2EGEA

Solution structure of the third sh3 domain from human kiaa1666 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
b'GSSGSSGKIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELGGHRGLVPAHLLDHMSLHGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein KIAA1666
publication title Solution structure of the third SH3 domain from human KIAA1666 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egeA00
1MV3A 1G83A 1MUZA 2RQRA 1U06A 2VKNA 2DA9A 1UJ0A 1E7OA 2F2VA 3U23A 2EBPA 3VS4A 1SPKA 1ZX6A 2YUPA 2YUQA 4X1VA 1VYVA 2B86A 5GJVB 2VWFA 3M0UA 1AWJA 5HCKA 2LCSA 4JJBA 5IXBA 1GBRA 1K0XA 2X3WD 3UF4A 2DBKA 2AK5A 1K4US 2EYYA 2JW4A 2MOXA 2KNBB 4D8KA 2BZ8A 3EG0A 1AZGB 2PZ1A 2J05A 3M0PA 2OI3A 3O5ZA 1PRLC 2KR3A 1UGVA 1JXOA 1YN8A 1UHFA 1SHGA 2DX1A 2JMAA 2DL7A 4OMPA 1X27A 1UTIA 3PVQA 1W6XA 1UJYA 1EFNA 2DMOA 1YP5A 2HSPA 4J9BA 3NPFA 2LJ1A 4GBQA 2D0NA 4HVUA 4J9IA 2RQTA 3I35A 1M30A 2LZ6B 1AWWA 1TUCA 3IQLA 3SHWA 3NGPA 4RTXA 1ZLMA 1K9AA 1J3TA 1GRIA 3GBQA 3CQTA 2DRMA 1HJDA 2KRSA 2PTKA 2K79A 4R0KA 3VS6A 3M0QA 1WIEA 1GCQC 2KXDA 1M3CA 2K2MA 1X43A 2JM9A 3KFVA 4JZ4A 1WDXA 4GLMA 2FO0A 2CDTA 5FW9A 2C0OA 2L3SA 2V1QA 3C0CA 2YT6A 4M4ZA 2I0NA 4E6RA 1T3LA 2EGAA 1TUDA 2ED1A 2JM8A 4AFQC 4JPBW 4A63B 2HDAA 2VVKA 2JMCA 2LJ0A 3TSWA 1AWOA 1JEGA 1TG0A 1I0CA 1NYGA 2GTJA 2RQVA 1QLYA 2FPEA 2ENMA 2CSQA 3VRZA 2EQIA 5IHKA 1PRMC 1K76A 2L0AA 1OPLA 2L3PA 2HEQA 2YDLA 2O9VA 4AFUC 4J9HA 4ZNXA 2CUBA 1M3AA 1CKBA 1KSWA 2OJ2A 2M0YA 5IHNA 2K6DA 2LQNA 3QWYA 2AKLA 4IIOA 4J9DA 1W70A 4Z88A 2HCKA 1NEGA 1ARKA 2DRKA 3SEMA 3VS2A 1OV3A 2K3BA 1B3QA 2K9GA 1HSQA 1JU5C 2PNIA 4RTUA 2DVJA 1AEYA 2NUZA 3I5SA 2DJQA 3PE0A 1GCPA 3M0SA 1WX6A 4EIKA 4RTYA 2KE9A 5ECAA 4OMLA 1N5ZA 2KYBA 1NEBA 2GGRA 2KT8A 2O2OA 2QDLA 4LE9A 1X6GA 2DBMA 2AKKA 1PKTA 2CH4W 2ROTA 2RQWA 1FYNA 3H0FA 1WYXA 2GQIA 5FWCA 3UA6A 2SRCA 2EYZA 2O31A 1JQQA 2CT4A 4WCIA 4AG1C 1Y57A 4FSSA 3THKA 3I9QA 2X3XD 3EHQA 2DL4A 2A36A 1NM7A 2JT4A 1H3HA 3ZL7C 2A08A 2P4RA 2EVRA 2J06A 5I11A 3REBB 1AOJA 1PHTA 1CSKA 4OMQA 4JJCA 2YSQA 2O9SA 2L3QA 2A37A 2GBQA 4OMNA 1NLPC 4D8DA 1VA7A 4ORZA 2LMJA 5GJWB 1M27C 4J9FA 1ZUYA 3RBBB 2YUNA 1X2QA 2HBWA 3I5RA 2J6FA 2LP5A 5IH2A 2ESWA 2C0TA 2FRYA 1YWOA 3H0IA 1GFDA 3VRYA 2DYBA 2DNUA 2DM1A 1RI9A 1I07A 2DF6A 4LN2A 3VS7A 5FWBA 3UA7A 4AFSC 1QKWA 2W10A 2KEAA 3EHRA 3R6NA 1MV0B 4AFZC 1QWFA 1GCQA 2F2WA 1T0JA 2FPFA 4RTZA 1CKAA 2KROA 4J9GA 1V1CA 1U5SA 2LX7A 1AZEA 2KRNA 2XMFA 1AD5A 1VYTA 1JXMA 1X69A 1NYFA 1SHFA 1BBZA 1UG1A 2BTTA 4LUDA 2LQWA 2AZSA 2V1RA 2CREA 3FJ5A 2G6FX 3REAB 1K0SA 2JTEA 4CC2A 1WFWA 4JZ3A 4K11A 1AWXA 4DEXA 2FRWA 4DEYA 2ED0A 1NLOC 2RQUA 2MIOA 4Z8AA 2EW3A 4LNPA 2DLPA 4IIMA 3NHNA 2EKHA 1E6HA 4Z89A 1WA7A 2CH4A 4F14A 3M0TA 1GL5A 3JV3A 1T0HA 1UE9A 2JS0A 2OAWA 2EPDA 2M51A 1WI7A 2KXCA 2DL8A 3LH5A 1QCFA 2SEMA 1H92A 3RNJA 4RUGA 1KJWA 1IO6A 4J9CA 4HVVA 1JO8A 3VS5A 2ABLA 1W1FA 4LUEA 2KRMA 1KFZA 2BZYA 2EGCA 5L23A 1BB9A 1Z9ZA 2RNAA 2D8JA 2GTOA 2ECZA 2H8HA 4JJDA 2ROLA 2A28A 1FMKA 2J7IA 1PWTA 4HXJA 1PKSA 1QKXA 3VS3A 5IXFA 2YUOA 2EGEA 1Y0MA 1WXBA 2W0ZA 1XOVA 1GFCA 5I22A 1H8KA 2DL5A 2CUDA 1NG2A 3H41A 3UATA 5IHIA 3EGUA 2D8HA 2E5KA 1X6BA 3M0RA 1ABQA 2AZVA 5EC7A 1AVZC 1UECA 2GNCA 2DL3A 4Y92A 2NWMA 1KIKA 2KBTA 2C0IA 3EG2A 1GBQA 1YCSB 3H0HA 1UDLA 1WLPB 3VS0A 1SSHA 4RTWA 1K1ZA 2K7AA 3EG3A 4RTVA 1OEBA 2RN8A 1SRMA 2JXBA 2LNHB 1I1JA 1G2BA 1VYUA 2RMOA 4CC4B 4F16A 1ZBJA 1BK2A 2CT3A 3ULRB 4J9EA 3TSZA 2O88A 1HD3A 1SRLA 2RF0A 1RLPC 1QWEA 2FEIA 2FG0A 4OMOA 2J6OA 1SEMA 1WXTA 1A0NB 2DILA 4HCKA 1RUWA 3EG1A 4CC7A 1B07A 4QT7A 2DE0X 1LCKA 1YNZA 1OPKA 2JS2A 1M8MA 2MCNA 2EYWA 2FPDA 1UHCA 1ZUUA 1UUEA 2LJ3A 2J6KA 1PNJA 2BZXA 2IIMA 3PVLA 2F2XA 4F17A 4RTTA 1ABOA 1BU1A 1YWPA 2L2PA 3NMZC 4ESRA 1RLQC 2CSIA 1OOTA 1ZUKA 1X2KA 1T3SA 1ZSGA 2RPNA 3QWXX 1WXUA 1Z9QA 4AG2C 2KYMA 1S1NA 2D1XA 1UFFA 3VS1A 1M3BA 2KT1A 2KGTA 4CC3A 3TVTA 4OMMA 4KRTA 4HVWA 3A98A 1E6GA 2EYXA 1U3OA
chains in the Genus database with same CATH superfamily
1WHGA 3A8OB 2M1HA 1MUZA 1U06A 2E12A 5GANe 1Q7YR 5CKEA 3M9QA 3FJPA 3U23A 5GMKh 2EBPA 5KE3A 1SPKA 2RHXA 3MKDA 3L2RA 2QA4A 2YUQA 2DVEA 4PJMA 3MP6A 5KYXB 2LT1A 5GJVB 4YTLA 3OA6A 4M7AA 2ZPFB 1LOJA 2VGNA 2LCSA 2HQXA 1BIBA 2RHYA 4X34A 3FDRA 1VQLT 2AK5A 2EQMA 5D6WA 2EYQA 4D8KA 1BCMA 2QA4Q 2QQRA 4JRKA 2J05A 3QO3A 1QVFA 3SD4A 3O5ZA 1WQ7A 4C8QG 1UGVA 1SHGA 4ELYC 1VQMQ 1NPRA 2ATCB 1X27A 5GAN8 4HCZA 3MEAA 1F1BB 3WVDB 1ZSZC 2LJ1A 1V29B 4HVUA 3CC4Q 3JCMh 2WSFE 2XDPA 1KG1A 2MYSA 2VXEA 3SHWA 2JTFA 1J3TA 3OBWA 2Y90A 4KGXB 2DRMA 3HRSA 3M0QA 4B9XA 1M3CA 2CP6A 1BIAA 3CCLA 3CCQT 2X9HA 1X43A 3A5ZB 4XU3A 1MGQA 1WDXA 3I55T 4BD3A 2L3SA 3MP8A 1BI2A 2I0NA 5LJ5h 3OYIA 2JN0A 4JPBW 1VQNT 4A63B 2HDAA 3X25B 2JMCA 3A8HB 3CCLQ 2RQVA 3CCRA 1QLYA 3HRTA 4OGCA 4RG2A 1H3ZA 1PRMC 2M0OA 2LDMA 3KBGA 5GAMh 2O9VA 5DY9A 3FB9A 4M75B 4ZNXA 2CUBA 2DEUA 2DD4A 1IGUA 2DAQA 1PCXA 4EMKB 3CCRQ 4M7AD 3QWYA 3EGDB 2HQEA 1W70A 1VQMT 4Z88A 2HCKA 3CCVA 3CCMT 3OYJA 5KYWB 4WF2A 2LCLA 1JU5C 1NZ9A 3PE0A 3JCMb 2DERA 3AHUA 1GCPA 3CC7A 2CP5A 3M0SA 4OMLA 1N5ZA 3CC4T 1YCYA 4Q5WA 2QDLA 2R5AA 4IUTA 1BCOA 3CCVQ 3OYCA 4M77G 2RQWA 2L3RA 2VB6A 4E7IA 3QJYA 1WZOA 4XTUA 3JCMX 2K3YA 3OYEA 4HKEA 2M02A 2CT4A 3EFSA 3QJ6A 3M59A 4FW1A 5M9OA 2NYSA 5HKCA 2A36A 1C6VX 2JT4A 4F7UG 3SB2A 2WACA 3M57A 4A54A 1PHTA 1CSKA 3CEYA 3CMAQ 2E3IA 4OMQA 3EGXB 4JJCA 1ZA2B 2O9SA 2VGMA 3F70A 3CCEA 2A37A 3JCMJ 4OP0A 4J6WA 4LXCA 4DBFA 4ORZA 2LMJA 1M27C 4M7DG 1X2QA 2RA2A 3I5RA 2ZCFB 2FRYA 1YWOA 3OSVA 4O5VA 5KYYA 3PMTA 1SSFA 5CK9A 3CCEQ 5GMKm 1MMNA 3JCMP 4LN2A 3H6ZA 1R0CB 2OTJA 2BE9B 1RAHB 4CRIA 4LDWA 3JCMQ 1LPLA 2DTHA 4Z02A 3OY9A 3R6NA 4NL3A 3MCAB 1QWFA 1FMWA 3URGA 1T0JA 3OS0A 1CKAA 3QHSA 2LNVA 4FIBA 3SDZA 2LX7A 2L8DA 2DZ9A 2K5IA 1AD5A 1VYTA 2KY9A 3EAEA 3OYGA 3HKSA 2AZSA 2CREA 2XI9A 1VQPQ 4PJOG 1WFWA 4JZ3A 4DEYA 1AWXA 4QW2A 2ED0A 4OB0B 4EMGA 1NLOC 2RQUA 3I56Q 2EW3A 4LNPA 2NUPB 3NHNA 2EKHA 3DKMA 4RG8A 1W4SA 1GL5A 4E7KA 2Y4YA 1LJOA 1T0HA 3DB4A 1Q81C 3CMAT 1MMDA 2MK5A 4M75G 1Y07A 3CCST 2RK2A 3RNJA 3ZEHA 4J9CA 3S6WA 2VXFA 2BE7D 3O8VA 3SWNB 1KHCA 2DTOA 1JO8A 3VUZA 3VS5A 2ABLA 2AIRB 3UDCA 3MHXA 2K5FA 4C0GA 2VC8A 1NJIR 1KFZA 