2EFHB

Ara7-gdp/atvps9a(d185n)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
152
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
total genus 51
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efhB00
1AZTA 5TXGA 3CWQA 3IGFA 2CLDX 3K0CC 4QXAA 4DDTA 2FPKA 1G16A 1MOZA 4FN5A 4A4DA 1GL7A 3CRW1 3CW2A 1G18A 3OAAD 1JR3D 4US1R 3TK1A 4BLOA 4UJ3A 4ZDJA 4LJ9A 2GK7A 5C46F 1W0JD 4EKDA 4B71A 2FPMA 1LFDB 1E9RA 1VPLA 4C0KA 1MO3A 3U7GA 5JEDA 4PXAA 2ZJ8A 1EESA 1S0UA 1HH4A 2QPTA 3EIEA 3GJ8A 1MRNA 1W4AA 4B35A 1SKQA 1EFTA 3D3QA 3W6NA 5JSZA 2KBFA 4Q1DA 1QDEA 2GHIA 2OE2A 1E1RD 2V9PA 4ACAA 1GWNA 1QVRA 1S3GA 2CLCX 4EPYA 4M1TA 4JVLA 2C77A 3ZZUA 4CT5A 1EFCA 3HR7A 4RFVA 4D2IA 4X8LA 1HV8A 3MJHA 5KU1A 4IDOA 2X1VA 1KI3A 4P32A 4WW0A 3Q72A 3QPUA 2ZQ5A 5FL7D 2W0SA 2WJJA 4G0NA 5AUQA 2JJ2D 4N1AA 2Q0HA 1EFRA 3PFIA 3R9XA 2UKDA 4Z1MD 1Z3IX 4PPFA 1XJCA 2YC2C 4Q4JA 4JLBA 2GJAA 3VMFA 3I61A 1P75A 2I4IA 2IYSA 2ZRFA 3LXXA 3BH0A 4C2TA 4XH9B 4K81B 4NH0A 1UJ2A 1IN4A 1ESNA 1VIYA 3LH5A 2PX0A 4HDOB 2V6JA 4QHSA 2ZUBA 1FNMA 1GKIA 1TMKA 1Z06A 2BEJA 2UVQA 5L3SB 4FMDF 1Z63A 1WA5A 2F43B 4PZLA 1TU4A 3SEAA 4E22A 2FWRA 1AN0A 2FFQA 3H2YA 4LHZA 2F55A 1V5WA 2PCLA 4BEBA 1AS2A 4MGYR 4Q1FA 5FBLB 2OFXA 4CEJB 3R9WA 1QVAA 4U02A 2VLIA 2P2LA 3I1FA 2CEAA 5EP2A 3I5YA 3K0SA 3RS4A 2FPLA 3KQNA 1IN5A 1G3MA 4B34A 1D9ZA 1IHUA 4MKGA 5HE8A 1W5SA 3CPEA 1I4TD 2IW3A 3CO5A 2CDNA 4OHVA 3QKSA 3WNBA 5J47A 3IBGA 1YZTA 1U0HC 2HJGA 3Q9LA 2F3RA 4Q66C 1P9WA 4LY6A 3ZVRA 1GRNA 3HWSA 1CJMA 5DYIA 2GBLA 2JLQA 3GJ4A 3HU3A 5EP4A 5KNBA 2QE7D 4B3DA 2CVFA 1G7RA 3GLGA 5JI3E 2R44A 2OXRA 4DHEA 1GSIA 3V00A 2NO9A 3CX8A 3PJRA 2G0NA 2XZPA 2YOFA 4YC7A 1CJKC 1E2MA 1AKEA 1H65A 2J0VA 3KUDA 2JJ1D 5CYOA 4Q1EA 4Z54A 4II7A 1ZP6A 2QSYA 4PANA 3L8YA 4M1KA 2NO7A 3LAWA 4C4PA 3A1WA 3KQLA 4A15A 1ELOA 1OB5A 3OESA 1W0KA 4URYR 1DAKA 1W49A 2RMKA 3ECCA 3NIBA 4ASUD 2EYQA 1Y3AA 1XPOA 1DG1G 2G6BA 4UNNA 3DVLA 1LTQA 2P3SA 1GAJA 2JJ2A 2QP4A 1ZUNB 2GEDA 4KYIB 3AB3A 3L8ZA 4LYAA 1U90A 4QBFA 2ZR0A 3WYAA 1N0VC 3NC1C 5DIFA 1VG8A 3SJAA 1W5TA 5HCIA 2GA8A 3MJRA 4JLJA 1CF4A 3P20A 1EFHA 2J5XA 2OAP1 3I92A 3CKLA 4DUGD 2OCBA 1XBTA 1IN8A 2FX3A 1X3SA 4ZCMA 5JJIA 3M4YA 1RKBA 4A6XA 3FB4A 4DDVA 1N2CE 4DLWA 2QAJA 4ZKDA 5EP3A 2FGKA 2VP2A 4AKIA 5B2ZA 2ZITA 2HEIA 2O8EA 4ZDWA 1OXXK 2OLKA 1MO5A 1VIAA 2CJWA 5LB2A 2W2TA 1CJTC 2VO1A 5AJWA 5UKDA 2AK2A 4UNPA 1DS6A 1S2MA 3IO5A 4V0LA 1PLKA 1M7HA 3WMGA 3BOSA 3L82B 1I2DA 5KDLA 1GKYA 2XSZA 1A5TA 3BRWD 2ZR7A 2CL6X 4RD6A 4PZZA 4QGHA 3LNCA 4BEJA 4E03A 4NPHA 4KYUA 3KFVA 4B47A 4MRVA 2TMKA 2D2FA 2GESA 2YJTD 2IXEA 1UDWA 3QE0A 5H68A 3AVVA 1IY0A 3SYNA 3CX6A 3FHCB 4RJLA 1KHTA 2IX3A 3Q8XB 4JT4A 4JVNA 4A2PA 4F4IA 1P72A 2VHJA 3LV8A 4FMCB 1NVUQ 2GRJA 1ZNZA 1P2TA 4LHYA 2QG6A 3WYGA 2FFBA 4A0HA 4L15A 3QF4B 4GOXA 1AGPA 2ZVQX 4BLRA 2Q21A 3O8BA 2CVHA 1T0HB 1SXJB 4GBMA 3K70C 3S1AA 4DDUA 3IUYA 2AK3A 2B7CA 3PENA 4P31A 3WP0A 3KXKA 3CRQA 1AQYA 3DHWC 4ITRC 4TMKA 3PUVA 2V8OA 421PA 4QL3A 3I62A 5C18A 3TR0A 4XWKA 3UATA 2YVUA 2LKDA 1KK3A 5IDVA 1LY1A 4KV9A 2CCGA 3MG9A 1UBEA 2N1BA 3DMDA 3GQBA 3Q85A 5LD2C 1XNJA 1GRQA 1MABB 4QJ3A 4P3YA 2DWPA 2YINC 1K5DA 3B78A 2FEOA 3B1YA 4MRRA 1CR2A 1FUKA 3OAAA 3ADBA 1DAEA 4Z8XA 5FFMA 2C2HA 2VSOA 5J5CA 3QUSA 1FTSA 2KSQA 4RCZA 2PCJA 1XD2A 5E7MA 3EA5A 1QHSA 2F7SA 1COWD 4RD0A 2A5YB 1HQYE 1VECA 2GXUA 3SFZA 1IOZA 2UZ3A 2ZUCA 1N5LA 2ZJ5A 1L2TA 1SVWA 3A4MA 1E1QA 2JLRA 2QT0A 2IEYA 4XTRA 4FWTA 3OE7D 3QJYA 3MAAC 2FFAA 4GI7A 1N5JA 3C7KA 821PA 4EJSC 2AXPA 4M9QA 5H1YA 4XOIA 3MWKA 1G7CA 2GBLC 3T5DA 2PLRA 3UKDA 3GLIE 1GFIA 3BGWA 1I4LD 3VKWA 4IOKA 3TVTA 3CM0A 4TL8A 3MGCA 1MV5A 3F0TA 3X1ZA 1JPJA 4TLBA 4B76A 1XZQA 1K5GA 4DVGA 5HZHA 1E4YA 2P67A 4IOMA 4RKEA 5C4MA 1HURA 5JS8A 2F43A 4JLAA 1KMQA 4XWOA 2VRWA 1G4UR 2AXNA 2J7PD 2RGXA 5K8LA 4URUR 2QUZA 4I1OA 4B3CA 3QXJA 4Q01A 4RD3A 3BFKA 3TUZC 5IK2A 3L2OB 3PEUA 3LFUA 5EE0A 3SJCA 4D4KA 5KPDA 1D8TA 2QPOA 4PHHA 1MO6A 2OV2A 4XVQA 5FUVA 4B3BA 2W83A 1NKTA 4QJ5A 4CEHA 1P3JA 2JIZA 4LV6A 1KJYA 2J45A 3CPHA 3NHBA 4KVGA 1YR7A 3ZS9A 4FIDA 4D25A 2HXSA 1II0A 3KKNA 3NH6A 3QEJA 4B33A 2ZSBA 3QPWA 5E4FA 4O0MA 4OHXA 2VH5R 4M4SA 4TMWA 3VR5A 1RYHA 1EXMA 4G5RA 1N6NA 1F2UB 2RGNA 4YDSA 5A0FA 3KTAB 4HAUA 4UQOA 1RC8A 1JXOA 2XGJA 4HYYA 4QGGA 4XD7D 2V54A 4QNRA 3IILA 2XXAA 3Q7PA 4NYJR 2HF8A 1ZRHA 1E0SA 3QOFA 4JYBA 8OHMA 3U7FB 1AK2A 5B30A 4WZAE 3GD7A 4HZIA 2O8BA 5FPYA 1XMIA 1Z47A 3TSZA 4F38A 3KKPA 4LBYA 1TF2A 2B8WA 2ODBA 1BS1A 3RAPR 1KSHA 4G01B 4KODA 4MQBA 4QM6A 1AS3A 2GAAA 3FKQA 2BBOA 4NHOA 4D81A 1B23P 4R2HA 2ZRNA 4AC9A 4PZYA 1G8GA 1R4AA 4LBZA 5SZIA 3AF0A 4Q4LA 3LW8A 5C1BA 4D4JA 4US2R 2EW1A 3SBDA 3W5IA 4DEYA 4GRAA 3UXMA 3KB1A 3R20A 4TMVA 1DAIA 1TUEA 3T15A 1E32A 4WA7A 2HLDA 1JR3A 1KI1A 5DO9A 2JCSA 4GPTA 2XTMA 1ZIOA 3VTKA 2NGRA 1JAHA 2QPAA 4Z51A 2J41A 4Q4JB 4DEXA 5LD2B 1OFIA 1XXHE 5FOUA 2A5GA 1D2MA 3UPUA 1ANKA 5IHPA 1E2JA 3KQUA 1OPXA 1N0UA 1EG7A 5F2EA 3PCRB 1UKYA 1DO2A 2ZI9A 3AVQA 1XRJA 3VX4A 4Q19A 1E6CA 1FMLA 1SVSA 2OT3B 1XD8A 2IF0A 3CPJB 4C0SA 3FE2A 1HUQA 4Q47A 3K53A 3FKSA 3BB3A 4B74A 2ZREA 3KB2A 