2EHGA

Crystal structure of hyperthermophilic archaeal rnase hi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
149
structure length
149
Chain Sequence
MIIGYFDGLCEPKNPGGIATFGFVIYLDNRKIEGYGLAEKPFSINSTNNVAEYSGLICLMETMLRLGISSPIIKGDSQLVIKQMNGEYKVKAKRIIPLYEKAIELKKKLNATLIWVPREENKEADRLSRVAYELVRRGKLRDIGCIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Type 1 RNase H from a Hyperthermophilic Archaeon with Double-stranded RNA-dependent RNase Activity
rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords ribonuclease HI
total genus 49
structure length 149
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13456 RVT_3 Reverse transcriptase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ehgA00
4CIFA 3MXJA 2XO7A 3CFRA 3U6FA 1KRPA 4M3XA 1NK7A 3HJFA 1RT6A 1GOBA 1HYZA 4CJQA 4CF9A 3EY1A 4M3ZA 1EKEA 3CG7A 3KLEA 1HRHA 3SQ2A 1LAWA 3P5JA 2RPIA 3HXMA 3ZT4A 2IS3A 1VSLA 2WONA 3OYAA 1SV5A 1S1XA 2XY8A 3V81A 4F8RA 1IKYA 3G10A 4E3SA 4ELTA 2E6LA 2IDOA 3HVRA 1ASVA 2OPPA 4DU4A 4GVMA 3S3NA 4CCHA 3CFOA 3NF7A 3ZT3A 4AH9A 3OYNA 3L3VA 4FJIA 1O1WA 4FZZA 3AVMA 4RW6A 1JLFA 2ZQBA 2HHXA 3VA0A 4K8XA 5I3UA 3OYIA 3C6UA 1KSPA 1BL3A 5SZTA 4CJ4A 4CJ3A 4CHYA 1J5OA 2E6MA 4I7FA 4DSEA 4FJKA 3OYEA 5J2QA 2ETJA 3ITHA 4DTNA 1CXUA 2X6NA 3VQ8A 4DFKA 4CFAA 3SV3A 3AVFA 4PWDA 2HVHA 4FLWA 4BWJA 1J54A 3RTVA 1KFDA 4CJSA 3NF8A 3DLEA 3L2RA 2D5RA 4FLXA 1L3UA 1B9DA 5KRTA 4DTSA 2VG7A 2VWJA 1BISA 1Z26A 3VA3A 2Z1GA 3UIQA 4HCBA 3QNOA 3AVCA 3QESA 5DK5A 3MXMA 2OPRA 4CJPA 2G8HA 4B3OA 3U3GA 5C42A 3RMAA 4KREA 1BCOA 4CEQA 4FK4A 3K59A 1Q8IA 2HHQA 3LANA 2Z1JA 4OVLA 2HHTA 2P1JA 1TKXA 3DRRA 4IG0A 4OPKA 1Y97A 4FZYA 1VSKA 1YVUA 4FM0A 3MEEA 3MECA 3ZSWA 3QEPA 3OJSA 1RT4A 1TKTA 3LP0A 4O0IA 4OLBA 4AHUA 1RBRA 3AO1A 1W9HA 4LH4A 3D0PA 4C8LA 1RDDA 3AVIA 1R0AA 4B9VA 1BI4A 4F3OA 1KCFA 4MQ3A 3K5NA 3HK2A 3SPZA 1S9GA 4W5NA 1TL3A 1DTQA 2G8IA 1VRUA 4B08A 4DF4A 1BI4B 3PX0A 4FM1A 1WSEA 4FK0A 1EXQA 3QNNA 1UWBA 1K6YA 1BCMA 1YTAA 1WSGA 1NKEA 4I2PA 1RDCA 3NDKA 4BACA 4DQRA 4CEBA 4CJTA 1XI1A 1RDBA 2FBXA 1F21A 3AO3A 1TVRA 2B5JA 3O3GA 3TAPA 2PYJA 3V1QA 4CHNA 3CQ8A 4J2EA 4Z4FA 3AO5A 1ZBIA 2D0CA 2EX3A 3WNEA 2JLEA 1IO2A 3QINA 4DQIA 3KKRA 3EYZA 4DU3A 2A1SA 3ALYA 3NBPA 4KRFA 3V9UA 1JXBA 4CGIA 3L2VA 3VQEA 4CIGA 3C6TA 1C0TA 4OKEA 4QOZB 2X74A 4B9NA 4CEZA 3C94A 3LWMA 3PUFA 3ULDA 1KFSA 2YHBA 2D0BA 5FROA 3VQAA 3PX6A 3KJVA 1RCHA 3QIOA 4FW1A 3VQCA 4HUFA 3TANA 3KD5E 4KTZA 4MFBA 5J1EA 4BE2A 1U04A 3ISNC 3LPUA 4OKJA 1GOCA 4LD0A 4CGJA 4YNQA 2IC3A 1NOYA 1D8YA 2YNHA 2BE2A 1G15A 2ITGA 3QEWA 4KO0A 1ZBUA 4IFVA 1D5AA 4O55A 3LDSA 4O5BA 5C25A 5SWMA 3SQ4A 2XHBA 2HHSA 3CM6A 4DLEA 3V9ZA 1FKOA 5FDLA 1ZYQA 2PZSA 4ID1A 3OYHA 4E7KA 4ELVA 4KFBA 2X78A 3K2PA 1D9DA 4FJ5A 1RT1A 3TAQA 1EP4A 4M3RA 1C6VA 3KLFA 3VQPA 2ZE2A 1SUQA 1FKPA 3KK1A 3DYAA 3HPHA 1WLJA 4N56A 4FJJA 2JGUA 4DSJA 1HJRA 3KLIA 1X1PA 1U45A 4JRQA 1HNIA 3LAKA 3OS1A 3O4NA 1JKHA 4DS4A 2B4JA 1YT3A 3P1GA 4HTUA 4IKFA 4N76A 1T8EA 4NCGA 3OS2A 3OVNA 3I0RA 4DU1A 1JL2A 1XHXA 4ELUA 4M3YA 3NAEA 4NYNA 5CYQA 3O3FA 3OYGA 3B6OA 2HMIA 3PO4A 1IKWA 3VQ6A 3AO4A 1C1CA 3K5OA 3SUQA 4DFPA 1I39A 4BE1A 4B9LA 2DTUA 4NCAA 4EP5A 2HW3A 1BIUA 2KQ2A 2QKKA 3PO5A 1JL1A 1T05A 3DLHA 3AA3A 2OZSA 5T7BA 1RT7A 3QLHA 4JS4A 3AA5X 2P51A 2OYQA 4KPYA 3RMDA 3LPTA 3L2WA 4FLYA 4BE0A 3SYZA 4KB0A 4BWMA 3TAFA 3KK3A 3B6PA 5KTQA 3SPYA 4Y1CA 2QXFA 3T1AA 3KLHA 1BHLA 2BANA 5CZ2A 1RT3A 1UA0A 2GV9A 1JLAA 3ZT2A 1X9WA 4DSLA 5HBMA 4CEAA 4CHZA 4KTWA 1UOCA 1NJWA 3AV9A 3QEIA 4CJKA 3OYBA 1VK0A 3V1RA 3PY8A 1MU2A 4B8AB 1IG9A 4N5SA 3OYMA 4CFCA 4FJGA 2FBYA 3NFAA 4FLUA 4M3TA 3VN5A 4PY5A 3AVJA 3P83D 1SKRA 3AVGA 3OJUA 4DQPA 2Y1JA 1WN7A 3H08A 3V1OA 3LZIA 3HM9A 4KHWA 3ZSRA 4IDKA 4YFUA 1LAVA 1RBUA 1RNHA 2YKNA 1IH7A 3I0SA 3RMCA 4ID5A 3S3MA 4ZTJA 4EZ6A 3DM2A 3K5MA 4DF8A 4PUOA 4DTXA 1WNSA 1NOZA 3KKSA 2G8VA 1GOAA 4UQGA 3NGZA 4E89A 4FLVA 2PY5A 3BDPA 4CIEA 4FJNA 4AILC 3THVA 1YTUA 3HO1A 3RR7A 5HRRA 4CECA 2HNDA 4DQSA 5HRSA 3V9WA 2FBVA 3OYLA 3HSTB 4DTMA 2AJQA 4OKKA 3MEDA 4E1NA 3A2FA 4GMJB 3SI6A 1FXXA 1S9EA 2YV0X 1QSYA 3U3YA 4F4KA 4K8ZA 2YNFA 1CZBA 3DI6A 1N5YA 1RDAA 4KHYA 1QSSA 3QEVA 1SL1A 3ZT1A 4Q5VA 4CJLA 3SJJA 3DRPA 4FJLA 3D45A 4CGHA 1S1WA 1S1TA 2B6AA 4H8KA 4CFDA 3SNNA 1RT5A 3TABA 3I8DA 3ASMA 1TKDA 4DLGA 1LW2A 1TGOA 4H4OA 5HLFA 3DLBA 2F8SA 1CZ9A 3WNHA 2DFFA 1TK0A 4M3UA 4DMNA 4I9QA 5C24A 4CJFA 1ITGA 1RT2A 3NGIA 1KLNA 4J2AA 5CYMA 3PV8A 4B9TA 4DTOA 4DS5A 3VQ4A 1S6QA 4HCCA 1UAXA 1TL1A 3K58A 4EP4A 4FJ8A 4Z4EA 4CE9A 3S3OA 4OLAA 1RBVA 1FK9A 4FLTA 1NK9A 1NK5A 4HUGA 3M8PA 1VSJA 5I42A 4CGDA 4H4MA 3CYMA 1ZBFA 3VQ9A 3K5LA 3LP1A 1RTIA 4KHUA 1U47A 5FRMA 2VG6A 3AVNA 3HL8A 5CY4A 3MAQA 4XIUA 1BGXT 4LSNA 1B9FA 2G8KA 3EZ5A 4KB1A 4AHRA 4CJ5A 4W5QA 1NKBA 1TV6A 3HP9A 4F3TA 1JLGA 4LH5A 3OYFA 4R5PA 1L3SA 2VWKA 3KTQA 1NKCA 4CJWA 1RTDA 1S1UA 4DFJA 3SUOA 2Z1HA 4NCBA 1REVA 2I5JA 1N6QA 1LW0A 1U4BA 4ZHRA 3SQ0A 3L2UA 2G8WA 3VQQA 4GW6A 2DFEA 4CERA 3OYDA 3NHGA 3DLKA 4FJXA 1WSHA 4CHPA 4I9LA 1LWEA 1QS4A 1VSFA 4CK1A 4FLZA 1D9FA 4J2BA 1TK5A 4OGEA 1CXQA 1T03A 2BGGA 4FM2A 2KZZA 2Z1IA 3AVLA 3AVHA 1W0HA 3HT3A 4M42A 2DFHA 1XWLA 4E7JA 4E19A 3C95A 2G8FA 1HQEA 4OGCA 1WSFA 1WSJA 4M41A 5FRNA 1S5JA 4W5RA 4FVMA 3FFIA 4Z0UA 2XY7A 4FCYA 4FJ9A 4B8CA 2PYLA 3LALA 3ZCMA 3AVBA 2GBZA 3TAGA 2O4IA 4JS5A 1KVAA 4Q0BA 3E01A 4O4GA 1WAJA 3F9KA 3SCXA 2KFZA 2P5GA 3ZSZA 3TR8A 4FK2A 3VQ5A 5HRNA 5HRPA 4CJUA 2XY6A 4EZ9A 5K14A 3QO9A 1BQMA 3QEXA 3KLGA 3QIPA 4CF1A 3ZSQA 5J2PA 3TARA 3SUPA 3HP6A 3L2QA 3QERA 2KTQA 1KTQA 4IFYA 2ZD1A 3LWLA 1J9AA 2YNGA 3HPOA 2IGIA 3OYJA 3VQ7A 1S6PA 4FXDA 3V9XA 4NYFA 1VSDA 1NK6A 1A5VA 4DWIA 1TAUA 1C0UA 1JLBA 4CHQA 3NE6A 3VQBA 4CF2A 4KHQA 2GUIA 1U48A 4C8OA 1QE1A 3LAMA 2ATQA 4AHCA 1RTJA 1CLQA 3SV4A 3AO2A 4DTUA 1SKSA 4DFMA 4DSFA 4KI4A 4M3WA 1HNVA 3LP2A 2EHGA 1TK8A 1NK0A 2OA8A 3KK2A 1HMVA 4E7LA 4DSIA 2F8TA 1A5WA 5J2MA 3DOKA 1ASWA 3JYTA 2QK9A 4CEOA 4CGFA 4L8RB 3M8SA 1RTHA 5CZ1A 2P5OA 4KAZA 3T3FA 3NH1A 4CGGA 3S9HA 1HPZA 5HROA 1Z25A 4B9MA 4ZTFA 1U49A 4CJEA 2OZMA 4KHSA 4CF0A 3DRSA 3L8BA 1L3VA 3O3HA 3AA2A 3PX4A 1NJXA 1JXEA 4OJRA 4QAGA 1IKXA 3ZSOA 5KGXA 3NH0A 1NJYA 2OPSA 3QETA 5DMRA 3F73A 4HHTA 2HHWA 1IKVA 1C1AA 4HVJA 1JLQA 1TAQA 4JLHA 5JS2A 2Y1IA 1SL2A 4RG8A 3KD1E 1JLCA 1BQNA 1HQUA 3O4QA 2W42A 2IOCA 3WNFA 3V9SA 3MEGA 1QSLA 2G8UA 2HVIA 4E7HA 4CEFA 1Q9XA 3DLGA 3MXIA 4N47A 4CK3A 1A5XA 1QHTA 3HYFA 3RRHA 2YNIA 4CHOA 1KVCA 1WAFA 3AA4A 4Z4GA 4W5OA 3V6DA 4B9UA 3OYCA 2KFNA 2E4LA 1RBTA 2HNYA 3SUNA 1QQCA 1VSIA 2RN2A 3OYKA 5EU7A 3IRXA 5E41A 2YHAA 3IS9A 4FZXC 4QCLA 3DLRA 2F96A 4C8NA 3ZSYA 4BDYA 4C8KA 1EX4A 4C8MA 1RILA 4LY7A 3JSMA 3WNGA 1TKZA 2FC0A 2LSNA 4E0DA 4TSXA 1Q9YA 4DSKA 2RKIA 4DG1A 3RWUA 2WOMA 4J2DA 4AHVA 3DMJA 4DTRA 4KTQA 1BIZA 4KHNA 1LWFA 1VSMA 4RW8A 1KLMA 4KV8A 1HYVA 5KI6A 4ICLA 1L3TA 1B92A 3ZSVA 2KW4A 3OY9A 3RR8A 2X6SA 2FBTA 5JS1A 3NF9A 1VSEA 1ZBHA 2VG5A 2KZMA 4M45A 5HP1A 4CFBA 1NJZA 4KKOA 4F2RA 4PA1A 4AHTA 3NF6A 2HNZA 3DOLA 1VSHA 4O0JA 4HUEA 3LP3A 1LV5A 4BDZA 1I3AA 4Z4HA 5KRSA 3M8RA 2HB5A 1T7PA 4AHSA 4E1MA 1DTTA 4Z4CA 4CEDA 3CFPA 4DQQA 3ZT0A 3AVAA 4I2QA 1XHZA 3TAEA 3TWHA 1NK4A 3HPGA 2XRIA 5KGWA 3HVTA 4OPJA 3LZJA 3RRGA 4FJ7A 4N41A 5J2NA 3AVKA 3TAMA 1C0MA 5D3GA 4PQUA 4E7IA 1X9MA 4CESA 4FW2A 4IBNA 4BDPA 4JRPA 3NCIA 4RW4A 2BDPA 4CF8A 4FJMA 3VQDA 1NK8A 3K57A 2HHUA 2IAJA 1WSIA 3RMBA 3BGRA 3G0ZA 1DLOA 2Q3SA 3T19A 4DTPA 4F2SA 1JLEA 1SKWA 4O44A 1HYSA 1UA1A 1J53A 2NUBA 1QTMA 2R7YA 3NGYA 4RW7A 4Y1DA 3KIOA 3SZ2A 2QKBA 2A1RA 4FYDA 3IAYA 1EETA 3OS0A 1LWCA 2DY4A 4G1QA 3M8QA 4DTJA 1XC9A 1C1BA 1L5UA 2OPQA 4RW9A 4Z4IA 3L3UA 4CK2A 4KI6A 1ASUA 1KVBA 4LSLA 1RBSA 2RF2A 3CM5A 1S1VA 2O4GA 3NH2A 1SL0A 4B9SA 3TI0A 4WE1A 2XY5A 3IG1A 2YKMA 4W5TA 4CJRA 4IG3A 1X9SA 3ZSXA 3V4IA 3SQ1A 4FJHA 2HHVA 4CJVA 2D0AA 1ZBLA 1VRTA 4CEEA
chains in the Genus database with same CATH superfamily
