2EHGA

Crystal structure of hyperthermophilic archaeal rnase hi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
149
structure length
149
Chain Sequence
b'MIIGYFDGLCEPKNPGGIATFGFVIYLDNRKIEGYGLAEKPFSINSTNNVAEYSGLICLMETMLRLGISSPIIKGDSQLVIKQMNGEYKVKAKRIIPLYEKAIELKKKLNATLIWVPREENKEADRLSRVAYELVRRGKLRDIGCIILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HI
publication title Crystal Structure of Type 1 RNase H from a Hyperthermophilic Archaeon with Double-stranded RNA-dependent RNase Activity
rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 49
structure length 149
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13456 RVT_3 Reverse transcriptase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ehgA00
4FZXC 1LV5A 3LP0A 5KTQA 5KI6A 1S6PA 2VG7A 3SZ2A 2ITGA 1L3TA 4HUFA 3T19A 4AHRA 2HVHA 4LSNA 2XY8A 4B9NA 2OPPA 4DS5A 1XHZA 4WE1A 4CEQA 4EZ9A 1DTQA 5FROA 4KO0A 4OLAA 4FYDA 4NYFA 1N6QA 4B9LA 5KRTA 1S1XA 3U6FA 3WNEA 1JL2A 1HYZA 1QSLA 1NK4A 1X9MA 3SYZA 3TAQA 3EY1A 3HP6A 3ZT2A 3PX6A 4FXDA 1JLFA 1TGOA 4FVMA 2BANA 4IBNA 3JSMA 3OS2A 3K5MA 3RR7A 4F2RA 3ISNC 4KTWA 5JS1A 1HMVA 3MEEA 1VSKA 3L3VA 4OKEA 1K6YA 2XY7A 4FJ9A 2F8TA 1KLMA 2X74A 3AVIA 3HP9A 3TI0A 4CE9A 2QK9A 3AO5A 3NF6A 3LZJA 3K59A 4AHUA 4W5RA 1T8EA 3AVMA 4KHQA 2IAJA 3IG1A 2YNGA 1LAWA 3IRXA 3VN5A 4FCYA 1BI4B 3TAPA 1FXXA 4AHVA 1SL0A 2I5JA 4DFJA 2HHSA 4BWJA 3NGYA 4FM0A 1RNHA 3T1AA 3KK2A 4CGJA 1UA1A 3LWLA 2Z1HA 4J2EA 3VQPA 1ASUA 3PX4A 4LH4A 1A5XA 3NH0A 2EHGA 1U45A 4ZHRA 1NJWA 3ZSYA 3OYFA 2ATQA 1ITGA 2RPIA 5HBMA 4CJKA 1LWEA 4CJ4A 2YHAA 1FKPA 4ICLA 3WNGA 4IG3A 1VSDA 2EX3A 4DSIA 3LP3A 5HRNA 2A1SA 2Y1JA 3G10A 1SKSA 1HQUA 2KFZA 2IDOA 1C1AA 3DLGA 3VA3A 1KTQA 3AVNA 4QAGA 1IKWA 3U3YA 4FJNA 4CFDA 1J54A 4FW1A 4CK2A 3LP1A 5KRSA 2AJQA 3QEVA 3WNFA 4KREA 2ZQBA 4I7FA 3DMJA 4NYNA 4B9VA 4M3YA 4Z4FA 4B9TA 3ASMA 1GOCA 2GUIA 3NF7A 1RDBA 1JLCA 3AVKA 3O4QA 3KLEA 4DTSA 2XY6A 1NKCA 2DFFA 1U47A 4HTUA 4M3XA 1U49A 5J2QA 3ZSRA 4O4GA 1QHTA 4CJWA 3SUPA 1BCMA 1WNSA 1CZ9A 2JGUA 4LD0A 4DTNA 3KKRA 3AO4A 4FK2A 1T03A 3VQ4A 3ALYA 3PO4A 3DRSA 3ZSXA 3NE6A 2OZMA 1LWCA 3LAMA 5E41A 3HVTA 1VSLA 4DF8A 1RDDA 3KKSA 3MEGA 4PUOA 4FJJA 4DSJA 1JLEA 1VRTA 1KCFA 5J1EA 5HLFA 1QSYA 4CCHA 3ULDA 4PWDA 4DQQA 3LPTA 4JRPA 3AVAA 5J2MA 2PYJA 1TL1A 1NK5A 4B9UA 2HNDA 3HL8A 3PUFA 3HK2A 3L2QA 2HHTA 3LANA 1S9GA 3MAQA 1NJYA 4DMNA 4M3TA 3TABA 4CEFA 3AV9A 4F3TA 4AHSA 3PX0A 4B08A 3OJUA 2DTUA 3QIPA 2XY5A 2A1RA 2VWKA 4RW9A 3AVHA 3ZSZA 3NH2A 1TK5A 3AO2A 1D8YA 5SZTA 4DWIA 1ZBUA 2B6AA 4JS4A 3G0ZA 4CJ3A 3SUOA 3KLGA 3PO5A 3NDKA 4O55A 1BIZA 3V9WA 4CHNA 3P83D 1WAFA 3OS1A 1HJRA 4QCLA 2O4IA 4CF8A 3S3NA 2WONA 4JS5A 2DY4A 2HB5A 1D5AA 1LW2A 4I9QA 1WSFA 1DTTA 1RDCA 1RT2A 4CF2A 3NGIA 4W5TA 3M8QA 3OYEA 4DFPA 1UA0A 4NCGA 1RT5A 1TV6A 4BDPA 2X78A 3CFOA 1RTJA 1T7PA 3SQ0A 1HYSA 1N5YA 1BGXT 1VSMA 3ZT3A 1JLAA 5CYQA 2YHBA 5CZ2A 4EZ6A 1RBUA 3P1GA 3SUNA 1I39A 3OY9A 5KGWA 4HHTA 1F21A 1A5VA 4CHZA 5KGXA 3ZT0A 2IOCA 3RTVA 2X6NA 3LDSA 3QEWA 3KJVA 1U4BA 1J9AA 3I0SA 1KVCA 3K57A 3DLRA 4CHYA 4DS4A 1VSHA 1G15A 2BE2A 4OVLA 1QSSA 2WOMA 3BGRA 1RTDA 4FJ5A 4DQRA 4OGCA 1HYVA 4FLXA 4CJSA 4FJLA 1RILA 3ZSWA 1JXEA 2HHQA 4KFBA 3V9XA 2ETJA 5FRNA 3TR8A 4CGDA 4CHPA 3HJFA 3V81A 3H08A 2O4GA 3QNOA 1IH7A 1QTMA 1TL3A 4OJRA 1WSIA 4FLTA 4RW8A 3QLHA 5I3UA 2YV0X 2RKIA 1NK6A 3AVLA 3RWUA 3V1OA 4FJMA 4CJRA 4IKFA 3O3FA 1HNIA 2IGIA 4CJEA 3CG7A 1KVBA 4CJQA 4CEZA 4O0IA 3WNHA 4CGIA 5HRSA 5J2PA 1HPZA 1ZBIA 1RBVA 4H4MA 3NGZA 4CECA 1NK7A 4DTXA 2G8IA 3B6OA 4Z4GA 2VG5A 3VQ5A 1S1VA 1SV5A 4DF4A 3S9HA 4CFCA 2G8HA 2G8WA 1C1BA 2KTQA 4DG1A 4E7IA 4DTOA 3OYJA 3AVFA 4CEBA 4B9SA 5FRMA 4E7LA 3L2VA 2KZZA 5HRPA 4DQSA 2P5OA 1RT6A 2Z1GA 1NKEA 4EP4A 1YTUA 3C6TA 4AHCA 4Y1CA 3K2PA 3DLEA 3SQ1A 1JKHA 3KLIA 4RW4A 3NAEA 4B8CA 4DTJA 3DLKA 1JLQA 3KIOA 1EXQA 1EX4A 3VQ6A 4DU1A 2GV9A 4W5OA 2XO7A 1MU2A 4Q5VA 4DSFA 1BI4A 4YFUA 1B9DA 2Z1JA 3SQ4A 1NKBA 5DK5A 3RMBA 3C6UA 1FKOA 4CEOA 4CF0A 4BE1A 1KVAA 3MXMA 1BQMA 4YNQA 4BE0A 2G8UA 3PY8A 3S3OA 1I3AA 1S9EA 3AA4A 1RTHA 5CZ1A 4E7JA 4FJ7A 3SJJA 3VQ7A 1RT1A 4H4OA 4IFVA 1VSJA 3EZ5A 4F2SA 3AA5X 4FLWA 4RW6A 3TAFA 4CHQA 3V9ZA 4ID1A 1WSGA 3CFPA 3DYAA 1UAXA 3TAMA 3B6PA 1IKVA 1WSEA 3VQDA 1YVUA 4M3WA 4Z0UA 2HVIA 4CFBA 3MEDA 2OPQA 3OYCA 4CF9A 1J53A 4CJTA 1SKWA 3ZSOA 4KHYA 4CEAA 4Y1DA 1BHLA 4NCBA 4M3ZA 3ITHA 4FW2A 1IO2A 1ZBFA 3MXJA 2HHXA 4CJVA 1SL1A 5HRRA 4B9MA 4BE2A 1IG9A 1FK9A 1EP4A 2IC3A 1TKXA 1VK0A 2PY5A 1JLGA 4DTRA 4FLVA 4W5NA 4DU4A 4KPYA 3VQBA 3VA0A 1X1PA 3OYNA 4FLUA 4KHNA 3M8SA 1NOYA 1JLBA 2NUBA 1LWFA 2Z1IA 1WLJA 3OYAA 3QO9A 4BDZA 1XI1A 4IDKA 1Z26A 4CF1A 3QERA 1Q8IA 4Q0BA 1BL3A 1RT4A 4LSLA 1X9WA 3NFAA 2YKNA 1BQNA 3DI6A 3V1QA 1T05A 2KZMA 3MXIA 5I42A 1VSIA 4HUGA 1BISA 3KTQA 2OYQA 2QKBA 4E89A 3KLHA 2DFEA 4M3UA 3DOKA 2XRIA 1U04A 4N76A 5T7BA 3VQ8A 3NHGA 4GW6A 3VQEA 2X6SA 1TKTA 4JLHA 3M8RA 3V9SA 2HNYA 1UOCA 2OA8A 3VQAA 3OS0A 2D0BA 1C0MA 4HUEA 2D0AA 3ZSVA 4CK3A 1KSPA 4FZYA 3AVBA 4W5QA 3OYBA 4E7HA 1B92A 4E7KA 3SUQA 3TARA 4FJXA 1DLOA 1JXBA 1RT7A 1KFSA 4CGHA 4O0JA 1IKXA 3QEIA 1CXUA 4DQIA 3A2FA 4FJ8A 3ZT4A 3OYGA 3DOLA 3E01A 3P5JA 2B4JA 1SKRA 1NJZA 4DFKA 2FBVA 1TKDA 1NK9A 3UIQA 4XIUA 5CY4A 4AH9A 2KW4A 1KFDA 4DTUA 4N5SA 4HCCA 2FC0A 4FJKA 5C24A 1GOAA 3CM6A 4CFAA 3VQ9A 3VQCA 4GVMA 3K5OA 3TWHA 1TK8A 3D0PA 4DSEA 3RRHA 3V9UA 2HHVA 4Z4EA 4CERA 1SUQA 1QQCA 3RRGA 3HM9A 4C8KA 2YNFA 1KLNA 4CGFA 2YNIA 3CM5A 2F8SA 1D9FA 3AVJA 5SWMA 3SI6A 3HO1A 1RBTA 3OYKA 2DFHA 1RCHA 3LPUA 4F8RA 4FLZA 1ZBHA 3HPGA 1NK8A 3RR8A 3L2RA 3ZSQA 5CYMA 3HYFA 4DTMA 2Q3SA 4LY7A 3AA2A 4K8XA 4O5BA 3SPZA 3O4NA 3SV4A 1GOBA 3RMAA 2ZD1A 1S1TA 1XC9A 1KRPA 3K5LA 3QESA 3DM2A 4KTQA 1RDAA 3VQQA 4CJ5A 4F4KA 3AO3A 4I9LA 2FBYA 4E1MA 4KV8A 4OKJA 5DMRA 3T3FA 2GBZA 4C8MA 4FJIA 1L3UA 4CJPA 4RW7A 4CGGA 3ZT1A 3M8PA 4CJUA 5EU7A 3HPOA 1XHXA 2OZSA 3OYMA 3MECA 3KLFA 3LALA 4M41A 4HCBA 4E3SA 3OYDA 2G8FA 1VSEA 1D9DA 4CEEA 1ZYQA 4DQPA 3LZIA 1ZBLA 3DLHA 3LWMA 2JLEA 2FBTA 2HMIA 4PQUA 3D45A 4G1QA 4KHWA 4CHOA 2E6LA 1W0HA 3QIOA 5HROA 2QKKA 3C94A 4ELTA 4GMJB 4KHUA 4M3RA 3CQ8A 1C0TA 4PA1A 1YT3A 3AVCA 4BWMA 4KAZA 2PYLA 4KHSA 1HNVA 1WN7A 2OPSA 1UWBA 4DFMA 1NOZA 3AO1A 4PY5A 3HVRA 3OYLA 1TVRA 1VRUA 3HPHA 3FFIA 1BIUA 4R5PA 4J2AA 4B3OA 4ID5A 1ASVA 3RMDA 4FJHA 3CFRA 4Z4CA 3ZCMA 4DLGA 4TSXA 1S1UA 2OPRA 4H8KA 4KB1A 4IG0A 4CJLA 4UQGA 3F73A 3SQ2A 4BDYA 4FK0A 3F9KA 4M45A 1SL2A 1TAUA 4CK1A 3K58A 5D3GA 4CEDA 3LP2A 2Y1IA 2E6MA 3TAGA 3QEPA 4MFBA 3SCXA 3AA3A 3OVNA 4N47A 3K5NA 1S6QA 4JRQA 2G8VA 5FDLA 1HQEA 3SV3A 1Q9XA 3TAEA 3RMCA 4C8OA 1WAJA 4I2QA 2D0CA 4E1NA 3QEXA 1L3VA 5K14A 4ZTJA 3KD1E 1HRHA 1XWLA 4OPKA 5J2NA 1L5UA 1S5JA 2F96A 4KKOA 1QS4A 4LH5A 4CIEA 1L3SA 4E0DA 1CZBA 1IKYA 2HHWA 4I2PA 4HVJA 2XHBA 1QE1A 4FK4A 3LAKA 3TANA 2HW3A 3U3GA 1J5OA 4J2DA 2KFNA 4C8LA 3AVGA 2PZSA 2RF2A 4DSLA 4K8ZA 3HT3A 2FBXA 3CYMA 4RG8A 2B5JA 3SPYA 3EYZA 1CXQA 3NH1A 2YKMA 3L2UA 4KRFA 4KI6A 3JYTA 2IS3A 3I0RA 3HXMA 4FM1A 4IFYA 1NK0A 4FZZA 4CIGA 4J2BA 4E19A 1C1CA 2W42A 2E4LA 3O3GA 2HHUA 1O1WA 4M42A 2BGGA 1EKEA 4OGEA 3NBPA 1S1WA 5JS2A 3QETA 4C8NA 3NCIA 2R7YA 3V4IA 4O44A 1ASWA 4KTZA 1YTAA 3DRPA 2YNHA 3HSTB 3L3UA 4BACA 4DLEA 1A5WA 3V6DA 2P5GA 3PV8A 2VWJA 4F3OA 1RT3A 4EP5A 1W9HA 3KK1A 3THVA 2BDPA 4DSKA 1R0AA 3KD5E 4N41A 3L2WA 1WSJA 2P51A 2QXFA 1TK0A 3DRRA 1WSHA 2G8KA 4ZTFA 3V1RA 4OKKA 4KI4A 4CESA 1TAQA 4FLYA 4ELVA 2RN2A 5C42A 3QNNA 4N56A 3S3MA 1JL1A 3KK3A 4OLBA 4CIFA 3QINA 4AHTA 4L8RB 3C95A 4MQ3A 5HP1A 1X9SA 4AILC 1Q9YA 4FJGA 4KB0A 3OJSA 2D5RA 5C25A 1NJXA 3NF9A 1RBSA 3IS9A 2P1JA 1EETA 3L8BA 2KQ2A 4Z4HA 3SNNA 3IAYA 1REVA 1VSFA 3DLBA 1BCOA 4ELUA 1LW0A 1RTIA 2ZE2A 1CLQA 4QOZB 1B9FA 2LSNA 4CJFA 3I8DA 3OYHA 4FM2A 1Z25A 1C6VA 4OPJA 1RBRA 4B8AB 4DTPA 3OYIA 2HNZA 4DU3A 1U48A 3BDPA 1Y97A 2VG6A 1TKZA 3NF8A 4Z4IA 1LAVA 1C0UA 3O3HA 4NCAA
chains in the Genus database with same CATH superfamily
