19A 4KJXA 4LRUA 4MVJH 4NCXA 4AKGA 4XLZA 4ZK6A 1RLOA 3RUFA 3PDUA 4QEKA 1SUCA 3ZEAA 5EFOA 4BNDA 1D5WA 1IAQA 1GQYA 3JU3A 5LQUA 1JQEA 2IKSA 4YCCA 4D8YA 5K3OA 1A8UA 1DC6A 2YHIA 1W5BA 2YL2A 5JECA 2JLUA 4I1PA 2VH2A 3D2LA 4H0NA 3AF4A 5T4FA 4ER0A 4JKOA 2G5CA 4MYRA 4QUGA 5KHLB 4KRFA 2J3LA 2RGNC 2GLTA 1BN7A 1JHOA 4DIKA 1K5GA 1SR8A 1ORHA 3WLMA 1JHZA 2PS0A 2QZPA 4Q0MA 3TKYA 5KEIA 3SDZA 3ZN2A 3LT0A 1ZUD1 5CU7A 4PG8A 1WR8A 5FJIA 4R40A 4R1UA 3JWPA 5IVPA 2JJYA 3CWQA 1RWXA 1CB7A 4II7A 1GNSA 4LYYA 4PG5A 4G5GA 2B25A 3OMLA 1P3DA 4FD3A 1A72A 1M75A 4AJ4A 3TD9A 3QU4A 1VL2A 3THXA 3ZHOA 3PRKE 3NW9A 1W75A 4E4RA 1Z47A 2NAFA 3Q3HA 4NENB 4UEKA 3R7FA 3T7RA 3ABQB 1GVNB 4DCVA 5LMUB 3HGQA 1VFPA 4F72A 1DAIA 2R8ZA 3GJ4A 4ETMA 2C1ZA 1GFWA 3K6JA 5FB3A 5JZBA 3GLIA 4TQAA 4J0HA 3UXMA 1OASA 1Z7GA 3IUYA 4FXOA 4OQFA 4OP2A 4QM6A 1VHLA 5CK5A 2AEFA 3H5VA 521PA 4ZVUA 4D80A 4JIMA 2ECPA 2XKBA 2VDVE 1E7YA 3N2KB 3FHCB 4YRTA 4J0EA 1JXQA 3R23A 3LXMA 4PPGA 1EJBA 2H3EA 2JC3A 5KSPA 1CNEA 1FDUA 3LRTA 4NDZA 1ANKA 1HURA 4EHIA 3V34A 4YLYA 4I19A 4ZJYA 3RM3A 1XSEA 3P2EA 4KIWA 3VO2A 2JLSA 1TQ2A 2NU6B 1NZDA 1SVSA 3EYWA 4AF6A 1QK3A 3WJAA 3WR5A 3ZJVA 1M8GA 4XQCA 5A5VA 5IDQA 1GG9A 4F96A 2WTBA 3T8YA 1C9KA 1Z73A 3Q72A 2ZAOA 3MGKA 5JQGB 2WFMA 5K2OA 4FUTA 4FMBB 4GO1A 4BMOB 5JNLA 3EHEA 16PKA 2XNDA 1O87A 4JUDX 4MLPA 3VH4A 1SA0A 1N5JA 3ITNA 4TLBA 3TSAA 3UMSA 5AI5A 3CZMA 3C15C 5HKKA 1F7VA 3WK5A 3TR6A 3KQUA 3L93A 2OYSA 1L7VC 4TLEA 4WERA 1P9OA 1P33A 2IP2A 2OCXA 2XWJI 1GT6A 4KC0A 3G2HA 3A6JA 3IRUA 4DYHA 5KNBD 4LCJA 5EIBD 1G3RA 1WZUA 1KY3A 2RGEA 3PC6A 1FCJA 2A0UA 3B1VA 5JU6A 3SZRA 2AF3C 2PRKA 1CYEA 1DCMA 5JDIA 2PGJA 2ZJ2A 3DMTC 1FMFA 1C4WA 3IMGA 1DC5A 1VZ3A 3QYJA 1N2CB 1TCUA 2FGKA 3ANYB 