2EGEA

Solution structure of the third sh3 domain from human kiaa1666 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
GSSGSSGKIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELGGHRGLVPAHLLDHMSLHGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein KIAA1666
publication title Solution structure of the third SH3 domain from human KIAA1666 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2egeA00
3FJ5A 2JXBA 1Y0MA 1I1JA 4OMPA 4JZ4A 4LNPA 2K79A 2AKLA 1SEMA 2O9SA 1WA7A 2IIMA 2DLPA 3VS2A 2KYBA 2GBQA 4RTYA 2KRSA 1AD5A 1M30A 1JO8A 1H92A 1UDLA 1X69A 3REBB 2K7AA 2K3BA 1JXMA 2QDLA 2EVRA 2DA9A 1E6HA 1G83A 1KSWA 2BZXA 3I35A 3I5SA 2KXCA 2JMAA 4J9FA 2ESWA 2PZ1A 5L23A 4J9BA 1RI9A 2A36A 1S1NA 2K6DA 2DVJA 1HD3A 1UUEA 2D0NA 2L0AA 4JZ3A 2MCNA 1YWOA 2J06A 2CH4W 2CH4A 4Z88A 4J9EA 2NWMA 1GL5A 2L2PA 1PNJA 1U06A 1VA7A 1AEYA 2FPDA 1GFDA 1RUWA 5HCKA 1W6XA 2DJQA 3RNJA 2EGAA 2KT1A 1UG1A 2FPEA 2M0YA 1PKSA 3EHRA 1ZX6A 1NEGA 3PE0A 1GCQC 3NHNA 4OMLA 4EIKA 3VS5A 4OMNA 3VS4A 2C0TA 1K4US 1OOTA 2RQVA 1M27C 5I11A 1GRIA 1TUCA 2CSIA 2FEIA 4CC4B 2EYYA 1UHCA 2AZSA 1WFWA 3EGUA 4RUGA 1HJDA 2DBKA 3UA7A 2OAWA 2DRKA 3NGPA 3U23A 1SHGA 1RLPC 3NPFA 1BK2A 2DF6A 2OJ2A 4AFZC 3PVLA 4RTUA 2LQNA 5EC7A 1J3TA 2KXDA 3IQLA 2EPDA 1WXBA 4J9IA 2KE9A 3RBBB 3C0CA 1KFZA 1GBQA 4ESRA 2EGEA 3VS3A 2YUQA 5FWCA 2ABLA 2JMCA 1ARKA 1MV3A 1FYNA 3M0PA 4LN2A 4D8KA 2CSQA 2GQIA 3ULRB 1T0JA 4ZNXA 3EG0A 1OPKA 4GBQA 3M0UA 2LZ6B 5GJWB 2M51A 2DBMA 2X3XD 4CC7A 1H3HA 2D8HA 2DL3A 3EG3A 2KRMA 3M0RA 2FRYA 1EFNA 1OPLA 2L3SA 2BZYA 1BB9A 1X43A 1QLYA 2V1RA 1KJWA 2YUOA 1KIKA 1M3AA 2LMJA 2RQRA 5IHNA 2AKKA 2J7IA 2L3QA 2VKNA 1UJYA 2KNBB 1FMKA 1NYFA 1CKBA 1W70A 2KT8A 2NUZA 1ZUKA 1WDXA 4E6RA 2RMOA 2D8JA 2DYBA 2ED0A 2JM8A 1UHFA 2F2WA 1NLOC 4HCKA 1WX6A 1UGVA 5IHIA 2RQUA 1X6BA 4J9CA 1QCFA 1ZBJA 2ENMA 1Y57A 1JEGA 4J9HA 2VWFA 1QWEA 3VRZA 2LJ1A 1M3BA 1WXUA 2SEMA 5ECAA 1PWTA 2ED1A 1H8KA 1RLQC 2DM1A 1SSHA 2G6FX 4J9DA 1X27A 2FG0A 2DE0X 1GFCA 4OMQA 3THKA 2FO0A 2H8HA 4FSSA 1OEBA 1SRLA 1BBZA 1UE9A 3LH5A 3REAB 4IIOA 1K0SA 3TSZA 2YUNA 3VS7A 2LP5A 2DILA 1VYVA 2CT3A 1K1ZA 4K11A 1YCSB 1ZLMA 3O5ZA 2LJ3A 2L3PA 2A28A 3I9QA 1AVZC 1NG2A 1PHTA 1NLPC 2RPNA 1V1CA 1LCKA 4D8DA 4CC2A 2X3WD 2GNCA 1AWWA 1K76A 1GCPA 2CUBA 4Y92A 2P4RA 1PKTA 1YNZA 4JJDA 2CDTA 1VYTA 2JS2A 2JM9A 2ECZA 4M4ZA 2DL5A 3M0QA 2YSQA 2MOXA 1JU5C 1T0HA 2EBPA 4RTWA 4OMOA 1WYXA 2F2VA 2C0OA 2KBTA 5FW9A 1CSKA 1ZUUA 2LNHB 1ZUYA 2GTOA 1YN8A 4Z8AA 1M8MA 3H0HA 3M0SA 4DEYA 2KEAA 1T3LA 4AG2C 1X2QA 4LUEA 4IIMA 2KGTA 1TG0A 2DL4A 2HEQA 2J6FA 2HBWA 4X1VA 3EG1A 3CQTA 3EG2A 3M0TA 4RTZA 1SRMA 2RQWA 5FWBA 1NEBA 2EYXA 2C0IA 1U3OA 2KYMA 1K9AA 2EQIA 4RTXA 1XOVA 2MIOA 3UA6A 2DL8A 2K2MA 4AFSC 3UATA 1X2KA 1N5ZA 1UJ0A 1NM7A 2F2XA 4F14A 3I5RA 2V1QA 2JW4A 2J6OA 3ZL7C 4WCIA 2J05A 3TVTA 2XMFA 3SHWA 4RTVA 4HVUA 2J6KA 3VS1A 3A98A 1G2BA 1I0CA 4J9GA 4HVVA 1W1FA 3SEMA 2B86A 4QT7A 2AK5A 4R0KA 1AOJA 5IXFA 1PRLC 1HSQA 2A08A 1VYUA 2GGRA 2OI3A 1B07A 1I07A 3EHQA 3NMZC 1ABQA 2ROLA 2A37A 1AZGB 2SRCA 1UTIA 4LUDA 5IXBA 2O9VA 4OMMA 2EW3A 4AFQC 2FRWA 2LJ0A 4GLMA 1ZSGA 2HDAA 4HXJA 5IH2A 3VS0A 4KRTA 1BU1A 2JS0A 2O2OA 3GBQA 2AZVA 2ROTA 2YT6A 1Z9QA 1WIEA 2D1XA 1WLPB 4Z89A 2W0ZA 1QKXA 2JTEA 4RTTA 1X6GA 2HSPA 2FPFA 3H0IA 1JXOA 1GBRA 1TUDA 2EKHA 1OV3A 4LE9A 1SHFA 3VRYA 2BZ8A 2VVKA 1B3QA 2DRMA 1UECA 2LX7A 4A63B 1JQQA 1WI7A 2EYWA 1UFFA 3R6NA 4ORZA 2O31A 1YP5A 4HVWA 4JPBW 1WXTA 2CUDA 2GTJA 3QWXX 2E5KA 1T3SA 2JT4A 4JJBA 2I0NA 2RNAA 2RQTA 2W10A 5IHKA 2BTTA 2LCSA 1QWFA 1PRMC 2YUPA 1QKWA 2EGCA 1AZEA 3PVQA 3TSWA 4F17A 3VS6A 1AWJA 4F16A 3QWYA 2KROA 1M3CA 2CT4A 4CC3A 2HCKA 2PNIA 2DX1A 4AG1C 1AWOA 1E7OA 1YWPA 3JV3A 3H41A 2KR3A 4JJCA 2DL7A 2LQWA 2PTKA 3KFVA 5GJVB 2O88A 4AFUC 2YDLA 2CREA 2RF0A 2RN8A 1MV0B 1U5SA 1MUZA 4DEXA 1E6GA 2EYZA 2KRNA 3UF4A 1NYGA 2K9GA 1GCQA 1SPKA 1A0NB 1K0XA 1ABOA 2DNUA 1IO6A 1Z9ZA 1AWXA 5I22A 2DMOA 1CKAA 3H0FA
chains in the Genus database with same CATH superfamily
4JJNK 4J6WA 4KGZB 2AT1B 1Y0MA 2LX9A 4X9DA 1WJRA 2V26A 5CQXA 4QQGA 3CCMT 1V76A 3INZA 4JZ4A 1NZ9A 5DLOA 2KK4A 3META 1VQ7T 2KYBA 1VQPT 3OYJA 4RTYA 4FT4A 1AD5A 4FM4B 3CD6T 3CC7Q 1LPLA 2HKQB 2FHDA 2Y4YA 3QO3A 3CCSQ 1Q81U 4M7AG 5KCHA 2GFAA 1KSWA 1QVGP 5I2SA 4J9FA 5A0DA 4J9BA 2A36A 1KQ1A 2QEXQ 2HD0A 2EQJA 3OYHA 2DVEA 4A4FA 2OTLA 3SWNA 5D7UA 2LT4A 2CH4W 1RAIB 2NWMA 4CI0C 2QDYB 1G3YA 1RACB 2DIGA 5KYXB 2CP6A 5HCKA 5HK3A 3EFOB 3V7RA 5GAN6 1W6XA 1UG1A 2FPEA 1BIAA 2DJZA 3EHRA 2YLBA 3HHTB 1KHCA 2P0PA 2QGGA 5GAOn 1TOVA 2DO3A 2RH2A 4OMNA 1WQWA 1M8VA 4C8QB 1JJ2S 3M4GA 2RQVA 1QCOA 1QMCA 2CSIA 3Q1JA 1FMVA 1TU0B 4ELYC 4RUGA 2DBKA 3UA7A 4V2SA 4M78D 4C0FA 2QAZA 1S72A 2DF6A 1KHIA 2Y4XA 3L2ZA 5FU6B 3S3OA 4M78C 2LQNA 3VYHB 4JRIA 5EC7A 1N8RU 2KXDA 4M75G 1M1KC 2R5AA 3UPUA 2O4XB 4ESRA 2MYSA 1D1CA 1IRXA 3VYGA 5FWCA 3S3NA 4M7AA 3CCUQ 1MV3A 4D8KA 3LH0A 1IGUA 4B6MA 2DEQA 3OY9A 3M0UA 2LZ6B 4NOYA 5GJWB 3MP1A 3CXCS 1VQMQ 1I4K1 4YTLA 4PL6A 2ZPHB 4M7DE 1H3HA 1QP2A 2D8HA 3NTHA 3ME9A 1EFNA 3EGXB 1MMAA 5KYWA 3CCMQ 2MPXC 2L3SA 5GAN7 1BB9A 4Y28E 1VQ7Q 1VQNT 1KIKA 5KYNA 2OX7A 1M3AA 2LMJA 2FZGB 4C8QA 4NL2A 5IHNA 4JLGA 1FMKA 2E6ZA 2K5FA 1CKBA 1W70A 2KT8A 3DKMA 2QI2A 2F5TX 5GANe 3ER0A 2D8JA 2DERA 4FW1A 5GANg 2ED0A 3OYFA 1UHFA 3MEUA 4P5NA 4HCKA 2HQXA 1M1KR 2RQUA 1X6BA 4OGCA 4C0DC 1QCFA 2E4HA 5D6WA 4C92C 1VQOQ 2JJ9A 4A4EA 4J9HA 1QWEA 1WXUA 4OB0B 4Q5WA 1PWTA 5L8RE 3CCJA 2C06A 2DM1A 1VQ5A 5J39A 3CMEA 4PJOB 3RDVA 2X4XA 4OMQA 2H8HA 2K5IA 4FSSA 3RUXA 4M75A 1SRLA 1TSFA 1UE9A 1BKBA 3REAB 1XJWB 3A5ZB 2LP5A 2DILA 2OTJA 3EFRA 1KG1A 4QQDA 4K11A 1BIBA 1O9SA 1YCSB 3O5ZA 1ACMB 2A28A 1AVZC 4PJJA 1NLPC 4EDUA 1V1CA 1IGQA 3G6ET 4CC2A 3LWHA 2HQEA 4A53A 1AWWA 1K76A 1GCPA 2YXYA 1BI2A 1MMDA 3M59A 3X26B 4XTWA 2JM9A 4M4ZA 2FZKB 4DQ2A 5DY9A 2VB6A 2YSQA 1QQJA 4QQ6A 5EG2A 3A8OB 1T0HA 3CC2T 4BI4A 2C0OA 4PFZA 2LNHB 5HY6A 4FYVB 2COYA 4JLIA 3QDFA 3M0SA 1PM3A 2FB7A 4PJMA 4DEYA 2KEAA 1T3LA 4IIMA 2QA4T 1TG0A 2BIVA 3H8ZA 2J6FA 3BY7A 4M7DG 3LWIA 3CQTA 3L2UA 5FWBA 2XU8A 1NEBA 4LXCA 4C0ZA 1YITT 2G3RA 2HBPA 4XK8E 4RTXA 1XOVA 1TS9A 5I21A 2P0QA 2CP7A 3M58A 4AFSC 1X2KA 1N5ZA 1VQ9A 4OGEA 1UJ0A 1YJ9A 2PU9B 