4FZXC 3LP0A 2ASPA 3THWB 2ITGA 4JI1K 1NGJA 5AQUA 2FLOA 2NRHA 4H0XB 1QQOA 3I56N 4EZ9A 4PKHA 5FROA 2P9UB 1KAZA 4OLAA 1K8KB 5KRTA 3U6FA 1HYZA 1QSLA 3SYZA 2A3ZA 1TYQB 4IBNA 3OS2A 3RR7A 4F2RA 3ISNC 4OKEA 4FJ9A 4CZIA 3AVIA 3TI0A 4CE9A 5C2DA 4RWTA 3LZJA 4B1UB 4AHUA 4W5RA 1T8EA 4IJAA 2A40A 3IG1A 2F9WA 3IRXA 3VN5A 3WXLA 1SAZA 1SL0A 5AQTA 3P39A 3L4IA 3KK2A 5M1QA 1UA1A 4J2EA 2W6LA 3NH0A 1U45A 4ZHRA 1OKJA 2Q97A 3MWTA 4CJ4A 3WNGA 1VSDA 2QTDA 3R3LA 2RHKA 4PL7A 3VA3A 1KTQA 3AVNA 4QAGA 5ADXA 4FJNA 4JKCA 4FW1A 4BRAA 2CGLA 2AJQA 3R6MA 3WNFA 3EEQA 4I7FA 4DV6K 4B9TA 4UY8O 5JVHL 4DTSA 2DFFA 5LY3A 5HL7L 4HTUA 4GKJK 1QHTA 1X9JA 4YY3K 1WNSA 3FLCO 3KKRA 1VHXA 4WQ4A 4FK2A 4BRGA 3PO4A 3DRSA 3LAMA 4DF8A 5BPNA 1R59O 3RVCA 5KPRA 4PWDA 4DQQA 3LPTA 3HL8A 1QZ6A 5ELZA 5AZJA 2YI1A 4BR9A 4BRDA 3AV9A 4JAXA 4K42A 3T7ZA 4DCHA 4B08A 4B3RK 4F3TA 4RW9A 3AVHA 4NLBA 1TK5A 3QFPA 4JK7A 1JJ2M 2B6AA 2P9NA 3G0ZA 4EHTA 2IVOA 4LC9B 3NDKA 4H0VB 4OPHA 3MX2A 1N36K 1XMQK 3EKSA 2WONA 3BZKA 3EN9A 1T3VA 1D5AA 3R9PA 1LW2A 1WSFA 1DTTA 1T03A 1UA0A 3NGIA 5F1XA 1U2VA 3CCQN 4DFPA 1FJGK 1TV6A 2ZJPL 4BDPA 3A5OC 1T7PA 1HYSA 1N5YA 1VSMA 3CPWM 1JLAA 3M1FA 2O8CA 2BH1A 1RBUA 3SUNA 3FR0A 5M1OA 1F21A 2GEMA 3ZT0A 3ZETB 2FSKA 2IOCA 3CC7N 3QEWA 1U4BA 1J9AA 3J8AA 1KVCA 3HTVA 4DS4A 1VSHA 1G15A 2BE2A 2WOMA 3SBGA 4OGCA 1JCFA 4JI0K 2HHQA 4YORA 5EXWA 5AR0A 1N32K 1T6DA 3H08A 2O4GA 3QNOA 2QWPA 5KQ8A 3O4WA 2YV0X 3V1OA 3IKMA 4JYAK 2NRXA 1Q82O 2NZTA 5J2PA 4H0YB 1HPZA 1RBVA 4H4MA 1EWQA 3B6OA 2VG5A 1S1VA 1SV5A 4CFCA 4DTOA 3PIOL 5AZIB 5HRPA 4B1WB 3A5LC 2Z1GA 4DQSA 1YTUA 3C6TA 4AHCA 4Y1CA 3K2PA 5GAGP 2E1ZA 3R1XA 3DLKA 1JLQA 3CJAA 3KIOA 1EX4A 3O9UA 3AGRA 2XO7A 2HF3A 1BI4A 2E2NA 2Z1JA 4GV3A 1NKBA 1IBKK 3C6UA 1BQMA 4YNQA 3PY8A 4JK9A 3S3OA 5CZ1A 3CCEN 4E7JA 5AQPA 1RT1A 3SAGA 1HKGA 3O9RA 4RW6A 4CHQA 3V9ZA 4ID1A 1WSGA 3O9SA 1UAXA 1IKVA 1YVUA 2E2OA 3OYCA 1J53A 1SKWA 2GELA 3ZSOA 4BROA 4M3ZA 3ITHA 5TKYA 4A61A 4DR7K 4CJVA 4B9MA 3CC2N 2QA4N 1TKXA 4RTFD 4W5NA 3U4LA 2ITMA 4DU4A 3VQBA 5IT9O 4FLUA 3R8EA 1NOYA 3CJ7A 2NUBA 1IJJA 3O08A 3QERA 4Q0BA 3MWPA 3NFAA 3V1QA 3DI6A 4IO9L 1T05A 5C0YA 2P9PA 3KTQA 1NLVA 2VGNA 3VQEA 4JLHA 2HNYA 2D4WA 1SS6A 3CERA 4FZYA 2Q1NA 4JI3K 3ZYYX 1KFSA 3VOVA 3D2FB 3HM8A 3U9ZA 2ZM6K 4DV5K 3ULEB 3P5JA 1ESVA 1NK9A 5BN8A 5GINA 3UIQA 5GAHP 4XIUA 2KW4A 1KFDA 4JKGA 4N5SA 4HCCA 1GOAA 4CFAA 4CJ7A 3OHRA 3ZEUB 1SUQA 4O8KA 4AQYK 1KLNA 1KQSM 2YNIA 3WQUA 3CM5A 2F8SA 4DR6K 3AVJA 3HO1A 4BQZA 3OYKA 3CI5A 1HPMA 1GLLO 3RR8A 3ZSQA 4LY7A 3AA2A 4BR7A 2ZJQL 3O4NA 4FWRA 5CE3A 2W6KA 4Y0WA 2QW9A 3K5LA 1KRPA 5EVZA 3VQQA 2A6AA 5EOYA 2OTLN 4E1MA 1S72N 4FJIA 3CJBA 3QMLA 4CJPA 2ZJRL 2A42A 2O8BB 3HSCA 4CEEA 3DLHA 2HMIA 2E6LA 3CJ9A 3CQ8A 4PA1A 3AVCA 4BWMA 1WN7A 4WQ5A 1NOZA 3HVRA 3OYLA 4J2AA 3O5BA 4IOCL 4Z4CA 2FSNA 2OPRA 4QS9A 5AQHA 4CJLA 3F9KA 4M45A 1TAUA 4CK1A 2UUBK 5D3GA 3UE5A 3TSUA 1NGIA 4MFBA 3AA3A 3OVNA 5FDLA 3SV3A 1NG9A 1WAJA 4E1NA 5K14A 4ZTJA 1IG8A 4XH5A 4C1NI 1S5JA 1QS4A 3CCUN 1VQPN 3K9JA 4BRLA 4HVJA 2XHBA 5BR9A 5JMVA 3AVGA 4DSLA 4K8ZA 4JI4K 4RG8A 3IMXA 5AQJA 3SPYA 3EYZA 5LL6Z 3L2UA 4KI6A 3WEEA 4FWMA 4OGEA 3NBPA 4C8NA 4OO1J 2WC9A 4JKAA 1P90A 2GWKA 4KTZA 4BACA 4JEPA 2YNHA 3HSTB 2HOEA 3G71N 1RT3A 3KK1A 1U2VB 4DSKA 3KD5E 3JAMO 1R0AA 2P51A 3DRRA 4JI5K 1WSHA 1NMNA 2RN2A 3QNNA 4N56A 4DQ8A 4OLBA 5HP1A 3OJSA 3SBTA 1EETA 3L8BA 1P8ZA 3PSIA 1VSFA 1BCOA 1K9MO 4ELUA 3GG4A 1RTIA 1CLQA 1B9FA 2CGJA 4FM2A 4QS8A 2O8DA 4B8AB 3M5RA 2HNZA 1U48A 3BDPA 2VG6A 3O3HA 1VQLN 3WUHA 5KPTA 5KI6A 2VG7A 3SZ2A 1L3TA 4JI8K 4HUFA 3H6EA 2OPPA 4WE1A 4CEQA 1N6QA 1HX1A 3FZLA 4B9LA 3TSPA 4A2AA 3LDPA 1S22A 1C0GA 3TTCA 3EY1A 3ZT2A 1GLBG 3JSMA 1RGIA 1BWFO 3FE1A 3L3VA 5KPZA 2A5XA 2XY7A 2F8TA 1KLMA 2X74A 4DV1K 2QWRA 3AVMA 4FCYA 1BI4B 4AHVA 1J5EK 2I5JA 2HHSA 3BP8A 4FM0A 2IVNA 2Z1HA 4IFEA 2Q31A 3PX4A 4ILHA 2ASOA 1A5XA 2EHGA 3ZSYA 1ITGA 1NNEA 2YHAA 1FKPA 2EX3A 5HRNA 3G10A 1SKSA 1HQUA 3DLGA 3SLCA 4H5RA 3U3YA 2P9KB 3JXUA 1J54A 4CK2A 4YHHK 1E3MA 5KRSA 3QEVA 3QBWA 5AQWA 3H1VX 4JI2K 4I6MA 1GOCA 2GUIA 2P9LA 1NKCA 4JKHA 5J2QA 1U49A 4JHDA 4LD0A 2W40A 1YXQA 2P9PB 3VTIA 3ALYA 3ZX3A 3ZSXA 2OZMA 5E41A 3G25A 3KKSA 4PUOA 1KCFA 5HLFA 4NLCA 4CCHA 3ULDA 3KHYA 4H0OA 5M1KA 1VQ8N 3CQYA 3VPZA 4JRPA 2PYJA 4B9UA 2HNDA 3PUFA 3VEYA 3IFRA 3LANA 5CHIA 4AHSA 3PX0A 1MWMA 2VWKA 4CD3A 5SZTA 1ZBUA 4JK8A 4DUZK 3SUOA 3T1HK 4JKGB 3V9WA 3F5TA 3P83D 1WAFA 4CF8A 3S3NA 4CI6A 1KAXA 3WXIA 3M8QA 4ISEA 4JKDA 3CFOA 2VYPA 1NGFA 2WTUA 5F2RA 5KGWA 4CHZA 1A5VA 5KGXA 2PBDA 3I0SA 2HBJA 1KD1O 4CHYA 1Z6RA 4DQRA 2KKZA 3THXA 3FFKB 2QWMA 3J81O 4K41A 2ETJA 4LF8K 1X3MA 4BRNA 5AQRA 1WSIA 4FLTA 2O8FB 4CJRA 5AQKA 1NU0A 4CZHA 5C15A 2IGIA 4CJEA 3CG7A 4O0IA 4CGIA 1BOTO 3NGZA 3LL3A 4CECA 1V4TA 2G8IA 4Z4GA 4BR0A 4NB4A 3VQ5A 3S9HA 3MMVA 3OYJA 2ASMA 3L2VA 2ZWHA 2CH6A 2UUCK 3SQ1A 2YCHA 3DLEA 4RW4A 3KLIA 3VQ6A 4DU1A 3L4QA 4X66K 2GV9A 3GDQA 4MDAA 3O9TA 1B9DA 3SQ4A 3DXMB 5DK5A 1FKOA 4CF0A 4MO5A 3MXMA 2G8UA 1I3AA 4FJ7A 4BC3A 3T1YK 2E1YA 4IFVA 4F2SA 4FLWA 3VEZA 1Q7YO 1BUPA 5BPMA 3TAMA 5FPDA 2VWBA 3DXKA 3VQDA 2HVIA 3ID8A 4Y1DA 1BHLA 4BRQA 5GIOA 4FW2A 1IO2A 1ZBFA 3VGLA 2HHXA 4DHYA 5HRRA 1FK9A 5GADP 2IC3A 5B8HA 3MN5A 4FLVA 4LFAK 4KPYA 3VA0A 1X1PA 3VEVA 3OYNA 4JI7K 1JLBA 5JLHA 2QWLA 1LWFA 2Z1IA 3OYAA 4BDZA 3QO9A 4H5WA 1VQ5N 4IDKA 1Z26A 3C0BA 4CF1A 2YKNA 1BQNA 1VQ9N 1OVYA 2FF6A 4LF7K 4IWVA 3T69A 4E89A 3KLHA 3DOKA 2XRIA 1J6ZA 3CMEN 3DWLA 1NGBA 3E9LA 3M8RA 4DR3K 3OS0A 2D0BA 2D0AA 4CK3A 3NVKA 2QEXN 3KK7A 4CVNE 1JXBA 2P9SA 3C7NA 4CGHA 3SK3A 3TTDA 3LM9A 3QEIA 3THYB 1Q86O 2B4JA 1SKRA 1TKDA 5GAEP 4AH9A 3D7EO 4JI6K 2FC0A 3UKUB 3CM6A 3TWHA 3D0PA 1GLCG 4DSEA 1M1KO 4Z4EA 4FPAA 1BDGA 1QQCA 2KLAA 3MN9A 2I7NA 4CGFA 3G6EN 4YDUA 4BRFA 3CHWA 1BO5O 3L2RA 3HYFA 4DTMA 1G99A 4K8XA 3SV4A 3QESA 3DM2A 4KTQA 1RDAA 4F4KA 4I9LA 4KV8A 2GBZA 2GTDA 4CGGA 3ZT1A 3M8PA 3HPOA 5EU7A 3M6GA 1BU6O 4M41A 2Q0UA 3LDLA 3LM2A 3VTHA 4HWIA 3LZIA 1OVQA 3LWMA 2FBTA 1ATSA 4L3QA 4B9QA 4KHUA 1W0HA 4ELTA 3MK6A 3UB5A 4M3RA 4CBXA 4KH5A 2PAVA 1C0TA 4FL9A 1HNVA 4DV4K 1TVRA 2NNWA 2BTFA 3P4IA 3ENOA 4ID5A 1ASVA 4DLGA 4FVUA 4KB1A 5EY4A 3CETA 4UQGA 4FK0A 4FSVA 3EO3A 4JHDB 4LF5K 1ATRA 2Y1IA 3TAGA 3QEPA 4B1VA 4JRQA 1GLJO 3OTOK 1Q9XA 3RMCA 4I2QA 1NJIO 3L0QA 3N4QA 3KD1E 3HOSA 1NM1A 5J2NA 1L5UA 2F96A 1L3SA 1CZBA 3WXMB 5JICA 3EL2A 1ZXOA 4FWLA 2HW3A 4FWKA 3NH1A 3O1WA 2E88A 3F2KA 2YKMA 4KRFA 3CXCM 3C6HA 3HXMA 1MA9B 1NK0A 4CIGA 2W42A 4PKIA 4U7BA 2GX9A 3QBXA 1N8RO 5M1FA 4H5NA 4A62A 5JS2A 3QETA 2R7YA 1YHQN 3KZBA 4O44A 4JD2A 4WQ4C 1A5WA 2VWJA 4CZMA 4EP5A 1W9HA 4N41A 1O13A 2A41A 1ATNA 3VERA 1WSJA 1TK0A 2QXFA 3GBTA 2G8KA 4ZTFA 4FPBA 1GLAG 4OKKA 3U8XA 4H5VA 1HKBA 5LMUK 1GLEG 1JL1A 3MDQA 4AHTA 4L8RB 3C95A 4MQ3A 4FJGA 1EO1A 2D5RA 1HLUA 3SAFA 1NJXA 3BZCA 3TSQA 3SNNA 3IAYA 1REVA 2I7PA 3DLBA 1LW0A 3E9OA 2BUPA 4CJFA 3OYHA 3Q7BA 3OYIA 4DU3A 1LAVA 4B3SK 4RCHA 4NCAA 4FOEA 5AQXA 1S6PA 3T19A 2WFBA 1NMDA 2HHHK 3G4SN 2XY8A 4DS5A 1XHZA 1DTQA 5E84A 3ENHA 1S1XA 3WNEA 4FOIA 3HP6A 3PX6A 4FXDA 1TGOA 4FVMA 4QS7A 5FPNA 4BRMA 4EIAA 1QVGM 4CZGA 5JS1A 1HMVA 1VSKA 4HTLA 3O80A 3K59A 4YOWA 4KHQA 2IAJA 1LAWA 3O9QA 3TPQA 4U67L 3TAPA 1FXXA 1K8KA 3D2EA 3WT0A 3D6RA 4BWJA 4B3TK 1RNHA 3T1AA 4CGJA 4BR5A 4EHUA 1TYQA 4LH4A 5AQFA 3OYFA 2ATQA 4M7XA 5HBMA 4BG9A 1LWEA 4ICLA 3CPEA 4IG3A 3J7YP 4DSIA 3LP3A 3ENBA 2A1SA 2IDOA 3ATUA 1C1AA 1IV0A 4BG8A 3BF1A 4YOTA 3VMFB 1IKWA 4CFDA 1LCUA 4KREA 3P31A 2ZQBA 2YHXA 4M3YA 4Z4FA 2E2QA 3ASMA 1RDBA 1JLCA 3O4QA 1U47A 1I94K 3ZSRA 5AZJB 2V51B 3FZKA 4CJWA 2YJEA 4DTNA 3AO4A 3VQ4A 3NE6A 2QI2A 3HZ6A 3HVTA 1VSLA 2P9NB 1RDDA 3C65A 3MEGA 4KHPK 4DSJA 1JLEA 1VRTA 5J1EA 1QSYA 5LJWA 2NRTA 4C23A 3AVAA 3FZHA 3TU5A 1GLFO 1S9GA 4CEFA 2DTUA 3QIPA 5CR4A 2XY5A 2A1RA 3I8BA 5A2QO 3RSEA 1D8YA 3OBWA 3SMPA 3AO2A 4DWIA 2O8CB 4CJ3A 4DV2K 3KLGA 3PO5A 4O55A 5JVGL 1YAGA 4X65K 4IO8A 3ID6A 1C0FA 4JS5A 2DY4A 2HB5A 4BREA 4I9QA 1XQSC 1RDCA 5LMNK 4W5TA 4NCGA 3LDQA 2X78A 1RTJA 3DJCA 3SQ0A 2IIRA 4MLEA 1BGXT 3ZT3A 4MO4A 5ADXH 5CYQA 4GV6A 5CZ2A 3P1GA 1I39A 3QB0A 5KQDA 3RTVA 2X6NA 3LDSA 3KJVA 3SAHA 3K57A 3H46O 3WXJA 4ILJA 5AFUH 1QSSA 3BGRA 4FJ5A 2UUAK 1HYVA 4FLXA 4FJLA 5IWAK 3ZSWA 1HNXK 2YJFA 4GY2B 4KFBA 3TR8A 4YOYA 1EQYA 1QTMA 1IH7A 3WQTA 1BA1A 1OH6A 3ZETA 5AQQA 2RKIA 3AVLA 3RWUA 4IKFA 1MWKA 1HNIA 4LF6K 5AQVA 4CJQA 1KVBA 3WNHA 3PSFA 5HRSA 1ZBIA 4H5TA 3GOIA 2WBNA 1XNRK 1HUXA 4DTXA 3H3OB 4DF4A 4BVPA 2KTQA 3VESA 4FWOA 4E7IA 1QQMA 4E7LA 2P5OA 1RT6A 1NKEA 4EP4A 4NXNK 3IUCA 4FWQA 2E2PA 4BVOA 4H0TB 4DTJA 4B8CA 2QWNA 1EXQA 4ISGA 4W5OA 5AQGA 2V52B 4DSFA 4CW7B 4YFUA 2W41A 1CZAN 4GKKK 1KVAA 4BE0A 1RTHA 3SJJA 3E1YA 3VQ7A 2CH5A 3EZ5A 1VSJA 4OX9K 5AZIA 3TAFA 2J4RA 4F9OA 2EWSA 4WQ5C 1WSEA 4Z0UA 2UYTA 4NXMK 4BR4A 3MEDA 2OPQA 4CF9A 4CZEA 1Y64A 3CCJN 4NCBA 1W97L 3MXJA 1U6ZA 1M90O 1VK0A 1JLGA 4DTRA 4JD2B 4KHNA 2QXLA 3M8SA 1SQKA 1YUWA 3CJ1A 2UU9K 1WLJA 1XI1A 4LSLA 2HSTA 4IJNA 5I42A 1BISA 2OYQA 2QKBA 2DFEA 5AQZA 4M3UA 1U04A 1XNQK 4EAHD 3LDOA 4AM6A 3BEXA 1E4FT 3AARA 3VQAA 3HI0A 3ZSVA 3AVBA 4E7HA 3L6QA 3ZX0A 1RDWX 1CXUA 1NGAA 3A2FA 3CMAN 3ZT4A 3DOLA 3Q7CA 4JKBA 3SJHA 3E01A 3F9MA 5JLFA 4FWPA 1NGHA 5CY4A 4WYBA 4FJKA 4IDHA 4GVMA 2PFUA 3K5OA 1TK8A 3H1QA 3CC4N 4CERA 1NGEA 4E1JA 4ILGB 3HM9A 4C8KA 2YNFA 1D9FA 3D2FA 3SI6A 1RBTA 2IVPA 5DM7L 2DFHA 1RCHA 3LPUA 