2XO7A 3VGMA 3SK3A 3HJFA 1RT6A 1HYZA 4M3ZA 3BP8A 5AQSA 1LAWA 3HXMA 1VSLA 4FWMA 3OYAA 1S1XA 5BPMA 2XY8A 2GWJA 3G10A 5BPLA 1NM1A 1ASVA 1SAZA 3S3NA 1KAZA 2YHXA 3CFOA 3ZT3A 4AM7A 3FLCO 4H0PA 1JLFA 3ID8A 5I3UA 1BL3A 4CJ4A 3A5LC 3ITHA 2Q2RA 3E66A 4DFKA 4U7BA 3AVFA 4PWDA 2FSKA 4WQ4C 1JCGA 2CGKA 1KFDA 1KC8O 1J5EK 3NF8A 2D5RA 2QI2A 1B9DA 4DTSA 2VG7A 1Z26A 3CETA 3UIQA 1K73O 2OPRA 3U3GA 5LL6Z 2VYPA 3RMAA 1BCOA 4FK4A 4JI8K 4JEPA 3U9ZA 2HHQA 2NZTA 2Z1JA 1TKXA 2CGJA 1YVUA 4FM0A 2UXDK 1WUAA 4OLBA 4O0IA 2GX9A 1W9HA 4FO0A 4LH4A 4JKEA 1IJJA 1BI4A 4JK8A 3MCPA 5AZIB 4W5NA 1TL3A 2PBDA 1DTQA 2E88A 4B08A 4JI7K 1WSEA 4FK0A 5FLXO 5AQZA 2F4VK 4H0VB 4MO5A 4NLBA 1UWBA 2P9LA 1K6YA 2NNWA 4BRIA 4LC9B 2NLXA 4DQRA 1TVRA 5TKWA 3D2FA 3WXIA 3IDHA 2A40A 3P38A 1C0FA 1X9JA 2A1SA 4JI2K 4BC5A 4DU3A 2ZJPL 4CGIA 3VQEA 4OKEA 4QOZB 2X74A 3CIPA 4B9NA 5C2FA 3ULDA 5FROA 3DAWA 1NGCA 4FW1A 3VF6A 3CMEN 3KD5E 4MFBA 4RWTA 4JKBA 4EHTA 4JI1K 4BRHA 4CZGA 3CPEA 3EEQA 5GINA 2BE2A 2ITGA 1D5AA 5SWMA 5C25A 1MWMA 3CM6A 1E4FT 3HTVA 1FKOA 3TSPA 5EVZA 4ID1A 3WEEB 4E7KA 2X78A 4FJ5A 3KLFA 3DXMA 1OVYA 4BY9C 4FWLA 4N56A 4FJJA 5ELZA 4DSJA 2ASOA 1HJRA 1HNWK 4JRQA 4M7XA 4DS4A 2HBLA 2B4JA 1YT3A 3P1GA 2QTDA 1BWFO 3OS2A 1JL2A 1XHXA 3D2FB 4WQ5A 2P9PA 2W41A 3B6OA 3T7ZA 5FPDA 2GWKA 2VWBA 3K5OA 4E1JA 1HPMA 5C15A 4BE1A 2DTUA 3J7ZO 1BIUA 4BG8A 3M6GA 2OZSA 2QKKA 1T05A 1HNZK 3VEOA 4BC4A 4FLYA 3SYZA 4KB0A 1T44A 3B6PA 2P9IA 2QXFA 1BHLA 1RT3A 3FZMA 4DSLA 4KTWA 1NJWA 3O9RA 3CMAN 3PY8A 4B8AB 3OYMA 1W97L 1EWRA 2E20A 1SKRA 5EXWA 4DQPA 5IT9O 4YFUA 1LAVA 2YKNA 3RMCA 4ZTJA 3K5MA 4JI4K 3KKSA 3L6QA 2PY5A 4E89A 1HX1A 4KH6A 3RSEA 3THVA 2I7PA 3OYLA 3HSTB 3MEDA 4GMJB 3W3DA 3J81O 3U3YA 3QFUA 1CZAN 5ADXA 4B1YB 5EOYA 1QSSA 3ZT1A 3SJJA 1NGFA 3FFKB 4CZEA 3SBGA 1EO1A 4A62A 3U9DA 4CFDA 4B3SK 4JV5K 4DLGA 3H1VX 4PHTX 1KD1O 4JKFA 4BRLA 4WFAL 4I9QA 1RT2A 1VQ5N 5CYMA 4ISFA 1YJNN 2P9NB 3PV8A 4J2AA 4DTOA 4YOVA 4HCCA 4FWSA 3WXMB 5GAEP 5I9EB 4FLTA 1IBMK 2E1ZA 3M8PA 1VSJA 4CGDA 3VTHA 3VQ9A 3LP1A 1YXQA 5BRDA 4X64K 1N8RO 4KHUA 1YAGA 3HL8A 3MAQA 1ATNA 1BGXT 3CHWA 4XIUA 4M7YA 5AQQA 3EZ5A 4B1WB 4JI5K 2E2OA 1WBDA 1L3SA 4R5PA 2VWKA 3CCUN 4CJWA 2Z1HA 1N6QA 3L2UA 5CHIA 3VQQA 1YHQN 3VPZA 4CERA 4AQYK 3F2KA 3DLKA 4A5AA 3VEZA 1N36K 2BGGA 2KZZA 4E19A 3C95A 5FRNA 3VF4A 1NBWA 4B8CA 3AAQA 3SCXA 3NVMA 4FK2A 3VQ5A 5HRPA 3ATVA 2O8DA 3QIPA 3ZSQA 5J2PA 1JCFA 3W0LA 3CQXA 2V7YA 3VF2A 4OX9K 3SMPA 2FXUA 3OYJA 1VSDA 1TAUA 3CJ1A 5C12A 4DV1K 4CHQA 3VQBA 1YVNA 4LF9K 4C8OA 2O8CA 2J4RA 2HF4A 3AO2A 3P4IA 1BUPA 2UU9K 2OANA 2PAVA 1WOQA 4CGFA 3SMSA 3CXCM 1HUXA 1Z25A 1O13A 5HL7L 4IEEA 3THWA 3SLCA 1L3VA 4LF4K 4OJRA 3QETA 3F73A 4FPAA 3O80A 4HHTA 4H03B 1C1AA 1JLQA 5JS2A 5GADP 3V9SA 3WNFA 1Q9XA 4CK3A 5LJWA 4JI0K 1JJ2M 1A5XA 3VGLA 4XH1A 1NU0A 2YNIA 2YJFA 3AA4A 4JK9A 3PSFA 4H5TA 5A2QO 5JMVA 3IS9A 1NGDA 4ISGA 4C8KA 2VGNA 4FWRA 3JSMA 3D6RA 1QVGM 4E0DA 1Q81O 1HR0K 4AHVA 3DMJA 1M1KO 1BIZA 1LWFA 4RW8A 1KLMA 4FPBA 5KI6A 1NJIO 3O5BA 5BN9A 3OY9A 1VQ6N 2FBTA 2KZMA 3CD6N 4F2RA 5CE3A 4O0JA 3C65A 4BVPA 1Q86O 1T7PA 2VQFK 2OCEA 3N4QA 1DTTA 2YHWA 4XH4A 4CEDA 4E1MA 3ZT0A 4Z4CA 3CFPA 1XHZA 4DV6K 3TAEA 1T6DA 3HPGA 3MDQA 5AQHA 3RRGA 5J2NA 1BOTO 3TAMA 2BUPA 3ENBA 1NWKA 4FW2A 4BDPA 4JRPA 4FJMA 4I6MB 3RMBA 3AARA 1DLOA 3T19A 4DTPA 1JLEA 3KZBA 1NNEA 4RTFD 2R7YA 4Y1DA 3MCAB 2RHKA 2A1RA 3OS0A 2DY4A 3CJBA 3UKRA 2OPQA 3QFPA 4Z4IA 4CK2A 1YIJN 1ASUA 1KVBA 5KPTA 3LDPA 4YDUC 4CJ7A 2QA4N 2XY5A 1XNQK 1NMDA 4IG3A 3THYA 1X9SA 4BR9A 3V4IA 3SQ1A 4FJHA 4FVMA 4GV3A 3CCVN 3O1WA 4CEEA 3MXJA 4X62K 4JK7A 2YHYA 2E8AA 1MDUB 3CG7A 3PSIA 2RPIA 3ZT4A 2Q0RA 2EWSA 2IS3A 3BY5A 2WONA 3CF5L 5B8HA 3U8XA 4E3SA 4BRDA 3HVRA 2OPPA 4CZLA 5AZJB 4DU4A 4CCHA 3OYNA 2ZJQL 4FZZA 4RW6A 5AQYA 2ZQBA 3A5NC 3VA0A 3OYIA 5SZTA 4CJ3A 4CHYA 1J5OA 3IFRA 4I7FA 4DSEA 5CR4A 3OHRA 5J2QA 2ETJA 4DTNA 1CXUA 1YUWA 4CFAA 3E9OA 4V19S 4YOXA 3T1HK 2JWLA 5KRTA 2VWJA 1BISA 2Z1GA 1TYQB 4CJPA 5LJVA 3WEEA 3K59A 1Q8IA 4GKJK 2W6KA 3AAPA 3LANA 2HHTA 4IG0A 4OPKA 4FZYA 3IMXA 3ZSWA 3OTOK 5BREA 2ZM6K 3OJSA 3WQTA 1RBRA 3AO1A 3D0PA 4C1NK 3PIOL 1NGHA 4MQ3A 3K5NA 2G8IA 1NGEA 3PX0A 1OH7A 4XEIA 2UYTA 3QNNA 4I2PA 1RDCA 4BACA 4CEBA 4CJTA 1IBKK 1RDBA 5GIOA 1FJGK 3CQ8A 2P9LB 2EX3A 1RGIA 4DV2K 1IO2A 3EYZA 3GBTA 1JXBA 3L2VA 3V9UA 1DT9A 4CIGA 4JI6K 4CEZA 3C94A 3LWMA 1KFSA 2D0BA 3VQAA 1X3NA 1QQOA 3ZX0A 4HUFA 3LPUA 4LD0A 1GOCA 4CGJA 1D8YA 1XC3A 2YNHA 2YJEA 3T69A 1G15A 3K9JA 4IDHA 3SQ4A 2XHBA 3V9ZA 5FDLA 4ELVA 5BN8A 3VETA 2A42A 1LCUA 3VENA 3TAQA 3NVKA 3KK1A 3HPHA 1WLJA 2ZGYA 2JGUA 2NRWA 3CCRN 5AQUA 3KLIA 1X1PA 3LAKA 3OS1A 3OVNA 3I0RA 4DU1A 4WFBL 3NAEA 4NYNA 5CYQA 3OYGA 2HMIA 1C1CA 3MN9A 1ATRA 4IXCA 1I39A 1SZ2A 3DLLL 4EP5A 2HW3A 1RT7A 3QLHA 3AA5X 2OYQA 4KPYA 4BE0A 4BWMA 3TAFA 5AFUA 3KK3A 4Y1CA 3O9SA 4A59A 3T1AA 3I33A 2NRRA 1X9WA 1JLAA 4KBOA 4CEAA 4DR4K 4BRKA 1UOCA 3QEIA 4CJKA 2WUSA 1MU2A 2Q36A 3ZX2A 1IG9A 2FBYA 4H0TB 1TUYA 3AVJA 3G4SN 4R79A 2Y1JA 1WN7A 3H08A 3D2EB 3S3MA 1RNHA 3I0SA 4EZ6A 1WNSA 4CI6A 3MMVA 2AP1A 4QS7A 4CECA 2QWPA 2HNDA 3EN9A 3V9WA 4DQSA 3EKSA 2ZF5O 3A2FA 1FXXA 2YV0X 4F4KA 3EL2A 1KQSM 5F2RA 3OBYA 3TSQA 3LDQA 3WT0A 4HTLA 3DRPA 3D45A 3VEWA 2W6LA 4CGHA 4H5NA 5GAHP 3R8EA 3I8DA 2P9KA 3NMUA 1TGOA 4YOUA 4H4OA 5DM6L 1HJOA 3DLBA 3WNHA 2F8SA 2DFFA 4NXNK 4DMNA 2WC9A 4OO1J 4MDAA 4DS5A 3VQ4A 4K42A 1S6QA 3DWLA 3K58A 4EP4A 3CJ9A 4DR7K 4JKAA 4CE9A 4GNIA 2GELA 2P9KB 4OLAA 2QW9A 1NK5A 3ATUA 5I42A 3CYMA 1E3MA 1ZBFA 1D4XA 1U47A 5AQLA 4PL8A 4A61A 3HI0A 1P90A 4KB1A 2Q1NA 4F3TA 4LH5A 3O4WA 3DJCA 3FZHA 3ZEUB 2I5JA 2PFUA 1U4BA 3SQ0A 3OBWA 3C7NA 2JWKA 4GW6A 2DFEA 2D0OA 4A57A 4L3QA 4FJXA 3U4LA 4CHPA 1LWEA 2O8CB 3CI5A 4OGEA 5IWAK 4FM2A 3MN6A 3CJ7A 3THWB 4OPAA 3HT3A 3JXUA 2DFHA 1XWLA 4E7JA 1HQEA 1VAZA 1WSFA 4OGCA 4M41A 3E1YA 3FFIA 3FZLA 3CCJN 2PYLA 4ILJA 1IG8A 3AVBA 2GBZA 3FE1A 2O4IA 1KVAA 3H45C 2P5GA 4O8KA 3QO9A 3QEXA 1DEJA 2F7TA 2YCHA 3KLGA 4CF1A 1XMOK 3SUPA 3HP6A 4YY3K 4B3MK 2KTQA 4IZ9A 4IFYA 1QQMA 1J9AA 2YNGA 2D1KA 3R1XA 2IGIA 3VQ7A 4NYFA 1A5VA 2D4WA 1C0UA 3P39A 3NE6A 3VERA 1U48A 2YI1A 1QE1A 4AHCA 3EE9A 3H3OB 4DTUA 1SKSA 4KI4A 4M3WA 3KK2A 1HMVA 4E7LA 3CCSN 4DHYA 1ASWA 3JYTA 4IOAL 4DV0K 3DXMB 4CEOA 3GG4A 4PKGA 3M8SA 2P5OA 4B3RK 1VQ9N 3S9HA 4FL9A 1KAXA 5AFUH 4CF0A 3PX4A 4GV6A 3TTFA 1NJYA 1IKVA 1BU6O 4HVJA 1U2VB 1TAQA 4K43A 1LOTB 1NMNA 3KD1E 1JLCA 1QSLA 3MEGA 1H1VA 4CEFA 3DLGA 4XH5A 4JKGA 3RRHA 4JYAK 4FWOA 4B9UA 4BRCA 4DB3A 3TU5A 4FOEA 3OYKA 2YHAA 4FZXC 4QCLA 1KXPA 4CZIA 3ZSYA 1VQ7N 4LY7A 3DXKB 2QWNA 3SJHA 2LSNA 4TSXA 3ULEA 1Q9YA 4DSKA 1W2BM 3FGUA 5M1QA 2Q0UA 4BR5A 4DTRA 4CBUA 1GLDG 4KTQA 4KHNA 1TUUA 4BRGA 1HYVA 4ICLA 3ZSVA 4A2BA 2IVPA 5JS1A 5BR9A 1ZBHA 3VEYA 2E2NA 3NF6A 1VQON 3DOLA 1VSHA 3FZKA 4EFHA 4BDZA 4DV7K 4Z4HA 3IUCA 2W40A 3M8RA 2HB5A 4UY8O 2ASPA 3M1FA 2XRIA 5GIPA 4OPJA 3LZJA 4FJ7A 4N41A 1BO5O 1OH6A 3AVKA 4CESA 4YOYA 4BR0A 2BDPA 4RW4A 4NLCA 1WSIA 3G0ZA 4F2SA 2Q31A 2HMPA 1UA1A 3BZCA 4JNEA 2QWOA 3VTIA 2A41A 3IAYA 5AQOA 1WBBA 2P9PB 1ESVA 4DTJA 4DR3K 4CBWA 3G6EN 3KVGA 3L3UA 1VQ4N 1IV0A 1RBSA 1SL0A 1RDUA 4FSVA 2UUBK 3M5RA 2D0AA 3NCIA 1N33K 4BRMA 2CH5A 2E1YA 3CFRA 3O08A 1NK7A 4M63C 2FLOA 4CF9A 3EY1A 2OTJN 1EKEA 2P9NA 2QWQA 1HRHA 4CZHA 3KLEA 3HOSA 2KLAA 4CZMA 3LM9A 1SV5A 4LF5K 3V81A 2HF3A 1IKYA 4ELTA 3CCEN 3E9PA 4CD3A 3MK6A 4AH9A 3L3VA 4FJIA 1N32K 2OTLN 4H5VA 1KSPA 4WFNL 3O9QA 1Z6RA 3OYEA 3CJCA 2X6NA 3J8AA 2IVOA 3SV3A 2NRTA 3JAMO 3CC4N 3LM2A 3MX5A 2HVHA 3RTVA 1J54A 3R9PA 4CJSA 2NRHA 4BVOA 3QNOA 2G8HA 4YORA 5DK5A 5AQMA 3MXMA 3GE1A 4KREA 5DM7L 3UKRB 2P1JA 1ZBSA 2O8BA 1Y97A 1VSKA 4IOXA 3PLAA 1NGJA 1TKTA 4AHUA 3CCQN 4C8LA 4DV3K 2P9UB 2WFBA 1RDDA 1R0AA 4F3OA 3SPZA 1S9GA 1VRUA 2WTUA 4DF4A 1BI4B 1QHAA 1S22A 1YTAA 1BCMA 1WSGA 5F1XA 3NDKA 1NKEA 4BQZA 1N34K 1XI1A 2CH6A 2FBXA 3WXLA 3O3GA 3TAPA 2PYJA 4Z4FA 4CHNA 4JAXA 1ZBIA 5AQGA 3QINA 3KKRA 4KRFA 3ALYA 3NBPA 3C6TA 4DUYK 2UXCK 3BEXA 3ZYYX 3PX6A 3KJVA 3GL1A 4BE2A 3ZEUA 1U04A 4OKJA 4DR6K 4YNQA 2YX6A 3KHYA 1NOYA 3UKUB 4JD2B 3THXA 3QEWA 5AQNA 4JD2A 1ZBUA 2ZGZA 4IFVA 3M3ZA 4KO0A 4O55A 3UKUA 3LDSA 4H0OA 4YOTA 4DLEA 2PZSA 1ZYQA 3OYHA 3K2PA 1D9DA 1NGAA 4M3RA 4DV5K 1XUPO 2E2PA 3VQPA 4JKGB 1SUQA 5JLHA 1FKPA 2IVNA 3DYAA 3L4QA 1U45A 1HNIA 3O4NA 4YOWA 1OH8A 1T8EA 4NCGA 3I55N 3OW2M 1NG9A 4J8FA 3AO4A 4KHPK 3THYB 1QVFM 4NCAA 3LL3A 1JL1A 1ZXOA 3DLHA 3QB0A 4JS4A 3P31A 2O8DB 1FW6A 3O8MA 3LPTA 2V51B 3VGKA 3QICA 5KTQA 3KLHA 1UA0A 4OPHA 5HBMA 4FWPA 4CHZA 4H5RA 4JHDA 3V1RA 5TKYA 1G99A 4LFAK 1HLUA 4N5SA 4PY5A 4CFCA 4M3TA 3VN5A 4WQ5C 3AVGA 3OJUA 3LZIA 3V1OA 1ATSA 4IDKA 2GTDA 1RBUA 4BRFA 4EAHD 4BGAA 2G8VA 1GOAA 4UQGA 3NGZA 4FLVA 1J6ZA 2ASMA 4CIEA 4FJNA 4AILC 1YTUA 1U6ZA 3WUHA 5HRSA 1VQKN 3Q7BA 2P9SB 4E1NA 1GLAG 4K8ZA 1CZBA 3DI6A 1RDAA 3L0QA 1SL1A 4CJLA 4FJLA 1JCEA 1S1WA 1S1TA 2B6AA 4H8KA 5EX5A 3VESA 3C7NB 3TABA 3ASMA 4JKCA 2F9WA 1LW2A 3ENHA 5HLFA 1CZ9A 3QMLA 3FZFA 2VQEK 4LF7K 3VMFB 3C6HA 4CJFA 1ITGA 4NO7A 2NRXA 4B9TA 4GKKK 1KAYA 1SQKA 4B3TK 5AJ3K 1UAXA 3A8YA 3WXKA 1T3VA 4FJ8A 4Z4EA 3KWGA 3S3OA 3VEVA 3J80O 1NK9A 5AQWA 4DKWA 3TTCA 4H4MA 3K5LA 1V4SA 3AVNA 3HM8A 4LSNA 4U67L 2G8KA 5MLCQ 1NKBA 3A5MC 1TV6A 1YITN 3HP9A 1JLGA 2AA4A 5JICA 5AQRA 2V7ZA 3K0SA 1NKCA 5BPNA 1RTDA 4DFJA 3SUOA 4LF6K 4NCBA 5FPMA 1LW0A 4ZHRA 4BROA 3NHGA 4JN4A 1WSHA 4FWQA 4CK1A 1D9FA 4J2BA 1TK5A 1T03A 4X66K 4M42A 1ZC6A 4NB4A 2G8FA 2UUAK 5AQIA 1K8KA 3CERA 4C1NI 2XY7A 4DV4K 3LALA 4EHUA 3TAGA 2NRVA 4JS5A 2H3GX 4O4GA 1WAJA 2KFZA 5M1KA 3T1YK 2XY6A 4EZ9A 5K14A 1BQMA 5C10A 3O6WA 3L2QA 3MWPA 3HPOA 4B9QA 1S6PA 4FXDA 3V9XA 4H5WA 4CZJA 1JLBA 4CF2A 4CD1A 2P9IB 5H1SQ 4CBXA 1CLQA 4G9ZA 3LDLA 4IJAA 3LP2A 1TK8A 2OA8A 2F8TA 4A2AA 1A5WA 3DOKA 1XQSC 4L8RB 1RTHA 4KAZA 4PL7A 3HBTA 4BC2A 1K8KB 3J7YP 4ZTFA 4QS9A 4CJEA 3MN5A 3UE5A 2OZMA 4KHSA 3DRSA 3L8BA 2A6AA 3O3HA 1JXEA 4QAGA 4Z94A 1OKJA 1IKXA 3ZSOA 3NH0A 2OPSA 3GOIA 3LDOA 5DMRA 2KHOA 3F5TA 2HHWA 5AQFA 2Y1IA 1SL2A 4RG8A 5HOOA 3BF1A 4ILGB 1BQNA 3O4QA 1YJ9N 2HVIA 1ILYA 1Q7YO 4N47A 4BC3A 3HYFA 5E26A 3BUZB 1WAFA 4W5OA 3V6DA 3OYCA 2KFNA 3SBTA 4BREA 2ZJRL 3IRXA 5E41A 3CC2N 1Z05A 2F96A 4C8NA 