3OSVA 1KQSS 2CP0A 2MAMA 1MNDA 4E47A 1LVKA 2QQRA 3SHWA 1B34B 1PSFA 4RTVA 4D6WA 1G2BA 5LJ3d 3CXCA 2D0QB 4A4GA 5KYUB 5GAOl 5AT1B 2KDSA 3JB9I 4FYWB 2B86A 4HT9A 4N0AC 2JOYA 4FSXA 1VYUA 1PSEA 1JRIA 2HZYA 2DD5A 4B9WA 2A37A 4PK4A 1B7TA 1UTIA 4A4HA 2RJDA 1VIFA 1K73C 2O9VA 4AFQC 2LQ8A 4EMHA 4KUIA 4E7SA 2X4JA 3FC3A 4BE0A 4XTUA 6AT1B 3QHSA 4M77E 5GANf 3OS0A 2ROTA 3PIOA 2NUPA 3CCRT 2RJCA 2W0ZA 1QKXA 3D7SB 2M9UA 2JTEA 4R56A 2PVOB 2FPFA 4Z02A 4L6V5 3HRTA 2JZ2A 1JXOA 4ZGEB 3OW2P 2RA2A 1B3QA 2DRMA 3CPFA 3I55A 5IAYA 3R6NA 4PFPA 2L89A 3H6ZA 1VQKA 2GTJA 2JNGA 3QWXX 3RMQA 1T3SA 1Y96B 3OYEA 4M78B 3CCQA 2RNAA 4IURA 3CCLT 3CC2Q 3TCJA 5FU7B 3RERA 3AHUA 2DZCA 3G4SQ 1K73R 1WJSA 2AHJB 5GAMd 4CRIA 3SDZA 4FL6A 1QVGS 3M57A 2HCKA 2PNIA 4AG1C 2DIQA 2V8KA 2ZAEA 3H41A 1VQ6T 5CKDA 2LQWA 2PTKA 4M75F 3GNGA 4AFUC 5CO7A 5A2QE 3A8HB 2RN8A 4BDZA 2AIRB 3UF4A 4EMGA 4J7IA 1SPKA 1KD1C 1OYXA 4HCZA 3UT1A 4HCBA 2K2VA 2DNUA 2E65A 3N5BB 2MF2A 2QQSA 2M16A 1QP3A 1AWXA 5I22A 1CKAA 2CGHA 3H0FA 4MDXA 1NPPA 3M9QA 5DM7R 3CMAQ 1YIJQ 4LNPA 3PIPA 5GANh 1WHKA 2K79A 3LX7A 2KSSA 4M78A 2H3JA 1WA7A 2DLPA 3LGFA 4C92B 1W4SA 1JO8A 4WF2A 3JCMc 1X69A 3REBB 2K7AA 2M1HA 1M2OA 4M7AE 2QDLA 2D6FA 3X28B 4XTYA 1ZQ1A 5LJ3e 3I56Q 2KXCA 3CCVT 3CCRQ 2EYQA 3CBMA 3TQ7P 2ESWA 5L23A 5LJ3g 3OYIA 1D0XA 3LGLA 3G71Q 4KGXB 5LJ5j 3CC7A 4WTOB 1KD1R 2O01E 4J83A 4JZ3A 2MCNA 1YWOA 2J06A 3DLLA 4PJOC 1XNIA 2QQBA 4J9EA 2LT1A 3OBYA 3CCSA 4BI8B 1U06A 1BYMA 1R8OB 2FPDA 1G3TA 4DOWA 3L2WA 4PLIA 1MMNA 2DJQA 3RNJA 2X51A 2EGAA 4C8QE 2M0YA 1PKSA 3JB9G 2LDMA 1NEGA 1GCQC 1QCNA 3DB3A 2CZ0B 3NHNA 4E7HA 8AT1B 3SFMA 2EJFA 2QK0A 1OOTA 2CP3A 3GP8A 2H3EB 4E7LA 2VV5A 1YI2T 4CC4B 1H3ZA 1UHCA 1HJDA 1G3SA 4C92A 2HNIA 3X20B 1RLPC 1BK2A 4KH1B 3WVEB 1SF9A 1VQ6Q 4RTUA 5J26A 1WHMA 3LLRA 2RI5A 4ZGDB 1J3TA 3IQLA 1WXBA 4J9IA 3BDLA 4LD6A 2MI6A 5GAN4 2XD0A 3VS3A 3QPHA 1FWZA 3FJPA 4ELZC 3EGDA 3FLGA 3EAEA 3QIIA 1ARKA 4Y91A 5GAMe 1YJWQ 2CSQA 1T0JA 3PNWC 3EG0A 1OPKA 4GBQA 1AT1B 1I5LA 5GAMg 2DBMA 3HTRA 4M7DF 2XI9A 1NJIU 3M0RA 1WHLA 5IT9E 3CCUA 2MWPA 3LYIA 5GAN3 2RQRA 3PFSA 2NLUA 1VQMA 2KNBB 1IZ6A 1TH7A 3CPWP 1Q82U 1WDXA 4MMKA 4E7JA 2RMOA 3GLXA 1DJ7B 2F2WA 1NLOC 3CCVQ 4J6XA 1BCMA 4J9CA 1OQKA 3FDRA 3JCMb 1X01A 1C1AA 2ENMA 3L2QA 3L2VA 2QASA 2K3XA 1VQ4A 1M3BA 2DXBA 2P84A 1RLQC 4J7FA 4O5VA 1PD1A 1X27A 2OTLT 1P92A 2K4YA 3OS2A 1GFCA 1UGQB 1OEBA 1PC0A 2FYKA 4IUTA 2MWOA 3OS1A 1VQOA 3LH5A 4X34A 4C8QG 1K0SA 5CR2A 2YUNA 2DPPB 1MNEA 3CCET 2RB6A 1VYVA 2CT3A 4QVZA 1RAEB 2I2LA 1YI2Q 1NG2A 1PHTA 5GAN2 2E64A 2RPNA 2JVVA 4N0AA 1SSFA 4EPCA 1VQ8Q 3V8KA 2P4RA 1PKTA 3GOXA 1YNZA 4JJDA 3TEEA 1S72T 4AMCA 5LL6S 2DL5A 1XTDA 3M0QA 2MOXA 2NUTB 1JU5C 5FU7C 2ZCFB 1WYXA 1Q7YU 2ZGWA 2OAUA 1VQLQ 2KBTA 5FW9A 2CZ1B 3A8MB 1ZUUA 3CEYA 3ZEHA 2WSEE 3OYGA 1M8MA 3H0HA 4LDYA 5LJ5e 3QG1A 1KC8C 1LJOA 4AG2C 1X2QA 2YRVA 4LUEA 3A8GB 2KGTA 2DL4A 5KYXA 4C5HA 4RKUE 2HEQA 3EFOA 3EG1A 4RMOA 1SRMA 2RQWA 2QG9B 3OW2S 3CBPA 1U3OA 2KYMA 3V7SA 1K9AA 2QTVA 4XTXA 3JCMe 1WHHA 3GF5A 2DL8A 3MO8A 3OYDA 2K2MA 1WHGA 3TREA 3SB2A 3MHXA 3JCMg 3G7ZA 4RCCA 5FRNA 5CKHA 1VQPQ 2LVMA 3CD6Q 4ZTFA 2JW4A 4KBMB 3ZL7C 4WCIA 2J05A 1K9MC 2XMFA 3VJPA 1OU9A 1K8AC 4MZPA 5FRMA 5GAOp 4J9GA 3VU3C 2AK5A 1AOJA 1HSQA 2A08A 2RI3A 1I81A 4PJOG 3QYHB 5AYFA 3NMZC 1TTHB 2NUTA 2A0FB 5LJ3h 3GNFB 1AZGB 4HCCA 1D1AA 1JBMA 2O4XA 3P8DA 3CC4A 5IXBA 4OMMA 1EX4A 2DZ9A 1KC8R 3CCJT 3QKJA 1NE8A 1VQ5T 3CMET 1ZSGA 1NPRA 2GF7A 1R0BG 5IH2A 3HRSA 3HKSA 2LCLA 4KRTA 4L59A 3GBQA 3CCEQ 4M77F 1RADB 4MDWA 1WIEA 1IB8A 2V8JA 2VGMA 1X6GA 2HSPA 3JCMV 2RD1A 3JRZA 2OTJT 3EGXA 2DETA 1C6VX 1GBRA 1TUDA 2GCXA 3KUFA 2VVKA 3SD4A 1UECA 1K9MR 1WI7A 4M78E 3JB9J 1K8AR 4F7UB 5GMKj 1YP5A 3RESA 4M77D 4JDSA 1S72Q 3QYGB 4RCBA 5GAN8 2ATCB 4JJBA 3GIBA 3JCMX 3FB9A 2RQTA 2W10A 3PTAA 2EFIA 2BTTA 2LC4A 2KVQG 1PRMC 3HSBA 4F17A 3RMSA 1JJ2A 2YWWA 3QXEB 2R5MA 4FT2A 4O6JA 3PGGA 2CT4A 3TU4K 4CC3A 1G3WA 1M4ZA 1AWOA 5GAOq 1E7OA 4PJOA 3JV3A 1Q81C 5CKEA 1YJNA 1IHWA 2ZPBB 1KK7A 2DL7A 2KMTA 2X4YA 5GAMh 2O88A 2YDLA 2CREA 3G4SA 2A7YA 4DEXA 2KRNA 1VQNQ 3OYLA 1GCQA 3QSUA 4KT0E 4MMLA 1K0XA 3E19A 1M90C 1YHQA 2DTIA 3HL8A 1VQ9T 1YJ9T 2E70A 1MHNA 3RKWA 4II1A 5GAN5 3WVDB 5KH6A 1M9SA 3OBWA 5C0MA 4F7UA 4C92E 1VUBA 1TUGB 1ZA1B 5CCAA 5A0GA 2DD4A 4JS4A 3OW2A 1LOJA 2YHTA 2IIMA 4QVDA 2KRSA 1X6OA 9ATCB 1M30A 1NBEB 1H92A 3VUBA 1UDLA 1JXMA 2RHXA 3CMAA 1YIJA 3OSSC 2EVRA 1Q81R 4FU6A 2DA9A 4M7AF 4HT8A 3OYYA 1G83A 2BZXA 3I5SA 2Y90A 4MZTA 4QKUA 2PZ1A 3OB9A 3MP8A 5FROA 1RI9A 2CS7A 4JRQA 1S1NA 3V8JA 2K6DA 2DVJA 3M56A 2OTJQ 4NL3A 1HD3A 1UUEA 2L0AA 1D3BB 4OB3B 1M90R 5I2MA 3MEWA 2HL5C 4Z88A 1GL5A 2L2PA 1AEYA 4DBQA 1GFDA 4M7AD 5CQYA 4QVCA 3G6EQ 3I56A 5KCOA 4C8QF 2WACA 2MK5A 4M78G 4A4KA 3I55T 1ZX6A 3G71A 3RKXA 2ZPGB 1R77A 1B34A 4FW2A 4OMLA 4EIKA 1Y71A 1G5VA 3JAME 2E1HA 1WGSA 2BKDN 3VS5A 1VQKT 2P0KA 3VS4A 3PMIA 2C0TA 1K4US 1WNLA 1IREB 5KYUA 4C0GA 3MKDA 3CPWS 3CCQT 1GRIA 2PUKB 1LNXA 3X24B 4BE1A 1W2BP 2FEIA 2CZ7B 3CBOA 2EYYA 1VIEA 1WFWA 5DLQE 1WHJA 1SHGA 5GMKi 1QVPA 1UB4A 3PVLA 2QA4Q 1RL2A 1G8XA 1Y07A 1Q86C 2EPDA 3RBBB 1RAHB 4X9CA 2BUDA 1GBQA 5LJ5h 1YITQ 2YUQA 2ABLA 2RI2A 1FYNA 3M0PA 2RK1A 4LN2A 2GQIA 2QGFB 3OYCA 2XK0A 1YJ9Q 3UDCA 4LDUA 1FX7A 2M51A 2PQWA 5C6SA 2XG8D 2X3XD 2XIDA 3JCMh 1TWBA 4M75D 2DL3A 2FRYA 1OPLA 4C92G 2BZYA 1X43A 3C94A 1YJWA 4LDXA 2QXFA 5GMKe 3V8LA 1Y96A 2F69A 2VYTA 4L5GA 1YFNA 2VKNA 1UJYA 4FYXB 1N9RA 1NYFA 3MEAA 3NTKA 3KBGA 5FLXE 3OQ5A 1ZUKA 3FEOA 5KYYA 2VXFA 4FIBA 4E6RA 3AT1B 1UEBA 1KQSA 2DYBA 2EQKA 5GMKl 1Q86R 1JB0E 2LRQA 1M1KU 8ATCB 5IHIA 4RG8A 1Y57A 3VRZA 2SEMA 4R55A 2XDBA 4BY6C 2ED1A 1H8KA 2X4WA 2XDDA 2EIFA 3CC7T 2FG0A 2XKOC 3EG9B 5CAIA 3THKA 2FO0A 2ZZDA 4PKCC 3CCST 2E41A 4DA4A 4IIOA 2QEXA 4HKEA 4KULA 4N4IA 4XTVA 2E5QA 1ZLMA 2X9HA 2JUFA 3CCLQ 2JTMA 1OULA 1ZA2B 4M77B 3CCQQ 2IG0A 1K9MU 4EMKB 3QJ6A 2HMAA 4E7KA 2X3WD 2YRDA 2A3LA 2COZA 5LJ5d 2CUBA 2LNVA 2K5LA 1VOMA 4IUVA 2CDTA 1VYTA 1YI2A 5GANj 2ECZA 2QQ9A 4E7IA 2F5KA 2R57A 2MMPA 4OMOA 2EAYA 3O8VA 1FXXA 3JCMd 3MCAB 3CPWA 1VQ8A 2GTOA 2E10A 2DAQA 1YN8A 4Z8AA 2PUOB 3GPLA 2XHCA 2E3IA 4A54A 3ASKA 2DEUA 1QVGA 1IHVA 3PT9A 1EIFA 4C5GA 3M0TA 2EQMA 1VQLA 2F1LA 