4F8RA 4FLZA 1ZBHA 3FGUA 4EFHA 3J7ZO 4O5BA 4CZJA 2NRWA 3SPZA 1GOBA 2ZD1A 1S1TA 2NLXA 1XC9A 4CZFA 1WBBA 2O8EA 3W3DA 4CJ5A 4CD1A 3ZEUA 3AO3A 2FBYA 1BA0A 1V4SA 5MLCQ 3T3FA 2YHYA 3D2EB 1FW6A 3J7AP 4Z94A 2OZSA 3OYMA 3MECA 3FZMA 4X62K 4HCBA 4E3SA 3OYDA 2ZF5O 1VSEA 1D9DA 3ZX2A 4DQPA 2E20A 3K0SA 4PQUA 4KHWA 1MDUB 1NGDA 2QKKA 3C94A 1ZC6A 4DV0K 5FPEA 3A8YA 4KAZA 2PYLA 1ILYA 2OPSA 4A2BA 1UWBA 1N34K 4BR2A 3AO1A 4PY5A 2O8BA 1QVFM 3KVGA 1BIUA 4R5PA 4B3OA 4KH4A 4FJHA 3RMDA 1QHAA 4CBWA 3CFRA 1W7AA 3ZCMA 1OH8A 1WUAA 1S1UA 1SZ2A 3VF2A 2WUSA 4IG0A 2HF4A 1SL2A 2ZGYA 4ISFA 3K58A 3MN6A 4M63C 2AA4A 3LP2A 4CEDA 1HNZK 3S41A 5BRDA 4N47A 4GV9A 4LF9K 1WB9A 3TAEA 1Q18A 4GVEA 3QEXA 3WEEB 1OH5A 1HRHA 1XWLA 4KKOA 4LH5A 4CIEA 4E0DA 1IKYA 2HHWA 4FWSA 1QE1A 4FK4A 3LAKA 3TANA 3U3GA 1J5OA 4J2DA 2DPNA 2KFNA 1D4XA 2RF2A 5AFUA 3HT3A 2FBXA 1DGKN 3EKUA 2FF3B 3I0RA 3RSEB 5AQIA 3BF3A 1TUUA 4FZZA 4J2BA 1C1CA 2E4LA 4B1ZA 4M42A 3NCIA 4CZKA 1ASWA 4DLEA 3L3UA 2VCPA 5BR8K 3PV8A 4F3OA 3PLAA 3THVA 2O8DB 3VGMA 2GUPA 5H1SQ 2Q2RA 3QICA 5I9EB 4M7YA 3GL1A 3V1RA 2D1KA 2D0OA 4KI4A 3QFUA 1TAQA 4FLYA 3MN7A 1EWRA 5C42A 3S3MA 3KK3A 3OBYA 4CIFA 3QINA 1Q9YA 2NRZA 1HJOA 5BRHA 5C25A 3BUZB 3NF9A 3IS9A 3VENA 2KQ2A 4Z4HA 4BC2A 3CD6N 4FWNA 2D0PA 2ZE2A 2LSNA 3I8DA 2YHWA 2CGKA 3AGKA 1Z25A 4OPJA 4KBOA 1RBRA 3KWIA 4DTPA 5DM6L 5BN9A 4AM7A 1Y97A 2RE2A 3NF8A 2NRRA 4JN4A 3O1BA 1C0UA 1QQNA 1LV5A 5KTQA 3AAQA 1YJWN 4WFBL 1VAZA 4AHRA 4V19S 2HVHA 4LSNA 2FXUA 4B9NA 2OCEA 1YVNA 4KO0A 4FYDA 4NYFA 5FLXO 5AQMA 1JL2A 1E4GT 1NK4A 2YX6A 1X9MA 2P9IA 3TAQA 1JLFA 2BANA 3K5MA 2VGMA 1GLDG 4KTWA 3MEEA 1K6YA 4IEEA 1IBLK 3HP9A 2QK9A 1XMOK 3AO5A 3NF6A 4R79A 2JWLA 2YNGA 3HOTA 4B3MK 1X3NA 4BRIA 4DFJA 5FPMA 3NGYA 4DR4K 2JWKA 1K8AO 3LWLA 4DR1K 5AQOA 3VQPA 1ASUA 2UXBK 3HRGA 1RDUA 3A5NC 4A5AA 1NJWA 4I6MB 3VEOA 2RPIA 4CJKA 2P9LB 5BRFA 1NGGA 5BREA 2Y1JA 1KAYA 2KFZA 4KH6A 4GNIA 4JNEA 3LP1A 1VQKN 3H45C 3DLLL 3DMJA 4NYNA 4DB3A 4B9VA 4X64K 5C2FA 3NF7A 3KLEA 3CIPA 3AVKA 3J80O 2XY6A 3A5MC 3OW2M 3VF4A 4M3XA 5TKWA 2UXCK 4O4GA 4XH1A 1WOQA 3SUPA 1S3XA 1BCMA 1CZ9A 3ZLJA 2JGUA 5AQYA 2F4VK 1LWCA 2P9KA 1ZBSA 3N4PA 5C10A 4FJJA 5J2MA 1TL1A 4BRKA 1NK5A 2E8AA 1JCEA 3HK2A 3L2QA 2HHTA 4BQLA 3MAQA 1NJYA 4DMNA 4M3TA 3TABA 3KWGA 2GWJA 3UKRA 3OJUA 2E5LK 3ZSZA 1VQMN 3NH2A 4YOUA 4JS4A 5GIPA 3EZWA 1BIZA 4O8UA 4J8FA 4CHNA 4G9ZA 3OS1A 1HJRA 4QCLA 1JCGA 4A59A 3A0IX 4JKEA 1XC3A 1RT2A 2HBMA 4CF2A 3OYEA 5AQNA 1RT5A 3JS6A 3THXB 4DUYK 2YHBA 4EZ6A 4PHTX 3OY9A 4HHTA 1KXPA 3MCAB 2O8EB 1HNWK 3DLRA 3HBTA 1W2BM 3M3ZA 4OVLA 1RTDA 4CZLA 3BY5A 4CJSA 1RILA 2FSJA 1JXEA 4YOXA 1N33K 1K73O 3V9XA 5FRNA 4CGDA 4CHPA 4LF4K 3HJFA 3V81A 1TL3A 2HBLA 4OJRA 4YDUC 3FZFA 4RW8A 3QLHA 3GE1A 5I3UA 4PL8A 3THWA 1NK6A 4BRHA 4FJMA 3O3FA 2QM1A 1YI2N 1HR0K 2P9UA 4CEZA 1VQ7N 1DKGD 1NK7A 3B8AX 2G8HA 3CJCA 2G8WA 1C1BA 2HBKA 4BGAA 4DG1A 4MLHA 4B9SA 5FRMA 3AVFA 4CEBA 2KZZA 2O8FA 4A5BA 3DXKB 1JKHA 3NAEA 2V7YA 1KC8O 4H03B 5AQSA 3O8MA 3IDHA 1MU2A 4Q5VA 1DT9A 3RMBA 4CEOA 4BE1A 3QDKA 2QWQA 1S9EA 3AA4A 4DR5K 5EX5A 4H4OA 4IOAL 3AA5X 4XH4A 4BC5A 3CCRN 1YIJN 3E9PA 3EE9A 3CFPA 3DYAA 2UXDK 3B6PA 4AF1A 4M3WA 4DV7K 3NVMA 4CFBA 4KHYA 4CJTA 3VGKA 4CEAA 1T6CA 1T44A 3DXMA 1SL1A 4BE2A 1WBDA 1IG9A 1EP4A 3VETA 1YITN 2PY5A 1QZ5A 4NO7A 4DV3K 3OA9A 2P9SB 3C7NB 3DAWA 4LFBK 1Q8IA 1BL3A 1RT4A 3CCVN 4H0PA 1X9WA 2KZMA 3MXIA 5M1NA 1VSIA 4HUGA 4C1NK 1IBMK 3SMSA 4N76A 5T7BA 3VQ8A 3NHGA 4GW6A 2X6SA 1TKTA 4B1XB 3LDNA 3V9SA 1UOCA 2OA8A 1C0MA 5F0XA 4K0KK 4HUEA 1KSPA 4W5QA 3OYBA 3AY9A 1B92A 4E7KA 3SUQA 3TARA 4FJXA 1DLOA 1RT7A 4O0JA 4YOVA 1IKXA 3PIPL 4BC4A 4DQIA 4FJ8A 3OYGA 1XUPO 1YF5L 1NJZA 2KHOA 2Q36A 4DFKA 2FBVA 1H1VA 4DTUA 5C24A 3CCLN 3VQ9A 3VQCA 3RRHA 5AQLA 3V9UA 2HHVA 3RRGA 3I55N 3P38A 4BGBA 1HKCA 5SWMA 4DKWA 3THYA 2P9IB 3HPGA 4WFAL 4K25A 1NK8A 3CCSN 5CYMA 2Q3SA 1OH7A 4PKGA 3UKUA 3RMAA 1BG3A 4OKJA 2ZGZA 3C6AA 5DMRA 2H3GX 4C8MA 1TUYA 1L3UA 4WF9L 4BRPA 4RW7A 4CJUA 2AP1A 1XHXA 2QWOA 1VQ4N 3KLFA 3LALA 2G8FA 1ZYQA 1ZBLA 3U9DA 4BY9C 2JLEA 2F9TA 5AJ3K 4A57A 3D45A 4G1QA 4CHOA 3QIOA 5HROA 4GMJB 3AAPA 4WFNL 1VQON 1YT3A 4KHSA 5E26A 4DFMA 2OTJN 1VRUA 3HPHA 3W0LA 3FFIA 1Q81O 3WXKA 5C12A 3K9KA 4TSXA 1RFQA 4H8KA 3VEXA 3F73A 3SQ2A 4BDYA 3O6WA 2E6MA 5M1PA 3SCXA 2G8VA 3K5NA 1S6QA 2Q0RA 3ATVA 4JV5K 1HQEA 1NWKA 4BRCA 4C8OA 3H3NO 3NMUA 2D0CA 1DEJA 1L3VA 4OPKA 4IEIA 4I2PA 1NBWA 1NGCA 3MX5A 4MDBA 2NRVA 4C8LA 1VQNN 5LJVA 2PZSA 5HOOA 4IOXA 4OPAA 3CYMA 2B5JA 4CBUA 1CXQA 3UKRB 4WCEL 2V7ZA 3JYTA 2IS3A 1LOTB 4FM1A 3VF6A 4IFYA 4FO0A 3CCMN 3EE8A 4E19A 3O3GA 2HHUA 1O1WA 2BGGA 1EKEA 1S1WA 3V4IA 4O5FA 5BPLA 1YTAA 3DRPA 2O4IA 3V6DA 3TTFA 2P5GA 2HMPA 2BDPA 3CQXA 3L2WA 4B1YB 1VQ6N 2F7TA 3VEWA 4CESA 4JKFA 3MCPA 4ELVA 1Z05A 4IXCA 4LFCK 2OANA 1X9SA 4AILC 1YJNN 2VQFK 4KB0A 3CF5L 4XEIA 1RBSA 2P1JA 2VQEK 3E66A 3I33A 4QOZB 4IZ9A 1C6VA 4DR2K 1YJ9N 4K43A 3ULEA 1TKZA 4Z4IA
chains in the Genus database with same CATH topology
4FZXC 1LV5A 3LP0A 5KTQA 5KI6A 1S6PA 2VG7A 3SZ2A 2ITGA 1L3TA 4HUFA 3T19A 4AHRA 2HVHA 4LSNA 2XY8A 4B9NA 2OPPA 4DS5A 1XHZA 4WE1A 4CEQA 4EZ9A 1DTQA 5FROA 4KO0A 4OLAA 4FYDA 4NYFA 1N6QA 4B9LA 5KRTA 1S1XA 3U6FA 3WNEA 1JL2A 1HYZA 1QSLA 1NK4A 1X9MA 3SYZA 3TAQA 3EY1A 3HP6A 3ZT2A 3PX6A 4FXDA 1JLFA 1TGOA 4FVMA 2BANA 4IBNA 3JSMA 3OS2A 3K5MA 3RR7A 4F2RA 3ISNC 4KTWA 5JS1A 1HMVA 3MEEA 1VSKA 3L3VA 4OKEA 1K6YA 2XY7A 4FJ9A 2F8TA 1KLMA 2X74A 3AVIA 3HP9A 3TI0A 4CE9A 2QK9A 3AO5A 3NF6A 3LZJA 3K59A 4AHUA 4W5RA 1T8EA 3AVMA 4KHQA 2IAJA 3IG1A 2YNGA 1LAWA 3IRXA 3VN5A 4FCYA 1BI4B 3TAPA 1FXXA 4AHVA 1SL0A 2I5JA 4DFJA 2HHSA 4BWJA 3NGYA 4FM0A 1RNHA 3T1AA 3KK2A 4CGJA 1UA1A 3LWLA 2Z1HA 4J2EA 3VQPA 1ASUA 3PX4A 4LH4A 1A5XA 3NH0A 2EHGA 1U45A 4ZHRA 1NJWA 3ZSYA 3OYFA 2ATQA 1ITGA 2RPIA 5HBMA 4CJKA 1LWEA 4CJ4A 2YHAA 1FKPA 4ICLA 3WNGA 4IG3A 1VSDA 2EX3A 4DSIA 3LP3A 5HRNA 2A1SA 2Y1JA 3G10A 1SKSA 1HQUA 2KFZA 2IDOA 1C1AA 3DLGA 3VA3A 1KTQA 3AVNA 4QAGA 1IKWA 3U3YA 4FJNA 4CFDA 1J54A 4FW1A 4CK2A 3LP1A 5KRSA 2AJQA 3QEVA 3WNFA 4KREA 2ZQBA 4I7FA 3DMJA 4NYNA 4B9VA 4M3YA 4Z4FA 4B9TA 3ASMA 1GOCA 2GUIA 3NF7A 1RDBA 1JLCA 3AVKA 3O4QA 3KLEA 4DTSA 2XY6A 1NKCA 2DFFA 1U47A 4HTUA 4M3XA 1U49A 5J2QA 3ZSRA 4O4GA 1QHTA 4CJWA 3SUPA 1BCMA 1WNSA 1CZ9A 2JGUA 4LD0A 4DTNA 3KKRA 3AO4A 4FK2A 1T03A 3VQ4A 3ALYA 3PO4A 3DRSA 3ZSXA 3NE6A 2OZMA 1LWCA 3LAMA 5E41A 3HVTA 1VSLA 4DF8A 1RDDA 3KKSA 3MEGA 4PUOA 4FJJA 4DSJA 1JLEA 1VRTA 1KCFA 5J1EA 5HLFA 1QSYA 4CCHA 3ULDA 4PWDA 4DQQA 3LPTA 4JRPA 3AVAA 5J2MA 2PYJA 1TL1A 1NK5A 4B9UA 2HNDA 3HL8A 3PUFA 3HK2A 3L2QA 2HHTA 3LANA 1S9GA 3MAQA 1NJYA 4DMNA 4M3TA 3TABA 4CEFA 3AV9A 4F3TA 4AHSA 3PX0A 4B08A 3OJUA 2DTUA 3QIPA 2XY5A 2A1RA 2VWKA 4RW9A 3AVHA 3ZSZA 3NH2A 1TK5A 3AO2A 1D8YA 5SZTA 4DWIA 1ZBUA 2B6AA 4JS4A 3G0ZA 4CJ3A 3SUOA 3KLGA 3PO5A 3NDKA 4O55A 1BIZA 3V9WA 4CHNA 3P83D 1WAFA 3OS1A 1HJRA 4QCLA 2O4IA 4CF8A 3S3NA 2WONA 4JS5A 2DY4A 2HB5A 1D5AA 1LW2A 4I9QA 1WSFA 1DTTA 1RDCA 1RT2A 4CF2A 3NGIA 4W5TA 3M8QA 3OYEA 4DFPA 1UA0A 4NCGA 1RT5A 1TV6A 4BDPA 2X78A 3CFOA 1RTJA 1T7PA 3SQ0A 1HYSA 1N5YA 1BGXT 1VSMA 3ZT3A 1JLAA 5CYQA 2YHBA 5CZ2A 4EZ6A 1RBUA 3P1GA 3SUNA 1I39A 3OY9A 5KGWA 4HHTA 1F21A 1A5VA 4CHZA 5KGXA 3ZT0A 2IOCA 3RTVA 2X6NA 3LDSA 3QEWA 3KJVA 1U4BA 1J9AA 3I0SA 1KVCA 3K57A 3DLRA 4CHYA 4DS4A 1VSHA 1G15A 2BE2A 4OVLA 1QSSA 2WOMA 3BGRA 1RTDA 4FJ5A 4DQRA 4OGCA 1HYVA 4FLXA 4CJSA 4FJLA 1RILA 3ZSWA 1JXEA 2HHQA 4KFBA 3V9XA 2ETJA 5FRNA 3TR8A 4CGDA 4CHPA 3HJFA 3V81A 3H08A 2O4GA 3QNOA 1IH7A 1QTMA 1TL3A 4OJRA 1WSIA 4FLTA 4RW8A 3QLHA 5I3UA 2YV0X 2RKIA 1NK6A 3AVLA 3RWUA 3V1OA 4FJMA 4CJRA 4IKFA 3O3FA 1HNIA 2IGIA 4CJEA 3CG7A 1KVBA 4CJQA 4CEZA 4O0IA 3WNHA 4CGIA 5HRSA 5J2PA 1HPZA 1ZBIA 1RBVA 4H4MA 3NGZA 4CECA 1NK7A 4DTXA 2G8IA 3B6OA 4Z4GA 2VG5A 3VQ5A 1S1VA 1SV5A 4DF4A 3S9HA 4CFCA 2G8HA 2G8WA 1C1BA 2KTQA 4DG1A 4E7IA 4DTOA 3OYJA 3AVFA 4CEBA 4B9SA 5FRMA 4E7LA 3L2VA 2KZZA 5HRPA 4DQSA 2P5OA 1RT6A 2Z1GA 1NKEA 4EP4A 1YTUA 3C6TA 4AHCA 4Y1CA 3K2PA 3DLEA 3SQ1A 1JKHA 3KLIA 4RW4A 3NAEA 4B8CA 4DTJA 3DLKA 1JLQA 3KIOA 1EXQA 1EX4A 3VQ6A 4DU1A 2GV9A 4W5OA 2XO7A 1MU2A 4Q5VA 4DSFA 1BI4A 4YFUA 1B9DA 2Z1JA 3SQ4A 1NKBA 5DK5A 3RMBA 3C6UA 1FKOA 4CEOA 4CF0A 4BE1A 1KVAA 3MXMA 1BQMA 4YNQA 4BE0A 2G8UA 3PY8A 3S3OA 1I3AA 1S9EA 3AA4A 1RTHA 5CZ1A 4E7JA 4FJ7A 3SJJA 3VQ7A 1RT1A 4H4OA 4IFVA 1VSJA 3EZ5A 4F2SA 3AA5X 4FLWA 4RW6A 3TAFA 4CHQA 3V9ZA 4ID1A 1WSGA 3CFPA 3DYAA 1UAXA 3TAMA 3B6PA 1IKVA 1WSEA 3VQDA 1YVUA 4M3WA 4Z0UA 2HVIA 4CFBA 3MEDA 2OPQA 3OYCA 4CF9A 1J53A 4CJTA 1SKWA 3ZSOA 4KHYA 4CEAA 4Y1DA 1BHLA 4NCBA 4M3ZA 3ITHA 4FW2A 1IO2A 1ZBFA 3MXJA 2HHXA 4CJVA 1SL1A 