4BDYA 1EX4A 4C8MA 1RILA 3WNGA 4J2DA 2RKIA 4DG1A 3RWUA 2WOMA 2ZWHA 4IOCL 4YHHK 1VSMA 4KV8A 1L3TA 2KW4A 3RR8A 2X6SA 5F0XA 2VG5A 4M45A 5HP1A 1NLVA 1NJZA 2UXBK 5KPRA 4PA1A 1YF5L 3IKMA 2HNZA 5KQ8A 3LP3A 4B1ZA 1I3AA 5KRSA 2QWMA 2VGMA 4AHSA 3R3LA 3N4PA 1E4GT 4DR2K 1NK4A 5KGWA 5M1FA 2HSTA 1C0MA 2WBNA 4E7IA 3QBWA 3AGRA 3K9KA 1VQNN 3H3NO 4CF8A 3VQDA 1XNRK 1EQYA 2IAJA 1C0GA 4DCHA 4BQLA 3ULEB 1GLJO 1J53A 2QM1A 3NGYA 4RW7A 3KIOA 3SZ2A 4FYDA 1GLFO 1LWCA 3M8QA 2QXLA 4JKDA 4RW9A 5M1PA 4KI6A 3E9LA 4GY2B 2E5LK 4LSLA 2RF2A 3CM5A 1S1VA 2O4GA 3HSCA 5AQTA 4W5TA 4CJRA 2O8EB 1ZBLA 1VRTA 4CIFA 1KRPA 3U6FA 4M3XA 5AQVA 1GOBA 4CJQA 4A5BA 3MN7A 1VQPN 4CVNE 1DKGD 3SQ2A 3P5JA 4PKIA 1P8ZA 3CJAA 3CCMN 2HBKA 5AZJA 4F8RA 2E6LA 2IDOA 3EKUA 3G25A 4BR2A 1RFQA 4GVMA 3NF7A 1QQNA 4JI3K 4MO4A 1O1WA 3AVMA 5FPNA 4K8XA 3C6UA 3CPWM 2E6MA 4FJKA 3VQ8A 5AQJA 3Q7CA 5M1OA 4FLWA 4BWJA 3DLEA 4H0YB 3L2RA 1L3UA 4FLXA 3WXJA 3VA3A 4HCBA 3AVCA 3QESA 4B3OA 5C42A 4CEQA 1R59O 2D0PA 4OVLA 3DRRA 4HWIA 3MEEA 1VQMN 3MECA 1NGIA 3ZETB 1I94K 3QEPA 1RT4A 3LP0A 3KK7A 4JHDB 3AGKA 5AR0A 5C2DA 3AVIA 4B9VA 4DR5K 3J7AP 1KCFA 3HK2A 4ISEA 3VOVA 4FM1A 3VEXA 1M90O 1EXQA 1GLEG 5LMNK 5KQDA 4CZKA 1F21A 2B5JA 3AO3A 3H46O 2HHXA 3V1QA 4J2EA 3ID6A 3AO5A 2D0CA 3WNEA 1QZ6A 2JLEA 4DQIA 3HRGA 4BRNA 4AM6A 1V4TA 1C0TA 5E84A 3AY9A 3EZWA 3PUFA 2YHBA 3D2EA 1GLBG 1RCHA 3QIOA 1Y64A 3VQCA 3TANA 4KTZA 5J1EA 3ISNC 4DUZK 2IC3A 1VQ8N 5KPZA 4WCEL 3EE8A 5LY3A 4MLHA 4O5BA 4IJNA 4AF1A 2KKZA 4B1VA 4K25A 2HHSA 4CW7B 3THXB 4KFBA 2Q97A 1RT1A 2O8FB 1EP4A 2O8EA 1C6VA 3WQUA 3MX2A 2ZE2A 3CQYA 3ZLJA 2I7NA 3O1BA 4O5FA 4BR7A 1JKHA 4IKFA 4N76A 4KH4A 5M1NA 4HTUA 5ADXH 4BRAA 4ELUA 4M3YA 3O3FA 3PO4A 1IKWA 3VQ6A 3SUQA 4DFPA 4B9LA 2P9SA 2KQ2A 3PO5A 3AA3A 5T7BA 2P51A 3RMDA 3L2WA 1OVQA 1YJWN 3SPYA 5CZ2A 2BANA 5AQPA 4B1XB 4QS8A 2GV9A 3ZT2A 1BDGA 3CC7N 1XMQK 5AQXA 3AV9A 3OYBA 1VK0A 2E2QA 5JVGL 4IEIA 4KH5A 4FJGA 3NFAA 3ZETA 4FLUA 2NRZA 3P83D 4KHWA 3HM9A 5AQKA 3ZSRA 3I56N 2QEXN 2HHVA 1IH7A 4ID5A 3DM2A 4DF8A 4PUOA 4DTXA 1K9MO 1GLCG 1NOZA 1Q18A 4H0XB 2F9TA 3BDPA 3HO1A 4BR4A 3RR7A 5HRRA 2FBVA 1T6CA 2FF3B 4DTMA 2AJQA 4OKKA 3SI6A 1K8AO 1W7AA 1QSYA 1S9EA 3O9UA 2YNFA 3H6EA 3BF3A 1N5YA 4KHYA 1TYQA 3QEVA 4Q5VA 1BA1A 3FR0A 4FOIA 3SNNA 3HZ6A 1RT5A 3QBXA 1TKDA 1SS6A 4LFCK 1U2VA 1TK0A 4M3UA 3MWTA 2GUPA 5C24A 2O8BB 3NGIA 1KLNA 2FF6A 4GVEA 4PKHA 3A0IX 3C6AA 1TL1A 4EIAA 1S3XA 1MWKA 1RBVA 2FSNA 1FK9A 4HUGA 1RTIA 5FRMA 2VG6A 5CY4A 1B9FA 3QDKA 4ILHA 4MDBA 4LF8K 2DPNA 4AHRA 4CJ5A 4W5QA 4K0KK 1BG3A 3OYFA 3B8AX 3KTQA 1S1UA 3PIPL 1REVA 1DGKN 2IIRA 2G8WA 4F9OA 3OYDA 2HBMA 1OH5A 4I9LA 4Y0WA 1QS4A 4FLZA 1VSFA 3KWIA 1X3MA 3F9MA 1CXQA 2CGLA 1Q82O 2Z1IA 3AVLA 3AVHA 1W0HA 1S72N 2P9UA 3SAFA 4IO9L 4IWVA 1WSJA 1S5JA 4W5RA 3RVCA 4Z0UA 3TTDA 4FCYA 2QWRA 4FJ9A 3GDQA 2HOEA 2HHHK 3ZCMA 5JVHL 3L4IA 4BRQA 3RSEB 3E01A 4K41A 4FVUA 4Q0BA 3F9KA 2BH1A 3ZSZA 3TR8A 2UUCK 5HRNA 3ZX3A 4CJUA 4BGBA 4LFBK 4BG9A 3TARA 3QERA 1KTQA 5LMUK 5GAGP 2ZD1A 3LWLA 2GEMA 1NK6A 4DWIA 3H1QA 4I6MA 4KHQA 2GUIA 3LAMA 2ATQA 1RTJA 3SV4A 3TSUA 3D7EO 4DFMA 4DSFA 3TPQA 1HNVA 1NK0A 2EHGA 4DSIA 2QK9A 3SAGA 4GV9A 5CZ1A 3T3FA 3NH1A 1MA9B 4CGGA 1HPZA 5HROA 4B9MA 1U49A 3BZKA 3AA2A 1NJXA 4CZFA 5KGXA 1YI2N 4C23A 1HKBA 4B1UB 4FWKA 1VHXA 2V52B 4JLHA 1HQUA 2W42A 2G8UA 2IOCA 4E7HA 2A5XA 2ITMA 2O8FA 3MXIA 3CCLN 5JLFA 3EO3A 1QHTA 4CHOA 1KVCA 4Z4GA 4IFEA 2E4LA 1RBTA 2HNYA 3SUNA 1QQCA 4JKHA 1VSIA 2RN2A 5EU7A 3DLRA 1IBLK 3S41A 1EWQA 1TKZA 2FC0A 4WQ4A 2RE2A 3G71N 5C0YA 2FSJA 1NGBA 1HKGA 2A3ZA 1B92A 3O9TA 3NF9A 1VSEA 5BRFA 3UB5A 3OA9A 4CFBA 1NGGA 4KKOA 4AHTA 3A5OC 3C0BA 3I8BA 3HOTA 3LDNA 4HUEA 2QWLA 1LV5A 4YDUA 2HBJA 1HKCA 3R6MA 4DQQA 1WB9A 3AVAA 4I2QA 3TWHA 3HVTA 5EY4A 5D3GA 4PQUA 4X65K 1X9MA 5AZIA 2VCPA 4RCHA 4IBNA 4BRPA 2HHUA 3JS6A 1NK8A 4IO8A 3K57A 5BRHA 1BA0A 3BGRA 4WF9L 2Q3SA 4FWNA 1HYSA 1SKWA 4O44A 1QZ5A 2NUBA 4DR1K 1QTMA 3DXKA 4NXMK 2QKBA 1EETA 4G1QA 1GLLO 3ENOA 1XC9A 1C1BA 3SAHA 1L5UA 2BTFA 1RDWX 5BR8K 4DQ8A 4WYBA 3NH2A 4O8UA 1HNXK 4B9SA 3TI0A 4WE1A 3IG1A 5FPEA 2YKMA 4MLEA 3ZSXA 4CJVA 5J2MA 1VQLN
chains in the Genus database with same CATH topology
4CIFA 3MXJA 2XO7A 3CFRA 3U6FA 1KRPA 4M3XA 1NK7A 3HJFA 1RT6A 1GOBA 1HYZA 4CJQA 4CF9A 3EY1A 4M3ZA 1EKEA 3CG7A 3KLEA 1HRHA 3SQ2A 1LAWA 3P5JA 2RPIA 3HXMA 3ZT4A 2IS3A 1VSLA 2WONA 3OYAA 1SV5A 1S1XA 2XY8A 3V81A 4F8RA 1IKYA 3G10A 4E3SA 4ELTA 2E6LA 2IDOA 3HVRA 1ASVA 2OPPA 4DU4A 4GVMA 3S3NA 4CCHA 3CFOA 3NF7A 3ZT3A 4AH9A 3OYNA 3L3VA 4FJIA 1O1WA 4FZZA 3AVMA 4RW6A 1JLFA 2ZQBA 2HHXA 3VA0A 4K8XA 5I3UA 3OYIA 3C6UA 1KSPA 1BL3A 5SZTA 4CJ4A 4CJ3A 4CHYA 1J5OA 2E6MA 4I7FA 4DSEA 4FJKA 3OYEA 5J2QA 2ETJA 3ITHA 4DTNA 1CXUA 2X6NA 3VQ8A 4DFKA 4CFAA 3SV3A 3AVFA 4PWDA 2HVHA 4FLWA 4BWJA 1J54A 3RTVA 1KFDA 4CJSA 3NF8A 3DLEA 3L2RA 2D5RA 4FLXA 1L3UA 1B9DA 5KRTA 4DTSA 2VG7A 2VWJA 1BISA 1Z26A 3VA3A 2Z1GA 3UIQA 4HCBA 3QNOA 3AVCA 3QESA 5DK5A 3MXMA 2OPRA 4CJPA 2G8HA 4B3OA 3U3GA 5C42A 3RMAA 4KREA 1BCOA 4CEQA 4FK4A 3K59A 1Q8IA 2HHQA 3LANA 2Z1JA 4OVLA 2HHTA 2P1JA 1TKXA 3DRRA 4IG0A 4OPKA 1Y97A 4FZYA 1VSKA 1YVUA 4FM0A 3MEEA 3MECA 3ZSWA 3QEPA 3OJSA 1RT4A 1TKTA 3LP0A 4O0IA 4OLBA 4AHUA 1RBRA 3AO1A 1W9HA 4LH4A 3D0PA 4C8LA 1RDDA 3AVIA 1R0AA 4B9VA 1BI4A 4F3OA 1KCFA 4MQ3A 3K5NA 3HK2A 3SPZA 1S9GA 4W5NA 1TL3A 1DTQA 2G8IA 1VRUA 4B08A 4DF4A 1BI4B 3PX0A 4FM1A 1WSEA 4FK0A 1EXQA 3QNNA 1UWBA 1K6YA 1BCMA 1YTAA 1WSGA 1NKEA 4I2PA 1RDCA 3NDKA 4BACA 4DQRA 4CEBA 4CJTA 1XI1A 1RDBA 2FBXA 1F21A 3AO3A 1TVRA 2B5JA 3O3GA 3TAPA 2PYJA 3V1QA 4CHNA 3CQ8A 4J2EA 4Z4FA 3AO5A 1ZBIA 2D0CA 2EX3A 3WNEA 2JLEA 1IO2A 3QINA 4DQIA 3KKRA 3EYZA 4DU3A 2A1SA 3ALYA 3NBPA 4KRFA 3V9UA 1JXBA 4CGIA 3L2VA 3VQEA 4CIGA 3C6TA 1C0TA 4OKEA 4QOZB 2X74A 4B9NA 4CEZA 3C94A 3LWMA 3PUFA 3ULDA 1KFSA 2YHBA 2D0BA 5FROA 3VQAA 3PX6A 3KJVA 1RCHA 3QIOA 4FW1A 3VQCA 4HUFA 3TANA 3KD5E 4KTZA 4MFBA 5J1EA 4BE2A 1U04A 3ISNC 3LPUA 4OKJA 1GOCA 4LD0A 4CGJA 4YNQA 2IC3A 1NOYA 1D8YA 2YNHA 2BE2A 1G15A 2ITGA 3QEWA 4KO0A 1ZBUA 4IFVA 1D5AA 4O55A 3LDSA 4O5BA 5C25A 5SWMA 3SQ4A 2XHBA 2HHSA 3CM6A 4DLEA 3V9ZA 1FKOA 5FDLA 1ZYQA 2PZSA 4ID1A 3OYHA 4E7KA 4ELVA 4KFBA 2X78A 3K2PA 1D9DA 4FJ5A 1RT1A 3TAQA 1EP4A 4M3RA 1C6VA 3KLFA 3VQPA 2ZE2A 1SUQA 1FKPA 3KK1A 3DYAA 3HPHA 1WLJA 4N56A 4FJJA 2JGUA 4DSJA 1HJRA 3KLIA 1X1PA 1U45A 4JRQA 1HNIA 3LAKA 3OS1A 3O4NA 1JKHA 4DS4A 2B4JA 1YT3A 3P1GA 4HTUA 4IKFA 4N76A 1T8EA 4NCGA 3OS2A 3OVNA 3I0RA 4DU1A 1JL2A 1XHXA 4ELUA 4M3YA 3NAEA 4NYNA 5CYQA 3O3FA 3OYGA 3B6OA 2HMIA 3PO4A 1IKWA 3VQ6A 3AO4A 1C1CA 3K5OA 3SUQA 4DFPA 1I39A 4BE1A 4B9LA 2DTUA 4NCAA 4EP5A 2HW3A 1BIUA 2KQ2A 2QKKA 3PO5A 1JL1A 1T05A 3DLHA 3AA3A 2OZSA 5T7BA 1RT7A 3QLHA 4JS4A 3AA5X 2P51A 2OYQA 4KPYA 3RMDA 3LPTA 3L2WA 4FLYA 4BE0A 3SYZA 4KB0A 4BWMA 3TAFA 3KK3A 3B6PA 5KTQA 3SPYA 4Y1CA 2QXFA 3T1AA 3KLHA 1BHLA 2BANA 5CZ2A 1RT3A 1UA0A 2GV9A 1JLAA 3ZT2A 1X9WA 4DSLA 5HBMA 4CEAA 4CHZA 4KTWA 1UOCA 1NJWA 3AV9A 3QEIA 4CJKA 3OYBA 1VK0A 3V1RA 3PY8A 1MU2A 4B8AB 1IG9A 4N5SA 3OYMA 4CFCA 4FJGA 2FBYA 3NFAA 4FLUA 4M3TA 3VN5A 4PY5A 3AVJA 3P83D 1SKRA 3AVGA 3OJUA 4DQPA 2Y1JA 1WN7A 3H08A 3V1OA 3LZIA 3HM9A 4KHWA 3ZSRA 4IDKA 4YFUA 1LAVA 1RBUA 1RNHA 2YKNA 1IH7A 3I0SA 3RMCA 4ID5A 3S3MA 4ZTJA 4EZ6A 3DM2A 3K5MA 4DF8A 4PUOA 4DTXA 1WNSA 1NOZA 3KKSA 2G8VA 1GOAA 4UQGA 3NGZA 4E89A 4FLVA 2PY5A 3BDPA 4CIEA 4FJNA 4AILC 3THVA 1YTUA 3HO1A 3RR7A 5HRRA 4CECA 2HNDA 4DQSA 5HRSA 3V9WA 2FBVA 3OYLA 3HSTB 4DTMA 2AJQA 4OKKA 3MEDA 4E1NA 3A2FA 4GMJB 3SI6A 1FXXA 1S9EA 2YV0X 1QSYA 3U3YA 4F4KA 4K8ZA 2YNFA 1CZBA 3DI6A 1N5YA 1RDAA 4KHYA 1QSSA 3QEVA 1SL1A 3ZT1A 4Q5VA 4CJLA 3SJJA 3DRPA 4FJLA 3D45A 4CGHA 1S1WA 1S1TA 2B6AA 4H8KA 4CFDA 3SNNA 1RT5A 3TABA 3I8DA 3ASMA 1TKDA 4DLGA 1LW2A 1TGOA 4H4OA 5HLFA 3DLBA 2F8SA 1CZ9A 3WNHA 2DFFA 1TK0A 4M3UA 4DMNA 4I9QA 5C24A 4CJFA 1ITGA 1RT2A 3NGIA 1KLNA 4J2AA 5CYMA 3PV8A 4B9TA 4DTOA 4DS5A 3VQ4A 1S6QA 4HCCA 1UAXA 1TL1A 3K58A 4EP4A 4FJ8A 4Z4EA 4CE9A 3S3OA 4OLAA 1RBVA 1FK9A 4FLTA 1NK9A 1NK5A 4HUGA 3M8PA 1VSJA 5I42A 4CGDA 4H4MA 3CYMA 1ZBFA 3VQ9A 3K5LA 3LP1A 1RTIA 4KHUA 1U47A 5FRMA 2VG6A 3AVNA 3HL8A 5CY4A 3MAQA 4XIUA 1BGXT 4LSNA 1B9FA 2G8KA 3EZ5A 4KB1A 4AHRA 4CJ5A 4W5QA 1NKBA 1TV6A 3HP9A 4F3TA 1JLGA 4LH5A 3OYFA 4R5PA 1L3SA 2VWKA 3KTQA 1NKCA 4CJWA 1RTDA 1S1UA 4DFJA 3SUOA 2Z1HA 4NCBA 1REVA 2I5JA 1N6QA 1LW0A 1U4BA 4ZHRA 3SQ0A 3L2UA 2G8WA 3VQQA 4GW6A 2DFEA 4CERA 3OYDA 3NHGA 3DLKA 4FJXA 1WSHA 4CHPA 4I9LA 1LWEA 1QS4A 1VSFA 4CK1A 4FLZA 1D9FA 4J2BA 1TK5A 4OGEA 1CXQA 1T03A 2BGGA 4FM2A 2KZZA 2Z1IA 3AVLA 3AVHA 1W0HA 3HT3A 4M42A 2DFHA 1XWLA 4E7JA 4E19A 3C95A 2G8FA 1HQEA 4OGCA 1WSFA 1WSJA 4M41A 5FRNA 1S5JA 4W5RA 4FVMA 3FFIA 4Z0UA 2XY7A 4FCYA 4FJ9A 4B8CA 2PYLA 3LALA 3ZCMA 3AVBA 2GBZA 3TAGA 2O4IA 4JS5A 1KVAA 4Q0BA 3E01A 4O4GA 1WAJA 3F9KA 3SCXA 2KFZA 2P5GA 3ZSZA 3TR8A 4FK2A 3VQ5A 5HRNA 5HRPA 4CJUA 2XY6A 4EZ9A 5K14A 3QO9A 1BQMA 3QEXA 3KLGA 3QIPA 4CF1A 3ZSQA 5J2PA 3TARA 3SUPA 3HP6A 3L2QA 3QERA 2KTQA 1KTQA 4IFYA 2ZD1A 3LWLA 1J9AA 2YNGA 3HPOA 