1EIFA 3VKIA 1AT1B 2BZYA 1Z9ZA 3A8GB 2A3LA 1C1AA 2KSSA 2EFIA 3GP8A 2RJEA 4N0AA 1VQ8T 4FYYB 3S3OA 3QDRB 1QKXA 3VS3A 5IXFA 5CIUA 2YRVA 3PT9A 4ZTJA 4E7HA 2E3HA 3JB9I 2DL5A 4J7IA 2CUDA 3H41A 5EC7A 2DZCA 1AVZC 1UECA 4HA8A 3HTRA 3EFRA 4M7AE 1W2BA 2LVMA 1G5VA 4Y92A 1YIJA 1VUBA 2HBPA 2C0IA 2V8KA 1GBQA 5J3BA 3EGDA 2K7AA 1BYMA 1OEBA 1P92A 1C0MA 1SRMA 3P8DA 1M2OA 1Q7YC 4CC4B 2Z0WA 1KQSP 2HQHA 2CT3A 3H8ZA 3ULRB 1RAAB 1MNEA 2GFUA 4M78G 1R0BG 1RL2A 3OYFA 1OX9A 3AT1B 1NBEB 1RAEB 3G4ST 3G71Q 2M16A 2DE0X 3NFCA 1D09B 4HT8A 2QTXA 1R8OB 1M8MA 2ZPIB 2MCNA 4JDSA 4IURA 3DLLA 5FU7B 4HCCA 4X9CA 3FEOA 4RTTA 1BU1A 3M55A 2OAUA 4C92B 2BUDA 2CSIA 3EGXA 1IZ6A 2JNGA 4ZTFA 2YLBA 1XQHA 1WXUA 2FL7A 4BDZA 2KYMA 1S1NA 4XTZA 3WXMB 4ELZC 2IVWA 2EQUA 3OYAA 3RKYA 3P8BB 3J81E 5AYFA 2F1LA 3TVTA 4OMMA 5LJ3g 2CZ6B 2KDSA 4FSSA 3QBYA 2K57A 3EH1A 5AT1B 3HSBA 3CMET 2VKNA 4PJNA 5GAN4 1KK7A 2DXTA 2HZYA 3VS4A 2AT1B 4KH0B 4ZN3A 5KYUB 3QKJA 2YUPA 4C8QB 3L2ZA 3OYHA 4IKFA 4M75D 5HCKA 4BI4A 3QPHA 3META 1X6OA 4CI0C 1D1BA 5DM7R 1K0XA 3JB9F 1X01A 2DBKA 1K4US 2EYYA 2MOXA 2V8JA 1TUGB 6AT1B 3EG0A 4FCYA 4C5EA 4J7FA 4R56A 2DIGA 1AZGB 1YHQA 1N8RR 1D0ZA 3QUIA 2OI3A 1PRLC 3TEEA 1YI2Q 3G71T 1VQLA 3N5BB 2DL7A 2PUOB 3PIOA 1OULA 2F69A 1RAIB 2R57A 2DO3A 4XU0A 2QYZA 4ANJA 3L42A 2X51A 2HSPA 3NPFA 1K8AU 2NUPA 2D0NA 5J39A 3OW2A 3I35A 4B6MA 3L1AA 1TUCA 3VU3C 3IQLA 1VQLQ 3QZ9B 1GXIE 3NGPA 4RTXA 1ZLMA 1K9AA 1KD1U 1GRIA 3GBQA 1UGSB 1HJDA 3V7RA 3VS6A 4PL6A 3SWNA 2I2LA 4QVDA 1GCQC 2LQ8A 3D7SB 3OYBA 1I81A 2AHJB 3OBYA 4GLMA 3GLXA 3OS5A 2YT6A 2CZ0B 1M1KU 3VV0A 4E6RA 2ED1A 3TU4K 2LJ0A 2JZ2A 4M78D 3TSWA 1TOVA 1VQ6T 2GTJA 3OMGA 3CD6T 2ENMA 4HT9A 3VRZA 2EQIA 4IUPA 2JOYA 1K76A 1YITQ 3TCJA 1OPLA 4BUGA 1VQNA 3PFSA 4J9HA 3OYDA 1U1TA 1M3AA 3CCQQ 3VYGA 1CKBA 2WSCE 4OGEA 4ZN1A 2JTMA 5LJ3f 3I55Q 2OJ2A 2MAMA 4M77B 3BDLA 2EJGA 2PU9B 3L2UA 3C94A 3LGFA 1ARKA 2GQVA 3SEMA 1OV3A 1QVPA 1B3QA 1PM3A 1VQNQ 1HSQA 1RABB 2NUZA 3I5SA 3BFMA 4C92F 1RADB 4RTYA 3QSUA 2KE9A 5ECAA 3GF5A 4F7UB 5GANd 1NEBA 4LE9A 1X6GA 2DBMA 2AKKA 1VQMA 1PKTA 3GNGA 3CCMA 4L5GA 2E41A 1FYNA 3H0FA 2O4XB 5FWCA 3UA6A 3NTIA 2SRCA 1KQ2A 3QXEB 4JUVA 2GF7A 1Y71A 4PJLA 3CC4A 2X3XD 3HFOA 1TS9A 3EHQA 3V7SA 3M56A 3JB9D 4RCBA 2XD0A 4M7DB 2A08A 3CCMQ 3OB9A 2J06A 1N9RA 3REBB 2E64A 3CCUT 4C92A 4C8QF 4BE0A 1V76A 2QQBA 1Y96B 2YSQA 1G8XA 1I8FA 3G6ET 1UGRB 2GBQA 5KH6A 1I4K1 1YFNA 5A0DA 1ZUYA 1D1CA 2D9TA 4XK8E 1WPYA 1MNDA 5IH2A 2C0TA 1YITT 1JB0E 1VQ4T 1M90U 5GMKl 3DLMA 1D0YA 3S3MA 2EJ9A 3QZ5B 2DYBA 2DNUA 2DM1A 1HYOA 3VYHB 3CXCP 3ZFJA 2VV5A 2DF6A 2L5QA 4A53A 1NJIC 1N8RU 3BW1A 3OS1A 3UA7A 2RHUA 3HL8A 4C8QA 4NS5A 2W10A 2RM4A 3HPWA 5CAIA 5HK3A 2QGFB 2FPFA 4KT0E 1G3WA 4RTZA 4PJOB 4N4IA 4ATOA 5GANg 4L6V5 1YJNQ 2FVUA 2KROA 1V1CA 2COWA 2E1HA 2XMFA 4ME7A 1JXMA 1X69A 1SHFA 4LD6A 3RMQA 1UG1A 4LUDA 2DJZA 3LX7A 5LJ3h 4VUBA 4R55A 3REAB 4ZGJB 3FLGA 3PNWC 2EAYA 2CGHA 2P0QA 3OSSC 2YHTA 2DLPA 4Z89A 1E6HA 2ZPBB 1WA7A 2YRDA 3M0TA 3HHTB 5A0GA 1UE9A 2X35A 2JS0A 2M51A 1WI7A 2KXCA 5CQXA 3LH5A 1OX8A 2PQWA 1QCFA 3A1PA 1H92A 2EQJA 1KJWA 1IO6A 4M7AC 1B34B 2P0PA 2E6ZA 4BY6B 3SFMA 2OTLT 1WHLA 1TTHB 4J8OA 3X24B 2KRMA 4C92D 1SF9A 3CMAA 4DA4A 5L23A 1BB9A 3CCSA 5I2SA 1HK9A 1JJ2A 4M77F 3V7CA 1OZ2A 4A4GA 4BB7A 1FMKA 4Y28E 5FU6B 2PUKB 2PVDB 2EGEA 4MZTA 4F7UF 3CCSQ 1GFCA 1K9MU 1YJNT 1VQ8A 3EGUA 4PFOA 1ABQA 1D0XA 5CKDA 2GNCA 4M78B 4C8QD 2RK1A 2DL3A 2YWWA 5GAOn 3L2WA 1KIKA 3EG2A 4M77A 5IAYA 2CYZB 3VS0A 2COYA 3MPUB 2QASA 1D3BB 1K1ZA 5GANj 2LCCA 4M7DF 2EKOA 1VQ8Q 4MMKA 2JXBA 3MP1A 1G2BA 1VYUA 3M5AA 4XAXB 3OYLA 2DFUA 4F16A 1ZBJA 1BK2A 2P0KA 1VQ5T 5KYXA 3TSZA 2O88A 4OB1B 1IRXA 2VYTA 4F7UA 1HD3A 5LL6S 1RLPC 1QWEA 1VIFA 5GMKe 3CBPA 5GANf 2FG0A 1M9SA 2O4XA 3V8LA 5GMKi 4RMOA 1VQPA 3LW5E 2LT4A 3MO8A 1YNZA 4J5YA 3I56A 1S72T 1IHWA 2EYWA 2ZZDA 1N8RC 2F5TX 3M4GA 4M7DA 2LTOA 2RJDA 2F2XA 4F04B 3A8LB 4LDXA 2IPOB 3M54A 1QP2A 4ESRA 1ZA1B 1ZUKA 1YJWQ 1Y96A 2RPNA 1W2BS 5A2QE 5CKFA 5GAN6 4PJOF 1UFFA 2O01E 1M1FA 2XDDA 1QW1A 1FMVA 2IG0A 2HD0A 3G4SQ 3JCMe 3JCMV 4BE2A 1QVGS 1ZSZB 3A98A 1E6GA 2M0YA 1U3OA 4C0DC 2ZPEB 4M75F 1G83A 2MMPA 1K8AR 2DA9A 3HP9A 1ZX6A 3M58A 2HNIA 2X4YA 4X1VA 2DK3A 2QAZA 2QDYB 2VWFA 1KD1R 1AWJA 1M4ZA 1KQ1A 1O9SA 5IXBA 4PJOA 2X3WD 3UF4A 4V2SA 1BI0A 2R58A 2JW4A 5LJ5e 4BI8B 4M77D 2BZ8A 2RH2A 4QVCA 1M2VB 1DJ7B 2KR3A 5LJ5d 1JXOA 1UHFA 2K2VA 4M75A 1M1KR 2QG9B 3QYHB 3OYYA 3CMEQ 4OMPA 1YJ9T 1YBYA 1UTIA 3MEVA 3PVQA 1WQWA 4EMKA 1EFNA 5GAMe 1KQSA 2DMOA 5FROA 5CKHA 1N9SA 4GBQA 3GOXA 4J9IA 4A4HA 1TSFA 5KYWA 2RQTA 5GAMd 2YLCA 1MMGA 2CP0A 3G71A 1IREB 2QTVA 1YJWT 1VQKT 4C0ZA 3CQTA 5GANh 2KRSA 2BIVA 2PTKA 1B34A 4M7DD 4R0KA 2FB7A 2KXDA 5GAOq 2K2MA 4E7SA 5D6XA 4C92E 4A4FA 3RR6A 3P8HA 1W2BP 4M78F 4NOYA 5DLOA 3JSCA 5FW9A 3UPUA 3C0CA 1KC8U 3LWIA 1Q86U 4M4ZA 3QIIA 2KQWA 4AFQC 2VVKA 4E7LA 4RCCA 1QVGP 1AWOA 1JEGA 3T9NA 1NYGA 1I0CA 4KGVB 2LQKA 2HL5C 2RD1A 2V26A 1Q82U 2CSQA 1WNLA 2P4TA 1ZBXA 3CCJQ 5GAOr 4PLIA 2L0AA 2YDLA 5HY6A 4C8QE 1VOMA 4FYXB 1QCNA 4KUDK 2QQSA 4M78A 1KSWA 2OX7A 2EQKA 3X26B 3OW2S 3CD6A 1PD0A 2K6DA 2GCXA 4IIOA 2RI2A 4J9DA 1U8RA 1D3BA 4PJOD 2DRKA 4XU1A 2K3BA 2K9GA 3J7AF 1I5LA 3EFOB 2PNIA 4RTUA 4C5HA 1AEYA 4FSXA 1VQ6Q 2EIFA 5GAMg 2DD5A 3ER0A 1QCOA 5GMKj 3CD6Q 2GFAA 3UWNA 3QG1A 1YI2A 1IB8A 4NL2A 2CZ7B 4N0AC 1OZ3A 2ROTA 2LRQA 1WYXA 1M90R 2KAFA 2MPXC 2E4HA 5GAOm 3THKA 8AT1B 3I9QA 1XJWB 3R6OA 2V8IA 1UGPB 4MZMA 2DL4A 1NM7A 5L8RE 3LH0A 4M75C 5KCHA 1BI3A 4EMKC 1YIJT 4N4GA 3UT1A 4DBHA 3OYMA 4FT4A 2L3QA 2EWNA 2RB6A 4OMNA 1VA7A 3ME9A 4A4KA 2FHDA 1OU8A 2NUTB 1WHMA 2FYKA 1TWBA 3RBBB 3CCUA 3CCJT 2LP5A 2ESWA 3G1JA 3Q1JA 3G6EA 3VRYA 2HMAA 1RI9A 5FLXE 3MEWA 1PD1A 3GIBA 3VS7A 3JCMW 2D0QB 4AFSC 1QKWA 3V8KA 2KI7A 3CCUQ 4UC4A 5GAN3 3PGGA 1YITA 2KEAA 1OQKA 1VQ4A 3CPWA 3OW2P 4DOWA 2KVQG 3CC2Q 4ZGDB 3RKWA 3G6EQ 2DEQA 2DYIA 3CCQA 4Y91A 5LJ5j 1QVFS 1VQOT 4X9DA 4J9GA 4M77E 3J80E 3I55A 2KRNA 2MWOA 4C0FA 1N6AA 1VQ9Q 4JS5A 2QEXT 1VQ4Q 2BTTA 3A8MB 2V1RA 4M7AG 3FJ5A 3NTKA 2G6FX 5LJ5f 5GAMj 4XTWA 4F7UE 1K0SA 4M78C 2PVOB 4CC2A 4K11A 4BE1A 1WJRA 2H3JA 2XU8A 1ACMB 3M4YA 1QP3A 2CH4A 2LX9A 4F14A 2R5MA 1K9MR 3JV3A 5GAMf 2EPDA 2DL8A 4M7DE 2SEMA 4RUGA 