5HRRA 4B9MA 4BE2A 1IG9A 1FK9A 1EP4A 2IC3A 1TKXA 1VK0A 2PY5A 1JLGA 4DTRA 4FLVA 4W5NA 4DU4A 4KPYA 3VQBA 3VA0A 1X1PA 3OYNA 4FLUA 4KHNA 3M8SA 1NOYA 1JLBA 2NUBA 1LWFA 2Z1IA 1WLJA 3OYAA 3QO9A 4BDZA 1XI1A 4IDKA 1Z26A 4CF1A 3QERA 1Q8IA 4Q0BA 1BL3A 1RT4A 4LSLA 1X9WA 3NFAA 2YKNA 1BQNA 3DI6A 3V1QA 1T05A 2KZMA 3MXIA 5I42A 1VSIA 4HUGA 1BISA 3KTQA 2OYQA 2QKBA 4E89A 3KLHA 2DFEA 4M3UA 3DOKA 2XRIA 1U04A 4N76A 5T7BA 3VQ8A 3NHGA 4GW6A 3VQEA 2X6SA 1TKTA 4JLHA 3M8RA 3V9SA 2HNYA 1UOCA 2OA8A 3VQAA 3OS0A 2D0BA 1C0MA 4HUEA 2D0AA 3ZSVA 4CK3A 1KSPA 4FZYA 3AVBA 4W5QA 3OYBA 4E7HA 1B92A 4E7KA 3SUQA 3TARA 4FJXA 1DLOA 1JXBA 1RT7A 1KFSA 4CGHA 4O0JA 1IKXA 3QEIA 1CXUA 4DQIA 3A2FA 4FJ8A 3ZT4A 3OYGA 3DOLA 3E01A 3P5JA 2B4JA 1SKRA 1NJZA 4DFKA 2FBVA 1TKDA 1NK9A 3UIQA 4XIUA 5CY4A 4AH9A 2KW4A 1KFDA 4DTUA 4N5SA 4HCCA 2FC0A 4FJKA 5C24A 1GOAA 3CM6A 4CFAA 3VQ9A 3VQCA 4GVMA 3K5OA 3TWHA 1TK8A 3D0PA 4DSEA 3RRHA 3V9UA 2HHVA 4Z4EA 4CERA 1SUQA 1QQCA 3RRGA 3HM9A 4C8KA 2YNFA 1KLNA 4CGFA 2YNIA 3CM5A 2F8SA 1D9FA 3AVJA 5SWMA 3SI6A 3HO1A 1RBTA 3OYKA 2DFHA 1RCHA 3LPUA 4F8RA 4FLZA 1ZBHA 3HPGA 1NK8A 3RR8A 3L2RA 3ZSQA 5CYMA 3HYFA 4DTMA 2Q3SA 4LY7A 3AA2A 4K8XA 4O5BA 3SPZA 3O4NA 3SV4A 1GOBA 3RMAA 2ZD1A 1S1TA 1XC9A 1KRPA 3K5LA 3QESA 3DM2A 4KTQA 1RDAA 3VQQA 4CJ5A 4F4KA 3AO3A 4I9LA 2FBYA 4E1MA 4KV8A 4OKJA 5DMRA 3T3FA 2GBZA 4C8MA 4FJIA 1L3UA 4CJPA 4RW7A 4CGGA 3ZT1A 3M8PA 4CJUA 5EU7A 3HPOA 1XHXA 2OZSA 3OYMA 3MECA 3KLFA 3LALA 4M41A 4HCBA 4E3SA 3OYDA 2G8FA 1VSEA 1D9DA 4CEEA 1ZYQA 4DQPA 3LZIA 1ZBLA 3DLHA 3LWMA 2JLEA 2FBTA 2HMIA 4PQUA 3D45A 4G1QA 4KHWA 4CHOA 2E6LA 1W0HA 3QIOA 5HROA 2QKKA 3C94A 4ELTA 4GMJB 4KHUA 4M3RA 3CQ8A 1C0TA 4PA1A 1YT3A 3AVCA 4BWMA 4KAZA 2PYLA 4KHSA 1HNVA 1WN7A 2OPSA 1UWBA 4DFMA 1NOZA 3AO1A 4PY5A 3HVRA 3OYLA 1TVRA 1VRUA 3HPHA 3FFIA 1BIUA 4R5PA 4J2AA 4B3OA 4ID5A 1ASVA 3RMDA 4FJHA 3CFRA 4Z4CA 3ZCMA 4DLGA 4TSXA 1S1UA 2OPRA 4H8KA 4KB1A 4IG0A 4CJLA 4UQGA 3F73A 3SQ2A 4BDYA 4FK0A 3F9KA 4M45A 1SL2A 1TAUA 4CK1A 3K58A 5D3GA 4CEDA 3LP2A 2Y1IA 2E6MA 3TAGA 3QEPA 4MFBA 3SCXA 3AA3A 3OVNA 4N47A 3K5NA 1S6QA 4JRQA 2G8VA 5FDLA 1HQEA 3SV3A 1Q9XA 3TAEA 3RMCA 4C8OA 1WAJA 4I2QA 2D0CA 4E1NA 3QEXA 1L3VA 5K14A 4ZTJA 3KD1E 1HRHA 1XWLA 4OPKA 5J2NA 1L5UA 1S5JA 2F96A 4KKOA 1QS4A 4LH5A 4CIEA 1L3SA 4E0DA 1CZBA 1IKYA 2HHWA 4I2PA 4HVJA 2XHBA 1QE1A 4FK4A 3LAKA 3TANA 2HW3A 3U3GA 1J5OA 4J2DA 2KFNA 4C8LA 3AVGA 2PZSA 2RF2A 4DSLA 4K8ZA 3HT3A 2FBXA 3CYMA 4RG8A 2B5JA 3SPYA 3EYZA 1CXQA 3NH1A 2YKMA 3L2UA 4KRFA 4KI6A 3JYTA 2IS3A 3I0RA 3HXMA 4FM1A 4IFYA 1NK0A 4FZZA 4CIGA 4J2BA 4E19A 1C1CA 2W42A 2E4LA 3O3GA 2HHUA 1O1WA 4M42A 2BGGA 1EKEA 4OGEA 3NBPA 1S1WA 5JS2A 3QETA 4C8NA 3NCIA 2R7YA 3V4IA 4O44A 1ASWA 4KTZA 1YTAA 3DRPA 2YNHA 3HSTB 3L3UA 4BACA 4DLEA 1A5WA 3V6DA 2P5GA 3PV8A 2VWJA 4F3OA 1RT3A 4EP5A 1W9HA 3KK1A 3THVA 2BDPA 4DSKA 1R0AA 3KD5E 4N41A 3L2WA 1WSJA 2P51A 2QXFA 1TK0A 3DRRA 1WSHA 2G8KA 4ZTFA 3V1RA 4OKKA 4KI4A 4CESA 1TAQA 4FLYA 4ELVA 2RN2A 5C42A 3QNNA 4N56A 3S3MA 1JL1A 3KK3A 4OLBA 4CIFA 3QINA 4AHTA 4L8RB 3C95A 4MQ3A 5HP1A 1X9SA 4AILC 1Q9YA 4FJGA 4KB0A 3OJSA 2D5RA 5C25A 1NJXA 3NF9A 1RBSA 3IS9A 2P1JA 1EETA 3L8BA 2KQ2A 4Z4HA 3SNNA 3IAYA 1REVA 1VSFA 3DLBA 1BCOA 4ELUA 1LW0A 1RTIA 2ZE2A 1CLQA 4QOZB 1B9FA 2LSNA 4CJFA 3I8DA 3OYHA 4FM2A 1Z25A 1C6VA 4OPJA 1RBRA 4B8AB 4DTPA 3OYIA 2HNZA 4DU3A 1U48A 3BDPA 1Y97A 2VG6A 1TKZA 3NF8A 4Z4IA 1LAVA 1C0UA 3O3HA 4NCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZX C;  1LV5 A;  3LP0 A;  5KTQ A;  5KI6 A;  1S6P A;  2VG7 A;  3SZ2 A;  2ITG A;  1L3T A;  4HUF A;  3T19 A;  4AHR A;  2HVH A;  4LSN A;  2XY8 A;  4B9N A;  2OPP A;  4DS5 A;  1XHZ A;  4WE1 A;  4CEQ A;  4EZ9 A;  1DTQ A;  5FRO A;  4KO0 A;  4OLA A;  4FYD A;  4NYF A;  1N6Q A;  4B9L A;  5KRT A;  1S1X A;  3U6F A;  3WNE A;  1JL2 A;  1HYZ A;  1QSL A;  1NK4 A;  1X9M A;  3SYZ A;  3TAQ A;  3EY1 A;  3HP6 A;  3ZT2 A;  3PX6 A;  4FXD A;  1JLF A;  1TGO A;  4FVM A;  2BAN A;  4IBN A;  3JSM A;  3OS2 A;  3K5M A;  3RR7 A;  4F2R A;  3ISN C;  4KTW A;  5JS1 A;  1HMV A;  3MEE A;  1VSK A;  3L3V A;  4OKE A;  1K6Y A;  2XY7 A;  4FJ9 A;  2F8T A;  1KLM A;  2X74 A;  3AVI A;  3HP9 A;  3TI0 A;  4CE9 A;  2QK9 A;  3AO5 A;  3NF6 A;  3LZJ A;  3K59 A;  4AHU A;  4W5R A;  1T8E A;  3AVM A;  4KHQ A;  2IAJ A;  3IG1 A;  2YNG A;  1LAW A;  3IRX A;  3VN5 A;  4FCY A;  1BI4 B;  3TAP A;  1FXX A;  4AHV A;  1SL0 A;  2I5J A;  4DFJ A;  2HHS A;  4BWJ A;  3NGY A;  4FM0 A;  1RNH A;  3T1A A;  3KK2 A;  4CGJ A;  1UA1 A;  3LWL A;  2Z1H A;  4J2E A;  3VQP A;  1ASU A;  3PX4 A;  4LH4 A;  1A5X A;  3NH0 A;  2EHG A;  1U45 A;  4ZHR A;  1NJW A;  3ZSY A;  3OYF A;  2ATQ A;  1ITG A;  2RPI A;  5HBM A;  4CJK A;  1LWE A;  4CJ4 A;  2YHA A;  1FKP A;  4ICL A;  3WNG A;  4IG3 A;  1VSD A;  2EX3 A;  4DSI A;  3LP3 A;  5HRN A;  2A1S A;  2Y1J A;  3G10 A;  1SKS A;  1HQU A;  2KFZ A;  2IDO A;  1C1A A;  3DLG A;  3VA3 A;  1KTQ A;  3AVN A;  4QAG A;  1IKW A;  3U3Y A;  4FJN A;  4CFD A;  1J54 A;  4FW1 A;  4CK2 A;  3LP1 A;  5KRS A;  2AJQ A;  3QEV A;  3WNF A;  4KRE A;  2ZQB A;  4I7F A;  3DMJ A;  4NYN A;  4B9V A;  4M3Y A;  4Z4F A;  4B9T A;  3ASM A;  1GOC A;  2GUI A;  3NF7 A;  1RDB A;  1JLC A;  3AVK A;  3O4Q A;  3KLE A;  4DTS A;  2XY6 A;  1NKC A;  2DFF A;  1U47 A;  4HTU A;  4M3X A;  1U49 A;  5J2Q A;  3ZSR A;  4O4G A;  1QHT A;  4CJW A;  3SUP A;  1BCM A;  1WNS A;  1CZ9 A;  2JGU A;  4LD0 A;  4DTN A;  3KKR A;  3AO4 A;  4FK2 A;  1T03 A;  3VQ4 A;  3ALY A;  3PO4 A;  3DRS A;  3ZSX A;  3NE6 A;  2OZM A;  1LWC A;  3LAM A;  5E41 A;  3HVT A;  1VSL A;  4DF8 A;  1RDD A;  3KKS A;  3MEG A;  4PUO A;  4FJJ A;  4DSJ A;  1JLE A;  1VRT A;  1KCF A;  5J1E A;  5HLF A;  1QSY A;  4CCH A;  3ULD A;  4PWD A;  4DQQ A;  3LPT A;  4JRP A;  3AVA A;  5J2M A;  2PYJ A;  1TL1 A;  1NK5 A;  4B9U A;  2HND A;  3HL8 A;  3PUF A;  3HK2 A;  3L2Q A;  2HHT A;  3LAN A;  1S9G A;  3MAQ A;  1NJY A;  4DMN A;  4M3T A;  3TAB A;  4CEF A;  3AV9 A;  4F3T A;  4AHS A;  3PX0 A;  4B08 A;  3OJU A;  2DTU A;  3QIP A;  2XY5 A;  2A1R A;  2VWK A;  4RW9 A;  3AVH A;  3ZSZ A;  3NH2 A;  1TK5 A;  3AO2 A;  1D8Y A;  5SZT A;  4DWI A;  1ZBU A;  2B6A A;  4JS4 A;  3G0Z A;  4CJ3 A;  3SUO A;  3KLG A;  3PO5 A;  3NDK A;  4O55 A;  1BIZ A;  3V9W A;  4CHN A;  3P83 D;  1WAF A;  3OS1 A;  1HJR A;  4QCL A;  2O4I A;  4CF8 A;  3S3N A;  2WON A;  4JS5 A;  2DY4 A;  2HB5 A;  1D5A A;  1LW2 A;  4I9Q A;  1WSF A;  1DTT A;  1RDC A;  1RT2 A;  4CF2 A;  3NGI A;  4W5T A;  3M8Q A;  3OYE A;  4DFP A;  1UA0 A;  4NCG A;  1RT5 A;  1TV6 A;  4BDP A;  2X78 A;  3CFO A;  1RTJ A;  1T7P A;  3SQ0 A;  1HYS A;  1N5Y A;  1BGX T;  1VSM A;  3ZT3 A;  1JLA A;  5CYQ A;  2YHB A;  5CZ2 A;  4EZ6 A;  1RBU A;  3P1G A;  3SUN A;  1I39 A;  3OY9 A;  5KGW A;  4HHT A;  1F21 A;  1A5V A;  4CHZ A;  5KGX A;  3ZT0 A;  2IOC A;  3RTV A;  2X6N A;  3LDS A;  3QEW A;  3KJV A;  1U4B A;  1J9A A;  3I0S A;  1KVC A;  3K57 A;  3DLR A;  4CHY A;  4DS4 A;  1VSH A;  1G15 A;  2BE2 A;  4OVL A;  1QSS A;  2WOM A;  3BGR A;  1RTD A;  4FJ5 A;  4DQR A;  4OGC A;  1HYV A;  4FLX A;  4CJS A;  4FJL A;  1RIL A;  3ZSW A;  1JXE A;  2HHQ A;  4KFB A;  3V9X A;  2ETJ A;  5FRN A;  3TR8 A;  4CGD A;  4CHP A;  3HJF A;  3V81 A;  3H08 A;  2O4G A;  3QNO A;  1IH7 A;  1QTM A;  1TL3 A;  4OJR A;  1WSI A;  4FLT A;  4RW8 A;  3QLH A;  5I3U A;  2YV0 X;  2RKI A;  1NK6 A;  3AVL A;  3RWU A;  3V1O A;  4FJM A;  4CJR A;  4IKF A;  3O3F A;  1HNI A;  2IGI A;  4CJE A;  3CG7 A;  1KVB A;  4CJQ A;  4CEZ A;  4O0I A;  3WNH A;  4CGI A;  5HRS A;  5J2P A;  1HPZ A;  1ZBI A;  1RBV A;  4H4M A;  3NGZ A;  4CEC A;  1NK7 A;  4DTX A;  2G8I A;  3B6O A;  4Z4G A;  2VG5 A;  3VQ5 A;  1S1V A;  1SV5 A;  4DF4 A;  3S9H A;  4CFC A;  2G8H A;  2G8W A;  1C1B A;  2KTQ A;  4DG1 A;  4E7I A;  4DTO A;  3OYJ A;  3AVF A;  4CEB A;  4B9S A;  5FRM A;  4E7L A;  3L2V A;  2KZZ A;  5HRP A;  4DQS A;  2P5O A;  1RT6 A;  2Z1G A;  1NKE A;  4EP4 A;  1YTU A;  3C6T A;  4AHC A;  4Y1C A;  3K2P A;  3DLE A;  3SQ1 A;  1JKH A;  3KLI A;  4RW4 A;  3NAE A;  4B8C A;  4DTJ A;  3DLK A;  1JLQ A;  3KIO A;  1EXQ A;  1EX4 A;  3VQ6 A;  4DU1 A;  2GV9 A;  4W5O A;  2XO7 A;  1MU2 A;  4Q5V A;  4DSF A;  1BI4 A;  4YFU A;  1B9D A;  2Z1J A;  3SQ4 A;  1NKB A;  5DK5 A;  3RMB A;  3C6U A;  1FKO A;  4CEO A;  4CF0 A;  4BE1 A;  1KVA A;  3MXM A;  1BQM A;  4YNQ A;  4BE0 A;  2G8U A;  3PY8 A;  3S3O A;  1I3A A;  1S9E A;  3AA4 A;  1RTH A;  5CZ1 A;  4E7J A;  4FJ7 A;  3SJJ A;  3VQ7 A;  1RT1 A;  4H4O A;  4IFV A;  1VSJ A;  3EZ5 A;  4F2S A;  3AA5 X;  4FLW A;  4RW6 A;  3TAF A;  4CHQ A;  3V9Z A;  4ID1 A;  1WSG A;  3CFP A;  