5LKAA 1CUDA 5I7HA 3A9UA 4RTJA 1Y9AA 4HH3C 4HWGA 4O02B 1NWCA 3ZDRA 4D4HA 4CG0A 1Q7TA 3AJRA 4LDNA 4OQPA 8LDHA 2WIBA 4Z8XA 5C34B 3DMGA 4OJTA 5D1NA 4LI0A 3DAGA 1VE5A 3L8DA 1WHSB 1UKZA 2D8AA 2WWRA 4IEEA 4ZAZA 4FFMA 5KOHB 5CB4B 2EZUA 5KTPA 2D6FA 4JGGA 1UFOA 1U0LA 5JZOA 1I6LA 4L73A 3TMYA 1GZ4A 3WB0A 1DFHA 4FHGA 3CVWA 1S2NA 4FKZA 4GXRA 4X64B 5A62A 4RTSA 1ZW6A 2BMAA 3UT0A 5L51A 1QNLA 1BX0A 1A04A 1OROA 3FIJA 1SQGA 1Z3IX 1JSZA 4QUBA 5GV8A 3CZRA 1JQDA 5L9AA 4Z4FA 4US1R 3ND9A 1ZN9A 3OT1A 5DTQA 2VHUA 4Q4LA 4AN4A 4YP6A 1GCUA 3G7NA 3NTXA 4WL0A 1Z2OX 4ZT4A 2HF2A 3EPRA 3EXHB 3CN9A 3H1PA 4L0MA 2KI5A 3FTNA 4EHFA 4HX2A 3HMKA 1K6EA 3KOMA 1NPTO 2JHAA 2XB6A 4RXTA 2KBFA 4HDMB 1ORVA 5L3SA 3KZNA 2LDXA 1T1RA 3U61B 3VJLA 3ODPA 2QK4A 3Q10A 3HA3A 2FOXA 2XUIA 1Y34E 2XMZA 4IIEA 4B34A 4BNGA 1PNTA 3KB6A 2ZIGA 3EXIB 2VJYA 4E15A 3E9MA 3CH7A 5LVAA 3UJCA 2XWBF 1M2HA 3KZVA 1CDOA 1RBQA 4KQ1A 5L45A 1FTYA 4ZEXA 1FUEA 3D3KA 3GJ7A 1KO1A 4P33A 4CM3A 2OENG 2TECE 3K35A 4D9KA 2AJ8A 3IDAA 1C81A 5KYNA 1ISIA 2X23A 5HJ2A 3KJZA 3GELA 1MC4A 1R16A 3IOYA 1XTUA 3ELDA 2XCLA 2C9YA 2NTJA 2R7NA 2V59A 3ZGYA 4BU1A 3VZDA 1H1LA 1MU0A 2W2MA 2BEVB 4PZPA 5I9SA 4RY8A 1XC7A 3OE7D 3UBTA 2B94A 3QVKA 1W35A 3EXFB 1W0KA 5ALEA 2DFTA 2JFNA 3K09C 4HI0E 5F5NA 1U3VA 2KYRA 3OM9A 3QX8A 5FA8A 3RUIA 4N8EA 2YWFA 4TMZA 2O6LA 4G56A 4ENRA 5ERGB 1DJLA 3VV3A 2ZYDA 2YCBA 4NBSA 4PPFA 1SZPA 1P2DA 1EFVB 1JQAA 3I2GA 3FVVA 4KRYA 1Y42X 3URKA 3OQIA 2QB5A 2JFXA 3MM4A 3EJ6A 5A7HA 4LF6B 4PG7A 2M1XA 3PHBE 1ECBA 4U2DA 1M6HA 3SIRA 1X94A 2GEDA 4ERNA 3VR0A 3O94A 4L2IA 4NK5A 1PW7A 3SBEA 1ISGA 1E7SA 1B6SA 1KAHA 3PDJA 3KOWA 3HVIA 3JQQA 4GLBA 5KSYA 3JALB 1RXYA 2VF4X 4CLRA 5J43A 1LA2A 2JJ1D 3DOEA 4W82A 1DOZA 1XV5A 3TJRA 