3SWNB 2C0IA 5HK0A 2EQIA 3JCMJ 2MIOA 3UA6A 4FCYA 3CCUT 1V29B 3UATA 3A1PA 1OX8A 1QVFP 1WPYA 1XQHA 1ZSZC 2YRCA 3QJYA 2FZCB 2V1QA 1VQMT 1PD0A 4HVUA 4M7DD 2J6KA 4E7ZA 3A98A 1X75C 4LDWA 3CCMA 3L1AA 1VQ7A 1SG5A 1YBYA 4GY5A 3DLMA 4ZGJB 4M7DC 2EKOA 3SEMA 2L3RA 4QT7A 2K3YA 3M5AA 1PRLC 1VQPA 4XTZA 4PJOE 2OI3A 1B07A 3CD6A 3EHQA 2ROLA 2SRCA 1VQ4T 1FMWA 5KE3A 2RM4A 2Z0WA 5A0LA 3NFCA 2FRWA 4JRPA 2QQAA 2KI7A 2P4TA 1M1FA 2HDAA 3M55A 4HXJA 1HXDA 4BB7A 4ANJA 2K57A 3VS0A 3OYBA 2O2OA 2AZVA 3MEVA 1VQOT 5GMKm 3VUZA 4M7AB 2DYIA 4Z89A 1SKUB 1UGRB 1EZZB 1M90U 4F7UE 3H0IA 5LJ3f 2EKHA 1SHFA 2BZ8A 2LX7A 2PVGB 3S3MA 1JQQA 4PLLA 3P8HA 3BE3A 1RAGB 4M78F 3CCEA 3C4SA 2O31A 5KYWB 4HVWA 1WXTA 2RO0A 1F1BB 2IVWA 3OYAA 4BI3A 1U8RA 2COWA 3QZ9B 2BE9B 4GLKA 2LCSA 2EGCA 1AZEA 3PVQA 3TSWA 3OA6A 3ZBDA 2CP5A 1K73U 1N9SA 7AT1B 3HPWA 4F16A 1BI0A 2CZ6B 3QWYA 1M3CA 2KROA 2V8IA 3A8LB 2DX1A 3OYKA 2ZPFB 1YWPA 4OB1B 1M1GA 2KQWA 1WJQA 4IUQA 4JJCA 5LJ5g 2RF0A 5J3BA 4XQ3A 1MV0B 1U5SA 1MUZA 1E6GA 2L8DA 1NYGA 4B9XA 3MP6A 1A0NB 4M75B 2E3HA 1IO6A 2R58A 2FVUA 5HKCA 1M2VB 1Z9ZA 5GMKh 2DMOA 2NYSA 3FJ5A 2JXBA 1VQNA 2L5QA 4C92F 5GAMf 4BACA 1I1JA 4XAXB 1W2BS 4XU1A 4OMPA 4XU3A 2VXEA 4JS5A 2AKLA 1C0MA 4IKFA 1SEMA 2O9SA 3VS2A 5KE2A 2GBQA 1VQ4Q 3E9GA 3HP9A 2RK2A 3BFMA 4BY6B 2OTLQ 4DBRA 2K3BA 3CC4T 3G1JA 4C92D 1Q86U 3HFOA 1E6HA 1RAAB 1MMGA 3I35A 3LW5E 3J7AF 2RJFA 2JMAA 2E6NA 3HFNA 4BE2A 2XDPA 2LTOA 2DFUA 1OU8A 1KD1U 2D0NA 3M4YA 2CH4A 1ZBXA 2KY9A 2WSFE 4F7UG 5D6XA 1PNJA 1VA7A 1RUWA 4AT1B 1BI1A 2KT1A 3JB9F 2CKKA 1M2VA 2B8AA 3JCMW 4ATOA 3PE0A 3L2RA 2VUBA 1NJIC 3J81E 4M77C 3OMGA 1M27C 5I11A 3G6EA 2RHIA 1TUCA 4EMKC 2AZSA 3EGUA 2OAWA 1OX9A 3JB9D 2DRKA 3NGPA 3U23A 3JB9H 3NPFA 1Q82C 2OJ2A 1N27A 4AFZC 1R0CB 4JRKA 1I8FA 2KE9A 1WQ7A 3CC2A 3E1SA 3C0CA 1KFZA 1YJNT 2EGEA 5LJ3j 4DOVA 3G4ST 2JMCA 2E12A 3ULRB 3BDUA 2QA4A 4HA8A 4ZNXA 2HL3A 1ZSZB 2NUPB 4CC7A 1YHQT 3OS5A 1NJIR 5CKBA 1YITA 3SWNC 3EG3A 4MZMA 1I5OB 2KRMA 2DKGA 1PG5B 1TXQA 1QLYA 2V1RA 1KJWA 2VGNA 2YUOA 5LJ5f 3VV0A 4M7DB 3S6WA 1D1BA 2RHUA 2AKKA 2J7IA 2L3QA 4XU2A 2YLCA 3QBYA 1JJ2P 2NUZA 1Q95G 1Q82R 3EFSA 3CCJQ 3JCMf 3CC4Q 1ZHIA 4UC4A 1VQ5Q 3CMEQ 3J80E 2JM8A 2HAXA 2GFUA 1WX6A 3CMAT 1UGVA 1YIJT 4QW2A 3EH2A 3C95A 4J5YA 1ZBJA 1JEGA 1W2BA 2VWFA 1N8RC 2LJ1A 2QYZA 5ECAA 4E2FB 1SSHA 2G6FX 4J9DA 3URGA 1Q7YC 2DE0X 4OF1A 1BBZA 2EQUA 3RKYA 3OYNA 3CCRA 2EJ9A 3I56T 1ZSZA 3TSZA 5GAMj 4M7AC 4BD3A 3VS7A 3CXCP 1QVFS 1K1ZA 3G71T 1MGQA 2FL7A 4RG2A 5CKFA 1D09B 2LJ3A 2L3PA 3I9QA 2ZPIB 4M7DA 3EH1A 3P8BB 4N4HA 1LCKA 4D8DA 4C8QD 2GNCA 4JUVA 2GQVA 2WSCE 4Y92A 3BW1A 3UWNA 2KAFA 3CCLA 1M5Q1 4C8QC 1RAFB 2JS2A 2JN0A 3QUIA 1N8RR 1U1SA 1YJNQ 2D9TA 5CVIA 1OZ3A 4OMFB 3MPUB 2EBPA 4RTWA 2F2VA 1Q7YR 5M9OA 3JSCA 3ZFJA 1CSKA 1ZUYA 5CK9A 3R6OA 4PJNA 4XU0A 4F04B 4ZN1A 1D0YA 1O75A 1D3BA 5FU6C 3KXTA 4LDVA 1VQ6A 1VQ9Q 2DXUA 3FIFA 1YHQQ 4TVRA 4N4GA 5D6YA 2HBWA 4IUPA 4LD9K 4X1VA 3JCMP 3E9FA 3EG2A 3PMTA 4RTZA 3RR6A 2EYXA 4OP0A 1RI0A 1Y7XA 3DB4A 1OZ2A 4M75C 1RABB 2DTHA 1YJWT 2EJGA 1NM7A 2F2XA 4F14A 2DTOA 4KH0B 3I5RA 2J6OA 2HKNA 3TVTA 3VS1A 1I0CA 5CIUA 4VUBA 4HVVA 2DXTA 1W1FA 3C12A 4PFOA 3X25B 2M02A 4R0KA 3NTIA 4IUUA 5IXFA 4KGVB 2HQHA 4C0DB 2GGRA 4J6YA 4PJOF 1I07A 2QTXA 1ABQA 1AHJB 2VC8A 3RIRA 5IN1A 4DBFA 4LUDA 4DBHA 4ME7A 4BUGA 1KC8U 2M0OA 2EW3A 1H641 1OI1A 1UGSB 3H9NA 2LJ0A 4GLMA 3CCVA 3V7CA 1GXIE 1YCYA 3I55Q 1BU1A 2JS0A 2RJEA 2YT6A 4FYYB 1BCOA 1Z9QA 4M77G 3WXMB 5GAOm 4PJOD 4J8OA 2D1XA 1WLPB 3EGDB 2BE7D 3JCMQ 4ZN3A 2QEXT 1VQKQ 2IPOB 4RTTA 2CYZB 4KUDK 4F7UF 1OV3A 1BI3A 4LE9A 3VRYA 3T9NA 4A63B 3QDRB 2EYWA 3VKIA 1UFFA 5KYYB 2LCCA 1K8AU 1KQ2A 2DXCA 1WZOA 4ORZA 4JPBW 1KQSP 2CUDA 2E5KA 2JT4A 2I0NA 2XICA 3E2UA 5IHKA 1QVFA 2ZPEB 1N6AA 1QWFA 2YUPA 3OYMA 2X35A 1QKWA 4BDYA 2DK3A 4NS5A 3VS6A 1AWJA 3QZ5B 5GAOr 1UGPB 4ZTJA 2PVDB 4C5IA 3M53A 3F70A 1VQ8T 1HYOA 2JTFA 3EG9A 4PJLA 2CP2A 2KR3A 3OMCA 1U1TA 3HRUA 4M75E 3KFVA 5GJVB 3L42A 1HK9A 3M54A 1QW1A 2EYZA 3MJXA 4OVAA 1VQLT 2K9GA 4C5EA 4PNOA 4OB2B 1IXDA 2LQKA 1ABOA 1D0ZA 4M77A 5GANd 3FRNA 2RHYA 2EWNA 2VASA 4EMKA 1PCXA 2HSEB 2RHZA
chains in the Genus database with same CATH topology
3FJ5A 2JXBA 1Y0MA 1I1JA 4OMPA 4JZ4A 4LNPA 2K79A 2AKLA 1SEMA 2O9SA 1WA7A 2IIMA 2DLPA 3VS2A 2KYBA 2GBQA 4RTYA 2KRSA 1AD5A 1M30A 1JO8A 1H92A 1UDLA 1X69A 3REBB 2K7AA 2K3BA 1JXMA 2QDLA 2EVRA 2DA9A 1E6HA 1G83A 1KSWA 2BZXA 3I35A 3I5SA 2KXCA 2JMAA 4J9FA 2ESWA 2PZ1A 5L23A 4J9BA 1RI9A 2A36A 1S1NA 2K6DA 2DVJA 1HD3A 1UUEA 2D0NA 2L0AA 4JZ3A 2MCNA 1YWOA 2J06A 2CH4W 2CH4A 4Z88A 4J9EA 2NWMA 1GL5A 2L2PA 1PNJA 1U06A 1VA7A 1AEYA 2FPDA 1GFDA 1RUWA 5HCKA 1W6XA 2DJQA 3RNJA 2EGAA 2KT1A 1UG1A 2FPEA 2M0YA 1PKSA 3EHRA 1ZX6A 1NEGA 3PE0A 1GCQC 3NHNA 4OMLA 4EIKA 3VS5A 4OMNA 3VS4A 2C0TA 1K4US 1OOTA 2RQVA 1M27C 5I11A 1GRIA 1TUCA 2CSIA 2FEIA 4CC4B 2EYYA 1UHCA 2AZSA 1WFWA 3EGUA 4RUGA 1HJDA 2DBKA 3UA7A 2OAWA 2DRKA 3NGPA 3U23A 1SHGA 1RLPC 3NPFA 1BK2A 2DF6A 2OJ2A 4AFZC 3PVLA 4RTUA 2LQNA 5EC7A 1J3TA 2KXDA 3IQLA 2EPDA 1WXBA 4J9IA 2KE9A 3RBBB 3C0CA 1KFZA 1GBQA 4ESRA 2EGEA 3VS3A 2YUQA 5FWCA 2ABLA 2JMCA 1ARKA 1MV3A 1FYNA 3M0PA 4LN2A 4D8KA 2CSQA 2GQIA 3ULRB 1T0JA 4ZNXA 3EG0A 1OPKA 4GBQA 3M0UA 2LZ6B 5GJWB 2M51A 2DBMA 2X3XD 4CC7A 1H3HA 2D8HA 2DL3A 3EG3A 2KRMA 3M0RA 2FRYA 1EFNA 1OPLA 2L3SA 2BZYA 1BB9A 1X43A 1QLYA 2V1RA 1KJWA 2YUOA 1KIKA 1M3AA 2LMJA 2RQRA 5IHNA 2AKKA 2J7IA 2L3QA 2VKNA 1UJYA 2KNBB 1FMKA 1NYFA 1CKBA 1W70A 2KT8A 2NUZA 1ZUKA 1WDXA 4E6RA 2RMOA 2D8JA 2DYBA 2ED0A 2JM8A 1UHFA 2F2WA 1NLOC 4HCKA 1WX6A 1UGVA 5IHIA 2RQUA 1X6BA 4J9CA 1QCFA 1ZBJA 2ENMA 1Y57A 1JEGA 4J9HA 2VWFA 1QWEA 3VRZA 2LJ1A 1M3BA 1WXUA 2SEMA 5ECAA 1PWTA 2ED1A 1H8KA 1RLQC 2DM1A 1SSHA 2G6FX 4J9DA 1X27A 2FG0A 2DE0X 1GFCA 4OMQA 3THKA 2FO0A 2H8HA 4FSSA 1OEBA 1SRLA 1BBZA 1UE9A 3LH5A 3REAB 4IIOA 1K0SA 3TSZA 2YUNA 3VS7A 2LP5A 2DILA 1VYVA 2CT3A 1K1ZA 4K11A 1YCSB 1ZLMA 3O5ZA 2LJ3A 2L3PA 2A28A 3I9QA 1AVZC 1NG2A 1PHTA 1NLPC 2RPNA 1V1CA 1LCKA 4D8DA 4CC2A 2X3WD 2GNCA 1AWWA 1K76A 1GCPA 2CUBA 4Y92A 2P4RA 1PKTA 1YNZA 4JJDA 2CDTA 1VYTA 2JS2A 2JM9A 2ECZA 4M4ZA 2DL5A 3M0QA 2YSQA 2MOXA 1JU5C 1T0HA 2EBPA 4RTWA 4OMOA 1WYXA 2F2VA 2C0OA 2KBTA 5FW9A 1CSKA 