3AQ4A 5CITA 3RS3A 2X19A 4LOAA 2J59A 2B21A 2LCFA 2GCPA 5EXPA 4JVMA 2FFHA 3OHMA 3HPRA 4PHTA 3HR8A 3KKMA 1E98A 1LS1A 4ZV4A 4L16A 5AJYA 1VCIA 1U9IC 2PJRA 3AUXA 1Q1BA 4DCNA 3OIUA 3Q7QA 4BFWA 3CUEF 4DCVA 4R7ZA 4E09A 1UEJA 1CR4A 1A2KC 1V43A 1ZD8A 2ZJBA 1KGDA 4RVCA 4CIDA 2GETA 3K70D 4WOPA 2ANCA 3GLFE 4AYXA 2PJZA 3RRMA 1W1WA 4TL9A 4TZ6A 4BECA 1X86B 4ZDIA 1X8KA 2V4ZA 5J40A 1JQJC 3O47A 4CRWB 3A1VA 4MKFA 3IQXA 3LRPA 4EPWA 3B8HA 4DBLC 2Q9BA 4V0KA 2BBWA 1HQCA 2ORIA 4ACBA 3QF7A 1E2FA 4KI0A 3N5CA 2IYTA 1W2GA 4PSAA 2WWYA 1XPRA 2I3BA 1SXJA 4XJXA 1JAIA 1OH6A 1VHTA 1EX7A 2BWJA 1XWIA 4M1YA 1S96A 3RS7A 4GZLA 4AYTA 3B9PA 4EJSA 1FX0B 3T35A 1E0AA 5CM9C 1J7KA 4NU0A 4P0TA 3R9IA 1Q1QA 4Q4HB 4BQSA 4QKQA 5K8TA 3ASZA 2GF0A 3NDBB 4Q7LA 3U6KA 2ZI3A 5LB4A 4BUJA 1Z6AA 5JJLA 1T8TA 1KTVA 1JI0A 3KJEA 2Z5FA 3RS0A 1BKDR 1FP7A 1NMZA 5EE9A 3BWDD 2RAPA 3FTQA 1Q1EA 2K5UA 1H8EA 2F1RA 4NYIR 3A4NA 1XD2B 2IYZA 3WBKA 2Q9CA 2AL7A 2Z0MA 2QAGB 3QKSB 4HLDA 4N0EA 4YMTA 1E94E 2QP3A 3SOPA 4PR0A 4DSUA 4QG7A 3D7MA 2GEVA 3AEZA 1Q21A 2BVNA 3DDCA 3RRYA 4F4CA 1ZM7A 2O8FA 4HUTA 2DR3A 2ZYTX 1BYUA 4TTQA 3JZAA 2GVZC 1HTWA 4K8OA 5BYJA 4DXAA 3MRSA 2ZJAA 4A0RA 2XITA 2HCBA 5EZ5A 5D3MA 3AH8A 1RRGA 1KSFX 1SVIA 3CF6R 5FUXA 2J0UB 4M1WA 4W9MC 2HLDD 5GJBA 4POAA 4IJMA 1RJ9A 4KFSA 3GJ6A 3SN6A 1R10A 221PA 1ZM4A 1W36B 1S4QA 4LBVA 3TAUA 3U3MA 4B32A 1E9DA 1IJFA 3LO5A 2CHQA 5DISB 1W36D 2REXB 3OEEA 3RYTC 3AUYA 3MWJA 5SZJA 5ANRB 3ICQB 4YONB 2P5TB 5DSZA 4AIIA 3FMIA 621PA 4FWIB 4OKSA 2J0QA 3CB4A 1CJVC 3DM9B 2G1KA 3SZRA 2OM2A 3TQCA 4OK5A 2QGNA 3R7WA 2NTYC 4I1SA 3CR8A 1ZM9A 1CTQA 2IYWA 3B82A 1NY5A 5KSOA 4CEHB 2BCGY 2BJVA 2JLVA 1XEWX 3A4LA 3DEFA 3LWNA 2GNOA 2ZSAA 4HUQB 3G0HA 3WBJA 1IONA 1XB2A 2BBTA 5BW8A 3LVQE 4HLCA 3QVUA 2QRNA 4C7OB 3IIMA 2QY9A 1SVOA 4DCUA 3W6PA 1CULC 2VHCA 2ZJ2A 3NEJA 1TQ2A 1HYQA 1L8QA 1II8B 2JIZD 2BBSA 4AG6A 3MUFA 1CP2A 3KX2A 2BOVA 4LJ8A 2XZOA 5LBIA 1G9XA 3K09A 3OIWA 1TEXA 3SFVA 2HYDA 3C14C 3QBTA 3MSXA 5B57C 2RGDA 5KDDA 2GCOB 4WXPA 1QHHB 3PG5A 4F93B 1FMJA 1QG4A 4NE2A 3ZS8A 4B75A 1NL3A 2CMKA 3U7EB 4EFLA 2HT1A 1BMFD 4LV8B 1VYTA 2NIPA 3TNFA 3BAFA 3QKRA 4IFBA 2PL3A 2ONJA 4A1FA 3GFOA 2HUPA 1GVNB 4DWJA 1C4OA 1XCMA 2CHGA 2RGEA 3A8TA 5P21A 1E2IA 4HB3A 1L7VC 4IDPA 1LNZA 1ZUIA 3RWMB 5L3RA 4OI2A 3OEHD 4GT1A 4LGMA 3ND9A 3GP8A 3OIVA 1OYWA 2OUKA 1DG3A 3IBYA 3AGPA 4A8JC 1G19A 1JR3E 3TAHA 1ZNYA 2WWIA 3EIHA 2GJ9A 4A8JA 1VG9B 1WQ1R 2ZSDA 1SULA 3H86A 4JYCA 1WMSA 1U81A 3GJ5A 2QNRA 4KFTA 1SZPA 1E2PA 1E1RA 1KDOA 4LJYA 3IQWA 4V0OA 3NH9A 1E0JA 1G17A 2XJ4A 1YRAA 3RRZA 1KI2A 4A9AA 1N0WA 4HAWA 5JJKA 2H5EA 4IRUB 1AA9A 3SBEA 2C04A 4TZ0A 2AX4A 2AFIE 3H4MA 4YQFA 3SQXA 4KBFA 1IN7A 2A7QA 2HF9A 2BC9A 1D5CA 5FTLA 1QF9A 4Q1CA 5JFGA 4FMBB 1R5NA 4TLDA 2X77A 1RPZA 2F9MA 4M9XA 4Z1MA 4M8NE 1SVLA 1N6HA 1YR6A 3T06B 5BYKA 5HR5A 1A2BA 4C0HA 3HP1A 4HI0E 2FEMA 3VR3A 2F1IA 4MRPA 1Z0KA 1Z2CA 3X1XA 2NZJA 4JLPA 2AD1A 3W5JA 2IYYA 2WJIA 1P2VA 4H1UA 5HZKA 4RKFA 1Z6XA 4U00A 1KDPA 3VR4A 5KYKA 4RCYA 4W5WA 2CNWD 1TF7A 2VQSA 1KI8A 3BK7A 1W48A 3G82C 3TRFA 5HE9A 5FPKA 2JLXA 2WWFA 2ZTSA 4JSTA 4TWZA 4JSYA 4JL8A 1WCV1 5TARA 5J4VA 1OFTA 5J4HA 2WJVA 4XTCS 3HJNA 4AKHA 3TW8B 3THWA 2O8CB 1AIPA 2KWIA 2QAGC 1QHGA 4JMPA 1QRAA 1OW3B 3N2EA 3QXXA 4TQAA 1OHHD 2MMGA 4YXWA 1OIVA 4F4JA 2C03A 3CZPA 4ZPXA 2FSGA 1P4SA 2WOOA 3KJGA 1ETUA 1UAAA 4JLOA 2A5FA 1P60A 2PT5A 3REGA 4QM7A 4GDFA 4J0QA 2IBMA 3EAQA 4Z8YA 3UIEA 4FD2A 2CXXA 3EPLA 1LS6A 2WWWA 2ZETA 1XPUA 5IF9A 1TPZA 3EPJA 1NBMD 3DKPA 1WP9A 1GNPA 4QHYA 5AR1A 1KAGA 4URZR 4MRNA 2G77B 5FBQB 2AKYA 2Z4SA 2AWOA 1G7SA 4WBSA 2GXSA 1XF9A 4GP6A 2C5LA 2ZJOA 2GXQA 3D6TB 4ZIRB 4OI4A 4MUAA 5JWRA 4MYHA 2V3CC 4QOSA 4HAYA 5D3QA 4LC1A 2ZR9A 2OCYC 1NVVQ 1E0KA 2VYFA 2ZUDA 4B44A 4DRZA 3NG1A 4DT1A 3SDZA 1CJUC 4HLQB 4FCTA 1NP6A 3SYLA 2DFTA 1U0JA 3B6EA 1YHNA 2KE5A 1EFRD 4CEIB 3BORA 4QHTA 3NC0C 5EE3A 2GCNA 3BD9A 2VHUA 3P27A 5DYGA 3QBVA 3U6BA 3ADCA 1IAQA 1YZQA 2RCNA 5G3YA 4UJ5A 4DIDA 4IW3B 5JHGB 2JLZA 4TMXA 3RC8A 4MRSA 2O8EB 4H9GA 1J2JA 2WICA 4MDFA 3VQTA 4C0JA 1Z0IA 3TKLA 3GJXC 2FU5C 2KJQA 4BASA 3VNVA 2WWXA 2G83A 4FI3C 1A7JA 1D2EA 1TF5A 3ZH9B 1W47A 4RY2A 3WNDA 1IXRC 4B6FA 4BE7B 4Q9HA 5FR1A 2XX3A 3P26A 1T8UA 2GCOA 2XXAB 4C30A 1NIJA 3OFNA 3OIYA 4MUBA 2E1RA 3AVWA 4IEEA 4JBWA 1QHXA 4R9UC 1YZNA 4JBXA 2CCJA 2AHOA 1NY6A 3OF5A 2XB2A 1KI6A 2R8RA 3AP2A 2X8AA 3D31A 3NVAA 4LZZA 2GVDC 2ZRKA 3FPAA 3HDTA 4IKEA 5GADl 2I1VB 1GL9B 4KFRA 4EPXA 2BEKA 2ECKA 3KKOA 3MD0A 4GSYA 2RGAA 1EGAA 3UG6A 2FZLA 4E07A 5JECA 3U7HB 4OHYA 2O0KA 2OCPA 2ZJZA 3R7WB 4DC9A 2HCJB 2SHKA 2R6GA 1Z0FA 3UMSA 4C2UA 3NKVA 3THYA 1S9DA 1BIFA 5CLLA 1NLZA 1E2EA 3GFTA 3PR1A 1GIAA 5CK5A 5JS7A 3I4LA 4OBEA 3EZ6A 4C7OA 3VR2A 5JHHB 2GAOA 4NDZA 2ZAMA 2WKQA 1VCNA 2KB0A 5FUWA 1NG9A 4ILEA 1GM5A 1CLUA 1KKLA 1KK1A 1CKEA 5DI9A 4OK6A 4L5BA 1OIXA 1GNRA 4JLDA 5TV2A 4JL6A 3RANA 2ATVA 4OI0A 4MYCA 4GMDA 1Q0UA 3B60A 3B2EA 2ASEA 5AUPB 5F3WB 3ZYCA 3DOEA 3F3YA 1UPTA 1MT0A 4AYWA 2IA5A 1PUIA 4R71A 1EWQA 2JATA 1T3HA 2BMEA 1GILA 3GEIA 5CB6A 1IY2A 3JVVA 5FBWB 1Z0DA 4UNRA 5K8IA 1WDTA 3CX7A 4IFEA 