4MMLA 4FYWB 1W1FA 2P84A 1BI1A 4LUEA 2EGCA 2MI6A 2D8JA 3E9GA 5GAN2 2WSEE 4FL6A 2GTOA 3KUFA 2ECZA 3NTHA 4OF1A 1YHQT 4JJDA 4XTYA 3EH2A 1M1GA 2A28A 2YXYA 4LDVA 3MJXA 2OTLA 1VQ7T 7AT1B 5C0MA 3VJPA 3X20B 3PIPA 2YUOA 1WXBA 3CC2T 1XOVA 3FIFA 1NG2A 2ZGWA 2QI2A 2D8HA 2E5KA 1X6BA 3M0RA 2AZVA 2NLUA 1MMAA 2DETA 2OTLQ 1RAFB 3CXCA 4FM4B 2DXCA 4IUQA 4MDWA 1QVFP 1VQ9T 4TVRA 2F5KA 4PJOE 1JBMA 1WLPB 4WTOB 2VASA 2DXUA 4RTWA 2YRCA 3SWNC 5CCAA 5IT9E 3EG3A 4RTVA 1YJNA 2RN8A 1G3YA 3EFOA 1K8AC 3EG9B 5KYUA 3TREA 3JRZA 3JAME 4L59A 4A4EA 3OS2A 4M75E 5KYYB 4IUUA 2E6NA 5GAOp 4E47A 3KXTA 1OI1A 4XTXA 1KD1C 4HCBA 2FEIA 4OMOA 1XTDA 3RESA 1D1AA 1SEMA 1JJ2S 1WXTA 3LLRA 4XQ3A 1RUWA 1VIEA 2QQ9A 1B07A 4P5NA 1VQ5A 4JRIA 1OPKA 1H641 2JS2A 2K3XA 4QKUA 1EZZB 3BE3A 2Y4XA 4J83A 4LD9K 1IXDA 1UHCA 1ZUUA 2LJ3A 2J6KA 1M1KC 1PNJA 2BZXA 2IIMA 1WJQA 3PVLA 4F17A 1YWPA 3NMZC 5CO7A 1RLQC 1VQ5Q 1OOTA 1X2KA 1T3SA 1S72A 3C95A 1ZSGA 3PTAA 1Q81U 1TXQA 3QWXX 4KGZB 2XICA 2EJFA 2JUFA 3LGLA 3VS1A 1WJSA 1JRIA 1WHHA 2NUTA 1M3BA 2ZAEA 1WHKA 2KT1A 2CZ1B 2QA4T 2E65A 2KGTA 2RJFA 2LNHB 2EYXA 1S72Q 3FRNA 4E7JA 1O75A 2X4XA 1MHNA 1MV3A 1PSFA 1QQJA 2RQRA 1UJ0A 1E7OA 2F2VA 4FYVB 5CR2A 1VYVA 2B86A 2XDBA 8ATCB 3M0UA 4JJNK 4M78E 4JJBA 5FRMA 3G7ZA 5FU7C 2K4YA 2HAXA 1GBRA 2HKNA 4KH1B 3CBMA 2E10A 2KNBB 4C92C 1G3TA 2XHCA 3CC7Q 2PZ1A 2JJ9A 3M0PA 1K73R 5CVIA 1YN8A 1KC8R 2DX1A 2JMAA 2QXFA 1Q86R 5CKBA 4JLGA 4BDYA 5KYNA 1W6XA 1UJYA 4PLLA 1JJ2P 1M5Q1 4GY5A 1YP5A 4J9BA 3RIRA 1Q82R 1Q7YU 3LWHA 1PSEA 3CCLT 1M30A 2LZ6B 1AWWA 5FRNA 1YJ9A 2H3EB 4C8QC 2QK0A 4AMCA 4XU2A 2CP3A 2K79A 5I2MA 9ATCB 2RHZA 5KE2A 1OU9A 1WIEA 1HXDA 2JM9A 3KFVA 4FU6A 1M90C 4KULA 3GNFB 4JZ4A 3CCRT 4PJJA 2FO0A 2CDTA 1YJWA 1YJ9Q 4IUVA 2C0OA 2V1QA 4N4HA 1VQKA 2CP7A 4JS4A 1T3LA 2EGAA 1TUDA 2JM8A 5EG2A 1OYXA 3X28B 2C06A 4EPCA 4RKUE 1TG0A 3DB3A 4BI3A 3G4SA 1M8VA 2FPEA 2OTJQ 4JLIA 1VQKQ 3QYGB 1N27A 4OB3B 5IHKA 3CCVT 2L3PA 2HEQA 1KQSS 4FW2A 4AFUC 4AT1B 2X4WA 2FZGB 4PKCC 2G3RA 4OB2B 2VUBA 4DOVA 3E9FA 3CC7T 5IHNA 2LQNA 2AKLA 3BDUA 2FZKB 1NEGA 3MEUA 3VS2A 3JCMd 5DLQE 3ASKA 3CBOA 2DVJA 1FXXA 3EG9A 2DJQA 3WVEB 3RDVA 4E7ZA 5J26A 1WX6A 4EIKA 2KYBA 2M9UA 2QGGA 3HRUA 4DQ2A 2GGRA 2KT8A 2O2OA 4KBMB 2CH4W 3OYKA 3CMEA 3H9NA 2GQIA 3JCMc 3FC3A 5GAOl 1LNXA 2EYZA 2O31A 1JQQA 3QDFA 4WCIA 4AG1C 2ZPGB 1Q95G 1Y57A 1RAGB 4OVAA 3CCET 5CQYA 1H3HA 3ZL7C 2P4RA 2EVRA 5I11A 1AOJA 1KHIA 4J6XA 2XKOC 1X75C 4M77C 3OMCA 5LJ3e 4LDYA 1NLPC 4D8DA 5GJWB 4J9FA 5LJ3d 1K9MC 2OTJT 1FX7A 4II1A 1UEBA 2DIQA 5C6SA 4MDXA 2YUNA 2DXBA 2HKQB 2HBWA 2J6FA 4C5IA 5HK0A 1U1SA 2BKDN 3H0IA 1GFDA 1I07A 1VQPT 2K5LA 1QVGA 5D7UA 5FWBA 1K73U 3JCMg 3CCJA 4DBQA 3I56T 1B7TA 2MF2A 1YIJQ 3EHRA 4M7AB 1MV0B 4AFZC 4LDUA 1XNIA 4M7DC 1AHJB 1UGQB 1GCQA 2F2WA 1ZHIA 5GAN5 4MZPA 4BACA 2B8AA 2KK4A 4QQDA 4C5GA 1U5SA 1AZEA 3RKXA 1RACB 3C12A 1NYFA 2JVVA 3BY7A 1BBZA 4KUIA 2DPPB 4J6YA 1ZQ1A 2LQWA 2CS7A 1VQOA 1VQ6A 2JTEA 3VUBA 1EX4A 5LJ5g 5KCOA 5A0LA 4DEXA 2A7YA 2FRWA 2XK0A 2QQAA 4Z8AA 2MIOA 3TQ7P 4EMHA 4IIMA 2QEXA 2HSEB 2OAWA 1G3SA 1SG5A 1VQOQ 2CKKA 1WHJA 2D6FA 1LVKA 1SKUB 4HVVA 1QMCA 4QVZA 1PG5B 3RERA 4PJOC 2QEXQ 2XIDA 2ZPHB 4OMFB 3CPWS 2DTIA 4EDUA 1IHVA 2RNAA 3JB9G 2COZA 1TU0B 3S3NA 2E5QA 2H8HA 4O6JA 2ROLA 1I5OB 2J7IA 3L2QA 4PK4A 1PWTA 4HXJA 1PKSA 4DBRA 3L2VA 4JRQA 3GPLA 1Y0MA 1R77A 2FZCB 2W0ZA 1IGQA 5I22A 1H8KA 2RJCA 5IN1A 4D6WA 3UATA 5IHIA 3ZBDA 2A0FB 1VQ7A 2RI3A 3M53A 4E2FB 3RUXA 5GAN7 2CP2A 2DKGA 1RI0A 2NWMA 2KBTA 1UB4A 3C4SA 4PNOA 1YCSB 3H0HA 3JB9J 1UDLA 1ZSZA 1SSHA 3CC2A 4BY6C 1WGSA 1NJIU 2RHIA 1YHQQ 4PFPA 2PVGB 3CPFA 2MWPA 4JRPA 1Q81R 3JB9H 2XG8D 1VQ7Q 1I1JA 2RMOA 3JCMf 2KMTA 4FT2A 1FWZA 4J9EA 1VQ9A 1SRLA 2RF0A 3OQ5A 3PMIA 4C0DB 4PFZA 2RO0A 2J6OA 5I21A 1A0NB 2DILA 4HCKA 5FU6C 3EG1A 4CC7A 2HL3A 4QT7A 1LCKA 3INZA 1PC0A 1Y7XA 1M2VA 1K73C 2FPDA 1KC8C 2X4JA 1Q86C 1UUEA 3E1SA 4QQ6A 3LYIA 1ABOA 2L2PA 3V8JA 5LJ3j 1TH7A 4ZGEB 3CPWP 4XTVA 4M7AF 2LC4A 3CXCS 1NE8A 3RMSA 1Q82C 3HFNA 1Z9QA 4AG2C 2D1XA 1BKBA 4QQGA 2L89A 5D6YA 3E19A 3E2UA 2RI5A 4B9WA 2E70A 3OYNA 4CC3A 4GLKA 4KRTA 1YI2T 1NPPA 4HVWA 4C92G
chains in the Genus database with same CATH topology
1MV3A 1G83A 1MUZA 2RQRA 1U06A 2VKNA 2DA9A 1UJ0A 1E7OA 2F2VA 3U23A 2EBPA 3VS4A 1SPKA 1ZX6A 2YUPA 2YUQA 4X1VA 1VYVA 2B86A 5GJVB 2VWFA 3M0UA 1AWJA 5HCKA 2LCSA 4JJBA 5IXBA 1GBRA 1K0XA 2X3WD 3UF4A 2DBKA 2AK5A 1K4US 2EYYA 2JW4A 2MOXA 2KNBB 4D8KA 2BZ8A 3EG0A 1AZGB 2PZ1A 2J05A 3M0PA 2OI3A 3O5ZA 1PRLC 2KR3A 1UGVA 1JXOA 1YN8A 1UHFA 1SHGA 2DX1A 2JMAA 2DL7A 4OMPA 1X27A 1UTIA 3PVQA 1W6XA 1UJYA 1EFNA 2DMOA 1YP5A 2HSPA 4J9BA 3NPFA 2LJ1A 4GBQA 2D0NA 4HVUA 4J9IA 2RQTA 3I35A 1M30A 2LZ6B 1AWWA 1TUCA 3IQLA 3SHWA 3NGPA 4RTXA 1ZLMA 1K9AA 1J3TA 1GRIA 3GBQA 3CQTA 2DRMA 1HJDA 2KRSA 2PTKA 2K79A 4R0KA 3VS6A 3M0QA 1WIEA 1GCQC 2KXDA 1M3CA 2K2MA 1X43A 2JM9A 3KFVA 4JZ4A 1WDXA 4GLMA 2FO0A 2CDTA 5FW9A 2C0OA 2L3SA 2V1QA 3C0CA 2YT6A 4M4ZA 2I0NA 4E6RA 1T3LA 2EGAA 1TUDA 2ED1A 2JM8A 4AFQC 4JPBW 4A63B 2HDAA 2VVKA 2JMCA 2LJ0A 3TSWA 1AWOA 1JEGA 1TG0A 1I0CA 1NYGA 2GTJA 2RQVA 1QLYA 2FPEA 2ENMA 2CSQA 3VRZA 2EQIA 5IHKA 1PRMC 1K76A 2L0AA 1OPLA 2L3PA 2HEQA 2YDLA 2O9VA 4AFUC 4J9HA 4ZNXA 2CUBA 1M3AA 1CKBA 1KSWA 2OJ2A 2M0YA 5IHNA 2K6DA 2LQNA 3QWYA 2AKLA 4IIOA 4J9DA 1W70A 4Z88A 2HCKA 1NEGA 1ARKA 2DRKA 3SEMA 3VS2A 1OV3A 2K3BA 1B3QA 2K9GA 1HSQA 1JU5C 2PNIA 4RTUA 2DVJA 1AEYA 2NUZA 3I5SA 2DJQA 3PE0A 1GCPA 3M0SA 1WX6A 4EIKA 4RTYA 2KE9A 5ECAA 4OMLA 1N5ZA 2KYBA 1NEBA 2GGRA 2KT8A 2O2OA 2QDLA 4LE9A 1X6GA 2DBMA 2AKKA 1PKTA 2CH4W 2ROTA 2RQWA 1FYNA 3H0FA 1WYXA 2GQIA 5FWCA 3UA6A 2SRCA 2EYZA 2O31A 1JQQA 2CT4A 4WCIA 4AG1C 1Y57A 4FSSA 3THKA 3I9QA 2X3XD 3EHQA 2DL4A 2A36A 1NM7A 2JT4A 1H3HA 3ZL7C 2A08A 2P4RA 2EVRA 2J06A 5I11A 3REBB 1AOJA 1PHTA 1CSKA 4OMQA 4JJCA 2YSQA 2O9SA 2L3QA 2A37A 2GBQA 4OMNA 1NLPC 4D8DA 1VA7A 4ORZA 2LMJA 5GJWB 1M27C 4J9FA 1ZUYA 3RBBB 2YUNA 1X2QA 2HBWA 3I5RA 2J6FA 2LP5A 5IH2A 2ESWA 2C0TA 2FRYA 1YWOA 3H0IA 1GFDA 3VRYA 2DYBA 2DNUA 2DM1A 1RI9A 1I07A 2DF6A 4LN2A 3VS7A 5FWBA 3UA7A 4AFSC 1QKWA 2W10A 2KEAA 3EHRA 3R6NA 1MV0B 4AFZC 1QWFA 1GCQA 2F2WA 1T0JA 2FPFA 4RTZA 1CKAA 2KROA 4J9GA 1V1CA 1U5SA 2LX7A 1AZEA 2KRNA 