1ZUUA 2LNHB 1ZUYA 2GTOA 1YN8A 4Z8AA 1M8MA 3H0HA 3M0SA 4DEYA 2KEAA 1T3LA 4AG2C 1X2QA 4LUEA 4IIMA 2KGTA 1TG0A 2DL4A 2HEQA 2J6FA 2HBWA 4X1VA 3EG1A 3CQTA 3EG2A 3M0TA 4RTZA 1SRMA 2RQWA 5FWBA 1NEBA 2EYXA 2C0IA 1U3OA 2KYMA 1K9AA 2EQIA 4RTXA 1XOVA 2MIOA 3UA6A 2DL8A 2K2MA 4AFSC 3UATA 1X2KA 1N5ZA 1UJ0A 1NM7A 2F2XA 4F14A 3I5RA 2V1QA 2JW4A 2J6OA 3ZL7C 4WCIA 2J05A 3TVTA 2XMFA 3SHWA 4RTVA 4HVUA 2J6KA 3VS1A 3A98A 1G2BA 1I0CA 4J9GA 4HVVA 1W1FA 3SEMA 2B86A 4QT7A 2AK5A 4R0KA 1AOJA 5IXFA 1PRLC 1HSQA 2A08A 1VYUA 2GGRA 2OI3A 1B07A 1I07A 3EHQA 3NMZC 1ABQA 2ROLA 2A37A 1AZGB 2SRCA 1UTIA 4LUDA 5IXBA 2O9VA 4OMMA 2EW3A 4AFQC 2FRWA 2LJ0A 4GLMA 1ZSGA 2HDAA 4HXJA 5IH2A 3VS0A 4KRTA 1BU1A 2JS0A 2O2OA 3GBQA 2AZVA 2ROTA 2YT6A 1Z9QA 1WIEA 2D1XA 1WLPB 4Z89A 2W0ZA 1QKXA 2JTEA 4RTTA 1X6GA 2HSPA 2FPFA 3H0IA 1JXOA 1GBRA 1TUDA 2EKHA 1OV3A 4LE9A 1SHFA 3VRYA 2BZ8A 2VVKA 1B3QA 2DRMA 1UECA 2LX7A 4A63B 1JQQA 1WI7A 2EYWA 1UFFA 3R6NA 4ORZA 2O31A 1YP5A 4HVWA 4JPBW 1WXTA 2CUDA 2GTJA 3QWXX 2E5KA 1T3SA 2JT4A 4JJBA 2I0NA 2RNAA 2RQTA 2W10A 5IHKA 2BTTA 2LCSA 1QWFA 1PRMC 2YUPA 1QKWA 2EGCA 1AZEA 3PVQA 3TSWA 4F17A 3VS6A 1AWJA 4F16A 3QWYA 2KROA 1M3CA 2CT4A 4CC3A 2HCKA 2PNIA 2DX1A 4AG1C 1AWOA 1E7OA 1YWPA 3JV3A 3H41A 2KR3A 4JJCA 2DL7A 2LQWA 2PTKA 3KFVA 5GJVB 2O88A 4AFUC 2YDLA 2CREA 2RF0A 2RN8A 1MV0B 1U5SA 1MUZA 4DEXA 1E6GA 2EYZA 2KRNA 3UF4A 1NYGA 2K9GA 1GCQA 1SPKA 1A0NB 1K0XA 1ABOA 2DNUA 1IO6A 1Z9ZA 1AWXA 5I22A 2DMOA 1CKAA 3H0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJ5 A;  2JXB A;  1Y0M A;  1I1J A;  4OMP A;  4JZ4 A;  4LNP A;  2K79 A;  2AKL A;  1SEM A;  2O9S A;  1WA7 A;  2IIM A;  2DLP A;  3VS2 A;  2KYB A;  2GBQ A;  4RTY A;  2KRS A;  1AD5 A;  1M30 A;  1JO8 A;  1H92 A;  1UDL A;  1X69 A;  3REB B;  2K7A A;  2K3B A;  1JXM A;  2QDL A;  2EVR A;  2DA9 A;  1E6H A;  1G83 A;  1KSW A;  2BZX A;  3I35 A;  3I5S A;  2KXC A;  2JMA A;  4J9F A;  2ESW A;  2PZ1 A;  5L23 A;  4J9B A;  1RI9 A;  2A36 A;  1S1N A;  2K6D A;  2DVJ A;  1HD3 A;  1UUE A;  2D0N A;  2L0A A;  4JZ3 A;  2MCN A;  1YWO A;  2J06 A;  2CH4 W;  2CH4 A;  4Z88 A;  4J9E A;  2NWM A;  1GL5 A;  2L2P A;  1PNJ A;  1U06 A;  1VA7 A;  1AEY A;  2FPD A;  1GFD A;  1RUW A;  5HCK A;  1W6X A;  2DJQ A;  3RNJ A;  2EGA A;  2KT1 A;  1UG1 A;  2FPE A;  2M0Y A;  1PKS A;  3EHR A;  1ZX6 A;  1NEG A;  3PE0 A;  1GCQ C;  3NHN A;  4OML A;  4EIK A;  3VS5 A;  4OMN A;  3VS4 A;  2C0T A;  1K4U S;  1OOT A;  2RQV A;  1M27 C;  5I11 A;  1GRI A;  1TUC A;  2CSI A;  2FEI A;  4CC4 B;  2EYY A;  1UHC A;  2AZS A;  1WFW A;  3EGU A;  4RUG A;  1HJD A;  2DBK A;  3UA7 A;  2OAW A;  2DRK A;  3NGP A;  3U23 A;  1SHG A;  1RLP C;  3NPF A;  1BK2 A;  2DF6 A;  2OJ2 A;  4AFZ C;  3PVL A;  4RTU A;  2LQN A;  5EC7 A;  1J3T A;  2KXD A;  3IQL A;  2EPD A;  1WXB A;  4J9I A;  2KE9 A;  3RBB B;  3C0C A;  1KFZ A;  1GBQ A;  4ESR A;  2EGE A;  3VS3 A;  2YUQ A;  5FWC A;  2ABL A;  2JMC A;  1ARK A;  1MV3 A;  1FYN A;  3M0P A;  4LN2 A;  4D8K A;  2CSQ A;  2GQI A;  3ULR B;  1T0J A;  4ZNX A;  3EG0 A;  1OPK A;  4GBQ A;  3M0U A;  2LZ6 B;  5GJW B;  2M51 A;  2DBM A;  2X3X D;  4CC7 A;  1H3H A;  2D8H A;  2DL3 A;  3EG3 A;  2KRM A;  3M0R A;  2FRY A;  1EFN A;  1OPL A;  2L3S A;  2BZY A;  1BB9 A;  1X43 A;  1QLY A;  2V1R A;  1KJW A;  2YUO A;  1KIK A;  1M3A A;  2LMJ A;  2RQR A;  5IHN A;  2AKK A;  2J7I A;  2L3Q A;  2VKN A;  1UJY A;  2KNB B;  1FMK A;  1NYF A;  1CKB A;  1W70 A;  2KT8 A;  2NUZ A;  1ZUK A;  1WDX A;  4E6R A;  2RMO A;  2D8J A;  2DYB A;  2ED0 A;  2JM8 A;  1UHF A;  2F2W A;  1NLO C;  4HCK A;  1WX6 A;  1UGV A;  5IHI A;  2RQU A;  1X6B A;  4J9C A;  1QCF A;  1ZBJ A;  2ENM A;  1Y57 A;  1JEG A;  4J9H A;  2VWF A;  1QWE A;  3VRZ A;  2LJ1 A;  1M3B A;  1WXU A;  2SEM A;  5ECA A;  1PWT A;  2ED1 A;  1H8K A;  1RLQ C;  2DM1 A;  1SSH A;  2G6F X;  4J9D A;  1X27 A;  2FG0 A;  2DE0 X;  1GFC A;  4OMQ A;  3THK A;  2FO0 A;  2H8H A;  4FSS A;  1OEB A;  1SRL A;  1BBZ A;  1UE9 A;  3LH5 A;  3REA B;  4IIO A;  1K0S A;  3TSZ A;  2YUN A;  3VS7 A;  2LP5 A;  2DIL A;  1VYV A;  2CT3 A;  1K1Z A;  4K11 A;  1YCS B;  1ZLM A;  3O5Z A;  2LJ3 A;  2L3P A;  2A28 A;  3I9Q A;  1AVZ C;  1NG2 A;  1PHT A;  1NLP C;  2RPN A;  1V1C A;  1LCK A;  4D8D A;  4CC2 A;  2X3W D;  2GNC A;  1AWW A;  1K76 A;  1GCP A;  2CUB A;  4Y92 A;  2P4R A;  1PKT A;  1YNZ A;  4JJD A;  2CDT A;  1VYT A;  2JS2 A;  2JM9 A;  2ECZ A;  4M4Z A;  2DL5 A;  3M0Q A;  2YSQ A;  2MOX A;  1JU5 C;  1T0H A;  2EBP A;  4RTW A;  4OMO A;  1WYX A;  2F2V A;  2C0O A;  2KBT A;  5FW9 A;  1CSK A;  1ZUU A;  2LNH B;  1ZUY A;  2GTO A;  1YN8 A;  4Z8A A;  1M8M A;  3H0H A;  3M0S A;  4DEY A;  2KEA A;  1T3L A;  4AG2 C;  1X2Q A;  4LUE A;  4IIM A;  2KGT A;  1TG0 A;  2DL4 A;  2HEQ A;  2J6F A;  2HBW A;  4X1V A;  3EG1 A;  3CQT A;  3EG2 A;  3M0T A;  4RTZ A;  1SRM A;  2RQW A;  5FWB A;  1NEB A;  2EYX A;  2C0I A;  1U3O A;  2KYM A;  1K9A A;  2EQI A;  4RTX A;  1XOV A;  2MIO A;  3UA6 A;  2DL8 A;  2K2M A;  4AFS C;  3UAT A;  1X2K A;  1N5Z A;  1UJ0 A;  1NM7 A;  2F2X A;  4F14 A;  3I5R A;  2V1Q A;  2JW4 A;  2J6O A;  3ZL7 C;  4WCI A;  2J05 A;  3TVT A;  2XMF A;  3SHW A;  4RTV A;  4HVU A;  2J6K A;  3VS1 A;  3A98 A;  1G2B A;  1I0C A;  4J9G A;  4HVV A;  1W1F A;  3SEM A;  2B86 A;  4QT7 A;  2AK5 A;  4R0K A;  1AOJ A;  5IXF A;  1PRL C;  1HSQ A;  2A08 A;  1VYU A;  2GGR A;  2OI3 A;  1B07 A;  1I07 A;  3EHQ A;  3NMZ C;  1ABQ A;  2ROL A;  2A37 A;  1AZG B;  2SRC A;  1UTI A;  4LUD A;  5IXB A;  2O9V A;  4OMM A;  2EW3 A;  4AFQ C;  2FRW A;  2LJ0 A;  4GLM A;  1ZSG A;  2HDA A;  4HXJ A;  5IH2 A;  3VS0 A;  4KRT A;  1BU1 A;  2JS0 A;  2O2O A;  3GBQ A;  2AZV A;  2ROT A;  2YT6 A;  1Z9Q A;  1WIE A;  2D1X A;  1WLP B;  4Z89 A;  2W0Z A;  1QKX A;  2JTE A;  4RTT A;  1X6G A;  2HSP A;  2FPF A;  3H0I A;  1JXO A;  1GBR A;  1TUD A;  2EKH A;  1OV3 A;  4LE9 A;  1SHF A;  3VRY A;  2BZ8 A;  2VVK A;  1B3Q A;  2DRM A;  1UEC A;  2LX7 A;  4A63 B;  1JQQ A;  1WI7 A;  2EYW A;  1UFF A;  3R6N A;  4ORZ A;  2O31 A;  1YP5 A;  4HVW A;  4JPB W;  1WXT A;  2CUD A;  2GTJ A;  3QWX X;  2E5K A;  1T3S A;  2JT4 A;  4JJB A;  2I0N A;  2RNA A;  2RQT A;  2W10 A;  5IHK A;  2BTT A;  2LCS A;  1QWF A;  1PRM C;  2YUP A;  1QKW A;  2EGC A;  1AZE A;  3PVQ A;  3TSW A;  4F17 A;  3VS6 A;  1AWJ A;  4F16 A;  3QWY A;  2KRO A;  1M3C A;  2CT4 A;  4CC3 A;  2HCK A;  2PNI A;  2DX1 A;  4AG1 C;  1AWO A;  1E7O A;  1YWP A;  3JV3 A;  3H41 A;  2KR3 A;  4JJC A;  2DL7 A;  2LQW A;  2PTK A;  3KFV A;  5GJV B;  2O88 A;  4AFU C;  2YDL A;  2CRE A;  2RF0 A;  2RN8 A;  1MV0 B;  1U5S A;  1MUZ A;  4DEX A;  1E6G A;  2EYZ A;  2KRN A;  3UF4 A;  1NYG A;  2K9G A;  1GCQ A;  1SPK A;  1A0N B;  1K0X A;  1ABO A;  2DNU A;  1IO6 A;  1Z9Z A;  1AWX A;  5I22 A;  2DMO A;  1CKA A;  3H0F A; 