2IGIA 3OYJA 3VQ7A 1S6PA 4FXDA 3V9XA 4NYFA 1VSDA 1NK6A 1A5VA 4DWIA 1TAUA 1C0UA 1JLBA 4CHQA 3NE6A 3VQBA 4CF2A 4KHQA 2GUIA 1U48A 4C8OA 1QE1A 3LAMA 2ATQA 4AHCA 1RTJA 1CLQA 3SV4A 3AO2A 4DTUA 1SKSA 4DFMA 4DSFA 4KI4A 4M3WA 1HNVA 3LP2A 2EHGA 1TK8A 1NK0A 2OA8A 3KK2A 1HMVA 4E7LA 4DSIA 2F8TA 1A5WA 5J2MA 3DOKA 1ASWA 3JYTA 2QK9A 4CEOA 4CGFA 4L8RB 3M8SA 1RTHA 5CZ1A 2P5OA 4KAZA 3T3FA 3NH1A 4CGGA 3S9HA 1HPZA 5HROA 1Z25A 4B9MA 4ZTFA 1U49A 4CJEA 2OZMA 4KHSA 4CF0A 3DRSA 3L8BA 1L3VA 3O3HA 3AA2A 3PX4A 1NJXA 1JXEA 4OJRA 4QAGA 1IKXA 3ZSOA 5KGXA 3NH0A 1NJYA 2OPSA 3QETA 5DMRA 3F73A 4HHTA 2HHWA 1IKVA 1C1AA 4HVJA 1JLQA 1TAQA 4JLHA 5JS2A 2Y1IA 1SL2A 4RG8A 3KD1E 1JLCA 1BQNA 1HQUA 3O4QA 2W42A 2IOCA 3WNFA 3V9SA 3MEGA 1QSLA 2G8UA 2HVIA 4E7HA 4CEFA 1Q9XA 3DLGA 3MXIA 4N47A 4CK3A 1A5XA 1QHTA 3HYFA 3RRHA 2YNIA 4CHOA 1KVCA 1WAFA 3AA4A 4Z4GA 4W5OA 3V6DA 4B9UA 3OYCA 2KFNA 2E4LA 1RBTA 2HNYA 3SUNA 1QQCA 1VSIA 2RN2A 3OYKA 5EU7A 3IRXA 5E41A 2YHAA 3IS9A 4FZXC 4QCLA 3DLRA 2F96A 4C8NA 3ZSYA 4BDYA 4C8KA 1EX4A 4C8MA 1RILA 4LY7A 3JSMA 3WNGA 1TKZA 2FC0A 2LSNA 4E0DA 4TSXA 1Q9YA 4DSKA 2RKIA 4DG1A 3RWUA 2WOMA 4J2DA 4AHVA 3DMJA 4DTRA 4KTQA 1BIZA 4KHNA 1LWFA 1VSMA 4RW8A 1KLMA 4KV8A 1HYVA 5KI6A 4ICLA 1L3TA 1B92A 3ZSVA 2KW4A 3OY9A 3RR8A 2X6SA 2FBTA 5JS1A 3NF9A 1VSEA 1ZBHA 2VG5A 2KZMA 4M45A 5HP1A 4CFBA 1NJZA 4KKOA 4F2RA 4PA1A 4AHTA 3NF6A 2HNZA 3DOLA 1VSHA 4O0JA 4HUEA 3LP3A 1LV5A 4BDZA 1I3AA 4Z4HA 5KRSA 3M8RA 2HB5A 1T7PA 4AHSA 4E1MA 1DTTA 4Z4CA 4CEDA 3CFPA 4DQQA 3ZT0A 3AVAA 4I2QA 1XHZA 3TAEA 3TWHA 1NK4A 3HPGA 2XRIA 5KGWA 3HVTA 4OPJA 3LZJA 3RRGA 4FJ7A 4N41A 5J2NA 3AVKA 3TAMA 1C0MA 5D3GA 4PQUA 4E7IA 1X9MA 4CESA 4FW2A 4IBNA 4BDPA 4JRPA 3NCIA 4RW4A 2BDPA 4CF8A 4FJMA 3VQDA 1NK8A 3K57A 2HHUA 2IAJA 1WSIA 3RMBA 3BGRA 3G0ZA 1DLOA 2Q3SA 3T19A 4DTPA 4F2SA 1JLEA 1SKWA 4O44A 1HYSA 1UA1A 1J53A 2NUBA 1QTMA 2R7YA 3NGYA 4RW7A 4Y1DA 3KIOA 3SZ2A 2QKBA 2A1RA 4FYDA 3IAYA 1EETA 3OS0A 1LWCA 2DY4A 4G1QA 3M8QA 4DTJA 1XC9A 1C1BA 1L5UA 2OPQA 4RW9A 4Z4IA 3L3UA 4CK2A 4KI6A 1ASUA 1KVBA 4LSLA 1RBSA 2RF2A 3CM5A 1S1VA 2O4GA 3NH2A 1SL0A 4B9SA 3TI0A 4WE1A 2XY5A 3IG1A 2YKMA 4W5TA 4CJRA 4IG3A 1X9SA 3ZSXA 3V4IA 3SQ1A 4FJHA 2HHVA 4CJVA 2D0AA 1ZBLA 1VRTA 4CEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIF A;  3MXJ A;  2XO7 A;  3CFR A;  3U6F A;  1KRP A;  4M3X A;  1NK7 A;  3HJF A;  1RT6 A;  1GOB A;  1HYZ A;  4CJQ A;  4CF9 A;  3EY1 A;  4M3Z A;  1EKE A;  3CG7 A;  3KLE A;  1HRH A;  3SQ2 A;  1LAW A;  3P5J A;  2RPI A;  3HXM A;  3ZT4 A;  2IS3 A;  1VSL A;  2WON A;  3OYA A;  1SV5 A;  1S1X A;  2XY8 A;  3V81 A;  4F8R A;  1IKY A;  3G10 A;  4E3S A;  4ELT A;  2E6L A;  2IDO A;  3HVR A;  1ASV A;  2OPP A;  4DU4 A;  4GVM A;  3S3N A;  4CCH A;  3CFO A;  3NF7 A;  3ZT3 A;  4AH9 A;  3OYN A;  3L3V A;  4FJI A;  1O1W A;  4FZZ A;  3AVM A;  4RW6 A;  1JLF A;  2ZQB A;  2HHX A;  3VA0 A;  4K8X A;  5I3U A;  3OYI A;  3C6U A;  1KSP A;  1BL3 A;  5SZT A;  4CJ4 A;  4CJ3 A;  4CHY A;  1J5O A;  2E6M A;  4I7F A;  4DSE A;  4FJK A;  3OYE A;  5J2Q A;  2ETJ A;  3ITH A;  4DTN A;  1CXU A;  2X6N A;  3VQ8 A;  4DFK A;  4CFA A;  3SV3 A;  3AVF A;  4PWD A;  2HVH A;  4FLW A;  4BWJ A;  1J54 A;  3RTV A;  1KFD A;  4CJS A;  3NF8 A;  3DLE A;  3L2R A;  2D5R A;  4FLX A;  1L3U A;  1B9D A;  5KRT A;  4DTS A;  2VG7 A;  2VWJ A;  1BIS A;  1Z26 A;  3VA3 A;  2Z1G A;  3UIQ A;  4HCB A;  3QNO A;  3AVC A;  3QES A;  5DK5 A;  3MXM A;  2OPR A;  4CJP A;  2G8H A;  4B3O A;  3U3G A;  5C42 A;  3RMA A;  4KRE A;  1BCO A;  4CEQ A;  4FK4 A;  3K59 A;  1Q8I A;  2HHQ A;  3LAN A;  2Z1J A;  4OVL A;  2HHT A;  2P1J A;  1TKX A;  3DRR A;  4IG0 A;  4OPK A;  1Y97 A;  4FZY A;  1VSK A;  1YVU A;  4FM0 A;  3MEE A;  3MEC A;  3ZSW A;  3QEP A;  3OJS A;  1RT4 A;  1TKT A;  3LP0 A;  4O0I A;  4OLB A;  4AHU A;  1RBR A;  3AO1 A;  1W9H A;  4LH4 A;  3D0P A;  4C8L A;  1RDD A;  3AVI A;  1R0A A;  4B9V A;  1BI4 A;  4F3O A;  1KCF A;  4MQ3 A;  3K5N A;  3HK2 A;  3SPZ A;  1S9G A;  4W5N A;  1TL3 A;  1DTQ A;  2G8I A;  1VRU A;  4B08 A;  4DF4 A;  1BI4 B;  3PX0 A;  4FM1 A;  1WSE A;  4FK0 A;  1EXQ A;  3QNN A;  1UWB A;  1K6Y A;  1BCM A;  1YTA A;  1WSG A;  1NKE A;  4I2P A;  1RDC A;  3NDK A;  4BAC A;  4DQR A;  4CEB A;  4CJT A;  1XI1 A;  1RDB A;  2FBX A;  1F21 A;  3AO3 A;  1TVR A;  2B5J A;  3O3G A;  3TAP A;  2PYJ A;  3V1Q A;  4CHN A;  3CQ8 A;  4J2E A;  4Z4F A;  3AO5 A;  1ZBI A;  2D0C A;  2EX3 A;  3WNE A;  2JLE A;  1IO2 A;  3QIN A;  4DQI A;  3KKR A;  3EYZ A;  4DU3 A;  2A1S A;  3ALY A;  3NBP A;  4KRF A;  3V9U A;  1JXB A;  4CGI A;  3L2V A;  3VQE A;  4CIG A;  3C6T A;  1C0T A;  4OKE A;  4QOZ B;  2X74 A;  4B9N A;  4CEZ A;  3C94 A;  3LWM A;  3PUF A;  3ULD A;  1KFS A;  2YHB A;  2D0B A;  5FRO A;  3VQA A;  3PX6 A;  3KJV A;  1RCH A;  3QIO A;  4FW1 A;  3VQC A;  4HUF A;  3TAN A;  3KD5 E;  4KTZ A;  4MFB A;  5J1E A;  4BE2 A;  1U04 A;  3ISN C;  3LPU A;  4OKJ A;  1GOC A;  4LD0 A;  4CGJ A;  4YNQ A;  2IC3 A;  1NOY A;  1D8Y A;  2YNH A;  2BE2 A;  1G15 A;  2ITG A;  3QEW A;  4KO0 A;  1ZBU A;  4IFV A;  1D5A A;  4O55 A;  3LDS A;  4O5B A;  5C25 A;  5SWM A;  3SQ4 A;  2XHB A;  2HHS A;  3CM6 A;  4DLE A;  3V9Z A;  1FKO A;  5FDL A;  1ZYQ A;  2PZS A;  4ID1 A;  3OYH A;  4E7K A;  4ELV A;  4KFB A;  2X78 A;  3K2P A;  1D9D A;  4FJ5 A;  1RT1 A;  3TAQ A;  1EP4 A;  4M3R A;  1C6V A;  3KLF A;  3VQP A;  2ZE2 A;  1SUQ A;  1FKP A;  3KK1 A;  3DYA A;  3HPH A;  1WLJ A;  4N56 A;  4FJJ A;  2JGU A;  4DSJ A;  1HJR A;  3KLI A;  1X1P A;  1U45 A;  4JRQ A;  1HNI A;  3LAK A;  3OS1 A;  3O4N A;  1JKH A;  4DS4 A;  2B4J A;  1YT3 A;  3P1G A;  4HTU A;  4IKF A;  4N76 A;  1T8E A;  4NCG A;  3OS2 A;  3OVN A;  3I0R A;  4DU1 A;  1JL2 A;  1XHX A;  4ELU A;  4M3Y A;  3NAE A;  4NYN A;  5CYQ A;  3O3F A;  3OYG A;  3B6O A;  2HMI A;  3PO4 A;  1IKW A;  3VQ6 A;  3AO4 A;  1C1C A;  3K5O A;  3SUQ A;  4DFP A;  1I39 A;  4BE1 A;  4B9L A;  2DTU A;  4NCA A;  4EP5 A;  2HW3 A;  1BIU A;  2KQ2 A;  2QKK A;  3PO5 A;  1JL1 A;  1T05 A;  3DLH A;  3AA3 A;  2OZS A;  5T7B A;  1RT7 A;  3QLH A;  4JS4 A;  3AA5 X;  2P51 A;  2OYQ A;  4KPY A;  3RMD A;  3LPT A;  3L2W A;  4FLY A;  4BE0 A;  3SYZ A;  4KB0 A;  4BWM A;  3TAF A;  3KK3 A;  3B6P A;  5KTQ A;  3SPY A;  4Y1C A;  2QXF A;  3T1A A;  3KLH A;  1BHL A;  2BAN A;  5CZ2 A;  1RT3 A;  1UA0 A;  2GV9 A;  1JLA A;  3ZT2 A;  1X9W A;  4DSL A;  5HBM A;  4CEA A;  4CHZ A;  4KTW A;  1UOC A;  1NJW A;  3AV9 A;  3QEI A;  4CJK A;  3OYB A;  1VK0 A;  3V1R A;  3PY8 A;  1MU2 A;  4B8A B;  1IG9 A;  4N5S A;  3OYM A;  4CFC A;  4FJG A;  2FBY A;  3NFA A;  4FLU A;  4M3T A;  3VN5 A;  4PY5 A;  3AVJ A;  3P83 D;  1SKR A;  3AVG A;  3OJU A;  4DQP A;  2Y1J A;  1WN7 A;  3H08 A;  3V1O A;  3LZI A;  3HM9 A;  4KHW A;  3ZSR A;  4IDK A;  4YFU A;  1LAV A;  1RBU A;  1RNH A;  2YKN A;  1IH7 A;  3I0S A;  3RMC A;  4ID5 A;  3S3M A;  4ZTJ A;  4EZ6 A;  3DM2 A;  3K5M A;  4DF8 A;  4PUO A;  4DTX A;  1WNS A;  1NOZ A;  3KKS A;  2G8V A;  1GOA A;  4UQG A;  3NGZ A;  4E89 A;  4FLV A;  2PY5 A;  3BDP A;  4CIE A;  4FJN A;  4AIL C;  3THV A;  1YTU A;  3HO1 A;  3RR7 A;  5HRR A;  4CEC A;  2HND A;  4DQS A;  5HRS A;  3V9W A;  2FBV A;  3OYL A;  3HST B;  4DTM A;  2AJQ A;  4OKK A;  3MED A;  4E1N A;  3A2F A;  4GMJ B;  3SI6 A;  1FXX A;  1S9E A;  2YV0 X;  1QSY A;  3U3Y A;  4F4K A;  4K8Z A;  2YNF A;  1CZB A;  3DI6 A;  1N5Y A;  1RDA A;  4KHY A;  1QSS A;  3QEV A;  1SL1 A;  3ZT1 A;  4Q5V A;  4CJL A;  3SJJ A;  3DRP A;  4FJL A;  3D45 A;  4CGH A;  1S1W A;  1S1T A;  2B6A A;  4H8K A;  4CFD A;  3SNN A;  1RT5 A;  3TAB A;  3I8D A;  3ASM A;  1TKD A;  4DLG A;  1LW2 A;  1TGO A;  4H4O A;  5HLF A;  3DLB A;  2F8S A;  1CZ9 A;  3WNH A;  2DFF A;  1TK0 A;  4M3U A;  4DMN A;  4I9Q A;  5C24 A;  4CJF A;  1ITG A;  1RT2 A;  3NGI A;  1KLN A;  4J2A A;  5CYM A;  3PV8 A;  4B9T A;  4DTO A;  4DS5 A;  3VQ4 A;  1S6Q A;  4HCC A;  1UAX A;  1TL1 A;  3K58 A;  4EP4 A;  4FJ8 A;  4Z4E A;  4CE9 A;  3S3O A;  4OLA A;  1RBV A;  1FK9 A;  4FLT A;  1NK9 A;  1NK5 A;  4HUG A;  3M8P A;  1VSJ A;  5I42 A;  4CGD A;  4H4M A;  3CYM A;  1ZBF A;  3VQ9 A;  3K5L A;  3LP1 A;  1RTI A;  4KHU A;  1U47 A;  5FRM A;  2VG6 A;  3AVN A;  3HL8 A;  5CY4 A;  3MAQ A;  4XIU A;  1BGX T;  4LSN A;  1B9F A;  2G8K A;  3EZ5 A;  4KB1 A;  4AHR A;  4CJ5 A;  4W5Q A;  1NKB A;  1TV6 A;  3HP9 A;  4F3T A;  1JLG A;  4LH5 A;  3OYF A;  4R5P A;  1L3S A;  2VWK A;  3KTQ A;  1NKC A;  4CJW A;  1RTD A;  1S1U A;  4DFJ A;  3SUO A;  2Z1H A;  4NCB A;  1REV A;  2I5J A;  1N6Q A;  1LW0 A;  1U4B A;  4ZHR A;  3SQ0 A;  3L2U A;  2G8W A;  3VQQ A;  4GW6 A;  2DFE A;  4CER A;  3OYD A;  3NHG A;  3DLK A;  4FJX A;  1WSH A;  4CHP A;  4I9L A;  1LWE A;  1QS4 A;  1VSF A;  4CK1 A;  4FLZ A;  1D9F A;  4J2B A;  1TK5 A;  4OGE A;  1CXQ A;  1T03 A;  2BGG A;  4FM2 A;  2KZZ A;  2Z1I A;  3AVL A;  3AVH A;  1W0H A;  3HT3 A;  4M42 A;  2DFH A;  1XWL A;  4E7J A;  4E19 A;  3C95 A;  2G8F A;  1HQE A;  4OGC A;  1WSF A;  1WSJ A;  4M41 A;  5FRN A;  1S5J A;  4W5R A;  