4LJ6A 4YDHB 4Q1BA 5AK0A 4D0NA 2C8VA 2ZPTX 2A2ZA 5E7IA 4S2EA 3ZZ0A 2FSFA 1T0JB 2F6RA 2O0JA 1GKUB 3B5JA 4MH0R 4ZI3A 2Z4RA 3SYKA 1Z22A 3DO6A 3X1YA 3ADKA 4EQ6B 4Q4AA 5FL7A 2JDID 1G20E 2Q3MA 1MO4A 1N6KA 1K6MA 2ZI6A 1E99A 2HJVA 1CU1A 1ZU4A 1T91A 1Q12A 2BMDA 4V0MA 5CB8A 1OYYA 2DHRA 4FW9A 1R0ZA 4DB4A 4AKGA 4IVQA 1G291 2QQEA 1ZNXA 2H92A 1CXZA 4ASUA 1G6HA 2MSDB 3ADDA 4Q4HA 1VG0B 2XOKA 1DEKA 3IPYA 4PQYA 4WZ6A 2QN6A 2QT1A 2ZS7A 3SHWA 5LPNA 2XZLA 2OO7A 3HU2A 4X8HA 4TMTA 5EE5B 4AKEA 3G5UA 5L3QA 2YWFA 3MLEA 5DE3A 2BKEA 2JLUA 1ESMA 1KZ7B 3MWYW 4RD4A 4YMSA 4CT4B 5TMPA 1XEWY 3GEHA 3K1JA 1CEEA 3AF2A 1IY1A 2D7DA 1G8PA 2IUTA 1A1VA 1JALA 1UDXA 3NWJA 4O3MA 4LCBA 5CDFA 521PA 2A5DA 2YWEA 1YZUA 2PZGA 2NO6A 4NYJQ 2OBLA 2QTVB 3ETLA 2C9YA 3K9HA 1XU4A 5JMTA 1JB1A 3Q3JB 1DAMA 4HUQA 1SHZA 4Q7KA 3TSWA 4JZKA 4X8MA 5BN5A 2BCJQ 4KLNA 2XJ9A 3TSOA 1DAHA 3KXIA 1G8FA 4DSTA 2QAGA 3LVRE 3T1QA 4HZUA 2ZM5A 4UXHA 5EUQB 4US0R 2IUUA 4TYNA 3ZLJA 5DLQC 2ZS8A 4OL0A 1XTIA 1OB2A 1X8LA 2WM9B 5AUOB 1W4RA 2CCKA 5EXTA 2BIFA 1E9SA 5FI1B 3KFXA 3RDPA 3CBQA 1OLOA 1KAOA 4TN1A 3RWOA 1O87A 5G53C 3KJIA 1W46A 4JT2A 1FL9A 2AWNA 2YC4C 3REFA 2OG2A 4R2IA 1UKVY 2F1HA 4DLUA 2J0UA 1M74A 3VR1A 4CGZA 2Z83A 1FOEB 5L3VA 3TUIC 1KO4A 1ZBDA 2BV3A 3P32A 4JLMA 4M22A 2FF7A 3QKRB 1D2NA 4TYPA 2HDNB 3SC3A 1JBKA 3ZDQA 4D82A 3E70C 5LDDC 3O8CA 3THXA 3KZ1E 4LJ4A 4JKYA 3ZQ6A 2R9VA 2NOAA 4DLXA 1T5LA 4CF7A 2OEPA 2WOJA 5JEEA 4KSCA 2YNMA 3IO3A 3EZ9A 5FTMA 1CBUA 4PSKA 2QZ4A 2P6NA 4KVAA 2VTKA 1N3BA 3VHXA 2WHXA 3GLFB 4DSNA 4M2LA 4MDEA 1L4UA 4RSGA 2PLFA 2RHDA 3K9NA 3CONA 4BZPA 2VIIA 3AV0B 4DLSA 1XTRA 1XXHB 1J90A 2IYVA 1WF3A 1OKKD 1W7AA 2D4HA 4NONA 4KHZA 1YRBA 2OESA 2QORA 2FMXA 6Q21A 3QENA 4LDJA 1HE8B 2H18A 5B64A 4L9WA 1XDBA 2X2FA 1M6NA 1SVKA 3X1WA 2O52A 3CR7A 5HPYB 2BKUA 4I4LA 4H1VA 5GJCA 1UBFA 4NCJA 2WBLC 2BM0A 1XCGB 4FXPA 2A30A 4Q21A 1F60A 3FWYA 3GPLA 3PITA 3K9GA 1B0UA 3AGQA 2YWGA 1AGRA 1Z29A 4ON9A 4FMDB 3RC3A 5GVSA 2GZHA 3SR0A 3BB4A 2H16A 1NG1A 3AVYA 1XCPA 5ELXA 4PC2A 2W00A 2N42A 2DFNA 3AM1A 4CYMA 2ZRDA 5AJXA 4HATA 5F98A 1R0WA 1TNDA 3V9PA 1P62B 1LB1B 1DAGA 4EIWA 1Q3HA 1LF5A 2ZE7A 3EARA 2PT7A 2J7KA 4OJKA 3SJZA 3CRMA 3UG7A 1DAFA 3THWB 4TYWA 3BXZA 3JZMA 5JBQA 2O8CA 1KO8A 2ZU6A 2H1LA 1MR3F 1E9FA 5EXSA 5FUYA 1ZM3A 2ZIAA 1U2RA 4D26A 3A37A 3QXSA 5CK4A 2IYXA 4EJSB 2O8DB 2QGZA 2H17A 4QGAA 3PIRA 4QBHA 1IM2A 1DBSA 4HLUC 2BDTA 4LYJA 3RVBA 2RKOA 3H84A 1HT1E 1JECA 2CK3D 3TH5A 3T1VA 2P6UA 4B43A 1A4RA 1VYUA 4TLAA 4YMVA 1TAGA 2VP5A 4XWAA 1P9NA 1EK0A 2R6AA 4PC7A 2MSCB 2GEUA 3VNUA 5FTJA 3TMKA 4ABYA 3E2IA 3QIAA 5SZKB 5DI3A 2W58A 3M0EA 4BGDA 3D8BA 1U8ZA 5JCZA 4Y0AA 4NL4H 721PA 1H8HA 2W6ID 1ZD9A 5KOYA 4CEIA 2PZEA 2VF8A 5EJEA 5JRJA 1P9RA 1TUIA 2XEXA 2PEYA 3GLGB 3ZVLA 1HT2E 3KL4A 4G5QA 1KSGA 3EA0A 3PV0A 1XZPA 2H7VA 4BLPA 4IXNA 1OT3A 1N6OA 2FSHA 4P4SA 1G5RA 5FOSA 1Q57A 4LC0A 2QU8A 3C5CA 4EQ6A 2BMJA 1OFHA 1ZC3A 1FTNA 1KY3A 2WJHA 2B8TA 2VP9A 2WWGA 1OFUX 2ZE6A 1U98A 2F9LA 5DH9A 4ERNA 4V0ME 3K0EA 2PX3A 4G3XA 1E2DA 5JZVA 1N6LA 1TEVA 3ZZTA 1JPNA 3CF0A 2CJWB 5DGXA 1ZM2A 1SGWA 4LI0A 5HKKD 3JVUA 4MA4A 4YMUA 4RZUA 4PHGA 3SS8A 1SVMA 3LBIA 4M9ZA 3DL0A 4DKXA 4A36A 1PVOA 1NSTA 2FDCA 2IYUA 1RVDA 1UKZA 2ZYVX 2XSZD 2ZRHA 2J3EA 3QXHA 2QA5A 3OEED 3QI2A 2V1UA 1Z0JA 2ZRBA 1X1SA 4GFDA 4D80A 3V4RA 2AKAB 3DMNA 2PH1A 2VBCA 1FFHA 3QKTA 4OJQA 5DNYB 1YQTA 2PEZA 1ZU5A 1YR9A 2JJ8A 3CH4B 4JJKA 5CDFE 1PUJA 2GKSA 4GL2A 4BFVA 1F2TA 3GJ3A 4BZQA 3FHOA 4LHXA 1KI7A 4DZZA 1M2OB 1OHHA 4ARZB 4UXIA 3EPHA 2JLSA 1DOAA 2P5SA 4QBIA 5FPTA 1OH5A 1E2QA 3EASA 2QI9C 1KSJA 1WBBA 3TIFA 1VG1A 1KIMA 3K9LA 4DLRA 2QL6A 1X6VA 2OBMA 1QHHA 4R98A 1NIPA 2JGNA 2WWHA 4KJZA 3VU9B 1G6OA 1P61B 2ZI4A 2ZRGA 1UBGA 5DN6D 3ZVMA 1S1CA 1KJWA 1NLYA 5AJZA 4BRWA 2IS2A 1GDDA 2FH5B 4QC2A 4BRUA 4ZI2A 1ZJ6A 3UMRA 3AKEA 2BJWA 1RRFA 4NCKA 3SI7A 4B2PA 3QG1A 4M1OA 4WXRA 2WSMA 4EFMA 1KMHA 2ZRAA 1E2GA 4KXFB 4LK2A 1SKYB 3FFAA 2IHBA 1CRPA 5GJVC 4F92B 2VEDA 3QQ5A 4DCSA 1JJ7A 4KBGA 1HEIA 2GJKA 3AF1A 4QRHA 3X1DA 1XTQA 2QTFA 1E2NA 1KI6B 3TR5A 1E69A 3DM5A 2DYKA 2WMOB 4JL5A 3OEHA 4LJ7A 3T5GA 2IWRA 2WJGA 1FZQA 3B1ZA 3V4FA 2NO0A 2XOKD 4ZDKA 3K0FB 1M8PA 4BFXA 5C4GB 1SXJD 1GOTA 3THOA 2GF9A 1D6JA 3UANA 1NKSA 2ZRJA 4M1SA 4TTRA 4QJ4A 4DIEA 2IS1A 2W0MA 5FBVB 1ZC4A 1AJEA 1ZMXA 3PUYA 4PAQA 1EWRA 2BHRA 5CIWA 3GLIA 4LX0A 5DHFA 4K46A 2BMFA 1VMAA 5FL3A 5TDHA 3KJHA 1U8YA 4G5SA 1AQUA 3CNOA 3TE6A 2V1XA 1KYIA 1M7GA 2FNAA 4D0LB 4F91B 1XMSA 3NBYC 3ZJYA 1JXMA 1ODFA 4XVUA 5KNDA 1FUUA 1T6NA 4B48A 3BERA 3I8SA 3EWAA 5DI3B 4OK3A 2DBYA 1W2HA 3H0KA 2YHSA 4PPNA 4URXR 1VHLA 4ZCLA 3CRRA 2OBNA 1R6BX 3U4QB 4B3XA 2VPPA 1NBME 4CDGA 2C95A 3KXLA 3QSYA 4DDWA 3M1IA 3MCAA 2C78A 1KK2A 3AKDA 4KAXA 1JJVA 2R62A 1SQ5A 4HAXA 5J4KA 1DARA 4EDHA 2VSXA 1OH7A 4AY2A 5E95A 2OSBA 3TUJC 3LXRA 2V6IA 2ZYWX 4URWR 4DLVA 4LUCA 1G5TA 3OFND 4RD1A 1N5IA 3K0AA 4I99A 4TLEA 3AKCA 1E9EA 4L4UA 3KQHA 2NZ8A 5AJVB 3EX7C 1NVVR 1NN0A 3FKSD 3P4XA 4B3FX 2CLSA 2PBRA 4HB2A 5D3MB 3ZQJA 5HTKA 2J1LA 1XJQA 2EVWX 3I8XA 4OQMA 4Q5IA 3BS4A 4ZIRA 1JEDA 2KI5A 4OQNA 2IT1A 1PLLA 5FTNA 4IDNA 