3DYA A;  1UAX A;  3TAM A;  3B6P A;  1IKV A;  1WSE A;  3VQD A;  1YVU A;  4M3W A;  4Z0U A;  2HVI A;  4CFB A;  3MED A;  2OPQ A;  3OYC A;  4CF9 A;  1J53 A;  4CJT A;  1SKW A;  3ZSO A;  4KHY A;  4CEA A;  4Y1D A;  1BHL A;  4NCB A;  4M3Z A;  3ITH A;  4FW2 A;  1IO2 A;  1ZBF A;  3MXJ A;  2HHX A;  4CJV A;  1SL1 A;  5HRR A;  4B9M A;  4BE2 A;  1IG9 A;  1FK9 A;  1EP4 A;  2IC3 A;  1TKX A;  1VK0 A;  2PY5 A;  1JLG A;  4DTR A;  4FLV A;  4W5N A;  4DU4 A;  4KPY A;  3VQB A;  3VA0 A;  1X1P A;  3OYN A;  4FLU A;  4KHN A;  3M8S A;  1NOY A;  1JLB A;  2NUB A;  1LWF A;  2Z1I A;  1WLJ A;  3OYA A;  3QO9 A;  4BDZ A;  1XI1 A;  4IDK A;  1Z26 A;  4CF1 A;  3QER A;  1Q8I A;  4Q0B A;  1BL3 A;  1RT4 A;  4LSL A;  1X9W A;  3NFA A;  2YKN A;  1BQN A;  3DI6 A;  3V1Q A;  1T05 A;  2KZM A;  3MXI A;  5I42 A;  1VSI A;  4HUG A;  1BIS A;  3KTQ A;  2OYQ A;  2QKB A;  4E89 A;  3KLH A;  2DFE A;  4M3U A;  3DOK A;  2XRI A;  1U04 A;  4N76 A;  5T7B A;  3VQ8 A;  3NHG A;  4GW6 A;  3VQE A;  2X6S A;  1TKT A;  4JLH A;  3M8R A;  3V9S A;  2HNY A;  1UOC A;  2OA8 A;  3VQA A;  3OS0 A;  2D0B A;  1C0M A;  4HUE A;  2D0A A;  3ZSV A;  4CK3 A;  1KSP A;  4FZY A;  3AVB A;  4W5Q A;  3OYB A;  4E7H A;  1B92 A;  4E7K A;  3SUQ A;  3TAR A;  4FJX A;  1DLO A;  1JXB A;  1RT7 A;  1KFS A;  4CGH A;  4O0J A;  1IKX A;  3QEI A;  1CXU A;  4DQI A;  3A2F A;  4FJ8 A;  3ZT4 A;  3OYG A;  3DOL A;  3E01 A;  3P5J A;  2B4J A;  1SKR A;  1NJZ A;  4DFK A;  2FBV A;  1TKD A;  1NK9 A;  3UIQ A;  4XIU A;  5CY4 A;  4AH9 A;  2KW4 A;  1KFD A;  4DTU A;  4N5S A;  4HCC A;  2FC0 A;  4FJK A;  5C24 A;  1GOA A;  3CM6 A;  4CFA A;  3VQ9 A;  3VQC A;  4GVM A;  3K5O A;  3TWH A;  1TK8 A;  3D0P A;  4DSE A;  3RRH A;  3V9U A;  2HHV A;  4Z4E A;  4CER A;  1SUQ A;  1QQC A;  3RRG A;  3HM9 A;  4C8K A;  2YNF A;  1KLN A;  4CGF A;  2YNI A;  3CM5 A;  2F8S A;  1D9F A;  3AVJ A;  5SWM A;  3SI6 A;  3HO1 A;  1RBT A;  3OYK A;  2DFH A;  1RCH A;  3LPU A;  4F8R A;  4FLZ A;  1ZBH A;  3HPG A;  1NK8 A;  3RR8 A;  3L2R A;  3ZSQ A;  5CYM A;  3HYF A;  4DTM A;  2Q3S A;  4LY7 A;  3AA2 A;  4K8X A;  4O5B A;  3SPZ A;  3O4N A;  3SV4 A;  1GOB A;  3RMA A;  2ZD1 A;  1S1T A;  1XC9 A;  1KRP A;  3K5L A;  3QES A;  3DM2 A;  4KTQ A;  1RDA A;  3VQQ A;  4CJ5 A;  4F4K A;  3AO3 A;  4I9L A;  2FBY A;  4E1M A;  4KV8 A;  4OKJ A;  5DMR A;  3T3F A;  2GBZ A;  4C8M A;  4FJI A;  1L3U A;  4CJP A;  4RW7 A;  4CGG A;  3ZT1 A;  3M8P A;  4CJU A;  5EU7 A;  3HPO A;  1XHX A;  2OZS A;  3OYM A;  3MEC A;  3KLF A;  3LAL A;  4M41 A;  4HCB A;  4E3S A;  3OYD A;  2G8F A;  1VSE A;  1D9D A;  4CEE A;  1ZYQ A;  4DQP A;  3LZI A;  1ZBL A;  3DLH A;  3LWM A;  2JLE A;  2FBT A;  2HMI A;  4PQU A;  3D45 A;  4G1Q A;  4KHW A;  4CHO A;  2E6L A;  1W0H A;  3QIO A;  5HRO A;  2QKK A;  3C94 A;  4ELT A;  4GMJ B;  4KHU A;  4M3R A;  3CQ8 A;  1C0T A;  4PA1 A;  1YT3 A;  3AVC A;  4BWM A;  4KAZ A;  2PYL A;  4KHS A;  1HNV A;  1WN7 A;  2OPS A;  1UWB A;  4DFM A;  1NOZ A;  3AO1 A;  4PY5 A;  3HVR A;  3OYL A;  1TVR A;  1VRU A;  3HPH A;  3FFI A;  1BIU A;  4R5P A;  4J2A A;  4B3O A;  4ID5 A;  1ASV A;  3RMD A;  4FJH A;  3CFR A;  4Z4C A;  3ZCM A;  4DLG A;  4TSX A;  1S1U A;  2OPR A;  4H8K A;  4KB1 A;  4IG0 A;  4CJL A;  4UQG A;  3F73 A;  3SQ2 A;  4BDY A;  4FK0 A;  3F9K A;  4M45 A;  1SL2 A;  1TAU A;  4CK1 A;  3K58 A;  5D3G A;  4CED A;  3LP2 A;  2Y1I A;  2E6M A;  3TAG A;  3QEP A;  4MFB A;  3SCX A;  3AA3 A;  3OVN A;  4N47 A;  3K5N A;  1S6Q A;  4JRQ A;  2G8V A;  5FDL A;  1HQE A;  3SV3 A;  1Q9X A;  3TAE A;  3RMC A;  4C8O A;  1WAJ A;  4I2Q A;  2D0C A;  4E1N A;  3QEX A;  1L3V A;  5K14 A;  4ZTJ A;  3KD1 E;  1HRH A;  1XWL A;  4OPK A;  5J2N A;  1L5U A;  1S5J A;  2F96 A;  4KKO A;  1QS4 A;  4LH5 A;  4CIE A;  1L3S A;  4E0D A;  1CZB A;  1IKY A;  2HHW A;  4I2P A;  4HVJ A;  2XHB A;  1QE1 A;  4FK4 A;  3LAK A;  3TAN A;  2HW3 A;  3U3G A;  1J5O A;  4J2D A;  2KFN A;  4C8L A;  3AVG A;  2PZS A;  2RF2 A;  4DSL A;  4K8Z A;  3HT3 A;  2FBX A;  3CYM A;  4RG8 A;  2B5J A;  3SPY A;  3EYZ A;  1CXQ A;  3NH1 A;  2YKM A;  3L2U A;  4KRF A;  4KI6 A;  3JYT A;  2IS3 A;  3I0R A;  3HXM A;  4FM1 A;  4IFY A;  1NK0 A;  4FZZ A;  4CIG A;  4J2B A;  4E19 A;  1C1C A;  2W42 A;  2E4L A;  3O3G A;  2HHU A;  1O1W A;  4M42 A;  2BGG A;  1EKE A;  4OGE A;  3NBP A;  1S1W A;  5JS2 A;  3QET A;  4C8N A;  3NCI A;  2R7Y A;  3V4I A;  4O44 A;  1ASW A;  4KTZ A;  1YTA A;  3DRP A;  2YNH A;  3HST B;  3L3U A;  4BAC A;  4DLE A;  1A5W A;  3V6D A;  2P5G A;  3PV8 A;  2VWJ A;  4F3O A;  1RT3 A;  4EP5 A;  1W9H A;  3KK1 A;  3THV A;  2BDP A;  4DSK A;  1R0A A;  3KD5 E;  4N41 A;  3L2W A;  1WSJ A;  2P51 A;  2QXF A;  1TK0 A;  3DRR A;  1WSH A;  2G8K A;  4ZTF A;  3V1R A;  4OKK A;  4KI4 A;  4CES A;  1TAQ A;  4FLY A;  4ELV A;  2RN2 A;  5C42 A;  3QNN A;  4N56 A;  3S3M A;  1JL1 A;  3KK3 A;  4OLB A;  4CIF A;  3QIN A;  4AHT A;  4L8R B;  3C95 A;  4MQ3 A;  5HP1 A;  1X9S A;  4AIL C;  1Q9Y A;  4FJG A;  4KB0 A;  3OJS A;  2D5R A;  5C25 A;  1NJX A;  3NF9 A;  1RBS A;  3IS9 A;  2P1J A;  1EET A;  3L8B A;  2KQ2 A;  4Z4H A;  3SNN A;  3IAY A;  1REV A;  1VSF A;  3DLB A;  1BCO A;  4ELU A;  1LW0 A;  1RTI A;  2ZE2 A;  1CLQ A;  4QOZ B;  1B9F A;  2LSN A;  4CJF A;  3I8D A;  3OYH A;  4FM2 A;  1Z25 A;  1C6V A;  4OPJ A;  1RBR A;  4B8A B;  4DTP A;  3OYI A;  2HNZ A;  4DU3 A;  1U48 A;  3BDP A;  1Y97 A;  2VG6 A;  1TKZ A;  3NF8 A;  4Z4I A;  1LAV A;  1C0U A;  3O3H A;  4NCA A; 
#chains in the Genus database with same CATH topology
 4FZX C;  3LP0 A;  2ASP A;  3THW B;  2ITG A;  4JI1 K;  1NGJ A;  5AQU A;  2FLO A;  2NRH A;  4H0X B;  1QQO A;  3I56 N;  4EZ9 A;  4PKH A;  5FRO A;  2P9U B;  1KAZ A;  4OLA A;  1K8K B;  5KRT A;  3U6F A;  1HYZ A;  1QSL A;  3SYZ A;  2A3Z A;  1TYQ B;  4IBN A;  3OS2 A;  3RR7 A;  4F2R A;  3ISN C;  4OKE A;  4FJ9 A;  4CZI A;  3AVI A;  3TI0 A;  4CE9 A;  5C2D A;  4RWT A;  3LZJ A;  4B1U B;  4AHU A;  4W5R A;  1T8E A;  4IJA A;  2A40 A;  3IG1 A;  2F9W A;  3IRX A;  3VN5 A;  3WXL A;  1SAZ A;  1SL0 A;  5AQT A;  3P39 A;  3L4I A;  3KK2 A;  5M1Q A;  1UA1 A;  4J2E A;  2W6L A;  3NH0 A;  1U45 A;  4ZHR A;  1OKJ A;  2Q97 A;  3MWT A;  4CJ4 A;  3WNG A;  1VSD A;  2QTD A;  3R3L A;  2RHK A;  4PL7 A;  3VA3 A;  1KTQ A;  3AVN A;  4QAG A;  5ADX A;  4FJN A;  4JKC A;  4FW1 A;  4BRA A;  2CGL A;  2AJQ A;  3R6M A;  3WNF A;  3EEQ A;  4I7F A;  4DV6 K;  4B9T A;  4UY8 O;  5JVH L;  4DTS A;  2DFF A;  5LY3 A;  5HL7 L;  4HTU A;  4GKJ K;  1QHT A;  1X9J A;  4YY3 K;  1WNS A;  3FLC O;  3KKR A;  1VHX A;  4WQ4 A;  4FK2 A;  4BRG A;  3PO4 A;  3DRS A;  3LAM A;  4DF8 A;  5BPN A;  1R59 O;  3RVC A;  5KPR A;  4PWD A;  4DQQ A;  3LPT A;  3HL8 A;  1QZ6 A;  5ELZ A;  5AZJ A;  2YI1 A;  4BR9 A;  4BRD A;  3AV9 A;  4JAX A;  4K42 A;  3T7Z A;  4DCH A;  4B08 A;  4B3R K;  4F3T A;  4RW9 A;  3AVH A;  4NLB A;  1TK5 A;  3QFP A;  4JK7 A;  1JJ2 M;  2B6A A;  2P9N A;  3G0Z A;  4EHT A;  2IVO A;  4LC9 B;  3NDK A;  4H0V B;  4OPH A;  3MX2 A;  1N36 K;  1XMQ K;  3EKS A;  2WON A;  3BZK A;  3EN9 A;  1T3V A;  1D5A A;  3R9P A;  1LW2 A;  1WSF A;  1DTT A;  1T03 A;  1UA0 A;  3NGI A;  5F1X A;  1U2V A;  3CCQ N;  4DFP A;  1FJG K;  1TV6 A;  2ZJP L;  4BDP A;  3A5O C;  1T7P A;  1HYS A;  1N5Y A;  1VSM A;  3CPW M;  1JLA A;  3M1F A;  2O8C A;  2BH1 A;  1RBU A;  3SUN A;  3FR0 A;  5M1O A;  1F21 A;  2GEM A;  3ZT0 A;  3ZET B;  2FSK A;  2IOC A;  3CC7 N;  3QEW A;  1U4B A;  1J9A A;  3J8A A;  1KVC A;  3HTV A;  4DS4 A;  1VSH A;  1G15 A;  2BE2 A;  2WOM A;  3SBG A;  4OGC A;  1JCF A;  4JI0 K;  2HHQ A;  4YOR A;  5EXW A;  5AR0 A;  1N32 K;  1T6D A;  3H08 A;  2O4G A;  3QNO A;  2QWP A;  5KQ8 A;  3O4W A;  2YV0 X;  3V1O A;  3IKM A;  4JYA K;  2NRX A;  1Q82 O;  2NZT A;  5J2P A;  4H0Y B;  1HPZ A;  1RBV A;  4H4M A;  1EWQ A;  3B6O A;  2VG5 A;  1S1V A;  1SV5 A;  4CFC A;  4DTO A;  3PIO L;  5AZI B;  5HRP A;  4B1W B;  3A5L C;  2Z1G A;  4DQS A;  1YTU A;  3C6T A;  4AHC A;  4Y1C A;  3K2P A;  5GAG P;  2E1Z A;  3R1X A;  3DLK A;  1JLQ A;  3CJA A;  3KIO A;  1EX4 A;  3O9U A;  3AGR A;  2XO7 A;  2HF3 A;  1BI4 A;  2E2N A;  2Z1J A;  4GV3 A;  1NKB A;  1IBK K;  3C6U A;  1BQM A;  4YNQ A;  3PY8 A;  4JK9 A;  3S3O A;  5CZ1 A;  3CCE N;  4E7J A;  5AQP A;  1RT1 A;  3SAG A;  1HKG A;  3O9R A;  4RW6 A;  4CHQ A;  3V9Z A;  4ID1 A;  1WSG A;  3O9S A;  1UAX A;  1IKV A;  1YVU A;  2E2O A;  3OYC A;  1J53 A;  1SKW A;  2GEL A;  3ZSO A;  4BRO A;  4M3Z A;  3ITH A;  5TKY A;  4A61 A;  4DR7 K;  4CJV A;  4B9M A;  3CC2 N;  2QA4 N;  1TKX A;  4RTF D;  4W5N A;  3U4L A;  2ITM A;  4DU4 A;  3VQB A;  5IT9 O;  4FLU A;  3R8E A;  