#chains in the Genus database with same CATH topology
 4JJN K;  4J6W A;  4KGZ B;  2AT1 B;  1Y0M A;  2LX9 A;  4X9D A;  1WJR A;  2V26 A;  5CQX A;  4QQG A;  3CCM T;  1V76 A;  3INZ A;  4JZ4 A;  1NZ9 A;  5DLO A;  2KK4 A;  3MET A;  1VQ7 T;  2KYB A;  1VQP T;  3OYJ A;  4RTY A;  4FT4 A;  1AD5 A;  4FM4 B;  3CD6 T;  3CC7 Q;  1LPL A;  2HKQ B;  2FHD A;  2Y4Y A;  3QO3 A;  3CCS Q;  1Q81 U;  4M7A G;  5KCH A;  2GFA A;  1KSW A;  1QVG P;  5I2S A;  4J9F A;  5A0D A;  4J9B A;  2A36 A;  1KQ1 A;  2QEX Q;  2HD0 A;  2EQJ A;  3OYH A;  2DVE A;  4A4F A;  2OTL A;  3SWN A;  5D7U A;  2LT4 A;  2CH4 W;  1RAI B;  2NWM A;  4CI0 C;  2QDY B;  1G3Y A;  1RAC B;  2DIG A;  5KYX B;  2CP6 A;  5HCK A;  5HK3 A;  3EFO B;  3V7R A;  5GAN 6;  1W6X A;  1UG1 A;  2FPE A;  1BIA A;  2DJZ A;  3EHR A;  2YLB A;  3HHT B;  1KHC A;  2P0P A;  2QGG A;  5GAO n;  1TOV A;  2DO3 A;  2RH2 A;  4OMN A;  1WQW A;  1M8V A;  4C8Q B;  1JJ2 S;  3M4G A;  2RQV A;  1QCO A;  1QMC A;  2CSI A;  3Q1J A;  1FMV A;  1TU0 B;  4ELY C;  4RUG A;  2DBK A;  3UA7 A;  4V2S A;  4M78 D;  4C0F A;  2QAZ A;  1S72 A;  2DF6 A;  1KHI A;  2Y4X A;  3L2Z A;  5FU6 B;  3S3O A;  4M78 C;  2LQN A;  3VYH B;  4JRI A;  5EC7 A;  1N8R U;  2KXD A;  4M75 G;  1M1K C;  2R5A A;  3UPU A;  2O4X B;  4ESR A;  2MYS A;  1D1C A;  1IRX A;  3VYG A;  5FWC A;  3S3N A;  4M7A A;  3CCU Q;  1MV3 A;  4D8K A;  3LH0 A;  1IGU A;  4B6M A;  2DEQ A;  3OY9 A;  3M0U A;  2LZ6 B;  4NOY A;  5GJW B;  3MP1 A;  3CXC S;  1VQM Q;  1I4K 1;  4YTL A;  4PL6 A;  2ZPH B;  4M7D E;  1H3H A;  1QP2 A;  2D8H A;  3NTH A;  3ME9 A;  1EFN A;  3EGX B;  1MMA A;  5KYW A;  3CCM Q;  2MPX C;  2L3S A;  5GAN 7;  1BB9 A;  4Y28 E;  1VQ7 Q;  1VQN T;  1KIK A;  5KYN A;  2OX7 A;  1M3A A;  2LMJ A;  2FZG B;  4C8Q A;  4NL2 A;  5IHN A;  4JLG A;  1FMK A;  2E6Z A;  2K5F A;  1CKB A;  1W70 A;  2KT8 A;  3DKM A;  2QI2 A;  2F5T X;  5GAN e;  3ER0 A;  2D8J A;  2DER A;  4FW1 A;  5GAN g;  2ED0 A;  3OYF A;  1UHF A;  3MEU A;  4P5N A;  4HCK A;  2HQX A;  1M1K R;  2RQU A;  1X6B A;  4OGC A;  4C0D C;  1QCF A;  2E4H A;  5D6W A;  4C92 C;  1VQO Q;  2JJ9 A;  4A4E A;  4J9H A;  1QWE A;  1WXU A;  4OB0 B;  4Q5W A;  1PWT A;  5L8R E;  3CCJ A;  2C06 A;  2DM1 A;  1VQ5 A;  5J39 A;  3CME A;  4PJO B;  3RDV A;  2X4X A;  4OMQ A;  2H8H A;  2K5I A;  4FSS A;  3RUX A;  4M75 A;  1SRL A;  1TSF A;  1UE9 A;  1BKB A;  3REA B;  1XJW B;  3A5Z B;  2LP5 A;  2DIL A;  2OTJ A;  3EFR A;  1KG1 A;  4QQD A;  4K11 A;  1BIB A;  1O9S A;  1YCS B;  3O5Z A;  1ACM B;  2A28 A;  1AVZ C;  4PJJ A;  1NLP C;  4EDU A;  1V1C A;  1IGQ A;  3G6E T;  4CC2 A;  3LWH A;  2HQE A;  4A53 A;  1AWW A;  1K76 A;  1GCP A;  2YXY A;  1BI2 A;  1MMD A;  3M59 A;  3X26 B;  4XTW A;  2JM9 A;  4M4Z A;  2FZK B;  4DQ2 A;  5DY9 A;  2VB6 A;  2YSQ A;  1QQJ A;  4QQ6 A;  5EG2 A;  3A8O B;  1T0H A;  3CC2 T;  4BI4 A;  2C0O A;  4PFZ A;  2LNH B;  5HY6 A;  4FYV B;  2COY A;  4JLI A;  3QDF A;  3M0S A;  1PM3 A;  2FB7 A;  4PJM A;  4DEY A;  2KEA A;  1T3L A;  4IIM A;  2QA4 T;  1TG0 A;  2BIV A;  3H8Z A;  2J6F A;  3BY7 A;  4M7D G;  3LWI A;  3CQT A;  3L2U A;  5FWB A;  2XU8 A;  1NEB A;  4LXC A;  4C0Z A;  1YIT T;  2G3R A;  2HBP A;  4XK8 E;  4RTX A;  1XOV A;  1TS9 A;  5I21 A;  2P0Q A;  2CP7 A;  3M58 A;  4AFS C;  1X2K A;  1N5Z A;  1VQ9 A;  4OGE A;  1UJ0 A;  1YJ9 A;  2PU9 B;  3OSV A;  1KQS S;  2CP0 A;  2MAM A;  1MND A;  4E47 A;  1LVK A;  2QQR A;  3SHW A;  1B34 B;  1PSF A;  4RTV A;  4D6W A;  1G2B A;  5LJ3 d;  3CXC A;  2D0Q B;  4A4G A;  5KYU B;  5GAO l;  5AT1 B;  2KDS A;  3JB9 I;  4FYW B;  2B86 A;  4HT9 A;  4N0A C;  2JOY A;  4FSX A;  1VYU A;  1PSE A;  1JRI A;  2HZY A;  2DD5 A;  4B9W A;  2A37 A;  4PK4 A;  1B7T A;  1UTI A;  4A4H A;  2RJD A;  1VIF A;  1K73 C;  2O9V A;  4AFQ C;  2LQ8 A;  4EMH A;  4KUI A;  4E7S A;  2X4J A;  3FC3 A;  4BE0 A;  4XTU A;  6AT1 B;  3QHS A;  4M77 E;  5GAN f;  3OS0 A;  2ROT A;  3PIO A;  2NUP A;  3CCR T;  2RJC A;  2W0Z A;  1QKX A;  3D7S B;  2M9U A;  2JTE A;  4R56 A;  2PVO B;  2FPF A;  4Z02 A;  4L6V 5;  3HRT A;  2JZ2 A;  1JXO A;  4ZGE B;  3OW2 P;  2RA2 A;  1B3Q A;  2DRM A;  3CPF A;  3I55 A;  5IAY A;  3R6N A;  4PFP A;  2L89 A;  3H6Z A;  1VQK A;  2GTJ A;  2JNG A;  3QWX X;  3RMQ A;  1T3S A;  1Y96 B;  3OYE A;  4M78 B;  3CCQ A;  2RNA A;  4IUR A;  3CCL T;  3CC2 Q;  3TCJ A;  5FU7 B;  3RER A;  3AHU A;  2DZC A;  3G4S Q;  1K73 R;  1WJS A;  2AHJ B;  5GAM d;  4CRI A;  3SDZ A;  4FL6 A;  1QVG S;  3M57 A;  2HCK A;  2PNI A;  4AG1 C;  2DIQ A;  2V8K A;  2ZAE A;  3H41 A;  1VQ6 T;  5CKD A;  2LQW A;  2PTK A;  4M75 F;  3GNG A;  4AFU C;  5CO7 A;  5A2Q E;  3A8H B;  2RN8 A;  4BDZ A;  2AIR B;  3UF4 A;  4EMG A;  4J7I A;  1SPK A;  1KD1 C;  1OYX A;  4HCZ A;  3UT1 A;  4HCB A;  2K2V A;  2DNU A;  2E65 A;  3N5B B;  2MF2 A;  2QQS A;  2M16 A;  1QP3 A;  1AWX A;  5I22 A;  1CKA A;  2CGH A;  3H0F A;  4MDX A;  1NPP A;  3M9Q A;  5DM7 R;  3CMA Q;  1YIJ Q;  4LNP A;  3PIP A;  5GAN h;  1WHK A;  2K79 A;  3LX7 A;  2KSS A;  4M78 A;  2H3J A;  1WA7 A;  2DLP A;  3LGF A;  4C92 B;  1W4S A;  1JO8 A;  4WF2 A;  3JCM c;  1X69 A;  3REB B;  2K7A A;  2M1H A;  1M2O A;  4M7A E;  2QDL A;  2D6F A;  3X28 B;  4XTY A;  1ZQ1 A;  5LJ3 e;  3I56 Q;  2KXC A;  3CCV T;  3CCR Q;  2EYQ A;  3CBM A;  3TQ7 P;  2ESW A;  5L23 A;  5LJ3 g;  3OYI A;  1D0X A;  3LGL A;  3G71 Q;  4KGX B;  5LJ5 j;  3CC7 A;  4WTO B;  1KD1 R;  2O01 E;  4J83 A;  4JZ3 A;  2MCN A;  1YWO A;  2J06 A;  3DLL A;  4PJO C;  1XNI A;  2QQB A;  4J9E A;  2LT1 A;  3OBY A;  3CCS A;  4BI8 B;  1U06 A;  1BYM A;  1R8O B;  2FPD A;  1G3T A;  4DOW A;  3L2W