2XMFA 1AD5A 1VYTA 1JXMA 1X69A 1NYFA 1SHFA 1BBZA 1UG1A 2BTTA 4LUDA 2LQWA 2AZSA 2V1RA 2CREA 3FJ5A 2G6FX 3REAB 1K0SA 2JTEA 4CC2A 1WFWA 4JZ3A 4K11A 1AWXA 4DEXA 2FRWA 4DEYA 2ED0A 1NLOC 2RQUA 2MIOA 4Z8AA 2EW3A 4LNPA 2DLPA 4IIMA 3NHNA 2EKHA 1E6HA 4Z89A 1WA7A 2CH4A 4F14A 3M0TA 1GL5A 3JV3A 1T0HA 1UE9A 2JS0A 2OAWA 2EPDA 2M51A 1WI7A 2KXCA 2DL8A 3LH5A 1QCFA 2SEMA 1H92A 3RNJA 4RUGA 1KJWA 1IO6A 4J9CA 4HVVA 1JO8A 3VS5A 2ABLA 1W1FA 4LUEA 2KRMA 1KFZA 2BZYA 2EGCA 5L23A 1BB9A 1Z9ZA 2RNAA 2D8JA 2GTOA 2ECZA 2H8HA 4JJDA 2ROLA 2A28A 1FMKA 2J7IA 1PWTA 4HXJA 1PKSA 1QKXA 3VS3A 5IXFA 2YUOA 2EGEA 1Y0MA 1WXBA 2W0ZA 1XOVA 1GFCA 5I22A 1H8KA 2DL5A 2CUDA 1NG2A 3H41A 3UATA 5IHIA 3EGUA 2D8HA 2E5KA 1X6BA 3M0RA 1ABQA 2AZVA 5EC7A 1AVZC 1UECA 2GNCA 2DL3A 4Y92A 2NWMA 1KIKA 2KBTA 2C0IA 3EG2A 1GBQA 1YCSB 3H0HA 1UDLA 1WLPB 3VS0A 1SSHA 4RTWA 1K1ZA 2K7AA 3EG3A 4RTVA 1OEBA 2RN8A 1SRMA 2JXBA 2LNHB 1I1JA 1G2BA 1VYUA 2RMOA 4CC4B 4F16A 1ZBJA 1BK2A 2CT3A 3ULRB 4J9EA 3TSZA 2O88A 1HD3A 1SRLA 2RF0A 1RLPC 1QWEA 2FEIA 2FG0A 4OMOA 2J6OA 1SEMA 1WXTA 1A0NB 2DILA 4HCKA 1RUWA 3EG1A 4CC7A 1B07A 4QT7A 2DE0X 1LCKA 1YNZA 1OPKA 2JS2A 1M8MA 2MCNA 2EYWA 2FPDA 1UHCA 1ZUUA 1UUEA 2LJ3A 2J6KA 1PNJA 2BZXA 2IIMA 3PVLA 2F2XA 4F17A 4RTTA 1ABOA 1BU1A 1YWPA 2L2PA 3NMZC 4ESRA 1RLQC 2CSIA 1OOTA 1ZUKA 1X2KA 1T3SA 1ZSGA 2RPNA 3QWXX 1WXUA 1Z9QA 4AG2C 2KYMA 1S1NA 2D1XA 1UFFA 3VS1A 1M3BA 2KT1A 2KGTA 4CC3A 3TVTA 4OMMA 4KRTA 4HVWA 3A98A 1E6GA 2EYXA 1U3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MV3 A;  1G83 A;  1MUZ A;  2RQR A;  1U06 A;  2VKN A;  2DA9 A;  1UJ0 A;  1E7O A;  2F2V A;  3U23 A;  2EBP A;  3VS4 A;  1SPK A;  1ZX6 A;  2YUP A;  2YUQ A;  4X1V A;  1VYV A;  2B86 A;  5GJV B;  2VWF A;  3M0U A;  1AWJ A;  5HCK A;  2LCS A;  4JJB A;  5IXB A;  1GBR A;  1K0X A;  2X3W D;  3UF4 A;  2DBK A;  2AK5 A;  1K4U S;  2EYY A;  2JW4 A;  2MOX A;  2KNB B;  4D8K A;  2BZ8 A;  3EG0 A;  1AZG B;  2PZ1 A;  2J05 A;  3M0P A;  2OI3 A;  3O5Z A;  1PRL C;  2KR3 A;  1UGV A;  1JXO A;  1YN8 A;  1UHF A;  1SHG A;  2DX1 A;  2JMA A;  2DL7 A;  4OMP A;  1X27 A;  1UTI A;  3PVQ A;  1W6X A;  1UJY A;  1EFN A;  2DMO A;  1YP5 A;  2HSP A;  4J9B A;  3NPF A;  2LJ1 A;  4GBQ A;  2D0N A;  4HVU A;  4J9I A;  2RQT A;  3I35 A;  1M30 A;  2LZ6 B;  1AWW A;  1TUC A;  3IQL A;  3SHW A;  3NGP A;  4RTX A;  1ZLM A;  1K9A A;  1J3T A;  1GRI A;  3GBQ A;  3CQT A;  2DRM A;  1HJD A;  2KRS A;  2PTK A;  2K79 A;  4R0K A;  3VS6 A;  3M0Q A;  1WIE A;  1GCQ C;  2KXD A;  1M3C A;  2K2M A;  1X43 A;  2JM9 A;  3KFV A;  4JZ4 A;  1WDX A;  4GLM A;  2FO0 A;  2CDT A;  5FW9 A;  2C0O A;  2L3S A;  2V1Q A;  3C0C A;  2YT6 A;  4M4Z A;  2I0N A;  4E6R A;  1T3L A;  2EGA A;  1TUD A;  2ED1 A;  2JM8 A;  4AFQ C;  4JPB W;  4A63 B;  2HDA A;  2VVK A;  2JMC A;  2LJ0 A;  3TSW A;  1AWO A;  1JEG A;  1TG0 A;  1I0C A;  1NYG A;  2GTJ A;  2RQV A;  1QLY A;  2FPE A;  2ENM A;  2CSQ A;  3VRZ A;  2EQI A;  5IHK A;  1PRM C;  1K76 A;  2L0A A;  1OPL A;  2L3P A;  2HEQ A;  2YDL A;  2O9V A;  4AFU C;  4J9H A;  4ZNX A;  2CUB A;  1M3A A;  1CKB A;  1KSW A;  2OJ2 A;  2M0Y A;  5IHN A;  2K6D A;  2LQN A;  3QWY A;  2AKL A;  4IIO A;  4J9D A;  1W70 A;  4Z88 A;  2HCK A;  1NEG A;  1ARK A;  2DRK A;  3SEM A;  3VS2 A;  1OV3 A;  2K3B A;  1B3Q A;  2K9G A;  1HSQ A;  1JU5 C;  2PNI A;  4RTU A;  2DVJ A;  1AEY A;  2NUZ A;  3I5S A;  2DJQ A;  3PE0 A;  1GCP A;  3M0S A;  1WX6 A;  4EIK A;  4RTY A;  2KE9 A;  5ECA A;  4OML A;  1N5Z A;  2KYB A;  1NEB A;  2GGR A;  2KT8 A;  2O2O A;  2QDL A;  4LE9 A;  1X6G A;  2DBM A;  2AKK A;  1PKT A;  2CH4 W;  2ROT A;  2RQW A;  1FYN A;  3H0F A;  1WYX A;  2GQI A;  5FWC A;  3UA6 A;  2SRC A;  2EYZ A;  2O31 A;  1JQQ A;  2CT4 A;  4WCI A;  4AG1 C;  1Y57 A;  4FSS A;  3THK A;  3I9Q A;  2X3X D;  3EHQ A;  2DL4 A;  2A36 A;  1NM7 A;  2JT4 A;  1H3H A;  3ZL7 C;  2A08 A;  2P4R A;  2EVR A;  2J06 A;  5I11 A;  3REB B;  1AOJ A;  1PHT A;  1CSK A;  4OMQ A;  4JJC A;  2YSQ A;  2O9S A;  2L3Q A;  2A37 A;  2GBQ A;  4OMN A;  1NLP C;  4D8D A;  1VA7 A;  4ORZ A;  2LMJ A;  5GJW B;  1M27 C;  4J9F A;  1ZUY A;  3RBB B;  2YUN A;  1X2Q A;  2HBW A;  3I5R A;  2J6F A;  2LP5 A;  5IH2 A;  2ESW A;  2C0T A;  2FRY A;  1YWO A;  3H0I A;  1GFD A;  3VRY A;  2DYB A;  2DNU A;  2DM1 A;  1RI9 A;  1I07 A;  2DF6 A;  4LN2 A;  3VS7 A;  5FWB A;  3UA7 A;  4AFS C;  1QKW A;  2W10 A;  2KEA A;  3EHR A;  3R6N A;  1MV0 B;  4AFZ C;  1QWF A;  1GCQ A;  2F2W A;  1T0J A;  2FPF A;  4RTZ A;  1CKA A;  2KRO A;  4J9G A;  1V1C A;  1U5S A;  2LX7 A;  1AZE A;  2KRN A;  2XMF A;  1AD5 A;  1VYT A;  1JXM A;  1X69 A;  1NYF A;  1SHF A;  1BBZ A;  1UG1 A;  2BTT A;  4LUD A;  2LQW A;  2AZS A;  2V1R A;  2CRE A;  3FJ5 A;  2G6F X;  3REA B;  1K0S A;  2JTE A;  4CC2 A;  1WFW A;  4JZ3 A;  4K11 A;  1AWX A;  4DEX A;  2FRW A;  4DEY A;  2ED0 A;  1NLO C;  2RQU A;  2MIO A;  4Z8A A;  2EW3 A;  4LNP A;  2DLP A;  4IIM A;  3NHN A;  2EKH A;  1E6H A;  4Z89 A;  1WA7 A;  2CH4 A;  4F14 A;  3M0T A;  1GL5 A;  3JV3 A;  1T0H A;  1UE9 A;  2JS0 A;  2OAW A;  2EPD A;  2M51 A;  1WI7 A;  2KXC A;  2DL8 A;  3LH5 A;  1QCF A;  2SEM A;  1H92 A;  3RNJ A;  4RUG A;  1KJW A;  1IO6 A;  4J9C A;  4HVV A;  1JO8 A;  3VS5 A;  2ABL A;  1W1F A;  4LUE A;  2KRM A;  1KFZ A;  2BZY A;  2EGC A;  5L23 A;  1BB9 A;  1Z9Z A;  2RNA A;  2D8J A;  2GTO A;  2ECZ A;  2H8H A;  4JJD A;  2ROL A;  2A28 A;  1FMK A;  2J7I A;  1PWT A;  4HXJ A;  1PKS A;  1QKX A;  3VS3 A;  5IXF A;  2YUO A;  2EGE A;  1Y0M A;  1WXB A;  2W0Z A;  1XOV A;  1GFC A;  5I22 A;  1H8K A;  2DL5 A;  2CUD A;  1NG2 A;  3H41 A;  3UAT A;  5IHI A;  3EGU A;  2D8H A;  2E5K A;  1X6B A;  3M0R A;  1ABQ A;  2AZV A;  5EC7 A;  1AVZ C;  1UEC A;  2GNC A;  2DL3 A;  4Y92 A;  2NWM A;  1KIK A;  2KBT A;  2C0I A;  3EG2 A;  1GBQ A;  1YCS B;  3H0H A;  1UDL A;  1WLP B;  3VS0 A;  1SSH A;  4RTW A;  1K1Z A;  2K7A A;  3EG3 A;  4RTV A;  1OEB A;  2RN8 A;  1SRM A;  2JXB A;  2LNH B;  1I1J A;  1G2B A;  1VYU A;  2RMO A;  4CC4 B;  4F16 A;  1ZBJ A;  1BK2 A;  2CT3 A;  3ULR B;  4J9E A;  3TSZ A;  2O88 A;  1HD3 A;  1SRL A;  2RF0 A;  1RLP C;  1QWE A;  2FEI A;  2FG0 A;  4OMO A;  2J6O A;  1SEM A;  1WXT A;  1A0N B;  2DIL A;  4HCK A;  1RUW A;  3EG1 A;  4CC7 A;  1B07 A;  4QT7 A;  2DE0 X;  1LCK A;  1YNZ A;  1OPK A;  2JS2 A;  1M8M A;  2MCN A;  2EYW A;  2FPD A;  1UHC A;  1ZUU A;  1UUE A;  2LJ3 A;  2J6K A;  1PNJ A;  2BZX A;  2IIM A;  3PVL A;  2F2X A;  4F17 A;  4RTT A;  1ABO A;  1BU1 A;  1YWP A;  2L2P A;  3NMZ C;  4ESR A;  1RLQ C;  2CSI A;  1OOT A;  1ZUK A;  1X2K A;  1T3S A;  1ZSG A;  2RPN A;  3QWX X;  1WXU A;  1Z9Q A;  4AG2 C;  2KYM A;  1S1N A;  2D1X A;  1UFF A;  3VS1 A;  1M3B A;  2KT1 A;  2KGT A;  4CC3 A;  3TVT A;  4OMM A;  4KRT A;  4HVW A;  3A98 A;  1E6G A;  2EYX A;  1U3O A; 