4FVM A;  3FFI A;  4Z0U A;  2XY7 A;  4FCY A;  4FJ9 A;  4B8C A;  2PYL A;  3LAL A;  3ZCM A;  3AVB A;  2GBZ A;  3TAG A;  2O4I A;  4JS5 A;  1KVA A;  4Q0B A;  3E01 A;  4O4G A;  1WAJ A;  3F9K A;  3SCX A;  2KFZ A;  2P5G A;  3ZSZ A;  3TR8 A;  4FK2 A;  3VQ5 A;  5HRN A;  5HRP A;  4CJU A;  2XY6 A;  4EZ9 A;  5K14 A;  3QO9 A;  1BQM A;  3QEX A;  3KLG A;  3QIP A;  4CF1 A;  3ZSQ A;  5J2P A;  3TAR A;  3SUP A;  3HP6 A;  3L2Q A;  3QER A;  2KTQ A;  1KTQ A;  4IFY A;  2ZD1 A;  3LWL A;  1J9A A;  2YNG A;  3HPO A;  2IGI A;  3OYJ A;  3VQ7 A;  1S6P A;  4FXD A;  3V9X A;  4NYF A;  1VSD A;  1NK6 A;  1A5V A;  4DWI A;  1TAU A;  1C0U A;  1JLB A;  4CHQ A;  3NE6 A;  3VQB A;  4CF2 A;  4KHQ A;  2GUI A;  1U48 A;  4C8O A;  1QE1 A;  3LAM A;  2ATQ A;  4AHC A;  1RTJ A;  1CLQ A;  3SV4 A;  3AO2 A;  4DTU A;  1SKS A;  4DFM A;  4DSF A;  4KI4 A;  4M3W A;  1HNV A;  3LP2 A;  2EHG A;  1TK8 A;  1NK0 A;  2OA8 A;  3KK2 A;  1HMV A;  4E7L A;  4DSI A;  2F8T A;  1A5W A;  5J2M A;  3DOK A;  1ASW A;  3JYT A;  2QK9 A;  4CEO A;  4CGF A;  4L8R B;  3M8S A;  1RTH A;  5CZ1 A;  2P5O A;  4KAZ A;  3T3F A;  3NH1 A;  4CGG A;  3S9H A;  1HPZ A;  5HRO A;  1Z25 A;  4B9M A;  4ZTF A;  1U49 A;  4CJE A;  2OZM A;  4KHS A;  4CF0 A;  3DRS A;  3L8B A;  1L3V A;  3O3H A;  3AA2 A;  3PX4 A;  1NJX A;  1JXE A;  4OJR A;  4QAG A;  1IKX A;  3ZSO A;  5KGX A;  3NH0 A;  1NJY A;  2OPS A;  3QET A;  5DMR A;  3F73 A;  4HHT A;  2HHW A;  1IKV A;  1C1A A;  4HVJ A;  1JLQ A;  1TAQ A;  4JLH A;  5JS2 A;  2Y1I A;  1SL2 A;  4RG8 A;  3KD1 E;  1JLC A;  1BQN A;  1HQU A;  3O4Q A;  2W42 A;  2IOC A;  3WNF A;  3V9S A;  3MEG A;  1QSL A;  2G8U A;  2HVI A;  4E7H A;  4CEF A;  1Q9X A;  3DLG A;  3MXI A;  4N47 A;  4CK3 A;  1A5X A;  1QHT A;  3HYF A;  3RRH A;  2YNI A;  4CHO A;  1KVC A;  1WAF A;  3AA4 A;  4Z4G A;  4W5O A;  3V6D A;  4B9U A;  3OYC A;  2KFN A;  2E4L A;  1RBT A;  2HNY A;  3SUN A;  1QQC A;  1VSI A;  2RN2 A;  3OYK A;  5EU7 A;  3IRX A;  5E41 A;  2YHA A;  3IS9 A;  4FZX C;  4QCL A;  3DLR A;  2F96 A;  4C8N A;  3ZSY A;  4BDY A;  4C8K A;  1EX4 A;  4C8M A;  1RIL A;  4LY7 A;  3JSM A;  3WNG A;  1TKZ A;  2FC0 A;  2LSN A;  4E0D A;  4TSX A;  1Q9Y A;  4DSK A;  2RKI A;  4DG1 A;  3RWU A;  2WOM A;  4J2D A;  4AHV A;  3DMJ A;  4DTR A;  4KTQ A;  1BIZ A;  4KHN A;  1LWF A;  1VSM A;  4RW8 A;  1KLM A;  4KV8 A;  1HYV A;  5KI6 A;  4ICL A;  1L3T A;  1B92 A;  3ZSV A;  2KW4 A;  3OY9 A;  3RR8 A;  2X6S A;  2FBT A;  5JS1 A;  3NF9 A;  1VSE A;  1ZBH A;  2VG5 A;  2KZM A;  4M45 A;  5HP1 A;  4CFB A;  1NJZ A;  4KKO A;  4F2R A;  4PA1 A;  4AHT A;  3NF6 A;  2HNZ A;  3DOL A;  1VSH A;  4O0J A;  4HUE A;  3LP3 A;  1LV5 A;  4BDZ A;  1I3A A;  4Z4H A;  5KRS A;  3M8R A;  2HB5 A;  1T7P A;  4AHS A;  4E1M A;  1DTT A;  4Z4C A;  4CED A;  3CFP A;  4DQQ A;  3ZT0 A;  3AVA A;  4I2Q A;  1XHZ A;  3TAE A;  3TWH A;  1NK4 A;  3HPG A;  2XRI A;  5KGW A;  3HVT A;  4OPJ A;  3LZJ A;  3RRG A;  4FJ7 A;  4N41 A;  5J2N A;  3AVK A;  3TAM A;  1C0M A;  5D3G A;  4PQU A;  4E7I A;  1X9M A;  4CES A;  4FW2 A;  4IBN A;  4BDP A;  4JRP A;  3NCI A;  4RW4 A;  2BDP A;  4CF8 A;  4FJM A;  3VQD A;  1NK8 A;  3K57 A;  2HHU A;  2IAJ A;  1WSI A;  3RMB A;  3BGR A;  3G0Z A;  1DLO A;  2Q3S A;  3T19 A;  4DTP A;  4F2S A;  1JLE A;  1SKW A;  4O44 A;  1HYS A;  1UA1 A;  1J53 A;  2NUB A;  1QTM A;  2R7Y A;  3NGY A;  4RW7 A;  4Y1D A;  3KIO A;  3SZ2 A;  2QKB A;  2A1R A;  4FYD A;  3IAY A;  1EET A;  3OS0 A;  1LWC A;  2DY4 A;  4G1Q A;  3M8Q A;  4DTJ A;  1XC9 A;  1C1B A;  1L5U A;  2OPQ A;  4RW9 A;  4Z4I A;  3L3U A;  4CK2 A;  4KI6 A;  1ASU A;  1KVB A;  4LSL A;  1RBS A;  2RF2 A;  3CM5 A;  1S1V A;  2O4G A;  3NH2 A;  1SL0 A;  4B9S A;  3TI0 A;  4WE1 A;  2XY5 A;  3IG1 A;  2YKM A;  4W5T A;  4CJR A;  4IG3 A;  1X9S A;  3ZSX A;  3V4I A;  3SQ1 A;  4FJH A;  2HHV A;  4CJV A;  2D0A A;  1ZBL A;  1VRT A;  4CEE A; 
#chains in the Genus database with same CATH topology
 2XO7 A;  3VGM A;  3SK3 A;  3HJF A;  1RT6 A;  1HYZ A;  4M3Z A;  3BP8 A;  5AQS A;  1LAW A;  3HXM A;  1VSL A;  4FWM A;  3OYA A;  1S1X A;  5BPM A;  2XY8 A;  2GWJ A;  3G10 A;  5BPL A;  1NM1 A;  1ASV A;  1SAZ A;  3S3N A;  1KAZ A;  2YHX A;  3CFO A;  3ZT3 A;  4AM7 A;  3FLC O;  4H0P A;  1JLF A;  3ID8 A;  5I3U A;  1BL3 A;  4CJ4 A;  3A5L C;  3ITH A;  2Q2R A;  3E66 A;  4DFK A;  4U7B A;  3AVF A;  4PWD A;  2FSK A;  4WQ4 C;  1JCG A;  2CGK A;  1KFD A;  1KC8 O;  1J5E K;  3NF8 A;  2D5R A;  2QI2 A;  1B9D A;  4DTS A;  2VG7 A;  1Z26 A;  3CET A;  3UIQ A;  1K73 O;  2OPR A;  3U3G A;  5LL6 Z;  2VYP A;  3RMA A;  1BCO A;  4FK4 A;  4JI8 K;  4JEP A;  3U9Z A;  2HHQ A;  2NZT A;  2Z1J A;  1TKX A;  2CGJ A;  1YVU A;  4FM0 A;  2UXD K;  1WUA A;  4OLB A;  4O0I A;  2GX9 A;  1W9H A;  4FO0 A;  4LH4 A;  4JKE A;  1IJJ A;  1BI4 A;  4JK8 A;  3MCP A;  5AZI B;  4W5N A;  1TL3 A;  2PBD A;  1DTQ A;  2E88 A;  4B08 A;  4JI7 K;  1WSE A;  4FK0 A;  5FLX O;  5AQZ A;  2F4V K;  4H0V B;  4MO5 A;  4NLB A;  1UWB A;  2P9L A;  1K6Y A;  2NNW A;  4BRI A;  4LC9 B;  2NLX A;  4DQR A;  1TVR A;  5TKW A;  3D2F A;  3WXI A;  3IDH A;  2A40 A;  3P38 A;  1C0F A;  1X9J A;  2A1S A;  4JI2 K;  4BC5 A;  4DU3 A;  2ZJP L;  4CGI A;  3VQE A;  4OKE A;  4QOZ B;  2X74 A;  3CIP A;  4B9N A;  5C2F A;  3ULD A;  5FRO A;  3DAW A;  1NGC A;  4FW1 A;  3VF6 A;  3CME N;  3KD5 E;  4MFB A;  4RWT A;  4JKB A;  4EHT A;  4JI1 K;  4BRH A;  4CZG A;  3CPE A;  3EEQ A;  5GIN A;  2BE2 A;  2ITG A;  1D5A A;  5SWM A;  5C25 A;  1MWM A;  3CM6 A;  1E4F T;  3HTV A;  1FKO A;  3TSP A;  5EVZ A;  4ID1 A;  3WEE B;  4E7K A;  2X78 A;  4FJ5 A;  3KLF A;  3DXM A;  1OVY A;  4BY9 C;  4FWL A;  4N56 A;  4FJJ A;  5ELZ A;  4DSJ A;  2ASO A;  1HJR A;  1HNW K;  4JRQ A;  4M7X A;  4DS4 A;  2HBL A;  2B4J A;  1YT3 A;  3P1G A;  2QTD A;  1BWF O;  3OS2 A;  1JL2 A;  1XHX A;  3D2F B;  4WQ5 A;  2P9P A;  2W41 A;  3B6O A;  3T7Z A;  5FPD A;  2GWK A;  2VWB A;  3K5O A;  4E1J A;  1HPM A;  5C15 A;  4BE1 A;  2DTU A;  3J7Z O;  1BIU A;  4BG8 A;  3M6G A;  2OZS A;  2QKK A;  1T05 A;  1HNZ K;  3VEO A;  4BC4 A;  4FLY A;  3SYZ A;  4KB0 A;  1T44 A;  3B6P A;  2P9I A;  2QXF A;  1BHL A;  1RT3 A;  3FZM A;  4DSL A;  4KTW A;  1NJW A;  3O9R A;  3CMA N;  3PY8 A;  4B8A B;  3OYM A;  1W97 L;  1EWR A;  2E20 A;  1SKR A;  5EXW A;  4DQP A;  5IT9 O;  4YFU A;  1LAV A;  2YKN A;  3RMC A;  4ZTJ A;  3K5M A;  4JI4 K;  3KKS A;  3L6Q A;  2PY5 A;  4E89 A;  1HX1 A;  4KH6 A;  3RSE A;  3THV A;  2I7P A;  3OYL A;  3HST B;  3MED A;  4GMJ B;  3W3D A;  3J81 O;  3U3Y A;  3QFU A;  1CZA N;  5ADX A;  4B1Y B;  5EOY A;  1QSS A;  3ZT1 A;  3SJJ A;  1NGF A;  3FFK B;  4CZE A;  3SBG A;  1EO1 A;  4A62 A;  3U9D A;  4CFD A;  4B3S K;  4JV5 K;  4DLG A;  3H1V X;  4PHT X;  1KD1 O;  4JKF A;  4BRL A;  4WFA L;  4I9Q A;  1RT2 A;  1VQ5 N;  5CYM A;  4ISF A;  1YJN N;  2P9N B;  3PV8 A;  4J2A A;  4DTO A;  4YOV A;  4HCC A;  4FWS A;  3WXM B;  5GAE P;  5I9E B;  4FLT A;  1IBM K;  2E1Z A;  3M8P A;  1VSJ A;  4CGD A;  3VTH A;  3VQ9 A;  3LP1 A;  1YXQ A;  5BRD A;  4X64 K;  1N8R O;  4KHU A;  1YAG A;  3HL8 A;  3MAQ A;  1ATN A;  1BGX T;  3CHW A;  4XIU A;  4M7Y A;  5AQQ A;  3EZ5 A;  4B1W B;  4JI5 K;  2E2O A;  1WBD A;  1L3S A;  4R5P A;  2VWK A;  3CCU N;  4CJW A;  2Z1H A;  1N6Q A;  3L2U A;  5CHI A;  3VQQ A;  1YHQ N;  3VPZ A;  4CER A;  4AQY K;  3F2K A;  3DLK A;  4A5A A;  3VEZ A;  1N36 K;  2BGG A;  2KZZ A;  4E19 A;  3C95 A;  5FRN A;  3VF4 A;  1NBW A;  4B8C A;  3AAQ A;  3SCX A;  3NVM A;  4FK2 A;  3VQ5 A;  5HRP A;  3ATV A;  2O8D A;  3QIP A;  3ZSQ A;  5J2P A;  1JCF A;  3W0L A;  3CQX A;  2V7Y A;  3VF2 A;  4OX9 K;  3SMP A;  2FXU A;  3OYJ A;  1VSD A;  1TAU A;  3CJ1 A;  5C12 A;  4DV1 K;  4CHQ A;  3VQB A;  1YVN A;  4LF9 K;  4C8O A;  2O8C A;  2J4R A;  2HF4 A;  3AO2 A;  3P4I A;  1BUP A;  2UU9 K;  2OAN A;  2PAV A;  1WOQ A;  4CGF A;  3SMS A;  3CXC M;  1HUX A;  1Z25 A;  1O13 A;  5HL7 L;  4IEE A;  3THW A;  3SLC A;  1L3V A;  4LF4 K;  4OJR A;  3QET A;  3F73 A;  4FPA A;  3O80 A;  4HHT A;  4H03 B;  1C1A A;  1JLQ A;  5JS2 A;  5GAD P;  3V9S A;  3WNF A;  1Q9X A;  4CK3 A;  5LJW A;  4JI0 K;  1JJ2 M;  1A5X A;  3VGL A;  4XH1 A;  1NU0 A;  2YNI A;  2YJF A;  3AA4 A;  4JK9 A;  3PSF A;  4H5T A;  5A2Q O;  5JMV A;  3IS9 A;  1NGD A;  4ISG A;  4C8K A;  2VGN A;  4FWR A;  3JSM A;  3D6R A;  1QVG M;  4E0D A;  1Q81 O;  1HR0 K;  4AHV A;  3DMJ A;  1M1K O;  1BIZ A;  1LWF A;  4RW8 A;  1KLM A;  4FPB A;  5KI6 A;  1NJI O;  3O5B A;  5BN9 A;  3OY9 A;  1VQ6 N;  2FBT A;  2KZM A;  3CD6 N;  4F2R A;  5CE3 A;  4O0J A;  3C65 A;  4BVP A;  1Q86 O;  1T7P A;  2VQF K;  2OCE A;  3N4Q A;  1DTT A;  2YHW A;  4XH4 A;  4CED A;  4E1M A;  3ZT0 A;  4Z4C A;  3CFP A;  1XHZ A;  4DV6 K;  3TAE A;  1T6D A;  3HPG A;  3MDQ A;  5AQH A;  3RRG A;  5J2N A;  1BOT O;  3TAM A;  2BUP A;  3ENB A;  1NWK A;  4FW2 A;  4BDP A;  4JRP A;  4FJM A;  4I6M B;  3RMB A;  3AAR A;  1DLO A;  3T19 A;  4DTP A;  1JLE A;  3KZB A;  1NNE A;  4RTF D;  2R7Y A;  4Y1D A;  3MCA B;  2RHK A;  2A1R A;  