A;  4PLI A;  1MMN A;  2DJQ A;  3RNJ A;  2X51 A;  2EGA A;  4C8Q E;  2M0Y A;  1PKS A;  3JB9 G;  2LDM A;  1NEG A;  1GCQ C;  1QCN A;  3DB3 A;  2CZ0 B;  3NHN A;  4E7H A;  8AT1 B;  3SFM A;  2EJF A;  2QK0 A;  1OOT A;  2CP3 A;  3GP8 A;  2H3E B;  4E7L A;  2VV5 A;  1YI2 T;  4CC4 B;  1H3Z A;  1UHC A;  1HJD A;  1G3S A;  4C92 A;  2HNI A;  3X20 B;  1RLP C;  1BK2 A;  4KH1 B;  3WVE B;  1SF9 A;  1VQ6 Q;  4RTU A;  5J26 A;  1WHM A;  3LLR A;  2RI5 A;  4ZGD B;  1J3T A;  3IQL A;  1WXB A;  4J9I A;  3BDL A;  4LD6 A;  2MI6 A;  5GAN 4;  2XD0 A;  3VS3 A;  3QPH A;  1FWZ A;  3FJP A;  4ELZ C;  3EGD A;  3FLG A;  3EAE A;  3QII A;  1ARK A;  4Y91 A;  5GAM e;  1YJW Q;  2CSQ A;  1T0J A;  3PNW C;  3EG0 A;  1OPK A;  4GBQ A;  1AT1 B;  1I5L A;  5GAM g;  2DBM A;  3HTR A;  4M7D F;  2XI9 A;  1NJI U;  3M0R A;  1WHL A;  5IT9 E;  3CCU A;  2MWP A;  3LYI A;  5GAN 3;  2RQR A;  3PFS A;  2NLU A;  1VQM A;  2KNB B;  1IZ6 A;  1TH7 A;  3CPW P;  1Q82 U;  1WDX A;  4MMK A;  4E7J A;  2RMO A;  3GLX A;  1DJ7 B;  2F2W A;  1NLO C;  3CCV Q;  4J6X A;  1BCM A;  4J9C A;  1OQK A;  3FDR A;  3JCM b;  1X01 A;  1C1A A;  2ENM A;  3L2Q A;  3L2V A;  2QAS A;  2K3X A;  1VQ4 A;  1M3B A;  2DXB A;  2P84 A;  1RLQ C;  4J7F A;  4O5V A;  1PD1 A;  1X27 A;  2OTL T;  1P92 A;  2K4Y A;  3OS2 A;  1GFC A;  1UGQ B;  1OEB A;  1PC0 A;  2FYK A;  4IUT A;  2MWO A;  3OS1 A;  1VQO A;  3LH5 A;  4X34 A;  4C8Q G;  1K0S A;  5CR2 A;  2YUN A;  2DPP B;  1MNE A;  3CCE T;  2RB6 A;  1VYV A;  2CT3 A;  4QVZ A;  1RAE B;  2I2L A;  1YI2 Q;  1NG2 A;  1PHT A;  5GAN 2;  2E64 A;  2RPN A;  2JVV A;  4N0A A;  1SSF A;  4EPC A;  1VQ8 Q;  3V8K A;  2P4R A;  1PKT A;  3GOX A;  1YNZ A;  4JJD A;  3TEE A;  1S72 T;  4AMC A;  5LL6 S;  2DL5 A;  1XTD A;  3M0Q A;  2MOX A;  2NUT B;  1JU5 C;  5FU7 C;  2ZCF B;  1WYX A;  1Q7Y U;  2ZGW A;  2OAU A;  1VQL Q;  2KBT A;  5FW9 A;  2CZ1 B;  3A8M B;  1ZUU A;  3CEY A;  3ZEH A;  2WSE E;  3OYG A;  1M8M A;  3H0H A;  4LDY A;  5LJ5 e;  3QG1 A;  1KC8 C;  1LJO A;  4AG2 C;  1X2Q A;  2YRV A;  4LUE A;  3A8G B;  2KGT A;  2DL4 A;  5KYX A;  4C5H A;  4RKU E;  2HEQ A;  3EFO A;  3EG1 A;  4RMO A;  1SRM A;  2RQW A;  2QG9 B;  3OW2 S;  3CBP A;  1U3O A;  2KYM A;  3V7S A;  1K9A A;  2QTV A;  4XTX A;  3JCM e;  1WHH A;  3GF5 A;  2DL8 A;  3MO8 A;  3OYD A;  2K2M A;  1WHG A;  3TRE A;  3SB2 A;  3MHX A;  3JCM g;  3G7Z A;  4RCC A;  5FRN A;  5CKH A;  1VQP Q;  2LVM A;  3CD6 Q;  4ZTF A;  2JW4 A;  4KBM B;  3ZL7 C;  4WCI A;  2J05 A;  1K9M C;  2XMF A;  3VJP A;  1OU9 A;  1K8A C;  4MZP A;  5FRM A;  5GAO p;  4J9G A;  3VU3 C;  2AK5 A;  1AOJ A;  1HSQ A;  2A08 A;  2RI3 A;  1I81 A;  4PJO G;  3QYH B;  5AYF A;  3NMZ C;  1TTH B;  2NUT A;  2A0F B;  5LJ3 h;  3GNF B;  1AZG B;  4HCC A;  1D1A A;  1JBM A;  2O4X A;  3P8D A;  3CC4 A;  5IXB A;  4OMM A;  1EX4 A;  2DZ9 A;  1KC8 R;  3CCJ T;  3QKJ A;  1NE8 A;  1VQ5 T;  3CME T;  1ZSG A;  1NPR A;  2GF7 A;  1R0B G;  5IH2 A;  3HRS A;  3HKS A;  2LCL A;  4KRT A;  4L59 A;  3GBQ A;  3CCE Q;  4M77 F;  1RAD B;  4MDW A;  1WIE A;  1IB8 A;  2V8J A;  2VGM A;  1X6G A;  2HSP A;  3JCM V;  2RD1 A;  3JRZ A;  2OTJ T;  3EGX A;  2DET A;  1C6V X;  1GBR A;  1TUD A;  2GCX A;  3KUF A;  2VVK A;  3SD4 A;  1UEC A;  1K9M R;  1WI7 A;  4M78 E;  3JB9 J;  1K8A R;  4F7U B;  5GMK j;  1YP5 A;  3RES A;  4M77 D;  4JDS A;  1S72 Q;  3QYG B;  4RCB A;  5GAN 8;  2ATC B;  4JJB A;  3GIB A;  3JCM X;  3FB9 A;  2RQT A;  2W10 A;  3PTA A;  2EFI A;  2BTT A;  2LC4 A;  2KVQ G;  1PRM C;  3HSB A;  4F17 A;  3RMS A;  1JJ2 A;  2YWW A;  3QXE B;  2R5M A;  4FT2 A;  4O6J A;  3PGG A;  2CT4 A;  3TU4 K;  4CC3 A;  1G3W A;  1M4Z A;  1AWO A;  5GAO q;  1E7O A;  4PJO A;  3JV3 A;  1Q81 C;  5CKE A;  1YJN A;  1IHW A;  2ZPB B;  1KK7 A;  2DL7 A;  2KMT A;  2X4Y A;  5GAM h;  2O88 A;  2YDL A;  2CRE A;  3G4S A;  2A7Y A;  4DEX A;  2KRN A;  1VQN Q;  3OYL A;  1GCQ A;  3QSU A;  4KT0 E;  4MML A;  1K0X A;  3E19 A;  1M90 C;  1YHQ A;  2DTI A;  3HL8 A;  1VQ9 T;  1YJ9 T;  2E70 A;  1MHN A;  3RKW A;  4II1 A;  5GAN 5;  3WVD B;  5KH6 A;  1M9S A;  3OBW A;  5C0M A;  4F7U A;  4C92 E;  1VUB A;  1TUG B;  1ZA1 B;  5CCA A;  5A0G A;  2DD4 A;  4JS4 A;  3OW2 A;  1LOJ A;  2YHT A;  2IIM A;  4QVD A;  2KRS A;  1X6O A;  9ATC B;  1M30 A;  1NBE B;  1H92 A;  3VUB A;  1UDL A;  1JXM A;  2RHX A;  3CMA A;  1YIJ A;  3OSS C;  2EVR A;  1Q81 R;  4FU6 A;  2DA9 A;  4M7A F;  4HT8 A;  3OYY A;  1G83 A;  2BZX A;  3I5S A;  2Y90 A;  4MZT A;  4QKU A;  2PZ1 A;  3OB9 A;  3MP8 A;  5FRO A;  1RI9 A;  2CS7 A;  4JRQ A;  1S1N A;  3V8J A;  2K6D A;  2DVJ A;  3M56 A;  2OTJ Q;  4NL3 A;  1HD3 A;  1UUE A;  2L0A A;  1D3B B;  4OB3 B;  1M90 R;  5I2M A;  3MEW A;  2HL5 C;  4Z88 A;  1GL5 A;  2L2P A;  1AEY A;  4DBQ A;  1GFD A;  4M7A D;  5CQY A;  4QVC A;  3G6E Q;  3I56 A;  5KCO A;  4C8Q F;  2WAC A;  2MK5 A;  4M78 G;  4A4K A;  3I55 T;  1ZX6 A;  3G71 A;  3RKX A;  2ZPG B;  1R77 A;  1B34 A;  4FW2 A;  4OML A;  4EIK A;  1Y71 A;  1G5V A;  3JAM E;  2E1H A;  1WGS A;  2BKD N;  3VS5 A;  1VQK T;  2P0K A;  3VS4 A;  3PMI A;  2C0T A;  1K4U S;  1WNL A;  1IRE B;  5KYU A;  4C0G A;  3MKD A;  3CPW S;  3CCQ T;  1GRI A;  2PUK B;  1LNX A;  3X24 B;  4BE1 A;  1W2B P;  2FEI A;  2CZ7 B;  3CBO A;  2EYY A;  1VIE A;  1WFW A;  5DLQ E;  1WHJ A;  1SHG A;  5GMK i;  1QVP A;  1UB4 A;  3PVL A;  2QA4 Q;  1RL2 A;  1G8X A;  1Y07 A;  1Q86 C;  2EPD A;  3RBB B;  1RAH B;  4X9C A;  2BUD A;  1GBQ A;  5LJ5 h;  1YIT Q;  2YUQ A;  2ABL A;  2RI2 A;  1FYN A;  3M0P A;  2RK1 A;  4LN2 A;  2GQI A;  2QGF B;  3OYC A;  2XK0 A;  1YJ9 Q;  3UDC A;  4LDU A;  1FX7 A;  2M51 A;  2PQW A;  5C6S A;  2XG8 D;  2X3X D;  2XID A;  3JCM h;  1TWB A;  4M75 D;  2DL3 A;  2FRY A;  1OPL A;  4C92 G;  2BZY A;  1X43 A;  3C94 A;  1YJW A;  4LDX A;  2QXF A;  5GMK e;  3V8L A;  1Y96 A;  2F69 A;  2VYT A;  4L5G A;  1YFN A;  2VKN A;  1UJY A;  4FYX B;  1N9R A;  1NYF A;  3MEA A;  3NTK A;  3KBG A;  5FLX E;  3OQ5 A;  1ZUK A;  3FEO A;  5KYY A;  2VXF A;  4FIB A;  4E6R A;  3AT1 B;  1UEB A;  1KQS A;  2DYB A;  2EQK A;  5GMK l;  1Q86 R;  1JB0 E;  2LRQ A;  1M1K U;  8ATC B;  5IHI A;  4RG8 A;  1Y57 A;  3VRZ A;  2SEM A;  4R55 A;  2XDB A;  4BY6 C;  