#chains in the Genus database with same CATH topology
 1WHG A;  3A8O B;  2M1H A;  1MUZ A;  1U06 A;  2E12 A;  5GAN e;  1Q7Y R;  5CKE A;  3M9Q A;  3FJP A;  3U23 A;  5GMK h;  2EBP A;  5KE3 A;  1SPK A;  2RHX A;  3MKD A;  3L2R A;  2QA4 A;  2YUQ A;  2DVE A;  4PJM A;  3MP6 A;  5KYX B;  2LT1 A;  5GJV B;  4YTL A;  3OA6 A;  4M7A A;  2ZPF B;  1LOJ A;  2VGN A;  2LCS A;  2HQX A;  1BIB A;  2RHY A;  4X34 A;  3FDR A;  1VQL T;  2AK5 A;  2EQM A;  5D6W A;  2EYQ A;  4D8K A;  1BCM A;  2QA4 Q;  2QQR A;  4JRK A;  2J05 A;  3QO3 A;  1QVF A;  3SD4 A;  3O5Z A;  1WQ7 A;  4C8Q G;  1UGV A;  1SHG A;  4ELY C;  1VQM Q;  1NPR A;  2ATC B;  1X27 A;  5GAN 8;  4HCZ A;  3MEA A;  1F1B B;  3WVD B;  1ZSZ C;  2LJ1 A;  1V29 B;  4HVU A;  3CC4 Q;  3JCM h;  2WSF E;  2XDP A;  1KG1 A;  2MYS A;  2VXE A;  3SHW A;  2JTF A;  1J3T A;  3OBW A;  2Y90 A;  4KGX B;  2DRM A;  3HRS A;  3M0Q A;  4B9X A;  1M3C A;  2CP6 A;  1BIA A;  3CCL A;  3CCQ T;  2X9H A;  1X43 A;  3A5Z B;  4XU3 A;  1MGQ A;  1WDX A;  3I55 T;  4BD3 A;  2L3S A;  3MP8 A;  1BI2 A;  2I0N A;  5LJ5 h;  3OYI A;  2JN0 A;  4JPB W;  1VQN T;  4A63 B;  2HDA A;  3X25 B;  2JMC A;  3A8H B;  3CCL Q;  2RQV A;  3CCR A;  1QLY A;  3HRT A;  4OGC A;  4RG2 A;  1H3Z A;  1PRM C;  2M0O A;  2LDM A;  3KBG A;  5GAM h;  2O9V A;  5DY9 A;  3FB9 A;  4M75 B;  4ZNX A;  2CUB A;  2DEU A;  2DD4 A;  1IGU A;  2DAQ A;  1PCX A;  4EMK B;  3CCR Q;  4M7A D;  3QWY A;  3EGD B;  2HQE A;  1W70 A;  1VQM T;  4Z88 A;  2HCK A;  3CCV A;  3CCM T;  3OYJ A;  5KYW B;  4WF2 A;  2LCL A;  1JU5 C;  1NZ9 A;  3PE0 A;  3JCM b;  2DER A;  3AHU A;  1GCP A;  3CC7 A;  2CP5 A;  3M0S A;  4OML A;  1N5Z A;  3CC4 T;  1YCY A;  4Q5W A;  2QDL A;  2R5A A;  4IUT A;  1BCO A;  3CCV Q;  3OYC A;  4M77 G;  2RQW A;  2L3R A;  2VB6 A;  4E7I A;  3QJY A;  1WZO A;  4XTU A;  3JCM X;  2K3Y A;  3OYE A;  4HKE A;  2M02 A;  2CT4 A;  3EFS A;  3QJ6 A;  3M59 A;  4FW1 A;  5M9O A;  2NYS A;  5HKC A;  2A36 A;  1C6V X;  2JT4 A;  4F7U G;  3SB2 A;  2WAC A;  3M57 A;  4A54 A;  1PHT A;  1CSK A;  3CEY A;  3CMA Q;  2E3I A;  4OMQ A;  3EGX B;  4JJC A;  1ZA2 B;  2O9S A;  2VGM A;  3F70 A;  3CCE A;  2A37 A;  3JCM J;  4OP0 A;  4J6W A;  4LXC A;  4DBF A;  4ORZ A;  2LMJ A;  1M27 C;  4M7D G;  1X2Q A;  2RA2 A;  3I5R A;  2ZCF B;  2FRY A;  1YWO A;  3OSV A;  4O5V A;  5KYY A;  3PMT A;  1SSF A;  5CK9 A;  3CCE Q;  5GMK m;  1MMN A;  3JCM P;  4LN2 A;  3H6Z A;  1R0C B;  2OTJ A;  2BE9 B;  1RAH B;  4CRI A;  4LDW A;  3JCM Q;  1LPL A;  2DTH A;  4Z02 A;  3OY9 A;  3R6N A;  4NL3 A;  3MCA B;  1QWF A;  1FMW A;  3URG A;  1T0J A;  3OS0 A;  1CKA A;  3QHS A;  2LNV A;  4FIB A;  3SDZ A;  2LX7 A;  2L8D A;  2DZ9 A;  2K5I A;  1AD5 A;  1VYT A;  2KY9 A;  3EAE A;  3OYG A;  3HKS A;  2AZS A;  2CRE A;  2XI9 A;  1VQP Q;  4PJO G;  1WFW A;  4JZ3 A;  4DEY A;  1AWX A;  4QW2 A;  2ED0 A;  4OB0 B;  4EMG A;  1NLO C;  2RQU A;  3I56 Q;  2EW3 A;  4LNP A;  2NUP B;  3NHN A;  2EKH A;  3DKM A;  4RG8 A;  1W4S A;  1GL5 A;  4E7K A;  2Y4Y A;  1LJO A;  1T0H A;  3DB4 A;  1Q81 C;  3CMA T;  1MMD A;  2MK5 A;  4M75 G;  1Y07 A;  3CCS T;  2RK2 A;  3RNJ A;  3ZEH A;  4J9C A;  3S6W A;  2VXF A;  2BE7 D;  3O8V A;  3SWN B;  1KHC A;  2DTO A;  1JO8 A;  3VUZ A;  3VS5 A;  2ABL A;  2AIR B;  3UDC A;  3MHX A;  2K5F A;  4C0G A;  2VC8 A;  1NJI R;  1KFZ A;  1EIF A;  3VKI A;  1AT1 B;  2BZY A;  1Z9Z A;  3A8G B;  2A3L A;  1C1A A;  2KSS A;  2EFI A;  3GP8 A;  2RJE A;  4N0A A;  1VQ8 T;  4FYY B;  3S3O A;  3QDR B;  1QKX A;  3VS3 A;  5IXF A;  5CIU A;  2YRV A;  3PT9 A;  4ZTJ A;  4E7H A;  2E3H A;  3JB9 I;  2DL5 A;  4J7I A;  2CUD A;  3H41 A;  5EC7 A;  2DZC A;  1AVZ C;  1UEC A;  4HA8 A;  3HTR A;  3EFR A;  4M7A E;  1W2B A;  2LVM A;  1G5V A;  4Y92 A;  1YIJ A;  1VUB A;  2HBP A;  2C0I A;  2V8K A;  1GBQ A;  5J3B A;  3EGD A;  2K7A A;  1BYM A;  1OEB A;  1P92 A;  1C0M A;  1SRM A;  3P8D A;  1M2O A;  1Q7Y C;  4CC4 B;  2Z0W A;  1KQS P;  2HQH A;  2CT3 A;  3H8Z A;  3ULR B;  1RAA B;  1MNE A;  2GFU A;  4M78 G;  1R0B G;  1RL2 A;  3OYF A;  1OX9 A;  3AT1 B;  1NBE B;  1RAE B;  3G4S T;  3G71 Q;  2M16 A;  2DE0 X;  3NFC A;  1D09 B;  4HT8 A;  2QTX A;  1R8O B;  1M8M A;  2ZPI B;  2MCN A;  4JDS A;  4IUR A;  3DLL A;  5FU7 B;  4HCC A;  4X9C A;  3FEO A;  4RTT A;  1BU1 A;  3M55 A;  2OAU A;  4C92 B;  2BUD A;  2CSI A;  3EGX A;  1IZ6 A;  2JNG A;  4ZTF A;  2YLB A;  1XQH A;  1WXU A;  2FL7 A;  4BDZ A;  2KYM A;  1S1N A;  4XTZ A;  3WXM B;  4ELZ C;  2IVW A;  2EQU A;  3OYA A;  3RKY A;  3P8B B;  3J81 E;  5AYF A;  2F1L A;  3TVT A;  4OMM A;  5LJ3 g;  2CZ6 B;  2KDS A;  4FSS A;  3QBY A;  2K57 A;  3EH1 A;  5AT1 B;  3HSB A;  3CME T;  2VKN A;  4PJN A;  5GAN 4;  1KK7 A;  2DXT A;  2HZY A;  3VS4 A;  2AT1 B;  4KH0 B;  4ZN3 A;  5KYU B;  3QKJ A;  2YUP A;  4C8Q B;  3L2Z A;  3OYH A;  4IKF A;  4M75 D;  5HCK A;  4BI4 A;  3QPH A;  3MET A;  1X6O A;  4CI0 C;  1D1B A;  5DM7 R;  1K0X A;  3JB9 F;  1X01 A;  2DBK A;  1K4U S;  2EYY A;  2MOX A;  2V8J A;  1TUG B;  6AT1 B;  3EG0 A;  4FCY A;  4C5E A;  4J7F A;  4R56 A;  2DIG A;  1AZG B;  1YHQ A;  1N8R R;  1D0Z A;  3QUI A;  2OI3 A;  1PRL C;  3TEE A;  1YI2 Q;  3G71 T;  1VQL A;  3N5B B;  2DL7 A;  2PUO B;  3PIO A;  1OUL A;  2F69 A;  1RAI B;  2R57 A;  2DO3 A;  4XU0 A;  2QYZ A;  4ANJ A;  3L42 A;  2X51 A;  2HSP A;  3NPF A;  1K8A U;  2NUP A;  2D0N A;  5J39 A;  3OW2 A;  3I35 A;  4B6M A;  3L1A A;  1TUC A;  3VU3 C;  3IQL A;  1VQL Q;  3QZ9 B;  1GXI E;  3NGP A;  4RTX A;  1ZLM A;  1K9A A;  1KD1 U;  1GRI A;  3GBQ A;  1UGS B;  1HJD A;  3V7R A;  3VS6 A;  4PL6 A;  3SWN A;  2I2L A;  4QVD