3I32A 3UMFA 3BFVA 1Q3TA 1AZSC 2DPXA 3PEWA 3E5HA 1GUAA 4M0LA 1NVWQ 2EWVA 5DHAA 4PC1A 5L3QB 3L0SA 4HB4A 1US8A 4PAOA 3THXB 5HCNA 3IIJA 3NBXX 4EAQA 4Q48A 3WMFA 2YV5A 4PQRA 3LX5A 4Q9KA 3AF4A 1W0KD 2F1JA 2VP0A 3F5FA 4XSGA 2WSSD 3TJZA 2GJSA 1RE0A 4GNKA 2V55B 3WP1B 2OFWA 3LA6A 3FDIA 1G41A 4N3NA 4PTLA 1PV4A 3EZ2A 4ARZA 3VKHA 1YZLA 1G8YA 2EYUA 3AP1A 1D9XA 1OE0A 1VYVA 4LPSA 3U2QA 3A36A 2RGGA 2A5JA 1QZXA 1E9AA 2E9SA 1ZVQA 3IEVA 1II8A 2PMDA 4A92A 1I2MA 4TQ9A 2P6RA 1U9IA 2ODNA 1TX4B 2IC5A 4PC3A 4HZUB 2NPIA 2QMHA 2FOLA 1HE1C 4D0GA 4NBSA 2OCAA 1WB9A 1Z6GA 3A6PC 1L4YA 2B6HA 5AUNB 2XAUA 1YE8A 4C0QC 1TQ4A 1TQDA 4UXJA 2YYZA 5EE1A 2ZRPA 4TSFD 4LV5B 2AR7A 4B73A 4CZ2A 5KTYA 3K09C 1E4VA 1COWA 3GMTA 4ESVA 2IHYA 4M9SA 5FTKA 1P7CA 1FNNA 1G3UA 4KLZA 2H8KA 4LRWA 3GJ7A 3VR6A 1RFLA 5IT5A 3AVXA 4MKHA 2ODWA 2WIBA 2YWHA 3PUWA 4MYUA 1T5IA 2G9NA 1P2UA 3RLFA 1XXHA 4MITA 4PO8A 3RHFA 5C2JB 3UWKA 3E1SA 4RFSB 3KKQA 4HDCA 2GILA 3BH6A 3QNUA 1G7TA 5E7JA 4DUGA 5E3HA 3HPQA 3WY9A 2R6DA 4DB2A 1KK0A 4FINA 3WHLA 3QG5A 1WBDA 3H1TA 2RGBA 2DY1A 2ZANA 1KDRA 3T34A 2RGCA 1KKMA 2W2XA 1Z2AA 3FOZA 2IS6A 5KPJA 4DLZA 4IDHA 4LBWA 2ERXA 3U3OA 1VDZA 1DADA 3QY0A 1S3SA 4AK9A 2ODEA 3Q5DA 2I1QA 1F48A 4DSOA 2WKRA 3X2SA 1Q1ZA 3C41J 1S1MA 2NPFA 5IRCD 3C16C 1KO5A 2D06A 3PUXA 4B3GA 2ZU0C 2GDJA 3L0PA 5SZHB 1J8YF 4O2RA 5FPSA 2A78A 4PX9A 1PLJA 4KU4A 1LW7A 1WRBA 2X2EA 4RZXA 3KQKA 2ZXUA 4HAZA 4NYMQ 3EXAA 2FE4A 3LDAA 3LQQA 1OSNA 1W44A 2IYRA 3BIFA 4XSHA 1RW4A 1P6XA 3LD9A 1DTSA 4Q1AA 1P73A 4G5GA 2DFLA 2IUSA 3DKVA 4LWZA 4KSBA 4C9BA 2ZE8A 4FCVA 5CIQA 1U0LA 5G40A 4U5XA 2QM8A 1LVGA 3I73A 2EFGA 3AVOA 3EW9A 3SU8A 2B7BA 2Y8EA 3HYRA 1Z6YA 1NVXQ 1E96A 2GZAA 3CNLA 4Q9LA 3GEEA 3W6OA 3I5XA 4P4SB 2GXAA 4LYFA 2O8DA 2JEOA 3ICEA 1XX6A 1FQJA 3LY5A 5FBRB 1ZUHA 2VL7A 5H8WA 4XIGS 1OH8A 3GFPA 3W34A 1SXJE 2W6JA 1KNQA 1X1RA 2IYLD 3U3JA 2FN4A 3LLUA 4XVRA 1R7RA 2J46A 4QBGB 3O8RA 2DCUA 121PA 5BXQC 2ANBA 4PC6A 4Q7JB 2J87A 1M34E 4TSFA 2IWHA 1VKJA 2Q6TA 1KDTA 1G3RA 2WPDD 2A3RA 1Z8FA 3VX3A 1R8QA 4Q02A 4NCHA 3FVQA 1YJ5A 1NJGA 2ATXA 3CF2A 3PQCA 3WMEA 4M53A 3SNHA 4YMWA 2LKCA 1KZGB 4N0DA 4P33A 3FHTA 2JLYA 4WZBE 1JR6A 1XTSA 3B1VA 1KNXA 2ZI5A 4LYHA 3U3KA 3SJBA 4AURA 3VKGA 2QMEA 3TVDA 4S35A 5FH9A 3LQRA 3ZD6A 5CJPA 4P4TA 5TVKA 2WPDA 4LHVA 2C9OA 1YVDA 1YU9A 1II9A 2O8FB 1BH2A 1HA3A 2CHVA 2REOA 3DPUA 2DFKB 3IEUA 4KCGA 1OKKA 4PSVA 4BFSA 2NQ2C 1JEEA 4IVPA 1ZCAA 4IOLA 4I1VA 1Z07A 1Q44A 3DZ8A 5A5GA 5JRZA 2FV8A 4D6PA 2DB3A 3GLHA 4GP7A 3EPKA 1XMVA 4Q9JA 3VFDA 3L43A 2Q9AA 1LV7A 2IXGA 1SHKA 2R65A 5BN4A 1NMXA 4ZCIA 3K0AB 1YR8A 1NRJB 3U44B 3FFBA 2CK3A 2D62A 4I81A 2E87A 1E2HA 4MGKR 1NSFA 5CYPA 4AWXA 2CL7X 2EFEB 2ZRMA 4LJ5A 3ONWA 2P0EA 4TYYA 3WYFA 5GJWC 1W4BA 4EPTA 4BWYA 3U61B 1NJFA 2L0XA 4BFTA 4MYTA 4HLUA 4RZ2A 1IN6A 1KMHB 3A1SA 3TGPA 3WHKA 3U60B 4JLKA 5H70A 5IK2D 1T3LA 2IEZA 2VHTA 4Q03A 3FMOB 3U3RA 1RRCA 1WXQA 2XTNA 1LF0A 3AVTA 2Q3FA 2OHFA 3I3SR 1XEXB 2C99A 5FPHA 2MSEB 4W5HA 1QHYA 2QTHA 2HYIC 3N70A 5F9FA 3OZXA 1Z28A 3W90A 2RH5A 2J0SA 4JLNA 3ZD7A 2QROA 1U94A 2OFOA 4AI6A 3IHWA 3CZQA 3P1JA 5L3SA 2QBYB 4HAVA 4QFMA 2O0HA 5J4LA 5CLQA 1C1YA 2ERYA 1OXVA 2HXYA 2OZEA 1CIPA 4UKDA 2ZRIA 1F2TB 5EQTA 2WZQA 3T12A 4PO9A 4JBYA 3GLIB 2ZAOA 2C9CA 4KITB 3CIOA 1GRRA 3TW4A 3OE7A 2CBZA 2WAYA 3KDSE 3NHAA 5JWHA 3RABA 1VCOA 1U8AA 2EFHB 3T61A 1M7BA 1DE0A 3W3ZB 5JSZB 1NN3A 1NN1A 1Q20A 1NLFA 1QBKC 1Z6TA 4L9SA 2RGNC 2YZ2A 4F7WA 2DWQA 5KSPA 1NMYA 4IVRA 1ZAKA 3VU9A 1Q22A 5KSYA 5KSZA 1MABA 3IIKA 2ZI7A 4MKIA 4CEJA 1Y63A 1OXUA 3SE0A 1P5ZB 1IXZA 5FI0B 3DZDA 4M21A 3W8NA 4GOJA 2IF2A 2RB4A 1U99A 3F8TA 4NKRA 2NG1A 4UNQA 5BWMA 2Q3HA 3FGNA 1GNQA 2ZROA 4HSEA 1UFQA 4OHZA 3M6AA 3GJ0A 4OHWA 5B58C 4TQUS 4A8JB 2ZS9A 4PPGA 1QHNA 4A2QA 2FJUA 4LPKA 1MKYA 3B13B 3T1OA 4EPVA 4JJZA 1VTKA 3RSOA 2J9RA 4TL6A 1UF9A 5TB5A 4A0FA 2RHMA 4M1MA 1W4CA 3B1XA 3QEOA 3LBNA 2WIAA 4W7SA 1XEFA 1N5KA 3A1UA 1T3SA 2GJ8A 4Q9IA 1G5PA 3PXGA 1GL6A 2FG5A 1E2KA 3CRVA 5A4JA 2VP4A 1O3YA 4YXWD 1MH1A 3C5HA 1KI9A 1ZD1A 2OAQ1 4Q00A 2G3YA 1KI4A 3CNNA 3B85A 4NTZA 3U4QA 2IS4A 4D4LA 1IBRA 4MGIR 1BOFA 4EUNA 2ZJYA 2V7QA 5KDOA 4OQLA 1G21E 2DWOA 1ZW6A 2VA8A 4GOKA 3C15C 2QMUA 4UNSA 1NN5A 3MFYA 2G1JA 2GZDA 3A1TA 4GZMA 4JKIA 1SXJC 2ZRCA 3I72A 2IXFA 4OQFA 1W36C 4IOJA 4WIAA 1YZKA 2WMNB 5G41A 3K70B 1T9HA 1BYIA 1KY2A 4DT1B 1UBCA 3BBPA 3DOFA 3BH7A 1E3MA 2EFCB 2JAQA 2R6CA 4KFUA 2GK6A 4QGFA 4TYQA 2REBA 1YZGA 5EP1A 3A58B 4FMCF 5AWFC 3RSLA 3SHFA 3ZIAD 4BFUA 4FCWA 2PMKA 1H8ED 4PPQA 1E79D 1GZSA 3C4JA 5JI2E 3W3AA 4RD2A 3IHLA 1QG2A 4JVSB 2D74A 2Z43A 4JLVA 4XD7A 3SQWA 1AS0A 1VCMA 1EFUA 4G1UC 4Y0VA 1UADA 4U7DA 1CRQA 3RS2A 2D2EA 1F3OA 5GVRA 2Z6VA 3IKJA 2QE7A 1ZIPA 2JA1A 3KTAA 3U44A 3PEYA 1GG2A 1C9KA 1TQ6A 1OXTA 1RYFA 2CL0X 5KNCA 4TT3D 2C98A 4X8OA 1JQLB 1OXSC 1XTJA 2MMCA 1T4GA 1IXSB 3R8FA 2ZYUX 1Z83A 2AFHE 4G5OA 3ZIAA 4O2LA 3PUZA 2O8BB 1N6PA 5JLJA 3BJIC 4TTPA 4EFNA 2P65A 4IEIA 4YLGA 4DLTA 3J81k 3EZFA 3WRYC 1SKYE 3KUCA 3AF3A 2R2AA 1FP6A 2WV9A 4TLCA 1X8JA 4PO1A 5CM8B 4A2WA 3BB1A 5FOTA 4CVNA 3O8DA 1R5BA 1ZCBA 1R8SA 3LX8A 5F9HA 2ZEJA 