2EEZA 3U26A 1S4MA 3QWAA 5CB4A 3GLIE 3IQFA 4BCBA 1TW2A 4TQGA 3ZGNA 3II6X 2OV1A 3PC4A 3P2KA 2IIVA 2FU5C 4E7OA 5IFKA 5E4JA 3STWA 1TFUA 4LQ4A 4C2UA 1K27A 3WNZA 1BOOA 3B2QA 1NAHA 1QBGA 2I6QA 1PT9A 2VTBA 1GN9A 1UT8A 2RIPA 4OK6A 1CUGA 4XJXA 4ZDWA 1OGJA 3VR4A 3E5MA 3MT9A 3PQ8A 5JR3A 5BXQC 1P8JA 4AJOA 3IULA 5KVVA 4ZHQB 1JVSA 2YIJA 4LE0A 1T8WA 1YQUA 3V7WA 5EZ5A 1KI2A 3VNAA 1P29A 4P82A 1NM5A 2A0YA 3OZUA 3F5MA 1VHJA 4YV1A 1XI2A 1XVAA 1EWRA 3DWGA 4WNCA 2SCUB 3N70A 5KTRA 2BN4A 2C3UA 4LUCA 3CKLA 5CYGA 2C96A 5JNVA 2LCFA 3HDGA 3WLPA 1IOWA 1JQ3A 4KXVA 1OA0A 1Q14A 1FMJA 1PI3A 3AUSA 3AF0A 4UBNA 3DP9A 1AZWA 3NB0A 4YXWD 3U4QB 1SURA 1YUBA 3GARA 2ON6A 3JQ8B 3M34A 1BEEA 4BN4A 2BYTA 4F7DA 3CX8A 1DHTA 3JATB 2EW8A 5CDUA 1GTZA 1N2OA 1KEEB 2JZCA 3NHBA 1JNYA 2QQEA 4FKMA 4Z2AA 2R2AA 3ELWA 1Y1TA 1GZ6A 5KI6A 1FUIA 1NRJB 1H6DA 1Y4DE 3UM9A 1DO2A 4CMGA 2WD8A 1KJQA 2BKEA 4NBLA 3LD9A 2NZWA 3RVNA 2IDJA 4D45A 1VMEA 4F6CA 1K75A 1JJIA 4CIYA 1ZD5A 4LY3A 1NT4A 2O2HA 2PCLA 2XUHA 1J0BA 1E4EA 1SIBE 3AR6A 1FS5A 3HGTA 2XUKA 1BU8A 3PICA 2YXEA 3PXBA 1MH1A 4M8NE 3DDSA 4Z86A 1V8DA 3ZCXA 1ZK3A 4N5HX 2GD1O 5J4VA 3FJYA 1U3CA 3CF2A 3OZWA 4NOLA 5GGXA 3R7DA 1NV9A 2W2QA 1GTL1 1EHIA 2XVYA 2HRDA 3IBSA 4DKJA 4O3MA 2AQ8A 1ZK4A 4EHLA 3H5WA 3LVQE 4Q01A 1N0IA 4RE6A 1IVSA 1GPWB 4K2HA 2CZGA 3WNVA 1F5SA 3L18A 2WUGA 4D5EA 1E6LA 1SCIA 3G2LA 4YMTA 2QGZA 2EDCA 3GJYA 4QVKA 2BMEA 2MHCA 4LYFA 1L7BA 4B2IA 1ENPA 1V5GA 2GHQA 3NHMA 1BYIA 3ZWNA 1NX6A 4FFDA 4RZIA 4B4UA 1ISMA 5E0KB 1UQTA 4MWBA 1KRXA 3A3NA 4NU8X 3PX7A 4I7EA 1NKSA 3D7RA 4U0KA 2ZI6A 2A5JA 3BWYA 2IS6A 1I3MA 1ZUNA 2NSHA 2Q1WA 2QA5A 3IHTA 3VKWA 1DRUA 3DYVA 1TJYA 1N5RA 2H3HA 5E6UA 1PR4A 2CXSA 4JI1B 3ZVLA 4BX8A 1E2UA 3DVSX 2P8JA 3FHJA 