A;  1GCQ C;  2LQ8 A;  3D7S B;  3OYB A;  1I81 A;  2AHJ B;  3OBY A;  4GLM A;  3GLX A;  3OS5 A;  2YT6 A;  2CZ0 B;  1M1K U;  3VV0 A;  4E6R A;  2ED1 A;  3TU4 K;  2LJ0 A;  2JZ2 A;  4M78 D;  3TSW A;  1TOV A;  1VQ6 T;  2GTJ A;  3OMG A;  3CD6 T;  2ENM A;  4HT9 A;  3VRZ A;  2EQI A;  4IUP A;  2JOY A;  1K76 A;  1YIT Q;  3TCJ A;  1OPL A;  4BUG A;  1VQN A;  3PFS A;  4J9H A;  3OYD A;  1U1T A;  1M3A A;  3CCQ Q;  3VYG A;  1CKB A;  2WSC E;  4OGE A;  4ZN1 A;  2JTM A;  5LJ3 f;  3I55 Q;  2OJ2 A;  2MAM A;  4M77 B;  3BDL A;  2EJG A;  2PU9 B;  3L2U A;  3C94 A;  3LGF A;  1ARK A;  2GQV A;  3SEM A;  1OV3 A;  1QVP A;  1B3Q A;  1PM3 A;  1VQN Q;  1HSQ A;  1RAB B;  2NUZ A;  3I5S A;  3BFM A;  4C92 F;  1RAD B;  4RTY A;  3QSU A;  2KE9 A;  5ECA A;  3GF5 A;  4F7U B;  5GAN d;  1NEB A;  4LE9 A;  1X6G A;  2DBM A;  2AKK A;  1VQM A;  1PKT A;  3GNG A;  3CCM A;  4L5G A;  2E41 A;  1FYN A;  3H0F A;  2O4X B;  5FWC A;  3UA6 A;  3NTI A;  2SRC A;  1KQ2 A;  3QXE B;  4JUV A;  2GF7 A;  1Y71 A;  4PJL A;  3CC4 A;  2X3X D;  3HFO A;  1TS9 A;  3EHQ A;  3V7S A;  3M56 A;  3JB9 D;  4RCB A;  2XD0 A;  4M7D B;  2A08 A;  3CCM Q;  3OB9 A;  2J06 A;  1N9R A;  3REB B;  2E64 A;  3CCU T;  4C92 A;  4C8Q F;  4BE0 A;  1V76 A;  2QQB A;  1Y96 B;  2YSQ A;  1G8X A;  1I8F A;  3G6E T;  1UGR B;  2GBQ A;  5KH6 A;  1I4K 1;  1YFN A;  5A0D A;  1ZUY A;  1D1C A;  2D9T A;  4XK8 E;  1WPY A;  1MND A;  5IH2 A;  2C0T A;  1YIT T;  1JB0 E;  1VQ4 T;  1M90 U;  5GMK l;  3DLM A;  1D0Y A;  3S3M A;  2EJ9 A;  3QZ5 B;  2DYB A;  2DNU A;  2DM1 A;  1HYO A;  3VYH B;  3CXC P;  3ZFJ A;  2VV5 A;  2DF6 A;  2L5Q A;  4A53 A;  1NJI C;  1N8R U;  3BW1 A;  3OS1 A;  3UA7 A;  2RHU A;  3HL8 A;  4C8Q A;  4NS5 A;  2W10 A;  2RM4 A;  3HPW A;  5CAI A;  5HK3 A;  2QGF B;  2FPF A;  4KT0 E;  1G3W A;  4RTZ A;  4PJO B;  4N4I A;  4ATO A;  5GAN g;  4L6V 5;  1YJN Q;  2FVU A;  2KRO A;  1V1C A;  2COW A;  2E1H A;  2XMF A;  4ME7 A;  1JXM A;  1X69 A;  1SHF A;  4LD6 A;  3RMQ A;  1UG1 A;  4LUD A;  2DJZ A;  3LX7 A;  5LJ3 h;  4VUB A;  4R55 A;  3REA B;  4ZGJ B;  3FLG A;  3PNW C;  2EAY A;  2CGH A;  2P0Q A;  3OSS C;  2YHT A;  2DLP A;  4Z89 A;  1E6H A;  2ZPB B;  1WA7 A;  2YRD A;  3M0T A;  3HHT B;  5A0G A;  1UE9 A;  2X35 A;  2JS0 A;  2M51 A;  1WI7 A;  2KXC A;  5CQX A;  3LH5 A;  1OX8 A;  2PQW A;  1QCF A;  3A1P A;  1H92 A;  2EQJ A;  1KJW A;  1IO6 A;  4M7A C;  1B34 B;  2P0P A;  2E6Z A;  4BY6 B;  3SFM A;  2OTL T;  1WHL A;  1TTH B;  4J8O A;  3X24 B;  2KRM A;  4C92 D;  1SF9 A;  3CMA A;  4DA4 A;  5L23 A;  1BB9 A;  3CCS A;  5I2S A;  1HK9 A;  1JJ2 A;  4M77 F;  3V7C A;  1OZ2 A;  4A4G A;  4BB7 A;  1FMK A;  4Y28 E;  5FU6 B;  2PUK B;  2PVD B;  2EGE A;  4MZT A;  4F7U F;  3CCS Q;  1GFC A;  1K9M U;  1YJN T;  1VQ8 A;  3EGU A;  4PFO A;  1ABQ A;  1D0X A;  5CKD A;  2GNC A;  4M78 B;  4C8Q D;  2RK1 A;  2DL3 A;  2YWW A;  5GAO n;  3L2W A;  1KIK A;  3EG2 A;  4M77 A;  5IAY A;  2CYZ B;  3VS0 A;  2COY A;  3MPU B;  2QAS A;  1D3B B;  1K1Z A;  5GAN j;  2LCC A;  4M7D F;  2EKO A;  1VQ8 Q;  4MMK A;  2JXB A;  3MP1 A;  1G2B A;  1VYU A;  3M5A A;  4XAX B;  3OYL A;  2DFU A;  4F16 A;  1ZBJ A;  1BK2 A;  2P0K A;  1VQ5 T;  5KYX A;  3TSZ A;  2O88 A;  4OB1 B;  1IRX A;  2VYT A;  4F7U A;  1HD3 A;  5LL6 S;  1RLP C;  1QWE A;  1VIF A;  5GMK e;  3CBP A;  5GAN f;  2FG0 A;  1M9S A;  2O4X A;  3V8L A;  5GMK i;  4RMO A;  1VQP A;  3LW5 E;  2LT4 A;  3MO8 A;  1YNZ A;  4J5Y A;  3I56 A;  1S72 T;  1IHW A;  2EYW A;  2ZZD A;  1N8R C;  2F5T X;  3M4G A;  4M7D A;  2LTO A;  2RJD A;  2F2X A;  4F04 B;  3A8L B;  4LDX A;  2IPO B;  3M54 A;  1QP2 A;  4ESR A;  1ZA1 B;  1ZUK A;  1YJW Q;  1Y96 A;  2RPN A;  1W2B S;  5A2Q E;  5CKF A;  5GAN 6;  4PJO F;  1UFF A;  2O01 E;  1M1F A;  2XDD A;  1QW1 A;  1FMV A;  2IG0 A;  2HD0 A;  3G4S Q;  3JCM e;  3JCM V;  4BE2 A;  1QVG S;  1ZSZ B;  3A98 A;  1E6G A;  2M0Y A;  1U3O A;  4C0D C;  2ZPE B;  4M75 F;  1G83 A;  2MMP A;  1K8A R;  2DA9 A;  3HP9 A;  1ZX6 A;  3M58 A;  2HNI A;  2X4Y A;  4X1V A;  2DK3 A;  2QAZ A;  2QDY B;  2VWF A;  1KD1 R;  1AWJ A;  1M4Z A;  1KQ1 A;  1O9S A;  5IXB A;  4PJO A;  2X3W D;  3UF4 A;  4V2S A;  1BI0 A;  2R58 A;  2JW4 A;  5LJ5 e;  4BI8 B;  4M77 D;  2BZ8 A;  2RH2 A;  4QVC A;  1M2V B;  1DJ7 B;  2KR3 A;  5LJ5 d;  1JXO A;  1UHF A;  2K2V A;  4M75 A;  1M1K R;  2QG9 B;  3QYH B;  3OYY A;  3CME Q;  4OMP A;  1YJ9 T;  1YBY A;  1UTI A;  3MEV A;  3PVQ A;  1WQW A;  4EMK A;  1EFN A;  5GAM e;  1KQS A;  2DMO A;  5FRO A;  5CKH A;  1N9S A;  4GBQ A;  3GOX A;  4J9I A;  4A4H A;  1TSF A;  5KYW A;  2RQT A;  5GAM d;  2YLC A;  1MMG A;  2CP0 A;  3G71 A;  1IRE B;  2QTV A;  1YJW T;  1VQK T;  4C0Z A;  3CQT A;  5GAN h;  2KRS A;  2BIV A;  2PTK A;  1B34 A;  4M7D D;  4R0K A;  2FB7 A;  2KXD A;  5GAO q;  2K2M A;  4E7S A;  5D6X A;  4C92 E;  4A4F A;  3RR6 A;  3P8H A;  1W2B P;  4M78 F;  4NOY A;  5DLO A;  3JSC A;  5FW9 A;  3UPU A;  3C0C A;  1KC8 U;  3LWI A;  1Q86 U;  4M4Z A;  3QII A;  2KQW A;  4AFQ C;  2VVK A;  4E7L A;  4RCC A;  1QVG P;  1AWO A;  1JEG A;  3T9N A;  1NYG A;  1I0C A;  4KGV B;  2LQK A;  2HL5 C;  2RD1 A;  2V26 A;  1Q82 U;  2CSQ A;  1WNL A;  2P4T A;  1ZBX A;  3CCJ Q;  5GAO r;  4PLI A;  2L0A A;  2YDL A;  5HY6 A;  4C8Q E;  1VOM A;  4FYX B;  1QCN A;  4KUD K;  2QQS A;  4M78 A;  1KSW A;  2OX7 A;  2EQK A;  3X26 B;  3OW2 S;  3CD6 A;  1PD0 A;  2K6D A;  2GCX A;  4IIO A;  2RI2 A;  4J9D A;  1U8R A;  1D3B A;  4PJO D;  2DRK A;  4XU1 A;  2K3B A;  2K9G A;  3J7A F;  1I5L A;  3EFO B;  2PNI A;  4RTU A;  4C5H A;  1AEY A;  4FSX A;  1VQ6 Q;  2EIF A;  5GAM g;  2DD5 A;  3ER0 A;  1QCO A;  5GMK j;  3CD6 Q;  2GFA A;  3UWN A;  3QG1 A;  1YI2 A;  1IB8 A;  4NL2 A;  2CZ7 B;  4N0A C;  1OZ3 A;  2ROT A;  2LRQ A;  1WYX A;  1M90 R;  2KAF A;  2MPX C;  2E4H A;  5GAO m;  3THK A;  8AT1 B;  3I9Q A;  1XJW B;  3R6O A;  2V8I A;  1UGP B;  4MZM A;  2DL4 A;  1NM7 A;  5L8R E;  3LH0 A;  4M75 C;  5KCH A;  1BI3 A;  4EMK C;  1YIJ T;  4N4G A;  3UT1 A;  4DBH A;  3OYM A;  4FT4 A;  2L3Q A;  2EWN A;  2RB6 A;  4OMN A;  1VA7 A;  3ME9 A;  4A4K A;  2FHD A;  1OU8 A;  2NUT B;  1WHM A;  2FYK A;  1TWB A;  3RBB B;  3CCU A;  3CCJ T;  2LP5 A;  2ESW A;  