3OS0 A;  2DY4 A;  3CJB A;  3UKR A;  2OPQ A;  3QFP A;  4Z4I A;  4CK2 A;  1YIJ N;  1ASU A;  1KVB A;  5KPT A;  3LDP A;  4YDU C;  4CJ7 A;  2QA4 N;  2XY5 A;  1XNQ K;  1NMD A;  4IG3 A;  3THY A;  1X9S A;  4BR9 A;  3V4I A;  3SQ1 A;  4FJH A;  4FVM A;  4GV3 A;  3CCV N;  3O1W A;  4CEE A;  3MXJ A;  4X62 K;  4JK7 A;  2YHY A;  2E8A A;  1MDU B;  3CG7 A;  3PSI A;  2RPI A;  3ZT4 A;  2Q0R A;  2EWS A;  2IS3 A;  3BY5 A;  2WON A;  3CF5 L;  5B8H A;  3U8X A;  4E3S A;  4BRD A;  3HVR A;  2OPP A;  4CZL A;  5AZJ B;  4DU4 A;  4CCH A;  3OYN A;  2ZJQ L;  4FZZ A;  4RW6 A;  5AQY A;  2ZQB A;  3A5N C;  3VA0 A;  3OYI A;  5SZT A;  4CJ3 A;  4CHY A;  1J5O A;  3IFR A;  4I7F A;  4DSE A;  5CR4 A;  3OHR A;  5J2Q A;  2ETJ A;  4DTN A;  1CXU A;  1YUW A;  4CFA A;  3E9O A;  4V19 S;  4YOX A;  3T1H K;  2JWL A;  5KRT A;  2VWJ A;  1BIS A;  2Z1G A;  1TYQ B;  4CJP A;  5LJV A;  3WEE A;  3K59 A;  1Q8I A;  4GKJ K;  2W6K A;  3AAP A;  3LAN A;  2HHT A;  4IG0 A;  4OPK A;  4FZY A;  3IMX A;  3ZSW A;  3OTO K;  5BRE A;  2ZM6 K;  3OJS A;  3WQT A;  1RBR A;  3AO1 A;  3D0P A;  4C1N K;  3PIO L;  1NGH A;  4MQ3 A;  3K5N A;  2G8I A;  1NGE A;  3PX0 A;  1OH7 A;  4XEI A;  2UYT A;  3QNN A;  4I2P A;  1RDC A;  4BAC A;  4CEB A;  4CJT A;  1IBK K;  1RDB A;  5GIO A;  1FJG K;  3CQ8 A;  2P9L B;  2EX3 A;  1RGI A;  4DV2 K;  1IO2 A;  3EYZ A;  3GBT A;  1JXB A;  3L2V A;  3V9U A;  1DT9 A;  4CIG A;  4JI6 K;  4CEZ A;  3C94 A;  3LWM A;  1KFS A;  2D0B A;  3VQA A;  1X3N A;  1QQO A;  3ZX0 A;  4HUF A;  3LPU A;  4LD0 A;  1GOC A;  4CGJ A;  1D8Y A;  1XC3 A;  2YNH A;  2YJE A;  3T69 A;  1G15 A;  3K9J A;  4IDH A;  3SQ4 A;  2XHB A;  3V9Z A;  5FDL A;  4ELV A;  5BN8 A;  3VET A;  2A42 A;  1LCU A;  3VEN A;  3TAQ A;  3NVK A;  3KK1 A;  3HPH A;  1WLJ A;  2ZGY A;  2JGU A;  2NRW A;  3CCR N;  5AQU A;  3KLI A;  1X1P A;  3LAK A;  3OS1 A;  3OVN A;  3I0R A;  4DU1 A;  4WFB L;  3NAE A;  4NYN A;  5CYQ A;  3OYG A;  2HMI A;  1C1C A;  3MN9 A;  1ATR A;  4IXC A;  1I39 A;  1SZ2 A;  3DLL L;  4EP5 A;  2HW3 A;  1RT7 A;  3QLH A;  3AA5 X;  2OYQ A;  4KPY A;  4BE0 A;  4BWM A;  3TAF A;  5AFU A;  3KK3 A;  4Y1C A;  3O9S A;  4A59 A;  3T1A A;  3I33 A;  2NRR A;  1X9W A;  1JLA A;  4KBO A;  4CEA A;  4DR4 K;  4BRK A;  1UOC A;  3QEI A;  4CJK A;  2WUS A;  1MU2 A;  2Q36 A;  3ZX2 A;  1IG9 A;  2FBY A;  4H0T B;  1TUY A;  3AVJ A;  3G4S N;  4R79 A;  2Y1J A;  1WN7 A;  3H08 A;  3D2E B;  3S3M A;  1RNH A;  3I0S A;  4EZ6 A;  1WNS A;  4CI6 A;  3MMV A;  2AP1 A;  4QS7 A;  4CEC A;  2QWP A;  2HND A;  3EN9 A;  3V9W A;  4DQS A;  3EKS A;  2ZF5 O;  3A2F A;  1FXX A;  2YV0 X;  4F4K A;  3EL2 A;  1KQS M;  5F2R A;  3OBY A;  3TSQ A;  3LDQ A;  3WT0 A;  4HTL A;  3DRP A;  3D45 A;  3VEW A;  2W6L A;  4CGH A;  4H5N A;  5GAH P;  3R8E A;  3I8D A;  2P9K A;  3NMU A;  1TGO A;  4YOU A;  4H4O A;  5DM6 L;  1HJO A;  3DLB A;  3WNH A;  2F8S A;  2DFF A;  4NXN K;  4DMN A;  2WC9 A;  4OO1 J;  4MDA A;  4DS5 A;  3VQ4 A;  4K42 A;  1S6Q A;  3DWL A;  3K58 A;  4EP4 A;  3CJ9 A;  4DR7 K;  4JKA A;  4CE9 A;  4GNI A;  2GEL A;  2P9K B;  4OLA A;  2QW9 A;  1NK5 A;  3ATU A;  5I42 A;  3CYM A;  1E3M A;  1ZBF A;  1D4X A;  1U47 A;  5AQL A;  4PL8 A;  4A61 A;  3HI0 A;  1P90 A;  4KB1 A;  2Q1N A;  4F3T A;  4LH5 A;  3O4W A;  3DJC A;  3FZH A;  3ZEU B;  2I5J A;  2PFU A;  1U4B A;  3SQ0 A;  3OBW A;  3C7N A;  2JWK A;  4GW6 A;  2DFE A;  2D0O A;  4A57 A;  4L3Q A;  4FJX A;  3U4L A;  4CHP A;  1LWE A;  2O8C B;  3CI5 A;  4OGE A;  5IWA K;  4FM2 A;  3MN6 A;  3CJ7 A;  3THW B;  4OPA A;  3HT3 A;  3JXU A;  2DFH A;  1XWL A;  4E7J A;  1HQE A;  1VAZ A;  1WSF A;  4OGC A;  4M41 A;  3E1Y A;  3FFI A;  3FZL A;  3CCJ N;  2PYL A;  4ILJ A;  1IG8 A;  3AVB A;  2GBZ A;  3FE1 A;  2O4I A;  1KVA A;  3H45 C;  2P5G A;  4O8K A;  3QO9 A;  3QEX A;  1DEJ A;  2F7T A;  2YCH A;  3KLG A;  4CF1 A;  1XMO K;  3SUP A;  3HP6 A;  4YY3 K;  4B3M K;  2KTQ A;  4IZ9 A;  4IFY A;  1QQM A;  1J9A A;  2YNG A;  2D1K A;  3R1X A;  2IGI A;  3VQ7 A;  4NYF A;  1A5V A;  2D4W A;  1C0U A;  3P39 A;  3NE6 A;  3VER A;  1U48 A;  2YI1 A;  1QE1 A;  4AHC A;  3EE9 A;  3H3O B;  4DTU A;  1SKS A;  4KI4 A;  4M3W A;  3KK2 A;  1HMV A;  4E7L A;  3CCS N;  4DHY A;  1ASW A;  3JYT A;  4IOA L;  4DV0 K;  3DXM B;  4CEO A;  3GG4 A;  4PKG A;  3M8S A;  2P5O A;  4B3R K;  1VQ9 N;  3S9H A;  4FL9 A;  1KAX A;  5AFU H;  4CF0 A;  3PX4 A;  4GV6 A;  3TTF A;  1NJY A;  1IKV A;  1BU6 O;  4HVJ A;  1U2V B;  1TAQ A;  4K43 A;  1LOT B;  1NMN A;  3KD1 E;  1JLC A;  1QSL A;  3MEG A;  1H1V A;  4CEF A;  3DLG A;  4XH5 A;  4JKG A;  3RRH A;  4JYA K;  4FWO A;  4B9U A;  4BRC A;  4DB3 A;  3TU5 A;  4FOE A;  3OYK A;  2YHA A;  4FZX C;  4QCL A;  1KXP A;  4CZI A;  3ZSY A;  1VQ7 N;  4LY7 A;  3DXK B;  2QWN A;  3SJH A;  2LSN A;  4TSX A;  3ULE A;  1Q9Y A;  4DSK A;  1W2B M;  3FGU A;  5M1Q A;  2Q0U A;  4BR5 A;  4DTR A;  4CBU A;  1GLD G;  4KTQ A;  4KHN A;  1TUU A;  4BRG A;  1HYV A;  4ICL A;  3ZSV A;  4A2B A;  2IVP A;  5JS1 A;  5BR9 A;  1ZBH A;  3VEY A;  2E2N A;  3NF6 A;  1VQO N;  3DOL A;  1VSH A;  3FZK A;  4EFH A;  4BDZ A;  4DV7 K;  4Z4H A;  3IUC A;  2W40 A;  3M8R A;  2HB5 A;  4UY8 O;  2ASP A;  3M1F A;  2XRI A;  5GIP A;  4OPJ A;  3LZJ A;  4FJ7 A;  4N41 A;  1BO5 O;  1OH6 A;  3AVK A;  4CES A;  4YOY A;  4BR0 A;  2BDP A;  4RW4 A;  4NLC A;  1WSI A;  3G0Z A;  4F2S A;  2Q31 A;  2HMP A;  1UA1 A;  3BZC A;  4JNE A;  2QWO A;  3VTI A;  2A41 A;  3IAY A;  5AQO A;  1WBB A;  2P9P B;  1ESV A;  4DTJ A;  4DR3 K;  4CBW A;  3G6E N;  3KVG A;  3L3U A;  1VQ4 N;  1IV0 A;  1RBS A;  1SL0 A;  1RDU A;  4FSV A;  2UUB K;  3M5R A;  2D0A A;  3NCI A;  1N33 K;  4BRM A;  2CH5 A;  2E1Y A;  3CFR A;  3O08 A;  1NK7 A;  4M63 C;  2FLO A;  4CF9 A;  3EY1 A;  2OTJ N;  1EKE A;  2P9N A;  2QWQ A;  1HRH A;  4CZH A;  3KLE A;  3HOS A;  2KLA A;  4CZM A;  3LM9 A;  1SV5 A;  4LF5 K;  3V81 A;  2HF3 A;  1IKY A;  4ELT A;  3CCE N;  3E9P A;  4CD3 A;  3MK6 A;  4AH9 A;  3L3V A;  4FJI A;  1N32 K;  2OTL N;  4H5V A;  1KSP A;  4WFN L;  3O9Q A;  1Z6R A;  3OYE A;  3CJC A;  2X6N A;  3J8A A;  2IVO A;  3SV3 A;  2NRT A;  3JAM O;  3CC4 N;  3LM2 A;  3MX5 A;  2HVH A;  3RTV A;  1J54 A;  3R9P A;  4CJS A;  2NRH A;  4BVO A;  3QNO A;  2G8H A;  4YOR A;  5DK5 A;  5AQM A;  3MXM A;  3GE1 A;  4KRE A;  5DM7 L;  3UKR B;  2P1J A;  1ZBS A;  2O8B A;  1Y97 A;  1VSK A;  4IOX A;  3PLA A;  1NGJ A;  1TKT A;  4AHU A;  3CCQ N;  4C8L A;  4DV3 K;  2P9U B;  2WFB A;  1RDD A;  1R0A A;  4F3O A;  3SPZ A;  1S9G A;  1VRU A;  2WTU A;  4DF4 A;  1BI4 B;  1QHA A;  1S22 A;  1YTA A;  1BCM A;  1WSG A;  5F1X A;  3NDK A;  1NKE A;  4BQZ A;  1N34 K;  1XI1 A;  2CH6 A;  2FBX A;  3WXL A;  3O3G A;  3TAP A;  2PYJ A;  4Z4F A;  4CHN A;  4JAX A;  1ZBI A;  5AQG A;  3QIN A;  3KKR A;  4KRF A;  3ALY A;  3NBP A;  3C6T A;  4DUY K;  2UXC K;  3BEX A;  3ZYY X;  3PX6 A;  3KJV A;  3GL1 A;  4BE2 A;  3ZEU A;  1U04 A;  4OKJ A;  4DR6 K;  4YNQ A;  2YX6 A;  3KHY A;  1NOY A;  3UKU B;  4JD2 B;  3THX A;  3QEW A;  5AQN A;  4JD2 A;  1ZBU A;  2ZGZ A;  4IFV A;  3M3Z A;  4KO0 A;  4O55 A;  3UKU A;  3LDS A;  4H0O A;  4YOT A;  4DLE A;  2PZS A;  1ZYQ A;  3OYH A;  3K2P A;  1D9D A;  1NGA A;  4M3R A;  4DV5 K;  1XUP O;  2E2P A;  3VQP A;  4JKG B;  1SUQ A;  5JLH A;  1FKP A;  2IVN A;  3DYA A;  3L4Q A;  1U45 A;  1HNI A;  3O4N A;  4YOW A;  1OH8 A;  1T8E A;  4NCG A;  3I55 N;  3OW2 M;  1NG9 A;  4J8F A;  3AO4 A;  4KHP K;  3THY B;  1QVF M;  4NCA A;  3LL3 A;  1JL1 A;  1ZXO A;  3DLH A;  3QB0 A;  4JS4 A;  3P31 A;  2O8D B;  1FW6 A;  3O8M A;  3LPT A;  2V51 B;  3VGK A;  3QIC A;  5KTQ A;  3KLH A;  1UA0 A;  4OPH A;  5HBM A;  4FWP A;  4CHZ A;  4H5R A;  4JHD A;  3V1R A;  5TKY A;  1G99 A;  4LFA K;  1HLU A;  4N5S A;  4PY5 A;  4CFC A;  4M3T A;  3VN5 A;  4WQ5 C;  3AVG A;  3OJU A;  3LZI A;  3V1O A;  1ATS A;  4IDK A;  2GTD A;  1RBU A;  4BRF A;  4EAH D;  4BGA A;  2G8V A;  1GOA A;  4UQG A;  3NGZ A;  4FLV A;  1J6Z A;  2ASM A;  4CIE A;  4FJN A;  4AIL C;  1YTU A;  1U6Z A;  3WUH A;  5HRS A;  1VQK N;  3Q7B A;  2P9S B;  4E1N A;  1GLA G;  4K8Z A;  1CZB A;  3DI6 A;  1RDA A;  3L0Q A;  1SL1 A;  4CJL A;  4FJL A;  1JCE A;  1S1W A;  1S1T A;  2B6A A;  4H8K A;  5EX5 A;  3VES A;  3C7N B;  3TAB A;  3ASM A;  4JKC A;  2F9W A;  1LW2 A;  3ENH A;  5HLF A;  1CZ9 A;  3QML A;  3FZF A;  2VQE K;  4LF7 K;  3VMF B;  3C6H A;  4CJF A;  1ITG A;  4NO7 A;  2NRX A;  4B9T A;  4GKK K;  1KAY A;  1SQK A;  4B3T K;  5AJ3 K;  1UAX A;  3A8Y A;  3WXK A;  1T3V A;  4FJ8 A;  4Z4E A;  3KWG A;  3S3O A;  3VEV A;  3J80 O;  1NK9 A;  5AQW A;  4DKW A;  3TTC A;  4H4M A;  3K5L A;  1V4S A;  3AVN A;  3HM8 A;  4LSN A;  4U67 L;  2G8K A;  5MLC Q;  1NKB A;  3A5M C;  1TV6 A;  1YIT N;  3HP9 A;  1JLG A;  2AA4 A;  5JIC A;  5AQR A;  2V7Z A;  3K0S A;  1NKC A;  5BPN A;  1RTD A;  4DFJ A;  3SUO A;  4LF6 K;  4NCB A;  5FPM A;  1LW0 A;  4ZHR A;  4BRO A;  3NHG A;  4JN4 A;  1WSH A;  4FWQ A;  4CK1 A;  1D9F A;  4J2B A;  1TK5 A;  1T03 A;  4X66 K;  4M42 A;  1ZC6 A;  4NB4 A;  2G8F