1J25A 3QTLA 1T2NA 1UR5A 1Z7YA 5K0FA 1KP2A 4BKUA 5H59A 4S2EA 4Y1FA 4XWTA 3P71T 1UZLA 4G5OA 1LBSA 2HLHA 1KYXA 2I34A 4F5DA 2BUCA 4YCBA 3DOIA 3KQQA 3N7UA 1U8TA 2OLKA 3RABA 3W8RA 3A04A 3VO9A 5JQWA 3IMFA 4Q9JA 2QVBA 2H5IA 4I4TF 1ULZA 1W5SA 1WF3A 4FWBA 1KBZA 1AQJA 4GXTA 4X9XA 1NNI1 1CUYA 1YRQA 3NEPX 4ZVQA 1SOUA 2H2FA 2L69A 3DR3A 3DM9B 3K8YA 1EYZA 3N53A 1OYWA 4J49A 4LBWA 3RE1A 2K2WA 3DFIA 2DCMA 2ORIA 3GROA 1QF6A 2FNAA 1ETUA 1C3EA 1EKXA 1QFXA 1KMIY 4YUXA 1E9VA 1WXFA 1OWMA 4Z99A 3Q5EA 3HI4A 3V5NA 2PUWA 4BLVA 1STOA 1ESDA 1E66A 1DOHA 2JIQA 3O8RA 5DX0A 2QTFA 4PVCA 2ZI5A 2Q0HA 4DLZA 3CPSA 3GC6A 4QO8A 2I4RA 3SE7A 3QENA 4LMBA 1JJFA 1FSSA 4I4LA 2C9ZA 3N28A 3ZZTA 1XB2A 4D43A 4IQGA 4YV2A 3E53A 4FCVA 1R4MB 1L8OA 1NR1A 1RRGA 3F67A 4MUYA 2DEUA 4X20B 1QDUA 3EW7A 2CV1A 1PBNA 2GM5A 3ORRA 3OZIA 2OY0A 1Y9ZA 3EGCA 4TLAA 5TVKA 5KWSA 5DM1A 3FPJA 4PE5B 3CR7A 4MB6A 1SUSA 2QLFA 1V4BA 3NDRA 3NHPA 4RLFA 3VPCA 1D4ZA 1L8QA 2OXRA 2YYZA 3LBYA 3HDHA 3R7BA 3BREA 2XKAA 3K2BA 3L6DA 4M7RA 3Q3GE 4NU5A 4U39A 4TXMA 3H9JA 3UMJA 4HNTA 3EPJA 2UUCB 4B82A 2PFKA 1RKXA 1QTRA 2FFHA 2VZ0A 5TSDA 4N0QA 4A1OA 2NVBA 2Z58A 2J8ZA 5E9WA 3DV0A 1JDVA 1KOFA 1XZQA 2O7RA 2OFXA 3F4BA 5ITWA 4OHUA 2DBYA 2RH4A 3SY8A 1Y8QB 2OGZA 2AFIE 3BQNB 1XDUA 1K8XB 2HIMA 1JTEA 3QNWA 4LS3A 4OD0A 4F12A 3PUJA 1SUFA 1UIMA 2L17A 3F9RA 1GL7A 2A78A 3G3EA 2I4OA 4EUFA 3GP3A 1Y33E 5CIQA 3T0FA 3STVA 3A2LA 5REQA 2HTEA 1U8XX 3FOZA 5AKKA 1I2DA 2AJTA 1L7MA 2QSUA 2A9FA 3LC1O 1CS4C 5AW3A 4JWKA 3V4OA 2Q07A 2ABWA 4C7OB 3M4NA 5C7IO 1EUZA 2ZRGA 2Q0XA 4B7CA 2V7VA 3DFMA 1GLNA 1XA4A 3NBFA 2CBZA 4LNHA 3W6OA 2PX2A 1XTSA 4QHSA 4L6CA 3MILA 2C4MA 2OECA 4PLHA 3QXSA 4N5LA 1G55A 3KJEA 1RRVA 2ZRDA 3L7OA 4M1TA 4XQGA 4TZ6A 