3G1J A;  3Q1J A;  3G6E A;  3VRY A;  2HMA A;  1RI9 A;  5FLX E;  3MEW A;  1PD1 A;  3GIB A;  3VS7 A;  3JCM W;  2D0Q B;  4AFS C;  1QKW A;  3V8K A;  2KI7 A;  3CCU Q;  4UC4 A;  5GAN 3;  3PGG A;  1YIT A;  2KEA A;  1OQK A;  1VQ4 A;  3CPW A;  3OW2 P;  4DOW A;  2KVQ G;  3CC2 Q;  4ZGD B;  3RKW A;  3G6E Q;  2DEQ A;  2DYI A;  3CCQ A;  4Y91 A;  5LJ5 j;  1QVF S;  1VQO T;  4X9D A;  4J9G A;  4M77 E;  3J80 E;  3I55 A;  2KRN A;  2MWO A;  4C0F A;  1N6A A;  1VQ9 Q;  4JS5 A;  2QEX T;  1VQ4 Q;  2BTT A;  3A8M B;  2V1R A;  4M7A G;  3FJ5 A;  3NTK A;  2G6F X;  5LJ5 f;  5GAM j;  4XTW A;  4F7U E;  1K0S A;  4M78 C;  2PVO B;  4CC2 A;  4K11 A;  4BE1 A;  1WJR A;  2H3J A;  2XU8 A;  1ACM B;  3M4Y A;  1QP3 A;  2CH4 A;  2LX9 A;  4F14 A;  2R5M A;  1K9M R;  3JV3 A;  5GAM f;  2EPD A;  2DL8 A;  4M7D E;  2SEM A;  4RUG A;  4MML A;  4FYW B;  1W1F A;  2P84 A;  1BI1 A;  4LUE A;  2EGC A;  2MI6 A;  2D8J A;  3E9G A;  5GAN 2;  2WSE E;  4FL6 A;  2GTO A;  3KUF A;  2ECZ A;  3NTH A;  4OF1 A;  1YHQ T;  4JJD A;  4XTY A;  3EH2 A;  1M1G A;  2A28 A;  2YXY A;  4LDV A;  3MJX A;  2OTL A;  1VQ7 T;  7AT1 B;  5C0M A;  3VJP A;  3X20 B;  3PIP A;  2YUO A;  1WXB A;  3CC2 T;  1XOV A;  3FIF A;  1NG2 A;  2ZGW A;  2QI2 A;  2D8H A;  2E5K A;  1X6B A;  3M0R A;  2AZV A;  2NLU A;  1MMA A;  2DET A;  2OTL Q;  1RAF B;  3CXC A;  4FM4 B;  2DXC A;  4IUQ A;  4MDW A;  1QVF P;  1VQ9 T;  4TVR A;  2F5K A;  4PJO E;  1JBM A;  1WLP B;  4WTO B;  2VAS A;  2DXU A;  4RTW A;  2YRC A;  3SWN C;  5CCA A;  5IT9 E;  3EG3 A;  4RTV A;  1YJN A;  2RN8 A;  1G3Y A;  3EFO A;  1K8A C;  3EG9 B;  5KYU A;  3TRE A;  3JRZ A;  3JAM E;  4L59 A;  4A4E A;  3OS2 A;  4M75 E;  5KYY B;  4IUU A;  2E6N A;  5GAO p;  4E47 A;  3KXT A;  1OI1 A;  4XTX A;  1KD1 C;  4HCB A;  2FEI A;  4OMO A;  1XTD A;  3RES A;  1D1A A;  1SEM A;  1JJ2 S;  1WXT A;  3LLR A;  4XQ3 A;  1RUW A;  1VIE A;  2QQ9 A;  1B07 A;  4P5N A;  1VQ5 A;  4JRI A;  1OPK A;  1H64 1;  2JS2 A;  2K3X A;  4QKU A;  1EZZ B;  3BE3 A;  2Y4X A;  4J83 A;  4LD9 K;  1IXD A;  1UHC A;  1ZUU A;  2LJ3 A;  2J6K A;  1M1K C;  1PNJ A;  2BZX A;  2IIM A;  1WJQ A;  3PVL A;  4F17 A;  1YWP A;  3NMZ C;  5CO7 A;  1RLQ C;  1VQ5 Q;  1OOT A;  1X2K A;  1T3S A;  1S72 A;  3C95 A;  1ZSG A;  3PTA A;  1Q81 U;  1TXQ A;  3QWX X;  4KGZ B;  2XIC A;  2EJF A;  2JUF A;  3LGL A;  3VS1 A;  1WJS A;  1JRI A;  1WHH A;  2NUT A;  1M3B A;  2ZAE A;  1WHK A;  2KT1 A;  2CZ1 B;  2QA4 T;  2E65 A;  2KGT A;  2RJF A;  2LNH B;  2EYX A;  1S72 Q;  3FRN A;  4E7J A;  1O75 A;  2X4X A;  1MHN A;  1MV3 A;  1PSF A;  1QQJ A;  2RQR A;  1UJ0 A;  1E7O A;  2F2V A;  4FYV B;  5CR2 A;  1VYV A;  2B86 A;  2XDB A;  8ATC B;  3M0U A;  4JJN K;  4M78 E;  4JJB A;  5FRM A;  3G7Z A;  5FU7 C;  2K4Y A;  2HAX A;  1GBR A;  2HKN A;  4KH1 B;  3CBM A;  2E10 A;  2KNB B;  4C92 C;  1G3T A;  2XHC A;  3CC7 Q;  2PZ1 A;  2JJ9 A;  3M0P A;  1K73 R;  5CVI A;  1YN8 A;  1KC8 R;  2DX1 A;  2JMA A;  2QXF A;  1Q86 R;  5CKB A;  4JLG A;  4BDY A;  5KYN A;  1W6X A;  1UJY A;  4PLL A;  1JJ2 P;  1M5Q 1;  4GY5 A;  1YP5 A;  4J9B A;  3RIR A;  1Q82 R;  1Q7Y U;  3LWH A;  1PSE A;  3CCL T;  1M30 A;  2LZ6 B;  1AWW A;  5FRN A;  1YJ9 A;  2H3E B;  4C8Q C;  2QK0 A;  4AMC A;  4XU2 A;  2CP3 A;  2K79 A;  5I2M A;  9ATC B;  2RHZ A;  5KE2 A;  1OU9 A;  1WIE A;  1HXD A;  2JM9 A;  3KFV A;  4FU6 A;  1M90 C;  4KUL A;  3GNF B;  4JZ4 A;  3CCR T;  4PJJ A;  2FO0 A;  2CDT A;  1YJW A;  1YJ9 Q;  4IUV A;  2C0O A;  2V1Q A;  4N4H A;  1VQK A;  2CP7 A;  4JS4 A;  1T3L A;  2EGA A;  1TUD A;  2JM8 A;  5EG2 A;  1OYX A;  3X28 B;  2C06 A;  4EPC A;  4RKU E;  1TG0 A;  3DB3 A;  4BI3 A;  3G4S A;  1M8V A;  2FPE A;  2OTJ Q;  4JLI A;  1VQK Q;  3QYG B;  1N27 A;  4OB3 B;  5IHK A;  3CCV T;  2L3P A;  2HEQ A;  1KQS S;  4FW2 A;  4AFU C;  4AT1 B;  2X4W A;  2FZG B;  4PKC C;  2G3R A;  4OB2 B;  2VUB A;  4DOV A;  3E9F A;  3CC7 T;  5IHN A;  2LQN A;  2AKL A;  3BDU A;  2FZK B;  1NEG A;  3MEU A;  3VS2 A;  3JCM d;  5DLQ E;  3ASK A;  3CBO A;  2DVJ A;  1FXX A;  3EG9 A;  2DJQ A;  3WVE B;  3RDV A;  4E7Z A;  5J26 A;  1WX6 A;  4EIK A;  2KYB A;  2M9U A;  2QGG A;  3HRU A;  4DQ2 A;  2GGR A;  2KT8 A;  2O2O A;  4KBM B;  2CH4 W;  3OYK A;  3CME A;  3H9N A;  2GQI A;  3JCM c;  3FC3 A;  5GAO l;  1LNX A;  2EYZ A;  2O31 A;  1JQQ A;  3QDF A;  4WCI A;  4AG1 C;  2ZPG B;  1Q95 G;  1Y57 A;  1RAG B;  4OVA A;  3CCE T;  5CQY A;  1H3H A;  3ZL7 C;  2P4R A;  2EVR A;  5I11 A;  1AOJ A;  1KHI A;  4J6X A;  2XKO C;  1X75 C;  4M77 C;  3OMC A;  5LJ3 e;  4LDY A;  1NLP C;  4D8D A;  5GJW B;  4J9F A;  5LJ3 d;  1K9M C;  2OTJ T;  1FX7 A;  4II1 A;  1UEB A;  2DIQ A;  5C6S A;  4MDX A;  2YUN A;  2DXB A;  2HKQ B;  2HBW A;  2J6F A;  4C5I A;  5HK0 A;  1U1S A;  2BKD N;  3H0I A;  1GFD A;  1I07 A;  1VQP T;  2K5L A;  1QVG A;  5D7U A;  5FWB A;  1K73 U;  3JCM g;  3CCJ A;  4DBQ A;  3I56 T;  1B7T A;  2MF2 A;  1YIJ Q;  3EHR A;  4M7A B;  1MV0 B;  4AFZ C;  4LDU A;  1XNI A;  4M7D C;  1AHJ B;  1UGQ B;  1GCQ A;  2F2W A;  1ZHI A;  5GAN 5;  4MZP A;  4BAC A;  2B8A A;  2KK4 A;  4QQD A;  4C5G A;  1U5S A;  1AZE A;  3RKX A;  1RAC B;  3C12 A;  1NYF A;  2JVV A;  3BY7 A;  1BBZ A;  4KUI A;  2DPP B;  4J6Y A;  1ZQ1 A;  2LQW A;  2CS7 A;  1VQO A;  1VQ6 A;  2JTE A;  3VUB A;  1EX4 A;  5LJ5 g;  5KCO A;  5A0L A;  4DEX A;  2A7Y A;  2FRW A;  2XK0 A;  2QQA A;  4Z8A A;  2MIO A;  3TQ7 P;  4EMH A;  4IIM A;  2QEX A;  2HSE B;  2OAW A;  1G3S A;  1SG5 A;  1VQO Q;  2CKK A;  1WHJ A;  2D6F A;  1LVK A;  1SKU B;  4HVV A;  1QMC A;  4QVZ A;  1PG5 B;  3RER A;  4PJO C;  2QEX Q;  2XID A;  2ZPH B;  4OMF B;  3CPW S;  2DTI A;  4EDU A;  1IHV A;  2RNA A;  3JB9 G;  2COZ A;  1TU0 B;  3S3N A;  2E5Q A;  2H8H A;  4O6J A;  2ROL A;  1I5O B;  2J7I A;  3L2Q A;  4PK4 A;  1PWT A;  4HXJ A;  1PKS A;  4DBR A;  3L2V A;  4JRQ A;  3GPL A;  1Y0M A;  1R77 A;  2FZC B;  2W0Z A;  1IGQ A;  5I22 A;  1H8K A;  2RJC A;  5IN1 A;  4D6W A;  3UAT A;  5IHI A;  3ZBD A;  2A0F B;  1VQ7 A;  2RI3 A;  3M53 A;  4E2F B;  3RUX A;  5GAN 7;  2CP2 A;  2DKG A;  1RI0 A;  2NWM A;  2KBT A;  1UB4 A;  3C4S A;  4PNO A;  1YCS B;  3H0H A;  3JB9 J;  1UDL A;  1ZSZ A;  1SSH A;  3CC2 A;  4BY6 C;  1WGS A;  1NJI U;  2RHI A;  1YHQ Q;  4PFP A;  2PVG B;  3CPF A;  2MWP A;  4JRP A;  1Q81 R;  3JB9 H;  2XG8 D;  1VQ7 Q;  1I1J A;  2RMO A;  3JCM f;  2KMT A;  4FT2 A;  1FWZ A;  4J9E A;  1VQ9 A;  1SRL A;  2RF0 A;  3OQ5 A;  3PMI A;  4C0D B;  4PFZ A;  2RO0 A;  2J6O A;  5I21 A;  1A0N B;  2DIL A;  4HCK A;  5FU6 C;  3EG1 A;  4CC7 A;  2HL3 A;  4QT7 A;  1LCK A;  3INZ A;  1PC0 A;  1Y7X A;  1M2V A;  1K73 C;  2FPD A;  1KC8 C;  2X4J A;  1Q86 C;  1UUE A;  3E1S A;  4QQ6 A;  3LYI A;  1ABO A;  2L2P A;  3V8J A;  5LJ3 j;  1TH7 A;  4ZGE B;  3CPW P;  4XTV A;  4M7A F;  2LC4 A;  3CXC S;  1NE8 A;  3RMS A;  1Q82 C;  3HFN A;  1Z9Q A;  4AG2 C;  2D1X A;  1BKB A;  4QQG A;  2L89 A;  5D6Y A;  3E19 A;  3E2U A;  2RI5 A;  4B9W A;  2E70 A;  3OYN A;  4CC3 A;  4GLK A;  4KRT A;  1YI2 T;  1NPP A;  4HVW A;  4C92 G; 