2ED1 A;  1H8K A;  2X4W A;  2XDD A;  2EIF A;  3CC7 T;  2FG0 A;  2XKO C;  3EG9 B;  5CAI A;  3THK A;  2FO0 A;  2ZZD A;  4PKC C;  3CCS T;  2E41 A;  4DA4 A;  4IIO A;  2QEX A;  4HKE A;  4KUL A;  4N4I A;  4XTV A;  2E5Q A;  1ZLM A;  2X9H A;  2JUF A;  3CCL Q;  2JTM A;  1OUL A;  1ZA2 B;  4M77 B;  3CCQ Q;  2IG0 A;  1K9M U;  4EMK B;  3QJ6 A;  2HMA A;  4E7K A;  2X3W D;  2YRD A;  2A3L A;  2COZ A;  5LJ5 d;  2CUB A;  2LNV A;  2K5L A;  1VOM A;  4IUV A;  2CDT A;  1VYT A;  1YI2 A;  5GAN j;  2ECZ A;  2QQ9 A;  4E7I A;  2F5K A;  2R57 A;  2MMP A;  4OMO A;  2EAY A;  3O8V A;  1FXX A;  3JCM d;  3MCA B;  3CPW A;  1VQ8 A;  2GTO A;  2E10 A;  2DAQ A;  1YN8 A;  4Z8A A;  2PUO B;  3GPL A;  2XHC A;  2E3I A;  4A54 A;  3ASK A;  2DEU A;  1QVG A;  1IHV A;  3PT9 A;  1EIF A;  4C5G A;  3M0T A;  2EQM A;  1VQL A;  2F1L A;  3SWN B;  2C0I A;  5HK0 A;  2EQI A;  3JCM J;  2MIO A;  3UA6 A;  4FCY A;  3CCU T;  1V29 B;  3UAT A;  3A1P A;  1OX8 A;  1QVF P;  1WPY A;  1XQH A;  1ZSZ C;  2YRC A;  3QJY A;  2FZC B;  2V1Q A;  1VQM T;  1PD0 A;  4HVU A;  4M7D D;  2J6K A;  4E7Z A;  3A98 A;  1X75 C;  4LDW A;  3CCM A;  3L1A A;  1VQ7 A;  1SG5 A;  1YBY A;  4GY5 A;  3DLM A;  4ZGJ B;  4M7D C;  2EKO A;  3SEM A;  2L3R A;  4QT7 A;  2K3Y A;  3M5A A;  1PRL C;  1VQP A;  4XTZ A;  4PJO E;  2OI3 A;  1B07 A;  3CD6 A;  3EHQ A;  2ROL A;  2SRC A;  1VQ4 T;  1FMW A;  5KE3 A;  2RM4 A;  2Z0W A;  5A0L A;  3NFC A;  2FRW A;  4JRP A;  2QQA A;  2KI7 A;  2P4T A;  1M1F A;  2HDA A;  3M55 A;  4HXJ A;  1HXD A;  4BB7 A;  4ANJ A;  2K57 A;  3VS0 A;  3OYB A;  2O2O A;  2AZV A;  3MEV A;  1VQO T;  5GMK m;  3VUZ A;  4M7A B;  2DYI A;  4Z89 A;  1SKU B;  1UGR B;  1EZZ B;  1M90 U;  4F7U E;  3H0I A;  5LJ3 f;  2EKH A;  1SHF A;  2BZ8 A;  2LX7 A;  2PVG B;  3S3M A;  1JQQ A;  4PLL A;  3P8H A;  3BE3 A;  1RAG B;  4M78 F;  3CCE A;  3C4S A;  2O31 A;  5KYW B;  4HVW A;  1WXT A;  2RO0 A;  1F1B B;  2IVW A;  3OYA A;  4BI3 A;  1U8R A;  2COW A;  3QZ9 B;  2BE9 B;  4GLK A;  2LCS A;  2EGC A;  1AZE A;  3PVQ A;  3TSW A;  3OA6 A;  3ZBD A;  2CP5 A;  1K73 U;  1N9S A;  7AT1 B;  3HPW A;  4F16 A;  1BI0 A;  2CZ6 B;  3QWY A;  1M3C A;  2KRO A;  2V8I A;  3A8L B;  2DX1 A;  3OYK A;  2ZPF B;  1YWP A;  4OB1 B;  1M1G A;  2KQW A;  1WJQ A;  4IUQ A;  4JJC A;  5LJ5 g;  2RF0 A;  5J3B A;  4XQ3 A;  1MV0 B;  1U5S A;  1MUZ A;  1E6G A;  2L8D A;  1NYG A;  4B9X A;  3MP6 A;  1A0N B;  4M75 B;  2E3H A;  1IO6 A;  2R58 A;  2FVU A;  5HKC A;  1M2V B;  1Z9Z A;  5GMK h;  2DMO A;  2NYS A;  3FJ5 A;  2JXB A;  1VQN A;  2L5Q A;  4C92 F;  5GAM f;  4BAC A;  1I1J A;  4XAX B;  1W2B S;  4XU1 A;  4OMP A;  4XU3 A;  2VXE A;  4JS5 A;  2AKL A;  1C0M A;  4IKF A;  1SEM A;  2O9S A;  3VS2 A;  5KE2 A;  2GBQ A;  1VQ4 Q;  3E9G A;  3HP9 A;  2RK2 A;  3BFM A;  4BY6 B;  2OTL Q;  4DBR A;  2K3B A;  3CC4 T;  3G1J A;  4C92 D;  1Q86 U;  3HFO A;  1E6H A;  1RAA B;  1MMG A;  3I35 A;  3LW5 E;  3J7A F;  2RJF A;  2JMA A;  2E6N A;  3HFN A;  4BE2 A;  2XDP A;  2LTO A;  2DFU A;  1OU8 A;  1KD1 U;  2D0N A;  3M4Y A;  2CH4 A;  1ZBX A;  2KY9 A;  2WSF E;  4F7U G;  5D6X A;  1PNJ A;  1VA7 A;  1RUW A;  4AT1 B;  1BI1 A;  2KT1 A;  3JB9 F;  2CKK A;  1M2V A;  2B8A A;  3JCM W;  4ATO A;  3PE0 A;  3L2R A;  2VUB A;  1NJI C;  3J81 E;  4M77 C;  3OMG A;  1M27 C;  5I11 A;  3G6E A;  2RHI A;  1TUC A;  4EMK C;  2AZS A;  3EGU A;  2OAW A;  1OX9 A;  3JB9 D;  2DRK A;  3NGP A;  3U23 A;  3JB9 H;  3NPF A;  1Q82 C;  2OJ2 A;  1N27 A;  4AFZ C;  1R0C B;  4JRK A;  1I8F A;  2KE9 A;  1WQ7 A;  3CC2 A;  3E1S A;  3C0C A;  1KFZ A;  1YJN T;  2EGE A;  5LJ3 j;  4DOV A;  3G4S T;  2JMC A;  2E12 A;  3ULR B;  3BDU A;  2QA4 A;  4HA8 A;  4ZNX A;  2HL3 A;  1ZSZ B;  2NUP B;  4CC7 A;  1YHQ T;  3OS5 A;  1NJI R;  5CKB A;  1YIT A;  3SWN C;  3EG3 A;  4MZM A;  1I5O B;  2KRM A;  2DKG A;  1PG5 B;  1TXQ A;  1QLY A;  2V1R A;  1KJW A;  2VGN A;  2YUO A;  5LJ5 f;  3VV0 A;  4M7D B;  3S6W A;  1D1B A;  2RHU A;  2AKK A;  2J7I A;  2L3Q A;  4XU2 A;  2YLC A;  3QBY A;  1JJ2 P;  2NUZ A;  1Q95 G;  1Q82 R;  3EFS A;  3CCJ Q;  3JCM f;  3CC4 Q;  1ZHI A;  4UC4 A;  1VQ5 Q;  3CME Q;  3J80 E;  2JM8 A;  2HAX A;  2GFU A;  1WX6 A;  3CMA T;  1UGV A;  1YIJ T;  4QW2 A;  3EH2 A;  3C95 A;  4J5Y A;  1ZBJ A;  1JEG A;  1W2B A;  2VWF A;  1N8R C;  2LJ1 A;  2QYZ A;  5ECA A;  4E2F B;  1SSH A;  2G6F X;  4J9D A;  3URG A;  1Q7Y C;  2DE0 X;  4OF1 A;  1BBZ A;  2EQU A;  3RKY A;  3OYN A;  3CCR A;  2EJ9 A;  3I56 T;  1ZSZ A;  3TSZ A;  5GAM j;  4M7A C;  4BD3 A;  3VS7 A;  3CXC P;  1QVF S;  1K1Z A;  3G71 T;  1MGQ A;  2FL7 A;  4RG2 A;  5CKF A;  1D09 B;  2LJ3 A;  2L3P A;  3I9Q A;  2ZPI B;  4M7D A;  3EH1 A;  3P8B B;  4N4H A;  1LCK A;  4D8D A;  4C8Q D;  2GNC A;  4JUV A;  2GQV A;  2WSC E;  4Y92 A;  3BW1 A;  3UWN A;  2KAF A;  3CCL A;  1M5Q 1;  4C8Q C;  1RAF B;  2JS2 A;  2JN0 A;  3QUI A;  1N8R R;  1U1S A;  1YJN Q;  2D9T A;  5CVI A;  1OZ3 A;  4OMF B;  3MPU B;  2EBP A;  4RTW A;  2F2V A;  1Q7Y R;  5M9O A;  3JSC A;  3ZFJ A;  1CSK A;  1ZUY A;  5CK9 A;  3R6O A;  4PJN A;  4XU0 A;  4F04 B;  4ZN1 A;  1D0Y A;  1O75 A;  1D3B A;  5FU6 C;  3KXT A;  4LDV A;  1VQ6 A;  1VQ9 Q;  2DXU A;  3FIF A;  1YHQ Q;  4TVR A;  4N4G A;  5D6Y A;  2HBW A;  4IUP A;  4LD9 K;  4X1V A;  3JCM P;  3E9F A;  3EG2 A;  3PMT A;  4RTZ A;  3RR6 A;  2EYX A;  4OP0 A;  1RI0 A;  1Y7X A;  3DB4 A;  1OZ2 A;  4M75 C;  1RAB B;  2DTH A;  1YJW T;  2EJG A;  1NM7 A;  2F2X A;  4F14 A;  2DTO A;  4KH0 B;  3I5R A;  2J6O A;  2HKN A;  3TVT A;  3VS1 A;  1I0C A;  5CIU A;  4VUB A;  4HVV A;  2DXT A;  1W1F A;  3C12 A;  4PFO A;  3X25 B;  2M02 A;  4R0K A;  3NTI A;  4IUU A;  5IXF A;  4KGV B;  2HQH A;  4C0D B;  2GGR A;  4J6Y A;  4PJO F;  1I07 A;  2QTX A;  1ABQ A;  1AHJ B;  2VC8 A;  3RIR A;  5IN1 A;  4DBF A;  4LUD A;  4DBH A;  4ME7 A;  4BUG A;  1KC8 U;  2M0O A;  2EW3 A;  1H64 1;  1OI1 A;  1UGS B;  3H9N A;  2LJ0 A;  4GLM A;  3CCV A;  3V7C A;  1GXI E;  1YCY A;  3I55 Q;  1BU1 A;  2JS0 A;  2RJE A;  2YT6 A;  4FYY B;  1BCO A;  1Z9Q A;  4M77 G;  3WXM B;  5GAO m;  4PJO D;  4J8O A;  2D1X A;  1WLP B;  3EGD B;  2BE7 D;  3JCM Q;  4ZN3 A;  2QEX T;  1VQK Q;  2IPO B;  4RTT A;  2CYZ B;  4KUD K;  4F7U F;  1OV3 A;  1BI3 A;  4LE9 A;  3VRY A;  3T9N A;  4A63 B;  3QDR B;  2EYW A;  3VKI A;  1UFF A;  5KYY B;  2LCC A;  1K8A U;  1KQ2 A;  2DXC A;  1WZO A;  4ORZ A;  4JPB W;  1KQS P;  2CUD A;  2E5K A;  2JT4 A;  2I0N A;  2XIC A;  3E2U A;  5IHK A;  1QVF A;  2ZPE B;  1N6A A;  1QWF A;  2YUP A;  3OYM A;  2X35 A;  1QKW A;  4BDY A;  2DK3 A;  4NS5 A;  3VS6 A;  1AWJ A;  3QZ5 B;  5GAO r;  1UGP B;  4ZTJ A;  2PVD B;  4C5I A;  3M53 A;  3F70 A;  1VQ8 T;  1HYO A;  2JTF A;  3EG9 A;  4PJL A;  2CP2 A;  2KR3 A;  3OMC A;  1U1T A;  3HRU A;  4M75 E;  3KFV A;  5GJV B;  3L42 A;  1HK9 A;  3M54 A;  1QW1 A;  2EYZ A;  3MJX A;  4OVA A;  1VQL T;  2K9G A;  4C5E A;  4PNO A;  4OB2 B;  1IXD A;  2LQK A;  1ABO A;  1D0Z A;  4M77 A;  5GAN d;  3FRN A;  2RHY A;  2EWN A;  2VAS A;  4EMK A;  1PCX A;  2HSE B;  2RHZ A; 