1NOY A;  3CJ7 A;  2NUB A;  1IJJ A;  3O08 A;  3QER A;  4Q0B A;  3MWP A;  3NFA A;  3V1Q A;  3DI6 A;  4IO9 L;  1T05 A;  5C0Y A;  2P9P A;  3KTQ A;  1NLV A;  2VGN A;  3VQE A;  4JLH A;  2HNY A;  2D4W A;  1SS6 A;  3CER A;  4FZY A;  2Q1N A;  4JI3 K;  3ZYY X;  1KFS A;  3VOV A;  3D2F B;  3HM8 A;  3U9Z A;  2ZM6 K;  4DV5 K;  3ULE B;  3P5J A;  1ESV A;  1NK9 A;  5BN8 A;  5GIN A;  3UIQ A;  5GAH P;  4XIU A;  2KW4 A;  1KFD A;  4JKG A;  4N5S A;  4HCC A;  1GOA A;  4CFA A;  4CJ7 A;  3OHR A;  3ZEU B;  1SUQ A;  4O8K A;  4AQY K;  1KLN A;  1KQS M;  2YNI A;  3WQU A;  3CM5 A;  2F8S A;  4DR6 K;  3AVJ A;  3HO1 A;  4BQZ A;  3OYK A;  3CI5 A;  1HPM A;  1GLL O;  3RR8 A;  3ZSQ A;  4LY7 A;  3AA2 A;  4BR7 A;  2ZJQ L;  3O4N A;  4FWR A;  5CE3 A;  2W6K A;  4Y0W A;  2QW9 A;  3K5L A;  1KRP A;  5EVZ A;  3VQQ A;  2A6A A;  5EOY A;  2OTL N;  4E1M A;  1S72 N;  4FJI A;  3CJB A;  3QML A;  4CJP A;  2ZJR L;  2A42 A;  2O8B B;  3HSC A;  4CEE A;  3DLH A;  2HMI A;  2E6L A;  3CJ9 A;  3CQ8 A;  4PA1 A;  3AVC A;  4BWM A;  1WN7 A;  4WQ5 A;  1NOZ A;  3HVR A;  3OYL A;  4J2A A;  3O5B A;  4IOC L;  4Z4C A;  2FSN A;  2OPR A;  4QS9 A;  5AQH A;  4CJL A;  3F9K A;  4M45 A;  1TAU A;  4CK1 A;  2UUB K;  5D3G A;  3UE5 A;  3TSU A;  1NGI A;  4MFB A;  3AA3 A;  3OVN A;  5FDL A;  3SV3 A;  1NG9 A;  1WAJ A;  4E1N A;  5K14 A;  4ZTJ A;  1IG8 A;  4XH5 A;  4C1N I;  1S5J A;  1QS4 A;  3CCU N;  1VQP N;  3K9J A;  4BRL A;  4HVJ A;  2XHB A;  5BR9 A;  5JMV A;  3AVG A;  4DSL A;  4K8Z A;  4JI4 K;  4RG8 A;  3IMX A;  5AQJ A;  3SPY A;  3EYZ A;  5LL6 Z;  3L2U A;  4KI6 A;  3WEE A;  4FWM A;  4OGE A;  3NBP A;  4C8N A;  4OO1 J;  2WC9 A;  4JKA A;  1P90 A;  2GWK A;  4KTZ A;  4BAC A;  4JEP A;  2YNH A;  3HST B;  2HOE A;  3G71 N;  1RT3 A;  3KK1 A;  1U2V B;  4DSK A;  3KD5 E;  3JAM O;  1R0A A;  2P51 A;  3DRR A;  4JI5 K;  1WSH A;  1NMN A;  2RN2 A;  3QNN A;  4N56 A;  4DQ8 A;  4OLB A;  5HP1 A;  3OJS A;  3SBT A;  1EET A;  3L8B A;  1P8Z A;  3PSI A;  1VSF A;  1BCO A;  1K9M O;  4ELU A;  3GG4 A;  1RTI A;  1CLQ A;  1B9F A;  2CGJ A;  4FM2 A;  4QS8 A;  2O8D A;  4B8A B;  3M5R A;  2HNZ A;  1U48 A;  3BDP A;  2VG6 A;  3O3H A;  1VQL N;  3WUH A;  5KPT A;  5KI6 A;  2VG7 A;  3SZ2 A;  1L3T A;  4JI8 K;  4HUF A;  3H6E A;  2OPP A;  4WE1 A;  4CEQ A;  1N6Q A;  1HX1 A;  3FZL A;  4B9L A;  3TSP A;  4A2A A;  3LDP A;  1S22 A;  1C0G A;  3TTC A;  3EY1 A;  3ZT2 A;  1GLB G;  3JSM A;  1RGI A;  1BWF O;  3FE1 A;  3L3V A;  5KPZ A;  2A5X A;  2XY7 A;  2F8T A;  1KLM A;  2X74 A;  4DV1 K;  2QWR A;  3AVM A;  4FCY A;  1BI4 B;  4AHV A;  1J5E K;  2I5J A;  2HHS A;  3BP8 A;  4FM0 A;  2IVN A;  2Z1H A;  4IFE A;  2Q31 A;  3PX4 A;  4ILH A;  2ASO A;  1A5X A;  2EHG A;  3ZSY A;  1ITG A;  1NNE A;  2YHA A;  1FKP A;  2EX3 A;  5HRN A;  3G10 A;  1SKS A;  1HQU A;  3DLG A;  3SLC A;  4H5R A;  3U3Y A;  2P9K B;  3JXU A;  1J54 A;  4CK2 A;  4YHH K;  1E3M A;  5KRS A;  3QEV A;  3QBW A;  5AQW A;  3H1V X;  4JI2 K;  4I6M A;  1GOC A;  2GUI A;  2P9L A;  1NKC A;  4JKH A;  5J2Q A;  1U49 A;  4JHD A;  4LD0 A;  2W40 A;  1YXQ A;  2P9P B;  3VTI A;  3ALY A;  3ZX3 A;  3ZSX A;  2OZM A;  5E41 A;  3G25 A;  3KKS A;  4PUO A;  1KCF A;  5HLF A;  4NLC A;  4CCH A;  3ULD A;  3KHY A;  4H0O A;  5M1K A;  1VQ8 N;  3CQY A;  3VPZ A;  4JRP A;  2PYJ A;  4B9U A;  2HND A;  3PUF A;  3VEY A;  3IFR A;  3LAN A;  5CHI A;  4AHS A;  3PX0 A;  1MWM A;  2VWK A;  4CD3 A;  5SZT A;  1ZBU A;  4JK8 A;  4DUZ K;  3SUO A;  3T1H K;  4JKG B;  3V9W A;  3F5T A;  3P83 D;  1WAF A;  4CF8 A;  3S3N A;  4CI6 A;  1KAX A;  3WXI A;  3M8Q A;  4ISE A;  4JKD A;  3CFO A;  2VYP A;  1NGF A;  2WTU A;  5F2R A;  5KGW A;  4CHZ A;  1A5V A;  5KGX A;  2PBD A;  3I0S A;  2HBJ A;  1KD1 O;  4CHY A;  1Z6R A;  4DQR A;  2KKZ A;  3THX A;  3FFK B;  2QWM A;  3J81 O;  4K41 A;  2ETJ A;  4LF8 K;  1X3M A;  4BRN A;  5AQR A;  1WSI A;  4FLT A;  2O8F B;  4CJR A;  5AQK A;  1NU0 A;  4CZH A;  5C15 A;  2IGI A;  4CJE A;  3CG7 A;  4O0I A;  4CGI A;  1BOT O;  3NGZ A;  3LL3 A;  4CEC A;  1V4T A;  2G8I A;  4Z4G A;  4BR0 A;  4NB4 A;  3VQ5 A;  3S9H A;  3MMV A;  3OYJ A;  2ASM A;  3L2V A;  2ZWH A;  2CH6 A;  2UUC K;  3SQ1 A;  2YCH A;  3DLE A;  4RW4 A;  3KLI A;  3VQ6 A;  4DU1 A;  3L4Q A;  4X66 K;  2GV9 A;  3GDQ A;  4MDA A;  3O9T A;  1B9D A;  3SQ4 A;  3DXM B;  5DK5 A;  1FKO A;  4CF0 A;  4MO5 A;  3MXM A;  2G8U A;  1I3A A;  4FJ7 A;  4BC3 A;  3T1Y K;  2E1Y A;  4IFV A;  4F2S A;  4FLW A;  3VEZ A;  1Q7Y O;  1BUP A;  5BPM A;  3TAM A;  5FPD A;  2VWB A;  3DXK A;  3VQD A;  2HVI A;  3ID8 A;  4Y1D A;  1BHL A;  4BRQ A;  5GIO A;  4FW2 A;  1IO2 A;  1ZBF A;  3VGL A;  2HHX A;  4DHY A;  5HRR A;  1FK9 A;  5GAD P;  2IC3 A;  5B8H A;  3MN5 A;  4FLV A;  4LFA K;  4KPY A;  3VA0 A;  1X1P A;  3VEV A;  3OYN A;  4JI7 K;  1JLB A;  5JLH A;  2QWL A;  1LWF A;  2Z1I A;  3OYA A;  4BDZ A;  3QO9 A;  4H5W A;  1VQ5 N;  4IDK A;  1Z26 A;  3C0B A;  4CF1 A;  2YKN A;  1BQN A;  1VQ9 N;  1OVY A;  2FF6 A;  4LF7 K;  4IWV A;  3T69 A;  4E89 A;  3KLH A;  3DOK A;  2XRI A;  1J6Z A;  3CME N;  3DWL A;  1NGB A;  3E9L A;  3M8R A;  4DR3 K;  3OS0 A;  2D0B A;  2D0A A;  4CK3 A;  3NVK A;  2QEX N;  3KK7 A;  4CVN E;  1JXB A;  2P9S A;  3C7N A;  4CGH A;  3SK3 A;  3TTD A;  3LM9 A;  3QEI A;  3THY B;  1Q86 O;  2B4J A;  1SKR A;  1TKD A;  5GAE P;  4AH9 A;  3D7E O;  4JI6 K;  2FC0 A;  3UKU B;  3CM6 A;  3TWH A;  3D0P A;  1GLC G;  4DSE A;  1M1K O;  4Z4E A;  4FPA A;  1BDG A;  1QQC A;  2KLA A;  3MN9 A;  2I7N A;  4CGF A;  3G6E N;  4YDU A;  4BRF A;  3CHW A;  1BO5 O;  3L2R A;  3HYF A;  4DTM A;  1G99 A;  4K8X A;  3SV4 A;  3QES A;  3DM2 A;  4KTQ A;  1RDA A;  4F4K A;  4I9L A;  4KV8 A;  2GBZ A;  2GTD A;  4CGG A;  3ZT1 A;  3M8P A;  3HPO A;  5EU7 A;  3M6G A;  1BU6 O;  4M41 A;  2Q0U A;  3LDL A;  3LM2 A;  3VTH A;  4HWI A;  3LZI A;  1OVQ A;  3LWM A;  2FBT A;  1ATS A;  4L3Q A;  4B9Q A;  4KHU A;  1W0H A;  4ELT A;  3MK6 A;  3UB5 A;  4M3R A;  4CBX A;  4KH5 A;  2PAV A;  1C0T A;  4FL9 A;  1HNV A;  4DV4 K;  1TVR A;  2NNW A;  2BTF A;  3P4I A;  3ENO A;  4ID5 A;  1ASV A;  4DLG A;  4FVU A;  4KB1 A;  5EY4 A;  3CET A;  4UQG A;  4FK0 A;  4FSV A;  3EO3 A;  4JHD B;  4LF5 K;  1ATR A;  2Y1I A;  3TAG A;  3QEP A;  4B1V A;  4JRQ A;  1GLJ O;  3OTO K;  1Q9X A;  3RMC A;  4I2Q A;  1NJI O;  3L0Q A;  3N4Q A;  3KD1 E;  3HOS A;  1NM1 A;  5J2N A;  1L5U A;  2F96 A;  1L3S A;  1CZB A;  3WXM B;  5JIC A;  3EL2 A;  1ZXO A;  4FWL A;  2HW3 A;  4FWK A;  3NH1 A;  3O1W A;  2E88 A;  3F2K A;  2YKM A;  4KRF A;  3CXC M;  3C6H A;  3HXM A;  1MA9 B;  1NK0 A;  4CIG A;  2W42 A;  4PKI A;  4U7B A;  2GX9 A;  3QBX A;  1N8R O;  5M1F A;  4H5N A;  4A62 A;  5JS2 A;  3QET A;  2R7Y A;  1YHQ N;  3KZB A;  4O44 A;  4JD2 A;  4WQ4 C;  1A5W A;  2VWJ A;  4CZM A;  4EP5 A;  1W9H A;  4N41 A;  1O13 A;  2A41 A;  1ATN A;  3VER A;  1WSJ A;  1TK0 A;  2QXF A;  3GBT A;  2G8K A;  4ZTF A;  4FPB A;  1GLA G;  4OKK A;  3U8X A;  4H5V A;  1HKB A;  5LMU K;  1GLE G;  1JL1 A;  3MDQ A;  4AHT A;  4L8R B;  3C95 A;  4MQ3 A;  4FJG A;  1EO1 A;  2D5R A;  1HLU A;  3SAF A;  1NJX A;  3BZC A;  3TSQ A;  3SNN A;  3IAY A;  1REV A;  2I7P A;  3DLB A;  1LW0 A;  3E9O A;  2BUP A;  4CJF A;  3OYH A;  3Q7B A;  3OYI A;  4DU3 A;  1LAV A;  4B3S K;  4RCH A;  4NCA A;  4FOE A;  5AQX A;  1S6P A;  3T19 A;  2WFB A;  1NMD A;  2HHH K;  3G4S N;  2XY8 A;  4DS5 A;  1XHZ A;  1DTQ A;  5E84 A;  3ENH A;  1S1X A;  3WNE A;  4FOI A;  3HP6 A;  3PX6 A;  4FXD A;  1TGO A;  4FVM A;  4QS7 A;  5FPN A;  4BRM A;  4EIA A;  1QVG M;  4CZG A;  5JS1 A;  1HMV A;  1VSK A;  4HTL A;  3O80 A;  3K59 A;  4YOW A;  4KHQ A;  2IAJ A;  1LAW A;  3O9Q A;  3TPQ A;  4U67 L;  3TAP A;  1FXX A;  1K8K A;  3D2E A;  3WT0 A;  3D6R A;  4BWJ A;  4B3T K;  1RNH A;  3T1A A;  4CGJ A;  4BR5 A;  4EHU A;  1TYQ A;  4LH4 A;  5AQF A;  3OYF A;  2ATQ A;  4M7X A;  5HBM A;  4BG9 A;  1LWE A;  4ICL A;  3CPE A;  4IG3 A;  3J7Y P;  4DSI A;  3LP3 A;  3ENB A;  2A1S A;  2IDO A;  3ATU A;  1C1A A;  1IV0 A;  4BG8 A;  3BF1 A;  4YOT A;  3VMF B;  1IKW A;  4CFD A;  1LCU A;  4KRE A;  3P31 A;  2ZQB A;  2YHX A;  4M3Y A;  4Z4F A;  2E2Q A;  3ASM A;  1RDB A;  1JLC A;  3O4Q A;  1U47 A;  1I94 K;  3ZSR A;  5AZJ B;  2V51 B;  3FZK A;  4CJW A;  2YJE A;  4DTN A;  3AO4 A;  3VQ4 A;  3NE6 A;  2QI2 A;  3HZ6 A;  3HVT A;  1VSL A;  2P9N B;  1RDD A;  3C65 A;  3MEG A;  4KHP K;  4DSJ A;  1JLE A;  1VRT A;  5J1E A;  1QSY A;  5LJW A;  2NRT A;  4C23 A;  3AVA A;  3FZH A;  3TU5 A;  1GLF O;  1S9G A;  4CEF A;  2DTU A;  3QIP A;  5CR4 A;  2XY5 A;  2A1R A;  3I8B A;  5A2Q O;  3RSE A;  1D8Y A;  3OBW A;  3SMP A;  3AO2 A;  