A;  2UUA K;  5AQI A;  1K8K A;  3CER A;  4C1N I;  2XY7 A;  4DV4 K;  3LAL A;  4EHU A;  3TAG A;  2NRV A;  4JS5 A;  2H3G X;  4O4G A;  1WAJ A;  2KFZ A;  5M1K A;  3T1Y K;  2XY6 A;  4EZ9 A;  5K14 A;  1BQM A;  5C10 A;  3O6W A;  3L2Q A;  3MWP A;  3HPO A;  4B9Q A;  1S6P A;  4FXD A;  3V9X A;  4H5W A;  4CZJ A;  1JLB A;  4CF2 A;  4CD1 A;  2P9I B;  5H1S Q;  4CBX A;  1CLQ A;  4G9Z A;  3LDL A;  4IJA A;  3LP2 A;  1TK8 A;  2OA8 A;  2F8T A;  4A2A A;  1A5W A;  3DOK A;  1XQS C;  4L8R B;  1RTH A;  4KAZ A;  4PL7 A;  3HBT A;  4BC2 A;  1K8K B;  3J7Y P;  4ZTF A;  4QS9 A;  4CJE A;  3MN5 A;  3UE5 A;  2OZM A;  4KHS A;  3DRS A;  3L8B A;  2A6A A;  3O3H A;  1JXE A;  4QAG A;  4Z94 A;  1OKJ A;  1IKX A;  3ZSO A;  3NH0 A;  2OPS A;  3GOI A;  3LDO A;  5DMR A;  2KHO A;  3F5T A;  2HHW A;  5AQF A;  2Y1I A;  1SL2 A;  4RG8 A;  5HOO A;  3BF1 A;  4ILG B;  1BQN A;  3O4Q A;  1YJ9 N;  2HVI A;  1ILY A;  1Q7Y O;  4N47 A;  4BC3 A;  3HYF A;  5E26 A;  3BUZ B;  1WAF A;  4W5O A;  3V6D A;  3OYC A;  2KFN A;  3SBT A;  4BRE A;  2ZJR L;  3IRX A;  5E41 A;  3CC2 N;  1Z05 A;  2F96 A;  4C8N A;  4BDY A;  1EX4 A;  4C8M A;  1RIL A;  3WNG A;  4J2D A;  2RKI A;  4DG1 A;  3RWU A;  2WOM A;  2ZWH A;  4IOC L;  4YHH K;  1VSM A;  4KV8 A;  1L3T A;  2KW4 A;  3RR8 A;  2X6S A;  5F0X A;  2VG5 A;  4M45 A;  5HP1 A;  1NLV A;  1NJZ A;  2UXB K;  5KPR A;  4PA1 A;  1YF5 L;  3IKM A;  2HNZ A;  5KQ8 A;  3LP3 A;  4B1Z A;  1I3A A;  5KRS A;  2QWM A;  2VGM A;  4AHS A;  3R3L A;  3N4P A;  1E4G T;  4DR2 K;  1NK4 A;  5KGW A;  5M1F A;  2HST A;  1C0M A;  2WBN A;  4E7I A;  3QBW A;  3AGR A;  3K9K A;  1VQN N;  3H3N O;  4CF8 A;  3VQD A;  1XNR K;  1EQY A;  2IAJ A;  1C0G A;  4DCH A;  4BQL A;  3ULE B;  1GLJ O;  1J53 A;  2QM1 A;  3NGY A;  4RW7 A;  3KIO A;  3SZ2 A;  4FYD A;  1GLF O;  1LWC A;  3M8Q A;  2QXL A;  4JKD A;  4RW9 A;  5M1P A;  4KI6 A;  3E9L A;  4GY2 B;  2E5L K;  4LSL A;  2RF2 A;  3CM5 A;  1S1V A;  2O4G A;  3HSC A;  5AQT A;  4W5T A;  4CJR A;  2O8E B;  1ZBL A;  1VRT A;  4CIF A;  1KRP A;  3U6F A;  4M3X A;  5AQV A;  1GOB A;  4CJQ A;  4A5B A;  3MN7 A;  1VQP N;  4CVN E;  1DKG D;  3SQ2 A;  3P5J A;  4PKI A;  1P8Z A;  3CJA A;  3CCM N;  2HBK A;  5AZJ A;  4F8R A;  2E6L A;  2IDO A;  3EKU A;  3G25 A;  4BR2 A;  1RFQ A;  4GVM A;  3NF7 A;  1QQN A;  4JI3 K;  4MO4 A;  1O1W A;  3AVM A;  5FPN A;  4K8X A;  3C6U A;  3CPW M;  2E6M A;  4FJK A;  3VQ8 A;  5AQJ A;  3Q7C A;  5M1O A;  4FLW A;  4BWJ A;  3DLE A;  4H0Y B;  3L2R A;  1L3U A;  4FLX A;  3WXJ A;  3VA3 A;  4HCB A;  3AVC A;  3QES A;  4B3O A;  5C42 A;  4CEQ A;  1R59 O;  2D0P A;  4OVL A;  3DRR A;  4HWI A;  3MEE A;  1VQM N;  3MEC A;  1NGI A;  3ZET B;  1I94 K;  3QEP A;  1RT4 A;  3LP0 A;  3KK7 A;  4JHD B;  3AGK A;  5AR0 A;  5C2D A;  3AVI A;  4B9V A;  4DR5 K;  3J7A P;  1KCF A;  3HK2 A;  4ISE A;  3VOV A;  4FM1 A;  3VEX A;  1M90 O;  1EXQ A;  1GLE G;  5LMN K;  5KQD A;  4CZK A;  1F21 A;  2B5J A;  3AO3 A;  3H46 O;  2HHX A;  3V1Q A;  4J2E A;  3ID6 A;  3AO5 A;  2D0C A;  3WNE A;  1QZ6 A;  2JLE A;  4DQI A;  3HRG A;  4BRN A;  4AM6 A;  1V4T A;  1C0T A;  5E84 A;  3AY9 A;  3EZW A;  3PUF A;  2YHB A;  3D2E A;  1GLB G;  1RCH A;  3QIO A;  1Y64 A;  3VQC A;  3TAN A;  4KTZ A;  5J1E A;  3ISN C;  4DUZ K;  2IC3 A;  1VQ8 N;  5KPZ A;  4WCE L;  3EE8 A;  5LY3 A;  4MLH A;  4O5B A;  4IJN A;  4AF1 A;  2KKZ A;  4B1V A;  4K25 A;  2HHS A;  4CW7 B;  3THX B;  4KFB A;  2Q97 A;  1RT1 A;  2O8F B;  1EP4 A;  2O8E A;  1C6V A;  3WQU A;  3MX2 A;  2ZE2 A;  3CQY A;  3ZLJ A;  2I7N A;  3O1B A;  4O5F A;  4BR7 A;  1JKH A;  4IKF A;  4N76 A;  4KH4 A;  5M1N A;  4HTU A;  5ADX H;  4BRA A;  4ELU A;  4M3Y A;  3O3F A;  3PO4 A;  1IKW A;  3VQ6 A;  3SUQ A;  4DFP A;  4B9L A;  2P9S A;  2KQ2 A;  3PO5 A;  3AA3 A;  5T7B A;  2P51 A;  3RMD A;  3L2W A;  1OVQ A;  1YJW N;  3SPY A;  5CZ2 A;  2BAN A;  5AQP A;  4B1X B;  4QS8 A;  2GV9 A;  3ZT2 A;  1BDG A;  3CC7 N;  1XMQ K;  5AQX A;  3AV9 A;  3OYB A;  1VK0 A;  2E2Q A;  5JVG L;  4IEI A;  4KH5 A;  4FJG A;  3NFA A;  3ZET A;  4FLU A;  2NRZ A;  3P83 D;  4KHW A;  3HM9 A;  5AQK A;  3ZSR A;  3I56 N;  2QEX N;  2HHV A;  1IH7 A;  4ID5 A;  3DM2 A;  4DF8 A;  4PUO A;  4DTX A;  1K9M O;  1GLC G;  1NOZ A;  1Q18 A;  4H0X B;  2F9T A;  3BDP A;  3HO1 A;  4BR4 A;  3RR7 A;  5HRR A;  2FBV A;  1T6C A;  2FF3 B;  4DTM A;  2AJQ A;  4OKK A;  3SI6 A;  1K8A O;  1W7A A;  1QSY A;  1S9E A;  3O9U A;  2YNF A;  3H6E A;  3BF3 A;  1N5Y A;  4KHY A;  1TYQ A;  3QEV A;  4Q5V A;  1BA1 A;  3FR0 A;  4FOI A;  3SNN A;  3HZ6 A;  1RT5 A;  3QBX A;  1TKD A;  1SS6 A;  4LFC K;  1U2V A;  1TK0 A;  4M3U A;  3MWT A;  2GUP A;  5C24 A;  2O8B B;  3NGI A;  1KLN A;  2FF6 A;  4GVE A;  4PKH A;  3A0I X;  3C6A A;  1TL1 A;  4EIA A;  1S3X A;  1MWK A;  1RBV A;  2FSN A;  1FK9 A;  4HUG A;  1RTI A;  5FRM A;  2VG6 A;  5CY4 A;  1B9F A;  3QDK A;  4ILH A;  4MDB A;  4LF8 K;  2DPN A;  4AHR A;  4CJ5 A;  4W5Q A;  4K0K K;  1BG3 A;  3OYF A;  3B8A X;  3KTQ A;  1S1U A;  3PIP L;  1REV A;  1DGK N;  2IIR A;  2G8W A;  4F9O A;  3OYD A;  2HBM A;  1OH5 A;  4I9L A;  4Y0W A;  1QS4 A;  4FLZ A;  1VSF A;  3KWI A;  1X3M A;  3F9M A;  1CXQ A;  2CGL A;  1Q82 O;  2Z1I A;  3AVL A;  3AVH A;  1W0H A;  1S72 N;  2P9U A;  3SAF A;  4IO9 L;  4IWV A;  1WSJ A;  1S5J A;  4W5R A;  3RVC A;  4Z0U A;  3TTD A;  4FCY A;  2QWR A;  4FJ9 A;  3GDQ A;  2HOE A;  2HHH K;  3ZCM A;  5JVH L;  3L4I A;  4BRQ A;  3RSE B;  3E01 A;  4K41 A;  4FVU A;  4Q0B A;  3F9K A;  2BH1 A;  3ZSZ A;  3TR8 A;  2UUC K;  5HRN A;  3ZX3 A;  4CJU A;  4BGB A;  4LFB K;  4BG9 A;  3TAR A;  3QER A;  1KTQ A;  5LMU K;  5GAG P;  2ZD1 A;  3LWL A;  2GEM A;  1NK6 A;  4DWI A;  3H1Q A;  4I6M A;  4KHQ A;  2GUI A;  3LAM A;  2ATQ A;  1RTJ A;  3SV4 A;  3TSU A;  3D7E O;  4DFM A;  4DSF A;  3TPQ A;  1HNV A;  1NK0 A;  2EHG A;  4DSI A;  2QK9 A;  3SAG A;  4GV9 A;  5CZ1 A;  3T3F A;  3NH1 A;  1MA9 B;  4CGG A;  1HPZ A;  5HRO A;  4B9M A;  1U49 A;  3BZK A;  3AA2 A;  1NJX A;  4CZF A;  5KGX A;  1YI2 N;  4C23 A;  1HKB A;  4B1U B;  4FWK A;  1VHX A;  2V52 B;  4JLH A;  1HQU A;  2W42 A;  2G8U A;  2IOC A;  4E7H A;  2A5X A;  2ITM A;  2O8F A;  3MXI A;  3CCL N;  5JLF A;  3EO3 A;  1QHT A;  4CHO A;  1KVC A;  4Z4G A;  4IFE A;  2E4L A;  1RBT A;  2HNY A;  3SUN A;  1QQC A;  4JKH A;  1VSI A;  2RN2 A;  5EU7 A;  3DLR A;  1IBL K;  3S41 A;  1EWQ A;  1TKZ A;  2FC0 A;  4WQ4 A;  2RE2 A;  3G71 N;  5C0Y A;  2FSJ A;  1NGB A;  1HKG A;  2A3Z A;  1B92 A;  3O9T A;  3NF9 A;  1VSE A;  5BRF A;  3UB5 A;  3OA9 A;  4CFB A;  1NGG A;  4KKO A;  4AHT A;  3A5O C;  3C0B A;  3I8B A;  3HOT A;  3LDN A;  4HUE A;  2QWL A;  1LV5 A;  4YDU A;  2HBJ A;  1HKC A;  3R6M A;  4DQQ A;  1WB9 A;  3AVA A;  4I2Q A;  3TWH A;  3HVT A;  5EY4 A;  5D3G A;  4PQU A;  4X65 K;  1X9M A;  5AZI A;  2VCP A;  4RCH A;  4IBN A;  4BRP A;  2HHU A;  3JS6 A;  1NK8 A;  4IO8 A;  3K57 A;  5BRH A;  1BA0 A;  3BGR A;  4WF9 L;  2Q3S A;  4FWN A;  1HYS A;  1SKW A;  4O44 A;  1QZ5 A;  2NUB A;  4DR1 K;  1QTM A;  3DXK A;  4NXM K;  2QKB A;  1EET A;  4G1Q A;  1GLL O;  3ENO A;  1XC9 A;  1C1B A;  3SAH A;  1L5U A;  2BTF A;  1RDW X;  5BR8 K;  4DQ8 A;  4WYB A;  3NH2 A;  4O8U A;  1HNX K;  4B9S A;  3TI0 A;  4WE1 A;  3IG1 A;  5FPE A;  2YKM A;  4MLE A;  3ZSX A;  4CJV A;  5J2M A;  1VQL N; 
#chains in the Genus database with same CATH homology
 4CIF A;  3MXJ A;  2XO7 A;  3CFR A;  3U6F A;  1KRP A;  4M3X A;  1NK7 A;  3HJF A;  1RT6 A;  1GOB A;  1HYZ A;  4CJQ A;  4CF9 A;  3EY1 A;  4M3Z A;  1EKE A;  3CG7 A;  3KLE A;  1HRH A;  3SQ2 A;  1LAW A;  3P5J A;  2RPI A;  3HXM A;  3ZT4 A;  2IS3 A;  1VSL A;  2WON A;  3OYA A;  1SV5 A;  1S1X A;  2XY8 A;  3V81 A;  4F8R A;  1IKY A;  3G10 A;  4E3S A;  4ELT A;  2E6L A;  2IDO A;  3HVR A;  1ASV A;  2OPP A;  4DU4 A;  4GVM A;  3S3N A;  4CCH A;  3CFO A;  3NF7 A;  3ZT3 A;  4AH9 A;  3OYN A;  3L3V A;  4FJI A;  1O1W A;  4FZZ A;  3AVM A;  4RW6 A;  1JLF A;  2ZQB A;  2HHX A;  3VA0 A;  4K8X A;  5I3U A;  3OYI A;  3C6U A;  1KSP A;  1BL3 A;  5SZT A;  4CJ4 A;  4CJ3 A;  4CHY A;  1J5O A;  2E6M A;  4I7F A;  4DSE A;  4FJK A;  3OYE A;  5J2Q A;  2ETJ A;  3ITH A;  4DTN A;  1CXU A;  2X6N A;  3VQ8 A;  4DFK A;  4CFA A;  3SV3 A;  3AVF A;  4PWD A;  2HVH A;  4FLW A;  4BWJ A;  1J54 A;  3RTV A;  1KFD A;  4CJS A;  3NF8 A;  3DLE A;  3L2R A;  2D5R A;  4FLX A;  1L3U A;  1B9D A;  5KRT A;  4DTS A;  2VG7 A;  2VWJ A;  1BIS A;  1Z26 A;  3VA3 A;  2Z1G A;  3UIQ A;  4HCB A;  3QNO A;  3AVC A;  3QES A;  5DK5 A;  3MXM A;  2OPR A;  4CJP A;  2G8H A;  4B3O A;  3U3G A;  5C42 A;  3RMA A;  4KRE A;  1BCO A;  4CEQ A;  4FK4 A;  3K59 A;  1Q8I A;  2HHQ A;  3LAN A;  2Z1J A;  4OVL A;  2HHT A;  2P1J A;  1TKX A;  3DRR A;  4IG0 A;  4OPK A;  1Y97 A;  4FZY A;  1VSK A;  1YVU A;  4FM0 A;  3MEE A;  3MEC A;  3ZSW A;  3QEP A;  3OJS A;  1RT4 A;  1TKT A;  3LP0 A;  4O0I A;  4OLB A;  4AHU A;  1RBR A;  3AO1 A;  1W9H A;  4LH4 A;  3D0P A;  4C8L A;  1RDD A;  3AVI A;  1R0A A;  4B9V A;  1BI4 A;  4F3O A;  1KCF A;  