3MRSA 3ZXXA 3HWWA 4BLOA 2AD5A 1XDGA 1ZJYA 2VPXA 3QELA 3HU5A 4WSOA 4Q15A 4ATNA 3U3DA 5JE8A 3U6KA 1S2LA 3U17A 1K5HA 1TFRA 3PLRA 2X41A 4XVRA 4CNBA 3CCBA 3JS5A 1DL5A 3O4FA 4K6OA 4NOMA 4X6UA 4DV5B 1NDHA 1RCTE 1KKUA 2C5SA 3DD1A 1TJNA 3HFGA 4NRDA 1PWEA 3TIXB 1VPVA 3WMWA 4W5JA 2C3OA 1A5BB 1S1CA 3JQ7B 4IDNA 1SVOA 1A76A 8AT1A 1R4NB 3GMDA 5C1OA 4FEGA 4I2NA 3L4BC 1RWQA 4EMSA 2O2EA 3NVAA 4BECA 3AETB 3SLKA 1M0EA 2V58A 2IL1A 5F2OA 4RORA 5DN6A 3PRHA 3VSCA 4D5GA 1Y37A 3KZXA 1U3WA 2CFIA 3UOAB 3V9AA 1ZXXA 4PS1A 4EHDA 4ZCLA 5FUQA 2IY7A 4KE6A 5T4HA 5C1DA 4TV9F 5GJCA 4PLCA 4H2DA 3HFSA 4Q7JB 4FHFA 3EODA 4NJMB 3RBXA 3WOHA 2Q6IA 5TT1A 3NT4A 1F4VA 2R8OA 4CLXA 2GN9A 2VF8A 3G8YA 5JQGF 1WUHS 3DDUA 3LXRA 1SD5A 2BEWA 4OV6B 4QOIA 4F2DA 4HX9A 4JVOA 1YF3A 2X4IA 3AONB 3KFLA 2R86A 3EIWA 1B8PA 4R8SA 1DJQA 5A04A 4KX5A 4JVMA 3LYHA 4WZAB 2BH9A 4ZXPA 1UBMS 5DF1A 2DETA 2Y92A 4B73A 1QGUB 3B52X 1E79A 2A88A 2V0CA 3EZ9A 3NBYC 5FTLA 1BVHA 4DTCA 4RTLA 5GVSA 2DG2A 5IVDA 3I28A 3KR0A 1S3SA 5AKLA 2X0DA 1P72A 4WY2A 3S2SA 1W36C 2XTJA 1OQAA 4MVCA 3IP8A 4JLPA 2GESA 3JVIA 4IJVA 2OB2A 5IT5A 5LLDA 2FG6C 1UDRA 4UU0A 2ZIVB 4X66B 4PFSA 1EJ0A 5HJ5A 2OO5A 1T4GA 4C0SA 5BXYA 3CZCA 1UOQA 4W1SA 5CXXA 2DSNA 3CTMA 3L6UA 1MFZA 4GX5A 5KNDA 3PFKA 2HK7A 1Z5WA 3KVNA 3LP6A 2CLIB 2X1HA 2DT5A 1CQPA 2NQ2C 4S12A 1HFWA 4I0WB 3UUFA 4PYOA 4OEHA 4R81A 1GYQA 3QU7A 1H85A 3WYAA 2G67A 2Q27A 4OMCA 4JI2B 2R5NA 4QECA 4UDNA 2BGIA 2VSXA 3TIGA 5CM2Z 1V8ZA 4NY1A 2VRCD 3CYFA 4L4XA 4J7XA 4CQNA 2QOEA 2B4RO 5ER6A 1QQ6A 4BZPA 4IGEA 4R1NA 3O2QB 3G59A 4R05A 2E0IA 2PEZA 1TMKA 4KG7A 1XU9A 1UZMA 5KTMA 3FLBA 2P1ZA 3PG5A 1RPNA 4J0JA 2ZZKA 2PGDA 4Q3AA 5HF9A 1DIOB 1TW3A 3BERA 3K0KA 3ONDA 3PNSA 4IG9A 3RU9A 5KTKA 2UYOA 