3NDPA 4B2IA 3FYHA 2JLWA 1J99A 1XD9A 1NNEA 2J7PA 2ZSEA 1WE2A 4TT3A 1Z0AA 3K0CA 4TL7A 1E9BA 3Q5EA 3EIQA 3S1AB 1US8B 2JDIA 2CE2X 4PQFA 1CR0A 3U5ZB 4BPBA 1E1QD 4NZYA 2WKPA 2ZSFA 4IDQA 1YKSA 2OLJA 4LJAA 4I1UA 3VAAA 1XFAA 3VHLB 4DJTA 1QHIA 3GLFA 1AKYA 3QPVA 1TTTA 4NMMA 2QQ0A 1N6IA 2VHQA 4BLSA 4GMXA 5G3ZA 2WTUA 3RRNA 1I4DD 2QEQA 4AD8A 1JNYA 5J4YA 2G88A 2ORVA 1GITA 1M1YE 2FZ4A 3GLHB 4HB0A 4JS0A 1HY3A 4NYIQ 5FOWA 2WJYA 1XTKA 2OILA 4E5UA 4LHWA 4C0LA 3GLHE 1A82A 3RS5A 4ESHA 1F6BA 3IPXA 4ZKEA 4JIMA 4DLYA 2B92A 1IJEA 4IXMA 5BN3A 1PJRA 2R6FA 3K8YA 2D3WA 3AVPA 3NBFA 3EWSA 4WVFA 2EFDB 3PEVA 4HDQB 1EX6A 3EG5A 1KJZA 2N46A 2BM1A 3WNCA 3QKUA 2QRZA 3LBHA 1MRSA 3FMFA 4D4MA 1Z5ZA 2KBEA 2WAXA 5EUMA 1ONBA 2CE7A 4A0GA 1R0YA 2H57A 3NXSA 1NI3A 1E79A 1RZ3A 4RFSA 1G1MA 4OQXA 3TLXA 1S8FA 3GLGE 3WXMA 2WSSA 3K0FA 2EQBA 5CJ2A 3THYB 5KUTA 1ZYUA 5EZ6B 2ONKA 3C8UA 4ZO4A 4NCIA 1G64A 1GP2A 4L8GA 3ASYA 3GCGA 4IHQA 2HV8A 3HYTA 5DN6A 2XNDD 3B9QA 1E9CA 4Q4AB 4CW7A 2AD5A 1IQPA 2JASA 2V7QD 3BFXA 1AM4D 2QSZA 3CH5A 3W8RA 2EWWA 5FOVA 2FA9A 3PVSA 1UM8A 3P4YA 1XMJA 5K8UA 1BO6A 2QENA 3QVVA 3AVUA 5TY0A 5KO2A 2YKGA 1Z08A 3NTUA 2QM7A 5FOXA 4NCNA 3EC1A 4V0NA 5HKKA 1GTVA 3RNLA 4DCTA 1KO7A 3TQFA 5FR2A 3TBKA 3MWLA 1FQKA 3FMPB 4B2LA 4V03A 1S9HA 2GWHA 2FSIA 3UK6A 3L0OA 4B6EA 1FX0A 1OV4A 1NF3A 2FGJA 2XNDA 4C0BA 2QP9X 4NYMR 2O5VA 2YOHA 3CLVA 1G3IA 2XTZA 4P4UA 2A9KA 1KOFA 1ZINA 4A82A 2OXCA 3EZ7A 2XB4A 3CWZA 3L0IB 4OYHA 3AP3A 3BC1A 2W6JD 3ZGXA 2IL1A 3EC2A 1R5OA 4O25A 3NEYA 2WVJA 2C96A 2CNWA 4TMZA 5EXXA 3B7GA 2VP6A 1G8HA 4QNMA 4URVR 2G0TA 1DELA 1XJ0A 1OF1A 2HT6A 1P2SA 2ZVPX 4PHFA 5BQ5A 1G3QA 2W2VA 4BFZA 1TADA 4AG5A 4EPRA 3WRXC 1OIWA 3AKYA 2AN9A 3T1TA 3BE4A 2ZRLA 4PFSA 1CR1A 4A6PA 2XNSA 4NP6A 4W5JA 1TU3A 3ND8A 4LSGA 1FW6A 3HU1A 1R2QA 4Q18A 1G4AE 4MGZR 1KO1A 2ZE5A 4HEJA 4PAMA 1N6RA 1F5NA 2IK8A 5M04A 5JCPA 1FPMA 3R8CA 1NBMA 4V02A 5JWOA 1J8MF 1RJ9B 1UEIA 1E2LA 2QMOA 1TL7C 3ZVNA 1ZNWA 4Q7MB 1J70A 5L8VA 2JJ1A 3LW7A 3MMPA 4BLTA 1DPFA 1CS4C 2EU8A 4C0AC 5KHOC 2IYQA 4BFYA 4KO8A 2UZIR 1W0JA 3N2IA 1DVRA 2LWIA 3LLMA 1K8RA 1RIFA 4BZXA 2NMVA 1N25A 2NO1A 2VF7A 3UWOA 4OI1A 1R0XA 1XEXA 1XP8A 2ORWA 3B1WA 3NBZC 3QF4A 4RZ3A 4WAUA 1RRPA 3IDQA 3W9YA 2GTPA 1UKEA 4BLQA 1H8HD 2W6IA 1PZNA 2VSFA 1DO0A 1BMFA 4C3ZA 2D7CA 2YOGA 3QXCA 2PZFA 2QBYA 2F3TA 1OJLA 1F2UA
chains in the Genus database with same CATH superfamily
1DHRA 5DGTA 2DE0X 3CWQA 3LUJA 1G16A 1H4TA 3IAS1 1BROA 1L4FA 1XYYA 2V8BA 3DOOA 4ZHQF 4L8WB 1GNVA 1MD9A 2HMYB 3AHJA 3TK1A 2PFSA 5K7SA 5MFZA 3J81A 3D2AA 4LJ9A 3HKDB 1KC1A 1M0SA 3PCTA 4IHAA 3E5RA 3ZKWA 4EKDA 3EIWA 5IP5A 1GNSA 1LFDB 1LSOA 1QZTA 1CS0A 4O3FA 3SC2A 1E9RA 1E5LA 2IP4A 3PUKA 3I6IA 5DRTA 2V5AA 1BFDA 2XQVA 3MSCA 3PHIA 4DRXB 1EESA 3UTDA 1L7BA 1M2GA 3ZHQA 5KBYA 3GJ8A 3EIEA 1W4AA 1EA5A 1JAZA 1EFTA 1I9CA 1JQAA 3DAHA 1SCQA 3KVVA 3D3QA 3TW6A 3W6NA 3GJRA 5JSZA 3VJRA 3MELA 2G1AA 1AXEA 3D4PA 2R7AA 1NPDA 1CNFA 2YCLA 3P0IA 5TE9A 4ML3A 1E1RD 4KI7A 3IE2A 2PDAA 2XRFA 2JAWA 4M1TA 3S55A 2HU7A 2C77A 3SR4A 3KYCA 1EFCA 2HSDA 3HR7A 2AMJA 4X8LA 3UUWA 5KU1A 1DQZA 2CDBA 1KPIA 4KIFA 2X1VA 3WAJA 1KI3A 3TZ6A 4P32A 2A14A 3LY7A 2JI4A 2NT4A 3SQDA 1H66A 4G5YA 4IWXA 3AJRA 4L3OA 1I33A 1JYFA 4NEGA 4F0JA 4DRYA 1EFRA 4L9RA 2W6MA 2Y1KA 3T95A 2IJGX 1QZUA 1FNCA 1ULZA 3U5TA 3CVVA 1V37A 1D4ZA 2QV7A 4JLBA 3CE9A 3OLQA 1N2HA 2VOJA 3KD3A 3TFQA 3VMFA 3WGOA 3HFSA 4INZA 1R0SA 3ZWXA 3LXXA 2VATA 4TVOA 1P1FA 1HFKA 2YZNA 4BKMA 1JIJA 1W76A 2RH9B 4NH0A 4XDGA 3VC3A 5FO0A 5HDQA 4HSGA 2R11A 5FEMA 2HWWA 1S2DA 4RXMA 3B6ZA 3W9SA 1P7PA 3G8BA 2BEJA 3WE7A 1Z63A 1GSAA 4XWGA 1G0NA 1KE1A 2F43B 4PZLA 3LHSA 3V6LA 3ZU3A 3SEAA 4EITA 1R0BA 4KYTA 3K9QO 2JK1A 1XRRA 3H2YA 3SBXA 2C8KA 1WHSB 1XPJA 1UQUA 1BU5A 2HDWA 4YUVA 3VNSA 1KIAA 5EJ9A 4MW6A 3F4KA 3R4CA 1PZXA 2QTAA 5KINB 1STOA 1QVAA 4U02A 3ZD9A 3MJSA 4FR2A 3SF8A 3VDQA 5JZBA 3I1FA 4IDDA 5EP2A 3GFFA 1VJCA 3EXHC 3W06A 2HADA 3GCDA 3K0SA 1IN5A 1EZ4A 4XUEA 3DPIA 5KKAA 1YQWA 3ZW7A 1JG6A 1RBZA 2W4MA 5HE8A 2HPVA 2IW3A 1WG8A 3CO5A 3MGKA 3HE3A 1MDBA 4OHVA 1K06A 4R8SA 5DYWA 5AOVA 3WNBA 3IBGA 5J47A 2ZJFA 1U0HC 2HJGA 1B41A 3I1JA 3BK1A 3HCRA 2LD4A 1N2EA 2Z1MA 3ILHA 4NZ9A 4CMAA 1GRNA 5B3LA 4JLSA 1YXMA 4HR7A 1CJMA 3V3TA 2DPYA 4WOJA 4YQZA 3V8MA 2FSPA 3DTVA 4KLAA 3K4QA 4UDNA 3EGOA 2BTQB 2X4LA 3KXPA 1OA1A 1J8FA 3LKZA 2ARKA 3PEFA 4KIJA 2AUTA 1V45E 3ID6C 3GRRA 3GLGA 2R44A 2OXRA 2DU8A 4S1NA 3K1YA 4X1KA 1L4MA 2Z3VA 1M67A 3SVZA 4C07A 4YRNA 3CX8A 3F90A 4OREX 3CISA 4BZWA 3WNZA 4UEQA 4H2DA 2J31A 2I3AA 1H65A 1GTZA 3HJCA 5JS8A 2WA2A 1NXXA 1IZ9A 2WY2D 1DG9A 2QSYA 3F6BX 3GBPA 4M98A 2LIVA 4PANA 1HTBA 3GEMA 1W5EA 1P0CA 5JNLA 4M1KA 3VC7A 1IY8A 2IIQA 2IPAB 3IV6A 4NDNE 4FNGA 4D0SA 1J06A 3L0YA 3O8LA 4DMLA 1Q77A 5BWOA 3KQLA 1DKQA 5LDHA 1C9NA 4CM6A 3OESA 5LZ9A 1DAKA 1P6QA 4A1OA 4DN6A 5I7FA 2RMKA 4BB6A 5IJZA 4ASUD 4HX5A 2G8NA 1FTWA 1NXWA 3OBIA 4P3KA 3EWNA 3DVLA 3BE8A 4YJDA 3S40A 3PQ7A 3VHQA 4HCJA 4KAAA 4PW0A 2XQJA 2A9VA 2P3SA 2XCLA 3DCJA 1U7HA 2P6PA 2ONZA 2GEDA 1BJRE 3G8YA 1XRPA 3OZVA 3M3DA 1U90A 4JUIA 4U7HA 2QTGA 1LLCA 2UYYA 