4DWI A;  2O8C B;  4CJ3 A;  4DV2 K;  3KLG A;  3PO5 A;  4O55 A;  5JVG L;  1YAG A;  4X65 K;  4IO8 A;  3ID6 A;  1C0F A;  4JS5 A;  2DY4 A;  2HB5 A;  4BRE A;  4I9Q A;  1XQS C;  1RDC A;  5LMN K;  4W5T A;  4NCG A;  3LDQ A;  2X78 A;  1RTJ A;  3DJC A;  3SQ0 A;  2IIR A;  4MLE A;  1BGX T;  3ZT3 A;  4MO4 A;  5ADX H;  5CYQ A;  4GV6 A;  5CZ2 A;  3P1G A;  1I39 A;  3QB0 A;  5KQD A;  3RTV A;  2X6N A;  3LDS A;  3KJV A;  3SAH A;  3K57 A;  3H46 O;  3WXJ A;  4ILJ A;  5AFU H;  1QSS A;  3BGR A;  4FJ5 A;  2UUA K;  1HYV A;  4FLX A;  4FJL A;  5IWA K;  3ZSW A;  1HNX K;  2YJF A;  4GY2 B;  4KFB A;  3TR8 A;  4YOY A;  1EQY A;  1QTM A;  1IH7 A;  3WQT A;  1BA1 A;  1OH6 A;  3ZET A;  5AQQ A;  2RKI A;  3AVL A;  3RWU A;  4IKF A;  1MWK A;  1HNI A;  4LF6 K;  5AQV A;  4CJQ A;  1KVB A;  3WNH A;  3PSF A;  5HRS A;  1ZBI A;  4H5T A;  3GOI A;  2WBN A;  1XNR K;  1HUX A;  4DTX A;  3H3O B;  4DF4 A;  4BVP A;  2KTQ A;  3VES A;  4FWO A;  4E7I A;  1QQM A;  4E7L A;  2P5O A;  1RT6 A;  1NKE A;  4EP4 A;  4NXN K;  3IUC A;  4FWQ A;  2E2P A;  4BVO A;  4H0T B;  4DTJ A;  4B8C A;  2QWN A;  1EXQ A;  4ISG A;  4W5O A;  5AQG A;  2V52 B;  4DSF A;  4CW7 B;  4YFU A;  2W41 A;  1CZA N;  4GKK K;  1KVA A;  4BE0 A;  1RTH A;  3SJJ A;  3E1Y A;  3VQ7 A;  2CH5 A;  3EZ5 A;  1VSJ A;  4OX9 K;  5AZI A;  3TAF A;  2J4R A;  4F9O A;  2EWS A;  4WQ5 C;  1WSE A;  4Z0U A;  2UYT A;  4NXM K;  4BR4 A;  3MED A;  2OPQ A;  4CF9 A;  4CZE A;  1Y64 A;  3CCJ N;  4NCB A;  1W97 L;  3MXJ A;  1U6Z A;  1M90 O;  1VK0 A;  1JLG A;  4DTR A;  4JD2 B;  4KHN A;  2QXL A;  3M8S A;  1SQK A;  1YUW A;  3CJ1 A;  2UU9 K;  1WLJ A;  1XI1 A;  4LSL A;  2HST A;  4IJN A;  5I42 A;  1BIS A;  2OYQ A;  2QKB A;  2DFE A;  5AQZ A;  4M3U A;  1U04 A;  1XNQ K;  4EAH D;  3LDO A;  4AM6 A;  3BEX A;  1E4F T;  3AAR A;  3VQA A;  3HI0 A;  3ZSV A;  3AVB A;  4E7H A;  3L6Q A;  3ZX0 A;  1RDW X;  1CXU A;  1NGA A;  3A2F A;  3CMA N;  3ZT4 A;  3DOL A;  3Q7C A;  4JKB A;  3SJH A;  3E01 A;  3F9M A;  5JLF A;  4FWP A;  1NGH A;  5CY4 A;  4WYB A;  4FJK A;  4IDH A;  4GVM A;  2PFU A;  3K5O A;  1TK8 A;  3H1Q A;  3CC4 N;  4CER A;  1NGE A;  4E1J A;  4ILG B;  3HM9 A;  4C8K A;  2YNF A;  1D9F A;  3D2F A;  3SI6 A;  1RBT A;  2IVP A;  5DM7 L;  2DFH A;  1RCH A;  3LPU A;  4F8R A;  4FLZ A;  1ZBH A;  3FGU A;  4EFH A;  3J7Z O;  4O5B A;  4CZJ A;  2NRW A;  3SPZ A;  1GOB A;  2ZD1 A;  1S1T A;  2NLX A;  1XC9 A;  4CZF A;  1WBB A;  2O8E A;  3W3D A;  4CJ5 A;  4CD1 A;  3ZEU A;  3AO3 A;  2FBY A;  1BA0 A;  1V4S A;  5MLC Q;  3T3F A;  2YHY A;  3D2E B;  1FW6 A;  3J7A P;  4Z94 A;  2OZS A;  3OYM A;  3MEC A;  3FZM A;  4X62 K;  4HCB A;  4E3S A;  3OYD A;  2ZF5 O;  1VSE A;  1D9D A;  3ZX2 A;  4DQP A;  2E20 A;  3K0S A;  4PQU A;  4KHW A;  1MDU B;  1NGD A;  2QKK A;  3C94 A;  1ZC6 A;  4DV0 K;  5FPE A;  3A8Y A;  4KAZ A;  2PYL A;  1ILY A;  2OPS A;  4A2B A;  1UWB A;  1N34 K;  4BR2 A;  3AO1 A;  4PY5 A;  2O8B A;  1QVF M;  3KVG A;  1BIU A;  4R5P A;  4B3O A;  4KH4 A;  4FJH A;  3RMD A;  1QHA A;  4CBW A;  3CFR A;  1W7A A;  3ZCM A;  1OH8 A;  1WUA A;  1S1U A;  1SZ2 A;  3VF2 A;  2WUS A;  4IG0 A;  2HF4 A;  1SL2 A;  2ZGY A;  4ISF A;  3K58 A;  3MN6 A;  4M63 C;  2AA4 A;  3LP2 A;  4CED A;  1HNZ K;  3S41 A;  5BRD A;  4N47 A;  4GV9 A;  4LF9 K;  1WB9 A;  3TAE A;  1Q18 A;  4GVE A;  3QEX A;  3WEE B;  1OH5 A;  1HRH A;  1XWL A;  4KKO A;  4LH5 A;  4CIE A;  4E0D A;  1IKY A;  2HHW A;  4FWS A;  1QE1 A;  4FK4 A;  3LAK A;  3TAN A;  3U3G A;  1J5O A;  4J2D A;  2DPN A;  2KFN A;  1D4X A;  2RF2 A;  5AFU A;  3HT3 A;  2FBX A;  1DGK N;  3EKU A;  2FF3 B;  3I0R A;  3RSE B;  5AQI A;  3BF3 A;  1TUU A;  4FZZ A;  4J2B A;  1C1C A;  2E4L A;  4B1Z A;  4M42 A;  3NCI A;  4CZK A;  1ASW A;  4DLE A;  3L3U A;  2VCP A;  5BR8 K;  3PV8 A;  4F3O A;  3PLA A;  3THV A;  2O8D B;  3VGM A;  2GUP A;  5H1S Q;  2Q2R A;  3QIC A;  5I9E B;  4M7Y A;  3GL1 A;  3V1R A;  2D1K A;  2D0O A;  4KI4 A;  3QFU A;  1TAQ A;  4FLY A;  3MN7 A;  1EWR A;  5C42 A;  3S3M A;  3KK3 A;  3OBY A;  4CIF A;  3QIN A;  1Q9Y A;  2NRZ A;  1HJO A;  5BRH A;  5C25 A;  3BUZ B;  3NF9 A;  3IS9 A;  3VEN A;  2KQ2 A;  4Z4H A;  4BC2 A;  3CD6 N;  4FWN A;  2D0P A;  2ZE2 A;  2LSN A;  3I8D A;  2YHW A;  2CGK A;  3AGK A;  1Z25 A;  4OPJ A;  4KBO A;  1RBR A;  3KWI A;  4DTP A;  5DM6 L;  5BN9 A;  4AM7 A;  1Y97 A;  2RE2 A;  3NF8 A;  2NRR A;  4JN4 A;  3O1B A;  1C0U A;  1QQN A;  1LV5 A;  5KTQ A;  3AAQ A;  1YJW N;  4WFB L;  1VAZ A;  4AHR A;  4V19 S;  2HVH A;  4LSN A;  2FXU A;  4B9N A;  2OCE A;  1YVN A;  4KO0 A;  4FYD A;  4NYF A;  5FLX O;  5AQM A;  1JL2 A;  1E4G T;  1NK4 A;  2YX6 A;  1X9M A;  2P9I A;  3TAQ A;  1JLF A;  2BAN A;  3K5M A;  2VGM A;  1GLD G;  4KTW A;  3MEE A;  1K6Y A;  4IEE A;  1IBL K;  3HP9 A;  2QK9 A;  1XMO K;  3AO5 A;  3NF6 A;  4R79 A;  2JWL A;  2YNG A;  3HOT A;  4B3M K;  1X3N A;  4BRI A;  4DFJ A;  5FPM A;  3NGY A;  4DR4 K;  2JWK A;  1K8A O;  3LWL A;  4DR1 K;  5AQO A;  3VQP A;  1ASU A;  2UXB K;  3HRG A;  1RDU A;  3A5N C;  4A5A A;  1NJW A;  4I6M B;  3VEO A;  2RPI A;  4CJK A;  2P9L B;  5BRF A;  1NGG A;  5BRE A;  2Y1J A;  1KAY A;  2KFZ A;  4KH6 A;  4GNI A;  4JNE A;  3LP1 A;  1VQK N;  3H45 C;  3DLL L;  3DMJ A;  4NYN A;  4DB3 A;  4B9V A;  4X64 K;  5C2F A;  3NF7 A;  3KLE A;  3CIP A;  3AVK A;  3J80 O;  2XY6 A;  3A5M C;  3OW2 M;  3VF4 A;  4M3X A;  5TKW A;  2UXC K;  4O4G A;  4XH1 A;  1WOQ A;  3SUP A;  1S3X A;  1BCM A;  1CZ9 A;  3ZLJ A;  2JGU A;  5AQY A;  2F4V K;  1LWC A;  2P9K A;  1ZBS A;  3N4P A;  5C10 A;  4FJJ A;  5J2M A;  1TL1 A;  4BRK A;  1NK5 A;  2E8A A;  1JCE A;  3HK2 A;  3L2Q A;  2HHT A;  4BQL A;  3MAQ A;  1NJY A;  4DMN A;  4M3T A;  3TAB A;  3KWG A;  2GWJ A;  3UKR A;  3OJU A;  2E5L K;  3ZSZ A;  1VQM N;  3NH2 A;  4YOU A;  4JS4 A;  5GIP A;  3EZW A;  1BIZ A;  4O8U A;  4J8F A;  4CHN A;  4G9Z A;  3OS1 A;  1HJR A;  4QCL A;  1JCG A;  4A59 A;  3A0I X;  4JKE A;  1XC3 A;  1RT2 A;  2HBM A;  4CF2 A;  3OYE A;  5AQN A;  1RT5 A;  3JS6 A;  3THX B;  4DUY K;  2YHB A;  4EZ6 A;  4PHT X;  3OY9 A;  4HHT A;  1KXP A;  3MCA B;  2O8E B;  1HNW K;  3DLR A;  3HBT A;  1W2B M;  3M3Z A;  4OVL A;  1RTD A;  4CZL A;  3BY5 A;  4CJS A;  1RIL A;  2FSJ A;  1JXE A;  4YOX A;  1N33 K;  1K73 O;  3V9X A;  5FRN A;  4CGD A;  4CHP A;  4LF4 K;  3HJF A;  3V81 A;  1TL3 A;  2HBL A;  4OJR A;  4YDU C;  3FZF A;  4RW8 A;  3QLH A;  3GE1 A;  5I3U A;  4PL8 A;  3THW A;  1NK6 A;  4BRH A;  4FJM A;  3O3F A;  2QM1 A;  1YI2 N;  1HR0 K;  2P9U A;  4CEZ A;  1VQ7 N;  1DKG D;  1NK7 A;  3B8A X;  2G8H A;  3CJC A;  2G8W A;  1C1B A;  2HBK A;  4BGA A;  4DG1 A;  4MLH A;  4B9S A;  5FRM A;  3AVF A;  4CEB A;  2KZZ A;  2O8F A;  4A5B A;  3DXK B;  1JKH A;  3NAE A;  2V7Y A;  1KC8 O;  4H03 B;  5AQS A;  3O8M A;  3IDH A;  1MU2 A;  4Q5V A;  1DT9 A;  3RMB A;  4CEO A;  4BE1 A;  3QDK A;  2QWQ A;  1S9E A;  3AA4 A;  4DR5 K;  5EX5 A;  4H4O A;  4IOA L;  3AA5 X;  4XH4 A;  4BC5 A;  3CCR N;  1YIJ N;  3E9P A;  3EE9 A;  3CFP A;  3DYA A;  2UXD K;  3B6P A;  4AF1 A;  4M3W A;  4DV7 K;  3NVM A;  4CFB A;  4KHY A;  4CJT A;  3VGK A;  4CEA A;  1T6C A;  1T44 A;  3DXM A;  1SL1 A;  4BE2 A;  1WBD A;  1IG9 A;  1EP4 A;  3VET A;  1YIT N;  2PY5 A;  1QZ5 A;  4NO7 A;  4DV3 K;  3OA9 A;  2P9S B;  3C7N B;  3DAW A;  4LFB K;  1Q8I A;  1BL3 A;  1RT4 A;  3CCV N;  4H0P A;  1X9W A;  2KZM A;  3MXI A;  5M1N A;  1VSI A;  4HUG A;  4C1N K;  1IBM K;  3SMS A;  4N76 A;  5T7B A;  3VQ8 A;  3NHG A;  4GW6 A;  2X6S A;  1TKT A;  4B1X B;  3LDN A;  3V9S A;  1UOC A;  2OA8 A;  1C0M A;  5F0X A;  4K0K K;  4HUE A;  1KSP A;  4W5Q A;  3OYB A;  3AY9 A;  1B92 A;  4E7K A;  3SUQ A;  3TAR A;  4FJX A;  1DLO A;  1RT7 A;  4O0J A;  4YOV A;  1IKX A;  3PIP L;  4BC4 A;  4DQI A;  4FJ8 A;  3OYG A;  1XUP O;  1YF5 L;  1NJZ A;  2KHO A;  2Q36 A;  4DFK A;  2FBV A;  1H1V A;  4DTU A;  5C24 A;  3CCL N;  3VQ9 A;  3VQC A;  3RRH A;  5AQL A;  3V9U A;  2HHV A;  3RRG A;  3I55 N;  3P38 A;  4BGB A;  1HKC A;  5SWM A;  4DKW A;  3THY A;  2P9I B;  3HPG A;  4WFA L;  4K25 A;  1NK8 A;  3CCS N;  5CYM A;  2Q3S A;  1OH7 A;  4PKG A;  3UKU A;  3RMA A;  1BG3 A;  4OKJ A;  2ZGZ A;  3C6A A;  5DMR A;  2H3G X;  4C8M A;  1TUY A;  1L3U A;  4WF9 L;  4BRP A;  4RW7 A;  4CJU A;  2AP1 A;  1XHX A;  2QWO A;  1VQ4 N;  3KLF A;  3LAL A;  2G8F A;  1ZYQ A;  1ZBL A;  3U9D A;  4BY9 C;  2JLE A;  2F9T A;  5AJ3 K;  4A57 A;  3D45 A;  4G1Q A;  4CHO A;  3QIO A;  5HRO A;  4GMJ B;  3AAP A;  4WFN L;  1VQO N;  1YT3 A;  4KHS A;  5E26 A;  4DFM A;  2OTJ N;  1VRU A;  3HPH A;  3W0L A;  3FFI A;  1Q81 O;  3WXK A;  5C12 A;  3K9K A;  4TSX A;  1RFQ A;  4H8K A;  3VEX A;  3F73 A;  3SQ2 A;  4BDY A;  3O6W A;  2E6M A;  5M1P A;  3SCX A;  2G8V A;  3K5N A;  1S6Q A;  2Q0R A;  3ATV A;  4JV5 K;  1HQE A;  1NWK A;  4BRC A;  4C8O A;  3H3N O;  3NMU A;  2D0C A;  1DEJ A;  1L3V A;  4OPK A;  4IEI A;  4I2P A;  1NBW A;  1NGC A;  3MX5 A;  4MDB A;  2NRV A;  4C8L A;  1VQN N;  5LJV A;  2PZS A;  5HOO A;  4IOX A;  4OPA A;  3CYM A;  2B5J A;  4CBU A;  1CXQ A;  3UKR B;  4WCE L;  2V7Z A;  3JYT A;  2IS3 A;  1LOT B;  4FM1 A;  3VF6 A;  4IFY A;  4FO0 A;  3CCM N;  3EE8 A;  4E19 A;  3O3G A;  2HHU A;  1O1W A;  2BGG A;  1EKE A;  1S1W A;  3V4I A;  4O5F A;  5BPL A;  1YTA A;  3DRP A;  2O4I A;  3V6D A;  3TTF A;  2P5G A;  2HMP A;  2BDP A;  3CQX A;  3L2W A;  4B1Y B;  1VQ6 N;  2F7T A;  3VEW A;  4CES A;  4JKF A;  3MCP A;  4ELV A;  1Z05 A;  4IXC A;  4LFC K;  2OAN A;  1X9S A;  4AIL C;  1YJN N;  2VQF K;  4KB0 A;  3CF5 L;  4XEI A;  1RBS A;  2P1J A;  2VQE K;  3E66 A;  3I33 A;  4QOZ B;  4IZ9 A;  1C6V A;  4DR2 K;  1YJ9 N;  4K43 A;  3ULE A;  1TKZ A;  4Z4I A; 