5BW4A 1T26A 2XMBA 3O1HB 4JH0A 3O1JC 2AVNA 2P2CA 1CQWA 4RD6A 4REOA 4TT8A 4H16A 1U9IC 4XR9A 5ENDA 2EQ5A 4PONA 1ZICA 2O1EA 3A3OA 3L1JA 3OX2A 5EPEA 5JC1A 1Y6JA 2A9OA 3UB4A 2HBZA 3E5RA 4B6PA 1U02A 1WOMA 5EMLA 4IY1A 4YP1A 1E3WB 3HWSA 1C9DB 4M89A 3AVTA 2FE4A 2NO0A 2EJCA 5LP6C 4CUKA 2DTDA 4NBWA 5EIFA 2WJHA 3GOQA 1UBJS 3OJLA 4Q6BA 4MYSA 3IE1A 4YDRA 3GGSA 1YOVB 1LF5A 2ZJFA 3QUBA 3R24A 4TUYF 4ALMA 3H99A 1KJ8A 1M2JA 4RXUA 4H60A 2IDZA 4JLMA 1RVDA 3NHJA 1IEVA 5AI6A 4J0QA 2JRCA 1NVGA 3OJ0A 4Z4HA 2BHNA 2FMHA 2IXEA 4P3NA 3SIPA 3R7WB 2NNWB 4WKPA 1JU4A 2FFRA 3HJUA 4Z3KA 4KR3A 5BN3A 3OLCX 2EGGA 3FOBA 4EPYA 1JIUA 5HSGA 1K8YB 3D0OA 5BMVA 3RFVA 5LBTA 3B51X 4Q37A 3MWEB 3UB3A 3JVEA 1P77A 1YA4A 4KVGA 3TTWA 2FW8A 1UQRA 2OZVA 3EA5A 3AUAA 3RJ5A 4MS1A 4B31A 4GPZA 1FYFA 3GY0A 2B99A 4BBZA 2OCBA 4BO5A 3K5HA 1H8ED 3L8HA 1E3WA 4Q6WA 2XGGA 1QOPB 1G21E 4UASA 1VL5A 2SBTA 3HYSA 1TU3A 3P4XA 3L77A 1WNTA 5BQ5A 5IU6A 4YRLA 4TXJA 5K0NA 3OTWA 1TLLA 4FT4A 1RJEA 1ULBA 4QOGA 5IJ0B 5FL7A 2Y4OA 1FVXA 2H6EA 2SNIE 1R0ZA 3T1TA 4YCNA 4RK4A 1SWVA 4GECA 5TDHA 2YJNA 4MHOA 5K0BA 3RYIA 1HE1C 1Y3FE 3H16A 4BMNA 2P4UA 4D96A 1NT2A 1ZDMA 4MO9A 3LS2A 1VOTA 4BJ3A 2IHYA 2ZIWB 3G2NA 1DUSA 3KU1A 4M6WA 2YHUA 1RXEA 3AESA 4WGFA 3PCRB 1UXIA 3UQYS 5BOVA 4C3VA 1XTZA 2FAXA 3FYCA 3EVEA 2RG7A 2QL6A 4LDQA 2WZCA 2YBDA 4OHPA 2A4MA 4X1IB 2WBLC 2NU7B 2X9QA 1RZUA 4RBNA 3ZV7A 2FSVA 2WT8A 1Z18A 5J59A 4DFDA 4JAVC 2O0MA 1B7GO 3CONA 4YLGA 3EDOA 2X8JB 2VC2B 2IY8A 4PSAA 4HLNA 4DLSA 1QHHA 3N59A 4I1YA 1XTVA 2PPVA 3VR5A 3OCWA 1TRHA 3NIWA 5BN1A 1O4VA 1NNLA 1N5KA 1ULHA 3EVGA 4DSTA 1FNDA 4CTMA 2ODEA 8ATCA 3U56A 5CDGA 1ELOA 3GZNB 4RH0A 2XF2A 2Q2VA 2FQWA 2VHXA 2WFLB 2XLBA 3S2GA 5I7UA 3SAJA 1V2GA 4A8JA 2C2WA