3GWGA 1L7XA 3AM3A 1VG8A 3GPBA 4AF7A 1GUZA 3PRHA 4KNVA 1ORDA 2GA8A 3MT0A 5CVCA 5IH3A 3P20A 1EFHA 2J5XA 4X71A 5SY9A 5IYZF 2GBFA 5TPZA 3E82A 2OCBA 3RO7A 4UTNA 1XBTA 1IN8A 1KC3A 1XWFA 2FX3A 2Y93A 4ETIA 3M4YA 2FDRA 3DE7X 3FB4A 4X7PA 2NP7A 2DZDA 4MKZA 3RRXA 4YY3B 5K9ZA 2DKFA 4ENTA 1V11A 3DXXA 3K9CA 2UUAB 2ZITA 2O8EA 2V45A 4MQFA 1TYCA 3HUTA 5B37A 1MO5A 3V8NA 1EP3B 1KEEA 3JYNA 3GJTA 3DWEX 1FNDA 1EVJA 5LB2A 3RM3A 3V4VB 4EHNA 3N8HA 2AK2A 3O83A 3QVLA 2XDWA 1Q7RA 2IQIA 3INTA 3BOSA 2XSZA 4TTSA 3E7XA 1E63A 4R8VA 3TEJA 4Y1GA 4ZCSA 4HF7A 2ZR7A 2C5HA 2WF6A 1NYQA 1XUOA 3EFOA 3G3EA 3GFGA 4GX1A 5CVUA 4PZZA 3AHGA 3IH5A 3TNJA 1OCEA 3O3CA 4RA6A 5FLEX 2R4QA 4D4HA 3E9RA 3Q88A 1DWQA 4WXYB 3VR2D 3ZGNA 1XE3A 2BJHA 4B47A 1YJAA 4GRIA 2D2FA 4JA2A 4NZZA 2HV9A 5KX5F 2EX0A 4JU9A 1UDWA 3AVVA 1B2RA 3RVMA 1IY0A 4LF8B 4KO1S 1WKBA 3CX6A 3VZDA 3QMPA 4B4KA 3B8EA 4R8KA 4JVNA 4F4IA 4CMEA 3ZY2A 2VHJA 3D4IA 5JTUA 1K88A 1ZNZA 1P2TA 2VAMA 5AXBA 3U4MA 2GD1O 1P77A 2FWPA 4GX2A 3NTXA 4E33A 5B7PA 4XIFA 4BBJA 2FFBA 1V5FA 4A0HA 4L15A 1JVSA 1M1NB 1SC1A 3Q40A 2A9FA 4DUYB 4MRMB 1I6LA 4I5IA 2VCHA 3K7EA 5LN1A 2CVPA 2NX2A 1YZYA 2CVHA 5KC9A 3MUOA 3BMNA 4YACA 1WZEA 1Z82A 4PXYA 2H1VA 3AU9A 2Z57A 3BIXA 4MCHA 3S1AA 5BSRA 4DDUA 5JFOA 5KVSA 3WP0A 1CEYA 3KXKA 5CD1A 4KUHA 3SG0A 1DC4A 4GXTA 2V7WA 5C18A 4XWKA 3UATA 2XMRA 3K8ZA 1ZUD1 4NULA 1L5RA 5DNEA 2FSVC 1LSSA 1GL3A 2XUZA 4H1HA 3R24A 5D6OA 5EUCA 5EJMA 2PV7A 5LP6A 3EQ2A 3DMDA 4AW9A 2QTWB 3G0CA 3O2QB 3Q85A 2XIJA 4OXQA 3RU7A 1GRQA 5TMEA 4DV1B 1TYEB 1VP3A 1VE5A 3BGVA 3EEQA 5AHOA 2FEOA 4DS3A 1CR2A 1VLJA 3KT6A 1FUKA 7GPBA 4Z4FA 4YRBA 1PR5A 2C2HA 1ZD2P 3MJVA 5G4KB 4FHEA 5J5CA 3HBFA 3QUSA 4LYYA 4MPDA 1GPKA 3NBKA 3GMSA 5HXAA 3OE4A 1RCUA 1NM5A 1WZIA 1XD2A 2Z2IA 2YQ5A 1L5WA 3O8OB 4EF5A 2UZ4A 1UXJA 4RD0A 3DKKA 3SSNA 4EELA 3SFZA 1BKYA 4F1WA 1IOZA 2NADA 2GKGA 3DXFA 1L2TA 3A1NA 4YP1A 1U0SY 1SVWA 1E1QA 2JLRA 4XTRA 5DTIA 1N8KA 5AM2A 3K2EA 5AO9A 3N76A 3OE7D 4C7XA 2RJOA 1LDYA 3G2PA 3KUUA 1FFBA 3VVLA 3KWJA 1WCYA 2EBFX 2DETA 4LDQA 2BZSA 3DOIA 3ZG6A 5JNWA 5H1YA 2O4UX 3PD0A 2NN3C 4XGIA 2P2DA 4FYHA 1YOBA 5ISMA 1H2EA 1XTPA 3T5DA 2ZB4A 4PV7A 1TC1A 3GLIE 4JJIA 2ESRA 1I4LD 3VKWA 1JNXX 4UBIA 3T5MA 1Z2EA 1TGYA 1IVYA 2YVQA 4TL8A 5TPWB 3AJEA 3GFVA 2PKQO 1J0XO 4NC9A 2ES4A 4NBLA 2W6OA 1W1UA 4ND3A 1K5GA 1UJ6A 4DVGA 5HZHA 4IOMA 3TIGA 4Q05A 3ZLVA 4X92A 4XIIA 5C4MA 3AESA 1IEQA 4E51A 1E7SA 3WGQA 4JLAA 2HWKA 3UHAA 1Y81A 4AO8A 1DAPA 4GRDA 2ZBUA 3DAYA 1SCUA 4IJQA 1UOOA 3GVXA 4F3RA 1WQ3A 5MGBA 1JG3A 4G0UA 1EKXA 2GFHA 1Z7WA 4I1OA 3TUZC 2MYNA 3BFKA 3MT7A 2RGYA 2PQ0A 3W9UA 3Q3CA 4YAFA 1B7GO 3BZBA 1H6DA 2AX3A 3P2EA 5TT1A 4CQLA 4YRSA 4V0QA 3OU7A 4RM3A 4V39A 1X19A 1JIUA 1Y8RB 3M9LA 1CX9B 4KPFC 5C35A 1N2ZA 1N4DA 4GLBA 2EP8A 4RHXA 3TTSA 2O2JA 1J39A 1KJYA 1RWVA 3CPHA 3LT5A 3NHBA 3QOWA 4KVGA 4C01A 1C1XA 1MU0A 1H2HA 3CVOA 1T3ZA 4NY1A 1SCBA 3IP9A 4R40A 4F8JA 4RTKA 2O1WA 1X87A 4AROA 1XA4A 1RLJA 2GKOA 3EPRA 3EVNA 3QPWA 4OHXA 3V48A 3U3DA 1T9KA 1JWBB 1L1EA 2AYZA 5CJJA 5EHZA 2BTQA 1F2UB 1NFQA 3KQVA 4O59O 1O95D 4L27A 3RFFA 4HAUA 1CFZA 2XNCA 3VJLA 4BO2A 1RC8A 1J5EB 3G68A 1BKSB 4YAGA 1YUBA 2VYND 4UEWA 3FYUC 2G07A 3K3PA 3UTCA 4UFOA 3VPGA 3Q7PA 1WCIB 3A4TA 4UEKA 4NYJR 5JXJA 4QECA 1ZRHA 2DUJA 5JAUA 1E0SA 4JYBA 1ZJZA 3THRA 1XDGA 4OQ4A 1BGWA 5BW4A 4BNDB 4QRIA 1CUXA 3G0BA 2C0PA 4QXOA 1Z47A 1PWZA 1NNLA 2UV8A 2Z98A 3Q9NA 1M5RA 1V8OA 5LZ8A 1Y80A 2IKQA 1B1CA 3AINA 4G01B 4DMKA 2O23A 1AS3A 3SR3A 3RC7A 1ULTA 3VZCA 3PQ8A 2YMQA 4L75A 4D81A 5HQTA 3MVEA 2CD9A 2ZRNA 3RTDA 1X7ZB 5SZIA 3AF0A 5AW4A 1P4HA 1KY4A 3LW8A 5C1BA 3U37A 5EJ5A 1MDFA 4JP5A 1R9JA 5B1DA 4OD0A 2J9ZB 5C5CA 4FSDA 1TM7E 1WW2A 2EIHA 3VKVA 2Q3DA 2H5LA 1UKCA 1ZMBA 3KB1A 1C4KA 4MR8A 3UXMA 2C7RA 4M9RA 4O29A 3T15A 5LMZA 4W8GA 4FYVA 3DNFA 3EK2A 1AKMA 4LK3A 2XTMA 3EF0A 1PW7A 4JN6B 5T3YA 1J20A 1GZ4A 1ULUA 4JCOA 3BE6A 1TO6A 5LD2B 4HQFA 1EDEA 3SPXA 3OQOA 5F4BA 5FOUA 2A5GA 4QTYA 3UPUA 1SKMA 1CS0B 2WHQA 1N7IA 3T52A 1RXEA 5GZ6A 4M7PA 1OPXA 4ZQCB 1EG7A 1FNSA 1P81A 2XF8A 3FF1A 4FGZA 4CGYA 2PZMA 2B5VA 1K68A 1IHDA 2QXTA 3PCRB 3PT9A 3TN7A 4BNKA 1IHYA 1XRJA 5DLDA 1TQHA 1YJCA 4N5MA 4TKUB 4UTRA 5J58A 3NCTA 4YRDA 1JTVA 3CPJB 3VVBA 5FEUA 4L4RA 2P4SA 3FE2A 3VYWA 1IIRA 3KYDA 4OQPA 8ADHA 3HQ4O 4WKPA 3MMXA 1VHWA 1E6UA 1J8QA 4AZSA 4B74A 4E5YA 4ZMSA 1NUHA 3RS3A 2X19A 2TRSB 3QVSA 4LOAA 3I9LA 5K0ZA 2FFHA 1YE3A 2ZBEA 3KZMA 1JA1A 3HPRA 4I08A 4PHTA 3D8HA 3U81A 4C4AA 4WLUA 4DPMA 5I5EA 3AL0C 5IM4F 1CVIA 3OQPA 1DEHA 1JA0A 2FFRA 3STVA 4QSHA 2P41A 4BNTA 1TT5A 5KPJA 4Z4EA 4ECEA 4PIPA 1L4EA 3ZWVA 1HQDA 2JC3A 5M3BA 4C7BA 3E7FA 2XA1A 2XD4A 4YASA 4X1YA 3Q7QA 3CUEF 1LNQA 4R7ZA 3UV3A 1UEJA 4C6SA 1YRWA 3A10A 3FCCA 2VXBA 1ZD8A 2HBRA 3MTJA 5IXJA 2ROQA 4UDXX 3ANYB 3C7TA 4BVJA 1Q16A 4WOPA 4DR5B 2ANCA 3GRFA 3NTOA 4OVKA 3LCMA 5ILGA 1Z45A 1E3DA 3NHWA 1THMA 5HIJA 4AYXA 5FTWA 4TZ6A 4NOJA 5J40A 4EPWA 5CDHA 2GPNA 1BXGA 1IBSA 3IQXA 3DFUA 4ZOBA 4BZZA 1N92A 4DBLC 5BMOA 3PNOA 1CC1S 3PB3A 4N12A 2ORIA 1UINA 1E2FA 4PS1A 3MMNA 2MSWA 3BL6A 5E6SB 1QV9A 3B6MA 2Q46A 2QVGA 3RJTA 3UOWA 2NSYA 