4MQ3 A;  3K5N A;  3HK2 A;  3SPZ A;  1S9G A;  4W5N A;  1TL3 A;  1DTQ A;  2G8I A;  1VRU A;  4B08 A;  4DF4 A;  1BI4 B;  3PX0 A;  4FM1 A;  1WSE A;  4FK0 A;  1EXQ A;  3QNN A;  1UWB A;  1K6Y A;  1BCM A;  1YTA A;  1WSG A;  1NKE A;  4I2P A;  1RDC A;  3NDK A;  4BAC A;  4DQR A;  4CEB A;  4CJT A;  1XI1 A;  1RDB A;  2FBX A;  1F21 A;  3AO3 A;  1TVR A;  2B5J A;  3O3G A;  3TAP A;  2PYJ A;  3V1Q A;  4CHN A;  3CQ8 A;  4J2E A;  4Z4F A;  3AO5 A;  1ZBI A;  2D0C A;  2EX3 A;  3WNE A;  2JLE A;  1IO2 A;  3QIN A;  4DQI A;  3KKR A;  3EYZ A;  4DU3 A;  2A1S A;  3ALY A;  3NBP A;  4KRF A;  3V9U A;  1JXB A;  4CGI A;  3L2V A;  3VQE A;  4CIG A;  3C6T A;  1C0T A;  4OKE A;  4QOZ B;  2X74 A;  4B9N A;  4CEZ A;  3C94 A;  3LWM A;  3PUF A;  3ULD A;  1KFS A;  2YHB A;  2D0B A;  5FRO A;  3VQA A;  3PX6 A;  3KJV A;  1RCH A;  3QIO A;  4FW1 A;  3VQC A;  4HUF A;  3TAN A;  3KD5 E;  4KTZ A;  4MFB A;  5J1E A;  4BE2 A;  1U04 A;  3ISN C;  3LPU A;  4OKJ A;  1GOC A;  4LD0 A;  4CGJ A;  4YNQ A;  2IC3 A;  1NOY A;  1D8Y A;  2YNH A;  2BE2 A;  1G15 A;  2ITG A;  3QEW A;  4KO0 A;  1ZBU A;  4IFV A;  1D5A A;  4O55 A;  3LDS A;  4O5B A;  5C25 A;  5SWM A;  3SQ4 A;  2XHB A;  2HHS A;  3CM6 A;  4DLE A;  3V9Z A;  1FKO A;  5FDL A;  1ZYQ A;  2PZS A;  4ID1 A;  3OYH A;  4E7K A;  4ELV A;  4KFB A;  2X78 A;  3K2P A;  1D9D A;  4FJ5 A;  1RT1 A;  3TAQ A;  1EP4 A;  4M3R A;  1C6V A;  3KLF A;  3VQP A;  2ZE2 A;  1SUQ A;  1FKP A;  3KK1 A;  3DYA A;  3HPH A;  1WLJ A;  4N56 A;  4FJJ A;  2JGU A;  4DSJ A;  1HJR A;  3KLI A;  1X1P A;  1U45 A;  4JRQ A;  1HNI A;  3LAK A;  3OS1 A;  3O4N A;  1JKH A;  4DS4 A;  2B4J A;  1YT3 A;  3P1G A;  4HTU A;  4IKF A;  4N76 A;  1T8E A;  4NCG A;  3OS2 A;  3OVN A;  3I0R A;  4DU1 A;  1JL2 A;  1XHX A;  4ELU A;  4M3Y A;  3NAE A;  4NYN A;  5CYQ A;  3O3F A;  3OYG A;  3B6O A;  2HMI A;  3PO4 A;  1IKW A;  3VQ6 A;  3AO4 A;  1C1C A;  3K5O A;  3SUQ A;  4DFP A;  1I39 A;  4BE1 A;  4B9L A;  2DTU A;  4NCA A;  4EP5 A;  2HW3 A;  1BIU A;  2KQ2 A;  2QKK A;  3PO5 A;  1JL1 A;  1T05 A;  3DLH A;  3AA3 A;  2OZS A;  5T7B A;  1RT7 A;  3QLH A;  4JS4 A;  3AA5 X;  2P51 A;  2OYQ A;  4KPY A;  3RMD A;  3LPT A;  3L2W A;  4FLY A;  4BE0 A;  3SYZ A;  4KB0 A;  4BWM A;  3TAF A;  3KK3 A;  3B6P A;  5KTQ A;  3SPY A;  4Y1C A;  2QXF A;  3T1A A;  3KLH A;  1BHL A;  2BAN A;  5CZ2 A;  1RT3 A;  1UA0 A;  2GV9 A;  1JLA A;  3ZT2 A;  1X9W A;  4DSL A;  5HBM A;  4CEA A;  4CHZ A;  4KTW A;  1UOC A;  1NJW A;  3AV9 A;  3QEI A;  4CJK A;  3OYB A;  1VK0 A;  3V1R A;  3PY8 A;  1MU2 A;  4B8A B;  1IG9 A;  4N5S A;  3OYM A;  4CFC A;  4FJG A;  2FBY A;  3NFA A;  4FLU A;  4M3T A;  3VN5 A;  4PY5 A;  3AVJ A;  3P83 D;  1SKR A;  3AVG A;  3OJU A;  4DQP A;  2Y1J A;  1WN7 A;  3H08 A;  3V1O A;  3LZI A;  3HM9 A;  4KHW A;  3ZSR A;  4IDK A;  4YFU A;  1LAV A;  1RBU A;  1RNH A;  2YKN A;  1IH7 A;  3I0S A;  3RMC A;  4ID5 A;  3S3M A;  4ZTJ A;  4EZ6 A;  3DM2 A;  3K5M A;  4DF8 A;  4PUO A;  4DTX A;  1WNS A;  1NOZ A;  3KKS A;  2G8V A;  1GOA A;  4UQG A;  3NGZ A;  4E89 A;  4FLV A;  2PY5 A;  3BDP A;  4CIE A;  4FJN A;  4AIL C;  3THV A;  1YTU A;  3HO1 A;  3RR7 A;  5HRR A;  4CEC A;  2HND A;  4DQS A;  5HRS A;  3V9W A;  2FBV A;  3OYL A;  3HST B;  4DTM A;  2AJQ A;  4OKK A;  3MED A;  4E1N A;  3A2F A;  4GMJ B;  3SI6 A;  1FXX A;  1S9E A;  2YV0 X;  1QSY A;  3U3Y A;  4F4K A;  4K8Z A;  2YNF A;  1CZB A;  3DI6 A;  1N5Y A;  1RDA A;  4KHY A;  1QSS A;  3QEV A;  1SL1 A;  3ZT1 A;  4Q5V A;  4CJL A;  3SJJ A;  3DRP A;  4FJL A;  3D45 A;  4CGH A;  1S1W A;  1S1T A;  2B6A A;  4H8K A;  4CFD A;  3SNN A;  1RT5 A;  3TAB A;  3I8D A;  3ASM A;  1TKD A;  4DLG A;  1LW2 A;  1TGO A;  4H4O A;  5HLF A;  3DLB A;  2F8S A;  1CZ9 A;  3WNH A;  2DFF A;  1TK0 A;  4M3U A;  4DMN A;  4I9Q A;  5C24 A;  4CJF A;  1ITG A;  1RT2 A;  3NGI A;  1KLN A;  4J2A A;  5CYM A;  3PV8 A;  4B9T A;  4DTO A;  4DS5 A;  3VQ4 A;  1S6Q A;  4HCC A;  1UAX A;  1TL1 A;  3K58 A;  4EP4 A;  4FJ8 A;  4Z4E A;  4CE9 A;  3S3O A;  4OLA A;  1RBV A;  1FK9 A;  4FLT A;  1NK9 A;  1NK5 A;  4HUG A;  3M8P A;  1VSJ A;  5I42 A;  4CGD A;  4H4M A;  3CYM A;  1ZBF A;  3VQ9 A;  3K5L A;  3LP1 A;  1RTI A;  4KHU A;  1U47 A;  5FRM A;  2VG6 A;  3AVN A;  3HL8 A;  5CY4 A;  3MAQ A;  4XIU A;  1BGX T;  4LSN A;  1B9F A;  2G8K A;  3EZ5 A;  4KB1 A;  4AHR A;  4CJ5 A;  4W5Q A;  1NKB A;  1TV6 A;  3HP9 A;  4F3T A;  1JLG A;  4LH5 A;  3OYF A;  4R5P A;  1L3S A;  2VWK A;  3KTQ A;  1NKC A;  4CJW A;  1RTD A;  1S1U A;  4DFJ A;  3SUO A;  2Z1H A;  4NCB A;  1REV A;  2I5J A;  1N6Q A;  1LW0 A;  1U4B A;  4ZHR A;  3SQ0 A;  3L2U A;  2G8W A;  3VQQ A;  4GW6 A;  2DFE A;  4CER A;  3OYD A;  3NHG A;  3DLK A;  4FJX A;  1WSH A;  4CHP A;  4I9L A;  1LWE A;  1QS4 A;  1VSF A;  4CK1 A;  4FLZ A;  1D9F A;  4J2B A;  1TK5 A;  4OGE A;  1CXQ A;  1T03 A;  2BGG A;  4FM2 A;  2KZZ A;  2Z1I A;  3AVL A;  3AVH A;  1W0H A;  3HT3 A;  4M42 A;  2DFH A;  1XWL A;  4E7J A;  4E19 A;  3C95 A;  2G8F A;  1HQE A;  4OGC A;  1WSF A;  1WSJ A;  4M41 A;  5FRN A;  1S5J A;  4W5R A;  4FVM A;  3FFI A;  4Z0U A;  2XY7 A;  4FCY A;  4FJ9 A;  4B8C A;  2PYL A;  3LAL A;  3ZCM A;  3AVB A;  2GBZ A;  3TAG A;  2O4I A;  4JS5 A;  1KVA A;  4Q0B A;  3E01 A;  4O4G A;  1WAJ A;  3F9K A;  3SCX A;  2KFZ A;  2P5G A;  3ZSZ A;  3TR8 A;  4FK2 A;  3VQ5 A;  5HRN A;  5HRP A;  4CJU A;  2XY6 A;  4EZ9 A;  5K14 A;  3QO9 A;  1BQM A;  3QEX A;  3KLG A;  3QIP A;  4CF1 A;  3ZSQ A;  5J2P A;  3TAR A;  3SUP A;  3HP6 A;  3L2Q A;  3QER A;  2KTQ A;  1KTQ A;  4IFY A;  2ZD1 A;  3LWL A;  1J9A A;  2YNG A;  3HPO A;  2IGI A;  3OYJ A;  3VQ7 A;  1S6P A;  4FXD A;  3V9X A;  4NYF A;  1VSD A;  1NK6 A;  1A5V A;  4DWI A;  1TAU A;  1C0U A;  1JLB A;  4CHQ A;  3NE6 A;  3VQB A;  4CF2 A;  4KHQ A;  2GUI A;  1U48 A;  4C8O A;  1QE1 A;  3LAM A;  2ATQ A;  4AHC A;  1RTJ A;  1CLQ A;  3SV4 A;  3AO2 A;  4DTU A;  1SKS A;  4DFM A;  4DSF A;  4KI4 A;  4M3W A;  1HNV A;  3LP2 A;  2EHG A;  1TK8 A;  1NK0 A;  2OA8 A;  3KK2 A;  1HMV A;  4E7L A;  4DSI A;  2F8T A;  1A5W A;  5J2M A;  3DOK A;  1ASW A;  3JYT A;  2QK9 A;  4CEO A;  4CGF A;  4L8R B;  3M8S A;  1RTH A;  5CZ1 A;  2P5O A;  4KAZ A;  3T3F A;  3NH1 A;  4CGG A;  3S9H A;  1HPZ A;  5HRO A;  1Z25 A;  4B9M A;  4ZTF A;  1U49 A;  4CJE A;  2OZM A;  4KHS A;  4CF0 A;  3DRS A;  3L8B A;  1L3V A;  3O3H A;  3AA2 A;  3PX4 A;  1NJX A;  1JXE A;  4OJR A;  4QAG A;  1IKX A;  3ZSO A;  5KGX A;  3NH0 A;  1NJY A;  2OPS A;  3QET A;  5DMR A;  3F73 A;  4HHT A;  2HHW A;  1IKV A;  1C1A A;  4HVJ A;  1JLQ A;  1TAQ A;  4JLH A;  5JS2 A;  2Y1I A;  1SL2 A;  4RG8 A;  3KD1 E;  1JLC A;  1BQN A;  1HQU A;  3O4Q A;  2W42 A;  2IOC A;  3WNF A;  3V9S A;  3MEG A;  1QSL A;  2G8U A;  2HVI A;  4E7H A;  4CEF A;  1Q9X A;  3DLG A;  3MXI A;  4N47 A;  4CK3 A;  1A5X A;  1QHT A;  3HYF A;  3RRH A;  2YNI A;  4CHO A;  1KVC A;  1WAF A;  3AA4 A;  4Z4G A;  4W5O A;  3V6D A;  4B9U A;  3OYC A;  2KFN A;  2E4L A;  1RBT A;  2HNY A;  3SUN A;  1QQC A;  1VSI A;  2RN2 A;  3OYK A;  5EU7 A;  3IRX A;  5E41 A;  2YHA A;  3IS9 A;  4FZX C;  4QCL A;  3DLR A;  2F96 A;  4C8N A;  3ZSY A;  4BDY A;  4C8K A;  1EX4 A;  4C8M A;  1RIL A;  4LY7 A;  3JSM A;  3WNG A;  1TKZ A;  2FC0 A;  2LSN A;  4E0D A;  4TSX A;  1Q9Y A;  4DSK A;  2RKI A;  4DG1 A;  3RWU A;  2WOM A;  4J2D A;  4AHV A;  3DMJ A;  4DTR A;  4KTQ A;  1BIZ A;  4KHN A;  1LWF A;  1VSM A;  4RW8 A;  1KLM A;  4KV8 A;  1HYV A;  5KI6 A;  4ICL A;  1L3T A;  1B92 A;  3ZSV A;  2KW4 A;  3OY9 A;  3RR8 A;  2X6S A;  2FBT A;  5JS1 A;  3NF9 A;  1VSE A;  1ZBH A;  2VG5 A;  2KZM A;  4M45 A;  5HP1 A;  4CFB A;  1NJZ A;  4KKO A;  4F2R A;  4PA1 A;  4AHT A;  3NF6 A;  2HNZ A;  3DOL A;  1VSH A;  4O0J A;  4HUE A;  3LP3 A;  1LV5 A;  4BDZ A;  1I3A A;  4Z4H A;  5KRS A;  3M8R A;  2HB5 A;  1T7P A;  4AHS A;  4E1M A;  1DTT A;  4Z4C A;  4CED A;  3CFP A;  4DQQ A;  3ZT0 A;  3AVA A;  4I2Q A;  1XHZ A;  3TAE A;  3TWH A;  1NK4 A;  3HPG A;  2XRI A;  5KGW A;  3HVT A;  4OPJ A;  3LZJ A;  3RRG A;  4FJ7 A;  4N41 A;  5J2N A;  3AVK A;  3TAM A;  1C0M A;  5D3G A;  4PQU A;  4E7I A;  1X9M A;  4CES A;  4FW2 A;  4IBN A;  4BDP A;  4JRP A;  3NCI A;  4RW4 A;  2BDP A;  4CF8 A;  4FJM A;  3VQD A;  1NK8 A;  3K57 A;  2HHU A;  2IAJ A;  1WSI A;  3RMB A;  3BGR A;  3G0Z A;  1DLO A;  2Q3S A;  3T19 A;  4DTP A;  4F2S A;  1JLE A;  1SKW A;  4O44 A;  1HYS A;  1UA1 A;  1J53 A;  2NUB A;  1QTM A;  2R7Y A;  3NGY A;  4RW7 A;  4Y1D A;  3KIO A;  3SZ2 A;  2QKB A;  2A1R A;  4FYD A;  3IAY A;  1EET A;  3OS0 A;  1LWC A;  2DY4 A;  4G1Q A;  3M8Q A;  4DTJ A;  1XC9 A;  1C1B A;  1L5U A;  2OPQ A;  4RW9 A;  4Z4I A;  3L3U A;  4CK2 A;  4KI6 A;  1ASU A;  1KVB A;  4LSL A;  1RBS A;  2RF2 A;  3CM5 A;  1S1V A;  2O4G A;  3NH2 A;  1SL0 A;  4B9S A;  3TI0 A;  4WE1 A;  2XY5 A;  3IG1 A;  2YKM A;  4W5T A;  4CJR A;  4IG3 A;  1X9S A;  3ZSX A;  3V4I A;  3SQ1 A;  4FJH A;  2HHV A;  4CJV A;  2D0A A;  1ZBL A;  1VRT A;  4CEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...