#chains in the Genus database with same CATH homology
 3FJ5 A;  2JXB A;  1Y0M A;  1I1J A;  4OMP A;  4JZ4 A;  4LNP A;  2K79 A;  2AKL A;  1SEM A;  2O9S A;  1WA7 A;  2IIM A;  2DLP A;  3VS2 A;  2KYB A;  2GBQ A;  4RTY A;  2KRS A;  1AD5 A;  1M30 A;  1JO8 A;  1H92 A;  1UDL A;  1X69 A;  3REB B;  2K7A A;  2K3B A;  1JXM A;  2QDL A;  2EVR A;  2DA9 A;  1E6H A;  1G83 A;  1KSW A;  2BZX A;  3I35 A;  3I5S A;  2KXC A;  2JMA A;  4J9F A;  2ESW A;  2PZ1 A;  5L23 A;  4J9B A;  1RI9 A;  2A36 A;  1S1N A;  2K6D A;  2DVJ A;  1HD3 A;  1UUE A;  2D0N A;  2L0A A;  4JZ3 A;  2MCN A;  1YWO A;  2J06 A;  2CH4 W;  2CH4 A;  4Z88 A;  4J9E A;  2NWM A;  1GL5 A;  2L2P A;  1PNJ A;  1U06 A;  1VA7 A;  1AEY A;  2FPD A;  1GFD A;  1RUW A;  5HCK A;  1W6X A;  2DJQ A;  3RNJ A;  2EGA A;  2KT1 A;  1UG1 A;  2FPE A;  2M0Y A;  1PKS A;  3EHR A;  1ZX6 A;  1NEG A;  3PE0 A;  1GCQ C;  3NHN A;  4OML A;  4EIK A;  3VS5 A;  4OMN A;  3VS4 A;  2C0T A;  1K4U S;  1OOT A;  2RQV A;  1M27 C;  5I11 A;  1GRI A;  1TUC A;  2CSI A;  2FEI A;  4CC4 B;  2EYY A;  1UHC A;  2AZS A;  1WFW A;  3EGU A;  4RUG A;  1HJD A;  2DBK A;  3UA7 A;  2OAW A;  2DRK A;  3NGP A;  3U23 A;  1SHG A;  1RLP C;  3NPF A;  1BK2 A;  2DF6 A;  2OJ2 A;  4AFZ C;  3PVL A;  4RTU A;  2LQN A;  5EC7 A;  1J3T A;  2KXD A;  3IQL A;  2EPD A;  1WXB A;  4J9I A;  2KE9 A;  3RBB B;  3C0C A;  1KFZ A;  1GBQ A;  4ESR A;  2EGE A;  3VS3 A;  2YUQ A;  5FWC A;  2ABL A;  2JMC A;  1ARK A;  1MV3 A;  1FYN A;  3M0P A;  4LN2 A;  4D8K A;  2CSQ A;  2GQI A;  3ULR B;  1T0J A;  4ZNX A;  3EG0 A;  1OPK A;  4GBQ A;  3M0U A;  2LZ6 B;  5GJW B;  2M51 A;  2DBM A;  2X3X D;  4CC7 A;  1H3H A;  2D8H A;  2DL3 A;  3EG3 A;  2KRM A;  3M0R A;  2FRY A;  1EFN A;  1OPL A;  2L3S A;  2BZY A;  1BB9 A;  1X43 A;  1QLY A;  2V1R A;  1KJW A;  2YUO A;  1KIK A;  1M3A A;  2LMJ A;  2RQR A;  5IHN A;  2AKK A;  2J7I A;  2L3Q A;  2VKN A;  1UJY A;  2KNB B;  1FMK A;  1NYF A;  1CKB A;  1W70 A;  2KT8 A;  2NUZ A;  1ZUK A;  1WDX A;  4E6R A;  2RMO A;  2D8J A;  2DYB A;  2ED0 A;  2JM8 A;  1UHF A;  2F2W A;  1NLO C;  4HCK A;  1WX6 A;  1UGV A;  5IHI A;  2RQU A;  1X6B A;  4J9C A;  1QCF A;  1ZBJ A;  2ENM A;  1Y57 A;  1JEG A;  4J9H A;  2VWF A;  1QWE A;  3VRZ A;  2LJ1 A;  1M3B A;  1WXU A;  2SEM A;  5ECA A;  1PWT A;  2ED1 A;  1H8K A;  1RLQ C;  2DM1 A;  1SSH A;  2G6F X;  4J9D A;  1X27 A;  2FG0 A;  2DE0 X;  1GFC A;  4OMQ A;  3THK A;  2FO0 A;  2H8H A;  4FSS A;  1OEB A;  1SRL A;  1BBZ A;  1UE9 A;  3LH5 A;  3REA B;  4IIO A;  1K0S A;  3TSZ A;  2YUN A;  3VS7 A;  2LP5 A;  2DIL A;  1VYV A;  2CT3 A;  1K1Z A;  4K11 A;  1YCS B;  1ZLM A;  3O5Z A;  2LJ3 A;  2L3P A;  2A28 A;  3I9Q A;  1AVZ C;  1NG2 A;  1PHT A;  1NLP C;  2RPN A;  1V1C A;  1LCK A;  4D8D A;  4CC2 A;  2X3W D;  2GNC A;  1AWW A;  1K76 A;  1GCP A;  2CUB A;  4Y92 A;  2P4R A;  1PKT A;  1YNZ A;  4JJD A;  2CDT A;  1VYT A;  2JS2 A;  2JM9 A;  2ECZ A;  4M4Z A;  2DL5 A;  3M0Q A;  2YSQ A;  2MOX A;  1JU5 C;  1T0H A;  2EBP A;  4RTW A;  4OMO A;  1WYX A;  2F2V A;  2C0O A;  2KBT A;  5FW9 A;  1CSK A;  1ZUU A;  2LNH B;  1ZUY A;  2GTO A;  1YN8 A;  4Z8A A;  1M8M A;  3H0H A;  3M0S A;  4DEY A;  2KEA A;  1T3L A;  4AG2 C;  1X2Q A;  4LUE A;  4IIM A;  2KGT A;  1TG0 A;  2DL4 A;  2HEQ A;  2J6F A;  2HBW A;  4X1V A;  3EG1 A;  3CQT A;  3EG2 A;  3M0T A;  4RTZ A;  1SRM A;  2RQW A;  5FWB A;  1NEB A;  2EYX A;  2C0I A;  1U3O A;  2KYM A;  1K9A A;  2EQI A;  4RTX A;  1XOV A;  2MIO A;  3UA6 A;  2DL8 A;  2K2M A;  4AFS C;  3UAT A;  1X2K A;  1N5Z A;  1UJ0 A;  1NM7 A;  2F2X A;  4F14 A;  3I5R A;  2V1Q A;  2JW4 A;  2J6O A;  3ZL7 C;  4WCI A;  2J05 A;  3TVT A;  2XMF A;  3SHW A;  4RTV A;  4HVU A;  2J6K A;  3VS1 A;  3A98 A;  1G2B A;  1I0C A;  4J9G A;  4HVV A;  1W1F A;  3SEM A;  2B86 A;  4QT7 A;  2AK5 A;  4R0K A;  1AOJ A;  5IXF A;  1PRL C;  1HSQ A;  2A08 A;  1VYU A;  2GGR A;  2OI3 A;  1B07 A;  1I07 A;  3EHQ A;  3NMZ C;  1ABQ A;  2ROL A;  2A37 A;  1AZG B;  2SRC A;  1UTI A;  4LUD A;  5IXB A;  2O9V A;  4OMM A;  2EW3 A;  4AFQ C;  2FRW A;  2LJ0 A;  4GLM A;  1ZSG A;  2HDA A;  4HXJ A;  5IH2 A;  3VS0 A;  4KRT A;  1BU1 A;  2JS0 A;  2O2O A;  3GBQ A;  2AZV A;  2ROT A;  2YT6 A;  1Z9Q A;  1WIE A;  2D1X A;  1WLP B;  4Z89 A;  2W0Z A;  1QKX A;  2JTE A;  4RTT A;  1X6G A;  2HSP A;  2FPF A;  3H0I A;  1JXO A;  1GBR A;  1TUD A;  2EKH A;  1OV3 A;  4LE9 A;  1SHF A;  3VRY A;  2BZ8 A;  2VVK A;  1B3Q A;  2DRM A;  1UEC A;  2LX7 A;  4A63 B;  1JQQ A;  1WI7 A;  2EYW A;  1UFF A;  3R6N A;  4ORZ A;  2O31 A;  1YP5 A;  4HVW A;  4JPB W;  1WXT A;  2CUD A;  2GTJ A;  3QWX X;  2E5K A;  1T3S A;  2JT4 A;  4JJB A;  2I0N A;  2RNA A;  2RQT A;  2W10 A;  5IHK A;  2BTT A;  2LCS A;  1QWF A;  1PRM C;  2YUP A;  1QKW A;  2EGC A;  1AZE A;  3PVQ A;  3TSW A;  4F17 A;  3VS6 A;  1AWJ A;  4F16 A;  3QWY A;  2KRO A;  1M3C A;  2CT4 A;  4CC3 A;  2HCK A;  2PNI A;  2DX1 A;  4AG1 C;  1AWO A;  1E7O A;  1YWP A;  3JV3 A;  3H41 A;  2KR3 A;  4JJC A;  2DL7 A;  2LQW A;  2PTK A;  3KFV A;  5GJV B;  2O88 A;  4AFU C;  2YDL A;  2CRE A;  2RF0 A;  2RN8 A;  1MV0 B;  1U5S A;  1MUZ A;  4DEX A;  1E6G A;  2EYZ A;  2KRN A;  3UF4 A;  1NYG A;  2K9G A;  1GCQ A;  1SPK A;  1A0N B;  1K0X A;  1ABO A;  2DNU A;  1IO6 A;  1Z9Z A;  1AWX A;  5I22 A;  2DMO A;  1CKA A;  3H0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...