3NTRA 4WT7A 4PSAA 4RVOA 4G89A 4XJVA 3ZY5A 1B0PA 3GJZA 4WCFA 4YDRA 4XJXA 4CLHA 1XPRA 4Q82A 5B36A 2O6HA 4EX7A 1OH6A 1EX7A 5F77A 2PFKA 2ZDQA 2NUPA 2IPNA 3I05A 4JJFA 2QGFA 3AY3A 4RVGA 3OMLA 3RS7A 2F8SA 3SKXA 4FT2A 5AJXA 3B9PA 4EJSA 1USIA 3SCZA 5B1SA 3DQZA 5CM9C 5JIBA 4C6TA 3KC2A 1MQSA 1P4RA 2DWCA 5K8TA 1FCJA 1L7AA 1FRVA 3FWKA 2JS7A 1NR1A 4MV1A 4PWZA 5AI8A 3E35A 3O4IA 2IVZA 2Q8PA 4HADA 3NDBB 4LVOA 3WL5A 1RYEA 1SO8A 3ZGZA 3AL2A 3PTLA 3HXPA 5LB4A 1OWMA 1Z6AA 5JY6A 5JJLA 4K05A 3DTVB 4FFLA 3HO8A 4BMYA 1NDUA 4DJJA 3DUFB 1U8UA 3AEUA 4OF4A 4EWLA 4HWTA 1YQXA 4BNFA 2VAWA 5HBRA 3ENNA 4WY2A 1Q1EA 4HMPA 1H8EA 3E9QA 1XD2B 1F8FA 2C2YA 2IOFA 5DMHA 1PZEA 2A5LA 3WBKA 1KAMA 4CT0A 1W93A 1RI4A 2QAGB 1D5WA 1VCHA 2IXDA 1DRUA 2P30A 3F3SA 3QKSB 4HLDA 4WDQA 3IKLA 3CHYA 4YMTA 1E94E 1G59A 1H4QA 4UCWA 2JHFA 1T3GA 5KMGA 4DSUA 1QP7A 4FZJA 4GNRA 3O0TA 5CMLA 3CZCA 3D7MA 4GP9A 1ZXXA 1Q21A 3AEZA 2BR4A 2YXPX 3PFGA 2GO7A 3E0QA 3V7WA 2UYCA 4A8HA 2JHGA 1JHXA 2DR3A 3IALA 5KEIA 3LRTA 4K8OA 1FF9A 1HTWA 2H2DA 3C5VA 3VNRA 4LX8A 1WXIA 4LF6B 5DX1A 3W4IA 2ZJAA 3T3GA 5A6SA 1VGRA 1NRWA 3E18A 4UBMA 3TQIA 2HCBA 5EZ5A 5D3MA 3TDKA 1NUSA 3AH8A 1BDMA 1GZHB 2N47A 3PD7A 3PXBA 2ZTHA 3HA7A 4H31A 4L8LA 3K92A 2HLDD 3AILA 4DREA 2YXBA 3RU9A 5C3UA 3WBFA 3D6VA 2OXTA 3GJ6A 3G2OA 1RXSA 4I50B 4DLBA 3H8WA 1R10A 3GELA 3OI7A 221PA 1Q19A 4O1MA 5H3HA 3QVMA 3H2IA 1L3IA 4MLPA 4I66A 1Z8HA 1E1YA 2CHQA 2ISSD 2VKTA 2REXB 3OEEA 1PTJA 3RYTC 3AUYA 3MWJA 2AUMA 5FWYB 3TTWA 4Z5XA 1YBMA 2B9EA 4YONB 4RGBA 2IE0A 4X44A 3FMIA 4U7GA 3W5UA 4YAIA 3C6YA 3LXMA 5TQ2A 1CJVC 3DM9B 2PH7A 5JROA 2G1KA 3SZRA 2OM2A 5AVJA 4OK5A 8AT1A 4AMBA 4I1SA 4IF4A 2DJIA 2WSLA 2J9FA 2OXEA 4L8YA 1ZM9A 1CTQA 4EUFA 4C1BA 2BCGY 4F12A 4Q7QA 3P9YA 3CRNA 1SY7A 4P98A 5EMLA 1TB4A 2GNOA 2HWXA 1JEQB 2ZSAA 1KEZA 3HI6A 3FXAA 3OLVA 3EA4A 4K5QA 4MINA 3VJMA 3O4JA 3WBJA 4CR8A 3BE5A 1E7QA 1IXYA 1G38A 2QY9A 2DXIA 3LYLA 3G13A 5CNKA 4KN8A 2B0JA 3FUTA 2CBGA 1K66A 2GBCA 2XXJA 2I67A 2VPTA 4YRTA 5IHXA 4QPZA 4CU2A 3D4LA 2BBSA 1JX6A 2C7PA 1TJYA 4JITA 3TZKA 2VJDA 2ZDHA 3G9QA 4TWAA 4AG6A 2OZLA 1ZMTA 3PGVA 3UBTA 1E9VA 1KBZA 1W1IA 1W8IA 4S05A 2BOVA 4LJ8A 2ZR8A 1DNPA 1ODIA 2W48A 4J90A 5LBIA 2MYTA 4KN9S 3K09A 3CLRC 3WLPA 2Q5FA 1QIDA 2UZ1B 1TEXA 2GCGA 3JS5A 4N4AA 3LQYA 5K51A 2HYDA 4TMYA 3A9TA 4FDLA 3MSXA 4WERA 4WN9B 4XLTA 2RGDA 1SCDA 2CB9A 3KKKA 1JDUA 3C2QA 1FMJA 2ZSKA 4JV5B 1A97A 3ND7A 4RF3A 4FHGA 1KDYA 1EP9A 3NUQA 4DY4A 3ITNA 2R0QC 4RVNA 5EAIA 3QKRA 2OYRA 4MW9A 2G4CA 1ZOIA 2J48A 1Z6QA 3G6WA 4Q0MA 2ONJA 1GY8A 3BJEA 1GVNB 3PZRA 4PPYA 5I7UA 1D09A 5CD9A 4TTVA 4WFIA 1L7VC 4GKVA 3ZE1B 1KVTA 5L3RA 1TMOA 3GN2A 1XL1A 1QTNA 4GPZA 2EV9A 1XZAA 2GPTA 3GPCA 3GP8A 2ST1A 2LBPA 3R5FA 4PSDA 3P2MA 4L3WA 4LXUA 4ZYLA 3RRBA 2WAAA 3FYSA 1PL7A 1YVPA 1MQ8B 3ISTA 4C43A 1ZNYA 3EIHA 4OOFA 5E6RA 1VG9B 3HJUA 4NAVA 3ZCVA 1V8ZA 1U81A 1VE3A 1WMSA 2QNRA 1O94D 1KDOA 1KHHA 3IQWA 4XOUA 4DYVA 3NH9A 3LDGA 1G17A 3PVCA 3HYSA 1QP8A 3FNBA 4L07A 4GVLA 1NI4A 5G0UA 3DHEA 3RRZA 2V98A 3S3TA 3AT1A 3K16A 3L8DA 1K7CA 2QJWA 3G17A 2C04A 7REQB 2AX4A 2AFIE 3H4MA 2WTAA 4C7KA 4TZ0A 5AJTA 4L08A 1J07A 4JBLA 4KBFA 4MLZA 1C2TA 1NVTA 4NX2A 4XDZA 2WJ4A 6AT1A 2Z4TA 4XFJA 5A5DA 4Q1CA 1BWSA 4FMBB 4MWCA 3DTYA 2YQ4A 4PYLA 3LPMA 5CLFA 3TIXB 1DTWB 4PLCA 4M8NE 1N6HA 1A2BA 4G0QA 3N3BC 5DT2A 3QVXA 3G5TA 1XCJA 2EZ8A 4G26A 4BNMA 2QLNA 4FS8A 4QGSA 1QCCA 2AD1A 1SQ0A 2HLHA 1F6DA 2ZDGA 5ARCA 4FONA 4N7BA 5CX1A 4ZOLA 2PA0A 3JQRA 3LIPA 3KWMA 4X97A 5KYKA 4I0WB 4W5WA 2CNWD 2QRVB 1MNQA 3EIOA 4OU4A 3UT0A 3G82C 5D5QA 3FR8A 1H2BA 3FM9A 4B3SB 1UJCA 3HXMA 2ZJ7A 4D79A 3E3AA 5FPKA 1EXVA 1FMTA 2JLXA 4JSTA 3JYLA 3M70A 4JSYA 4WD3A 5E4TA 3AOEC 3PBKA 5GONA 1W5AA 2O8CB 4MUJA 1AIPA 2R6ZA 1CVRA 2SKCA 5A06A 1N2OA 1QRAA 2W2LD 3DE5X 4UHHA 2QN7A 3FJ1A 3D8RA 3EBPA 4WMLA 4F4JA 4DG5A 3W5CA 1P4SA 4JWTA 3UMBA 3VSBA 5IZCC 3KJGA 4ZREA 2I33A 4OP1A 5EWJB 4JLOA 1EXNA 1ND5A 1P60A 2PT5A 3TQRA 1PP4A 1RQLA 4J94A 3EAQA 4BX3A 1CUIA 4HFJA 4P0QB 4WCFB 3D5EA 3CLSD 1XAJA 4I1YA 1TPZA 2J6CA 3WQRA 3DKPA 1VMEA 1GNPA 3H6KA 4YUYA 1F1BA 4BAZA 4M36A 4WXEA 3SHQA 1CV2A 1N7GA 5IZ4A 3F98A 4PHCA 4ZA2A 1LSJA 2OBYA 2G77B 4RK7A 2AKYA 3VH4A 4KQ9A 3DDSA 1N1MA 3RR2A 3PI7A 3NHJA 2WYHA 3QEAZ 4XCXA 5JWRA 1C1XB 4HAYA 1I4OA 2C54A 3ZHCA 2IKSA 1Z17A 2PXAA 1YV9A 1ESEA 2VYFA 1KRHA 1LI4A 2D1YA 3M8KA 4DRZA 3EGXA 2GYVA 4RLSA 4CUJA 4HLQB 4FCTA 4E5PA 2DFTA 2XV1A 3B6EA 4AMZA 5JAOA 1YGPA 1GGKA 1WP4A 2M2IA 4GE0A 5KYUA 3ZLTA 3OQVA 5EE3A 4DBLE 3OM9A 2VHUA 3P27A 4K9NA 3U6BA 3TLBA 1IAQA 1M2EA 1M1ZA 1H22A 1YZQA 2RCNA 3L6EA 5G3YA 1M2FA 3MRTA 3PT5A 4PZ9A 2VAVA 4ZEWA 3DHNA 1P4JA 4MRSA 4HWOA 1NJ5A 4V3BA 3QFCA 2VPWA 2OMEA 1J2JA 3FPFA 5BN5B 3A9WA 3ROEA 4C0JA 5L3ZA 1C1HA 3MJEA 1Q0RA 3Q3EA 4F5WA 3GJXC 1EGQA 2FU5C 3U62A 3UCXA 3DMYA 4GYJA 5ALIA 2ZYIA 3C1TA 1D2EA 2FW6A 3ZH9B 2GK3A 1YDFA 1U4NA 2UZ1A 3GK3A 4B6FA 2BFWA 3NGMA 4PYIA 3OJLA 1NVGA 3EXFB 1FDIA 5JH7A 2XX3A 3N6VA 4K9LA 1AU9A 1N2XA 2XXAB 5JU6A 3GRUA 4U4AA 2Y6UA 3MGGA 4ZT6A 4IH1A 1FRNA 2EG5A 5FFNA 4JBWA 4J0IA 3DLTA 1F2VA 1FDWA 1NJ2A 4RAQA 1U9YA 1ZCJA 4GQBA 2YRWA 