#chains in the Genus database with same CATH homology
 1MV3 A;  1G83 A;  1MUZ A;  2RQR A;  1U06 A;  2VKN A;  2DA9 A;  1UJ0 A;  1E7O A;  2F2V A;  3U23 A;  2EBP A;  3VS4 A;  1SPK A;  1ZX6 A;  2YUP A;  2YUQ A;  4X1V A;  1VYV A;  2B86 A;  5GJV B;  2VWF A;  3M0U A;  1AWJ A;  5HCK A;  2LCS A;  4JJB A;  5IXB A;  1GBR A;  1K0X A;  2X3W D;  3UF4 A;  2DBK A;  2AK5 A;  1K4U S;  2EYY A;  2JW4 A;  2MOX A;  2KNB B;  4D8K A;  2BZ8 A;  3EG0 A;  1AZG B;  2PZ1 A;  2J05 A;  3M0P A;  2OI3 A;  3O5Z A;  1PRL C;  2KR3 A;  1UGV A;  1JXO A;  1YN8 A;  1UHF A;  1SHG A;  2DX1 A;  2JMA A;  2DL7 A;  4OMP A;  1X27 A;  1UTI A;  3PVQ A;  1W6X A;  1UJY A;  1EFN A;  2DMO A;  1YP5 A;  2HSP A;  4J9B A;  3NPF A;  2LJ1 A;  4GBQ A;  2D0N A;  4HVU A;  4J9I A;  2RQT A;  3I35 A;  1M30 A;  2LZ6 B;  1AWW A;  1TUC A;  3IQL A;  3SHW A;  3NGP A;  4RTX A;  1ZLM A;  1K9A A;  1J3T A;  1GRI A;  3GBQ A;  3CQT A;  2DRM A;  1HJD A;  2KRS A;  2PTK A;  2K79 A;  4R0K A;  3VS6 A;  3M0Q A;  1WIE A;  1GCQ C;  2KXD A;  1M3C A;  2K2M A;  1X43 A;  2JM9 A;  3KFV A;  4JZ4 A;  1WDX A;  4GLM A;  2FO0 A;  2CDT A;  5FW9 A;  2C0O A;  2L3S A;  2V1Q A;  3C0C A;  2YT6 A;  4M4Z A;  2I0N A;  4E6R A;  1T3L A;  2EGA A;  1TUD A;  2ED1 A;  2JM8 A;  4AFQ C;  4JPB W;  4A63 B;  2HDA A;  2VVK A;  2JMC A;  2LJ0 A;  3TSW A;  1AWO A;  1JEG A;  1TG0 A;  1I0C A;  1NYG A;  2GTJ A;  2RQV A;  1QLY A;  2FPE A;  2ENM A;  2CSQ A;  3VRZ A;  2EQI A;  5IHK A;  1PRM C;  1K76 A;  2L0A A;  1OPL A;  2L3P A;  2HEQ A;  2YDL A;  2O9V A;  4AFU C;  4J9H A;  4ZNX A;  2CUB A;  1M3A A;  1CKB A;  1KSW A;  2OJ2 A;  2M0Y A;  5IHN A;  2K6D A;  2LQN A;  3QWY A;  2AKL A;  4IIO A;  4J9D A;  1W70 A;  4Z88 A;  2HCK A;  1NEG A;  1ARK A;  2DRK A;  3SEM A;  3VS2 A;  1OV3 A;  2K3B A;  1B3Q A;  2K9G A;  1HSQ A;  1JU5 C;  2PNI A;  4RTU A;  2DVJ A;  1AEY A;  2NUZ A;  3I5S A;  2DJQ A;  3PE0 A;  1GCP A;  3M0S A;  1WX6 A;  4EIK A;  4RTY A;  2KE9 A;  5ECA A;  4OML A;  1N5Z A;  2KYB A;  1NEB A;  2GGR A;  2KT8 A;  2O2O A;  2QDL A;  4LE9 A;  1X6G A;  2DBM A;  2AKK A;  1PKT A;  2CH4 W;  2ROT A;  2RQW A;  1FYN A;  3H0F A;  1WYX A;  2GQI A;  5FWC A;  3UA6 A;  2SRC A;  2EYZ A;  2O31 A;  1JQQ A;  2CT4 A;  4WCI A;  4AG1 C;  1Y57 A;  4FSS A;  3THK A;  3I9Q A;  2X3X D;  3EHQ A;  2DL4 A;  2A36 A;  1NM7 A;  2JT4 A;  1H3H A;  3ZL7 C;  2A08 A;  2P4R A;  2EVR A;  2J06 A;  5I11 A;  3REB B;  1AOJ A;  1PHT A;  1CSK A;  4OMQ A;  4JJC A;  2YSQ A;  2O9S A;  2L3Q A;  2A37 A;  2GBQ A;  4OMN A;  1NLP C;  4D8D A;  1VA7 A;  4ORZ A;  2LMJ A;  5GJW B;  1M27 C;  4J9F A;  1ZUY A;  3RBB B;  2YUN A;  1X2Q A;  2HBW A;  3I5R A;  2J6F A;  2LP5 A;  5IH2 A;  2ESW A;  2C0T A;  2FRY A;  1YWO A;  3H0I A;  1GFD A;  3VRY A;  2DYB A;  2DNU A;  2DM1 A;  1RI9 A;  1I07 A;  2DF6 A;  4LN2 A;  3VS7 A;  5FWB A;  3UA7 A;  4AFS C;  1QKW A;  2W10 A;  2KEA A;  3EHR A;  3R6N A;  1MV0 B;  4AFZ C;  1QWF A;  1GCQ A;  2F2W A;  1T0J A;  2FPF A;  4RTZ A;  1CKA A;  2KRO A;  4J9G A;  1V1C A;  1U5S A;  2LX7 A;  1AZE A;  2KRN A;  2XMF A;  1AD5 A;  1VYT A;  1JXM A;  1X69 A;  1NYF A;  1SHF A;  1BBZ A;  1UG1 A;  2BTT A;  4LUD A;  2LQW A;  2AZS A;  2V1R A;  2CRE A;  3FJ5 A;  2G6F X;  3REA B;  1K0S A;  2JTE A;  4CC2 A;  1WFW A;  4JZ3 A;  4K11 A;  1AWX A;  4DEX A;  2FRW A;  4DEY A;  2ED0 A;  1NLO C;  2RQU A;  2MIO A;  4Z8A A;  2EW3 A;  4LNP A;  2DLP A;  4IIM A;  3NHN A;  2EKH A;  1E6H A;  4Z89 A;  1WA7 A;  2CH4 A;  4F14 A;  3M0T A;  1GL5 A;  3JV3 A;  1T0H A;  1UE9 A;  2JS0 A;  2OAW A;  2EPD A;  2M51 A;  1WI7 A;  2KXC A;  2DL8 A;  3LH5 A;  1QCF A;  2SEM A;  1H92 A;  3RNJ A;  4RUG A;  1KJW A;  1IO6 A;  4J9C A;  4HVV A;  1JO8 A;  3VS5 A;  2ABL A;  1W1F A;  4LUE A;  2KRM A;  1KFZ A;  2BZY A;  2EGC A;  5L23 A;  1BB9 A;  1Z9Z A;  2RNA A;  2D8J A;  2GTO A;  2ECZ A;  2H8H A;  4JJD A;  2ROL A;  2A28 A;  1FMK A;  2J7I A;  1PWT A;  4HXJ A;  1PKS A;  1QKX A;  3VS3 A;  5IXF A;  2YUO A;  2EGE A;  1Y0M A;  1WXB A;  2W0Z A;  1XOV A;  1GFC A;  5I22 A;  1H8K A;  2DL5 A;  2CUD A;  1NG2 A;  3H41 A;  3UAT A;  5IHI A;  3EGU A;  2D8H A;  2E5K A;  1X6B A;  3M0R A;  1ABQ A;  2AZV A;  5EC7 A;  1AVZ C;  1UEC A;  2GNC A;  2DL3 A;  4Y92 A;  2NWM A;  1KIK A;  2KBT A;  2C0I A;  3EG2 A;  1GBQ A;  1YCS B;  3H0H A;  1UDL A;  1WLP B;  3VS0 A;  1SSH A;  4RTW A;  1K1Z A;  2K7A A;  3EG3 A;  4RTV A;  1OEB A;  2RN8 A;  1SRM A;  2JXB A;  2LNH B;  1I1J A;  1G2B A;  1VYU A;  2RMO A;  4CC4 B;  4F16 A;  1ZBJ A;  1BK2 A;  2CT3 A;  3ULR B;  4J9E A;  3TSZ A;  2O88 A;  1HD3 A;  1SRL A;  2RF0 A;  1RLP C;  1QWE A;  2FEI A;  2FG0 A;  4OMO A;  2J6O A;  1SEM A;  1WXT A;  1A0N B;  2DIL A;  4HCK A;  1RUW A;  3EG1 A;  4CC7 A;  1B07 A;  4QT7 A;  2DE0 X;  1LCK A;  1YNZ A;  1OPK A;  2JS2 A;  1M8M A;  2MCN A;  2EYW A;  2FPD A;  1UHC A;  1ZUU A;  1UUE A;  2LJ3 A;  2J6K A;  1PNJ A;  2BZX A;  2IIM A;  3PVL A;  2F2X A;  4F17 A;  4RTT A;  1ABO A;  1BU1 A;  1YWP A;  2L2P A;  3NMZ C;  4ESR A;  1RLQ C;  2CSI A;  1OOT A;  1ZUK A;  1X2K A;  1T3S A;  1ZSG A;  2RPN A;  3QWX X;  1WXU A;  1Z9Q A;  4AG2 C;  2KYM A;  1S1N A;  2D1X A;  1UFF A;  3VS1 A;  1M3B A;  2KT1 A;  2KGT A;  4CC3 A;  3TVT A;  4OMM A;  4KRT A;  4HVW A;  3A98 A;  1E6G A;  2EYX A;  1U3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...