5K45A 1NY6A 4GWLA 4K2AA 4BEWA 3OF5A 2K7ZA 1CDOA 1PGJA 2R8RA 4FR5A 4O4LF 2IPLA 3H04A 4PTYA 7ADHA 2X8AA 4NFLA 5C0OE 1LBSA 3FUVA 3INNA 3ZCUA 1TVCA 1Y48E 2BFBB 5GADl 4KFRA 1CY6A 2QW0X 4MJ7A 4GSYA 2AA3A 3GWZA 3A3KA 2NM0A 2RGAA 3U40A 2GFIA 3ZBTA 4YUWA 5ALMA 2Y77A 3HKEB 5JECA 2R7NA 2O0KA 4OHYA 4I9FA 1P1KA 1HNZB 4GLFA 1Z0FA 4TS9A 3UMSA 4C2UA 2Q3EA 2OORA 1BIFA 5CR9A 3S0JA 1E2EA 3JZDA 5AKEA 4J7UA 2ZM6B 3GFTA 3PR1A 3Q7IA 1Z5VA 1U1GA 2GN9A 5HOEA 4U2DA 3R3ZA 1AVTA 1T5TA 2HMTA 3EN0A 4WZAB 2PLWA 3D9QX 4F60A 5LBTA 2PZKA 4C7OA 2HA7A 1XXLA 5JHHB 1GM5A 2KB0A 4RE6A 5IKEA 4ILEA 1R9GA 1Z5UA 1KKLA 2BHNA 4HTFB 1KK1A 1FK8A 2RBKA 4L5BA 4EJ2A 1GAXA 4M99A 1ZK3A 3QVJA 1NVBA 1P2DA 4OI0A 4HGYA 2C9BA 2E4VA 2X0RA 1TZMA 4GMDA 4N41A 5LA6A 1BDJA 3B2EA 3ZZNA 2PVCA 1G2OA 1V6CA 4QWMA 4J4BA 1P1BA 3U9LA 4BXOA 2D7JA 3G02A 5JAPA 3IJ5A 2EFYA 3DOEA 3F3YA 1MT0A 2NYUA 2WFLA 1PUIA 2OP1A 1GILA 2XUFA 4MEBA 1XVLA 4OB6A 1K8ZB 3JVVA 1HZZA 1Q74A 2WU4A 1WB5A 3CX7A 2V0NA 4D42A 4YDHB 4Q1BA 2EXXA 5AK0A 5HKAA 4YUXA 5CH8A 1SH7A 4D41A 3ZZ0A 3T7DA 2O2CA 3TLGA 2FSFA 1T0JB 1O0CA 2Z4RA 5BY2A 3MTDA 4Q6BA 4R9RA 3SYKA 3WKEA 4EH1A 2FQQA 3A7DA 5PGMA 5JUWA 1UR5A 3X1YA 3ADKA 5TQ0A 1K6JA 2B36A 3HB5X 2ODPA 2JDID 2Q3MA 5FL7A 1MO4A 1SQ6A 5EZYF 4FFSA 3N28A 1DT5A 5EY5B 2HJVA 3RFCA 1ZU4A 2GM5A 5H02A 1EYZA 2PLAA 4EQZA 1L6RA 3AYZB 5ERXA 4YRJA 3AERB 4AKGA 4QQNA 1DTEA 4KGVA 3FI9A 2IIVA 3GC6A 4RNDB 5DM70 9MHTA 5KNLA 3OA0A 3GARA 1XZDA 2MSDB 4DJFC 3ADDA 3IDOA 2HO5A 4E15A 1DEKA 4Y2HA 4BQIA 1T0PA 3HB9A 2WJAA 4PYKA 1PJBA 3IPYA 3CS3A 1JT2A 3SXPA 4AL4A 3NRCA 1WV0A 2QT1A 2UUPA 2RC5A 2HRZA 3HU2A 5IAJA 1S7CA 4Y2XA 5EE5B 1QGOA 3E84A 4K7JA 4S3MA 5DE3A 4E5MA 4ZMRA 3JAWB 3PFBA 4UUMA 3P45A 3MWYW 4RD4A 4D45A 5MN6A 5KYXA 1CEEA 3GEHA 2J30A 3AF2A 4P80A 1PQ4A 1G8PA 4ZJZA 2BGJA 5DB4A 2O06A 3GB9A 5F7OA 2Q6VA 4LZOA 2VPIA 2XZDA 4L4SA 5T4BA 3WDSA 3HN6A 4W6ZA 521PA 5BVHA 2G17A 3V7UA 4IGIA 2PZGA 2PL1A 4H7EA 4NYJQ 5BMVB 2NZWA 5BXYA 2OBLA 4BMPB 4H3SA 5KTOA 3LXUX 1NBHA 3NIGB 2WHPA 3Q3JB 4MVJI 3TSWA 4J29A 3QBEA 3JQ8B 4BX0A 4QATA 1O58A 5BN5A 1Y7PA 4BVEA 2XJ9A 2EJBA 2YIJA 1TYDE 4DSTA 2FHPA 4KUEA 5EUQB 3R0IA 4US0R 5KYYB 4N6GA 5I5GA 5CLJA 4TYNA 3H5NA 3PEEA 1AH2A 2YJ6A 2GZ1A 4OL0A 1X8LA 3Q6MA 4EX6A 1ULAA 2GSWA 1CY8A 1U80A 2CCKA 2HK9A 2BIFA 3R3XA 4UCXA 2VNHA 1OWPA 2HX1A 4D02A 5FD8A 3CBQA 3II6X 1GN8A 2XGSA 1RYMA 4I8IA 4PIMA 1TUBB 1RM5A 1YK1A 4RHFA 3ME5A 1WTCA 3ACDA 3V2GA 3WVNA 2P9GA 3SC2B 2HHLA 1W46A 2Q1TA 4D9GA 3EE6A 3KB6A 2YC4C 3DMTC 4R01A 4TM7A 2FK8A 4R2IA 3CO0S 3GX1A 3M83A 1TZBA 3IAUA 2WTBA 4DLUA 2J0UA 2ZBVA 4RHYA 3FX2A 5U4QA 4MGEA 4Z7QB 1MP0A 1Z33A 2RBEA 1KO4A 3TUIC 1XTZA 3EEIA 1UBTS 1YAJA 2C82A 2H00A 1PS8A 3DJYA 4PG4A 4EENA 3O8CA 4FBMA 1E7WA 1QYDA 2JPDA 3RT7A 2YDYA 4TVSA 4JKYA 2FMFA 2NOAA 2JGDA 2QG4A 3AY0A 3HKEA 3DFMA 1UZAA 4YT8A 2QRPA 2OEPA 2ZAYA 2BUBA 2UAGA 2WHRA 4KSCA 5JEEA 5BPFA 1F4LA 4KREA 3A9SA 1EFVA 2QLMA 1X7HA 1WNTA 2YFKA 1JW9B 4GVPA 2R84A 2CLIB 2BMAA 3KSRA 2P6NA 1CUUA 2VUTA 3IT3A 2HSEA 4KVAA 2XDYA 2WHXA 4AWAA 1L4UA 4JXJA 4KFCA 3H4IA 3WFJA 2R3SA 1FJHA 1V7QA 2INGX 3FYUB 4X91A 3IP3A 3IMGA 1XTRA 4OXXA 1J90A 1I6MA 4QPDA 1RTKA 4R2LA 2D4HA 1CZRA 5GZ3A 4S1PA 4NMWA 1ZUWA 1GPAA 4GPIB 3ZQUA 6Q21A 1A8QA 2H18A 3WMFA 4E0BA 4P5PA 5A5EA 1WLSA 4F2GA 5C8YF 4IY1A 1TZKA 2ZLBA 5JRDS 2O52A 1A4XA 4K6OA 2P2YA 4D96A 1Z7YA 5BSGA 1EE1A 3CR7A 5CLHA 5IJAA 5HPYB 4XQCA 1XTVA 5L6LB 1I5RA 1JUDA 3BDAA 1JDVA 4Q3EA 3ZGOA 2RGRA 4W7HA 1UBFA 1V16A 2PD6A 5EKSA 5JZSA 3H3JA 4G0XA 4CFZA 3D3WA 4CIVA 3ENVA 3K9GA 1UJNA 1U2ZA 3AGQA 3P96A 2QL5A 4A8TA 3R0QA 5THKA 5D1HA 1UL1X 2EIXA 2GZHA 3OZEA 5EJIA 3RC3A 2BFNA 1SRQA 3AG6A 3TB6A 3VOAA 4QSMA 1XCPA 5ELXA 5HEKA 5C8ZA 4RYLA 4CYMA 2I9PA 3LSTA 5F98A 3OCWA 2GLUA 1JGTA 1X7XB 4UE3S 1P62B 1LB1B 3H7AA 4YRCA 1JG7A 2PT7A 3TTVA 2G5PA 1W29A 2WJ3A 4QDJA 3LJKA 3QELA 3ER8A 4TYWA 3VRHA 3HABA 4CCYA 2VJLA 2H1LA 2ZU6A 3QFSA 5DZSA 4OAPA 3CF4G 5DBGA 2JGKA 2Y1FA 3KDAA 3ROQA 1AGNA 4D26A 4YHHB 2IYXA 2Y99A 3DV9A 4BNXA 1O96A 4MZDA 2P4UA 2F2TA 2YY6A 4EJSB 2AMLA 1UBRS 1OBHA 2CFRA 2QGZA 3OKPA 1QRDA 1SFRA 2FPIA 3FDZA 2G82A 3MCUA 4RF5A 5FCDA 2J3HA 1EUCB 4OSOA 5CA0B 3H84A 2F67A 3E9ZA 1TCUA 1OX4A 4EOGA 1SVNA 2CK3D 1QPZA 4E3WA 3G8DA 1TO2E 1VYUA 1CG6A 4UUPA 4UTVA 3NHZA 1E1LA 4XWAA 1P9NA 1EK0A 4PC7A 4UHKA 1AX9A 5LDGA 3EFHA 3TMKA 2IRWA 2JD1A 2YV4A 5SZKB 4Z9AA 3IKTA 2G9VA 4H7PA 5JXIA 2B20A 3F73A 1KZ1A 3ED5A 4DW8A 3BHMA 4PINA 1VSUA 1EK6A 1MAWA 4KXNA 4Y0AA 1MZPA 1Y42X 1MIHA 1GPNA 2AR0A 1H8HA 3WSTA 4QT4A 2JFHA 2PZEA 5KOYA 5F35A 3B1KA 3BHIA 3IEMA 3ZVLA 1U8CB 1HT2E 3KL4A 4U0KA 1CZUA 2O2ZA 2Y2VA 3EA0A 1XZPA 3KR1A 3JQAD 1UBHS 4P4LA 1RQ7A 2Z9DA 5FOSA 1G5RA 2YUIA 3TQSA 3OCVA 4L5AA 4LC0A 4GICA 4BMZA 4YT2A 2Q5LA 4EQ6A 4HWGA 2DX7A 4HN9A 1KJ9A 2R1VB 2VT2A 4I8XA 3RSGA 3TZCA 3WKCA 3K71B 4PZDA 4EY8A 1OY1A 1XLWA 3IR7A 5JD4A 1VSQA 2B8TA 2VP9A 1Z0ZA 3H5TA 4TKVB 1YZVA 3PR2B 4CUKA 2AN5A 2PX3A 3TTYA 1E2DA 3PXEA 1ZONA 3AM4A 5JZVA 5K0FA 3DGEC 3VZQA 5KCZA 1B3RA 1RAAA 1JI3A 2ID8A 2CJWB 3IKVA 2GX6A 4TKLA 1DDOA 5EHNA 4LI0A 4CHTA 2R8OA 2RKWA 3RASA 4EY5A 4HDMA