#chains in the Genus database with same CATH homology
 4FZX C;  1LV5 A;  3LP0 A;  5KTQ A;  5KI6 A;  1S6P A;  2VG7 A;  3SZ2 A;  2ITG A;  1L3T A;  4HUF A;  3T19 A;  4AHR A;  2HVH A;  4LSN A;  2XY8 A;  4B9N A;  2OPP A;  4DS5 A;  1XHZ A;  4WE1 A;  4CEQ A;  4EZ9 A;  1DTQ A;  5FRO A;  4KO0 A;  4OLA A;  4FYD A;  4NYF A;  1N6Q A;  4B9L A;  5KRT A;  1S1X A;  3U6F A;  3WNE A;  1JL2 A;  1HYZ A;  1QSL A;  1NK4 A;  1X9M A;  3SYZ A;  3TAQ A;  3EY1 A;  3HP6 A;  3ZT2 A;  3PX6 A;  4FXD A;  1JLF A;  1TGO A;  4FVM A;  2BAN A;  4IBN A;  3JSM A;  3OS2 A;  3K5M A;  3RR7 A;  4F2R A;  3ISN C;  4KTW A;  5JS1 A;  1HMV A;  3MEE A;  1VSK A;  3L3V A;  4OKE A;  1K6Y A;  2XY7 A;  4FJ9 A;  2F8T A;  1KLM A;  2X74 A;  3AVI A;  3HP9 A;  3TI0 A;  4CE9 A;  2QK9 A;  3AO5 A;  3NF6 A;  3LZJ A;  3K59 A;  4AHU A;  4W5R A;  1T8E A;  3AVM A;  4KHQ A;  2IAJ A;  3IG1 A;  2YNG A;  1LAW A;  3IRX A;  3VN5 A;  4FCY A;  1BI4 B;  3TAP A;  1FXX A;  4AHV A;  1SL0 A;  2I5J A;  4DFJ A;  2HHS A;  4BWJ A;  3NGY A;  4FM0 A;  1RNH A;  3T1A A;  3KK2 A;  4CGJ A;  1UA1 A;  3LWL A;  2Z1H A;  4J2E A;  3VQP A;  1ASU A;  3PX4 A;  4LH4 A;  1A5X A;  3NH0 A;  2EHG A;  1U45 A;  4ZHR A;  1NJW A;  3ZSY A;  3OYF A;  2ATQ A;  1ITG A;  2RPI A;  5HBM A;  4CJK A;  1LWE A;  4CJ4 A;  2YHA A;  1FKP A;  4ICL A;  3WNG A;  4IG3 A;  1VSD A;  2EX3 A;  4DSI A;  3LP3 A;  5HRN A;  2A1S A;  2Y1J A;  3G10 A;  1SKS A;  1HQU A;  2KFZ A;  2IDO A;  1C1A A;  3DLG A;  3VA3 A;  1KTQ A;  3AVN A;  4QAG A;  1IKW A;  3U3Y A;  4FJN A;  4CFD A;  1J54 A;  4FW1 A;  4CK2 A;  3LP1 A;  5KRS A;  2AJQ A;  3QEV A;  3WNF A;  4KRE A;  2ZQB A;  4I7F A;  3DMJ A;  4NYN A;  4B9V A;  4M3Y A;  4Z4F A;  4B9T A;  3ASM A;  1GOC A;  2GUI A;  3NF7 A;  1RDB A;  1JLC A;  3AVK A;  3O4Q A;  3KLE A;  4DTS A;  2XY6 A;  1NKC A;  2DFF A;  1U47 A;  4HTU A;  4M3X A;  1U49 A;  5J2Q A;  3ZSR A;  4O4G A;  1QHT A;  4CJW A;  3SUP A;  1BCM A;  1WNS A;  1CZ9 A;  2JGU A;  4LD0 A;  4DTN A;  3KKR A;  3AO4 A;  4FK2 A;  1T03 A;  3VQ4 A;  3ALY A;  3PO4 A;  3DRS A;  3ZSX A;  3NE6 A;  2OZM A;  1LWC A;  3LAM A;  5E41 A;  3HVT A;  1VSL A;  4DF8 A;  1RDD A;  3KKS A;  3MEG A;  4PUO A;  4FJJ A;  4DSJ A;  1JLE A;  1VRT A;  1KCF A;  5J1E A;  5HLF A;  1QSY A;  4CCH A;  3ULD A;  4PWD A;  4DQQ A;  3LPT A;  4JRP A;  3AVA A;  5J2M A;  2PYJ A;  1TL1 A;  1NK5 A;  4B9U A;  2HND A;  3HL8 A;  3PUF A;  3HK2 A;  3L2Q A;  2HHT A;  3LAN A;  1S9G A;  3MAQ A;  1NJY A;  4DMN A;  4M3T A;  3TAB A;  4CEF A;  3AV9 A;  4F3T A;  4AHS A;  3PX0 A;  4B08 A;  3OJU A;  2DTU A;  3QIP A;  2XY5 A;  2A1R A;  2VWK A;  4RW9 A;  3AVH A;  3ZSZ A;  3NH2 A;  1TK5 A;  3AO2 A;  1D8Y A;  5SZT A;  4DWI A;  1ZBU A;  2B6A A;  4JS4 A;  3G0Z A;  4CJ3 A;  3SUO A;  3KLG A;  3PO5 A;  3NDK A;  4O55 A;  1BIZ A;  3V9W A;  4CHN A;  3P83 D;  1WAF A;  3OS1 A;  1HJR A;  4QCL A;  2O4I A;  4CF8 A;  3S3N A;  2WON A;  4JS5 A;  2DY4 A;  2HB5 A;  1D5A A;  1LW2 A;  4I9Q A;  1WSF A;  1DTT A;  1RDC A;  1RT2 A;  4CF2 A;  3NGI A;  4W5T A;  3M8Q A;  3OYE A;  4DFP A;  1UA0 A;  4NCG A;  1RT5 A;  1TV6 A;  4BDP A;  2X78 A;  3CFO A;  1RTJ A;  1T7P A;  3SQ0 A;  1HYS A;  1N5Y A;  1BGX T;  1VSM A;  3ZT3 A;  1JLA A;  5CYQ A;  2YHB A;  5CZ2 A;  4EZ6 A;  1RBU A;  3P1G A;  3SUN A;  1I39 A;  3OY9 A;  5KGW A;  4HHT A;  1F21 A;  1A5V A;  4CHZ A;  5KGX A;  3ZT0 A;  2IOC A;  3RTV A;  2X6N A;  3LDS A;  3QEW A;  3KJV A;  1U4B A;  1J9A A;  3I0S A;  1KVC A;  3K57 A;  3DLR A;  4CHY A;  4DS4 A;  1VSH A;  1G15 A;  2BE2 A;  4OVL A;  1QSS A;  2WOM A;  3BGR A;  1RTD A;  4FJ5 A;  4DQR A;  4OGC A;  1HYV A;  4FLX A;  4CJS A;  4FJL A;  1RIL A;  3ZSW A;  1JXE A;  2HHQ A;  4KFB A;  3V9X A;  2ETJ A;  5FRN A;  3TR8 A;  4CGD A;  4CHP A;  3HJF A;  3V81 A;  3H08 A;  2O4G A;  3QNO A;  1IH7 A;  1QTM A;  1TL3 A;  4OJR A;  1WSI A;  4FLT A;  4RW8 A;  3QLH A;  5I3U A;  2YV0 X;  2RKI A;  1NK6 A;  3AVL A;  3RWU A;  3V1O A;  4FJM A;  4CJR A;  4IKF A;  3O3F A;  1HNI A;  2IGI A;  4CJE A;  3CG7 A;  1KVB A;  4CJQ A;  4CEZ A;  4O0I A;  3WNH A;  4CGI A;  5HRS A;  5J2P A;  1HPZ A;  1ZBI A;  1RBV A;  4H4M A;  3NGZ A;  4CEC A;  1NK7 A;  4DTX A;  2G8I A;  3B6O A;  4Z4G A;  2VG5 A;  3VQ5 A;  1S1V A;  1SV5 A;  4DF4 A;  3S9H A;  4CFC A;  2G8H A;  2G8W A;  1C1B A;  2KTQ A;  4DG1 A;  4E7I A;  4DTO A;  3OYJ A;  3AVF A;  4CEB A;  4B9S A;  5FRM A;  4E7L A;  3L2V A;  2KZZ A;  5HRP A;  4DQS A;  2P5O A;  1RT6 A;  2Z1G A;  1NKE A;  4EP4 A;  1YTU A;  3C6T A;  4AHC A;  4Y1C A;  3K2P A;  3DLE A;  3SQ1 A;  1JKH A;  3KLI A;  4RW4 A;  3NAE A;  4B8C A;  4DTJ A;  3DLK A;  1JLQ A;  3KIO A;  1EXQ A;  1EX4 A;  3VQ6 A;  4DU1 A;  2GV9 A;  4W5O A;  2XO7 A;  1MU2 A;  4Q5V A;  4DSF A;  1BI4 A;  4YFU A;  1B9D A;  2Z1J A;  3SQ4 A;  1NKB A;  5DK5 A;  3RMB A;  3C6U A;  1FKO A;  4CEO A;  4CF0 A;  4BE1 A;  1KVA A;  3MXM A;  1BQM A;  4YNQ A;  4BE0 A;  2G8U A;  3PY8 A;  3S3O A;  1I3A A;  1S9E A;  3AA4 A;  1RTH A;  5CZ1 A;  4E7J A;  4FJ7 A;  3SJJ A;  3VQ7 A;  1RT1 A;  4H4O A;  4IFV A;  1VSJ A;  3EZ5 A;  4F2S A;  3AA5 X;  4FLW A;  4RW6 A;  3TAF A;  4CHQ A;  3V9Z A;  4ID1 A;  1WSG A;  3CFP A;  3DYA A;  1UAX A;  3TAM A;  3B6P A;  1IKV A;  1WSE A;  3VQD A;  1YVU A;  4M3W A;  4Z0U A;  2HVI A;  4CFB A;  3MED A;  2OPQ A;  3OYC A;  4CF9 A;  1J53 A;  4CJT A;  1SKW A;  3ZSO A;  4KHY A;  4CEA A;  4Y1D A;  1BHL A;  4NCB A;  4M3Z A;  3ITH A;  4FW2 A;  1IO2 A;  1ZBF A;  3MXJ A;  2HHX A;  4CJV A;  1SL1 A;  5HRR A;  4B9M A;  4BE2 A;  1IG9 A;  1FK9 A;  1EP4 A;  2IC3 A;  1TKX A;  1VK0 A;  2PY5 A;  1JLG A;  4DTR A;  4FLV A;  4W5N A;  4DU4 A;  4KPY A;  3VQB A;  3VA0 A;  1X1P A;  3OYN A;  4FLU A;  4KHN A;  3M8S A;  1NOY A;  1JLB A;  2NUB A;  1LWF A;  2Z1I A;  1WLJ A;  3OYA A;  3QO9 A;  4BDZ A;  1XI1 A;  4IDK A;  1Z26 A;  4CF1 A;  3QER A;  1Q8I A;  4Q0B A;  1BL3 A;  1RT4 A;  4LSL A;  1X9W A;  3NFA A;  2YKN A;  1BQN A;  3DI6 A;  3V1Q A;  1T05 A;  2KZM A;  3MXI A;  5I42 A;  1VSI A;  4HUG A;  1BIS A;  3KTQ A;  2OYQ A;  2QKB A;  4E89 A;  3KLH A;  2DFE A;  4M3U A;  3DOK A;  2XRI A;  1U04 A;  4N76 A;  5T7B A;  3VQ8 A;  3NHG A;  4GW6 A;  3VQE A;  2X6S A;  1TKT A;  4JLH A;  3M8R A;  3V9S A;  2HNY A;  1UOC A;  2OA8 A;  3VQA A;  3OS0 A;  2D0B A;  1C0M A;  4HUE A;  2D0A A;  3ZSV A;  4CK3 A;  1KSP A;  4FZY A;  3AVB A;  4W5Q A;  3OYB A;  4E7H A;  1B92 A;  4E7K A;  3SUQ A;  3TAR A;  4FJX A;  1DLO A;  1JXB A;  1RT7 A;  1KFS A;  4CGH A;  4O0J A;  1IKX A;  3QEI A;  1CXU A;  4DQI A;  3A2F A;  4FJ8 A;  3ZT4 A;  3OYG A;  3DOL A;  3E01 A;  3P5J A;  2B4J A;  1SKR A;  1NJZ A;  4DFK A;  2FBV A;  1TKD A;  1NK9 A;  3UIQ A;  4XIU A;  5CY4 A;  4AH9 A;  2KW4 A;  1KFD A;  4DTU A;  4N5S A;  4HCC A;  2FC0 A;  4FJK A;  5C24 A;  1GOA A;  3CM6 A;  4CFA A;  3VQ9 A;  3VQC A;  4GVM A;  3K5O A;  3TWH A;  1TK8 A;  3D0P A;  4DSE A;  3RRH A;  3V9U A;  2HHV A;  4Z4E A;  4CER A;  1SUQ A;  1QQC A;  3RRG A;  3HM9 A;  4C8K A;  2YNF A;  1KLN A;  4CGF A;  2YNI A;  3CM5 A;  2F8S A;  1D9F A;  3AVJ A;  5SWM A;  3SI6 A;  3HO1 A;  1RBT A;  3OYK A;  2DFH A;  1RCH A;  3LPU A;  4F8R A;  4FLZ A;  1ZBH A;  3HPG A;  1NK8 A;  3RR8 A;  3L2R A;  3ZSQ A;  5CYM A;  3HYF A;  4DTM A;  2Q3S A;  4LY7 A;  3AA2 A;  4K8X A;  4O5B A;  3SPZ A;  3O4N A;  3SV4 A;  1GOB A;  3RMA A;  2ZD1 A;  1S1T A;  1XC9 A;  1KRP A;  3K5L A;  3QES A;  3DM2 A;  4KTQ A;  1RDA A;  3VQQ A;  4CJ5 A;  4F4K A;  3AO3 A;  4I9L A;  2FBY A;  4E1M A;  4KV8 A;  4OKJ A;  5DMR A;  3T3F A;  2GBZ A;  4C8M A;  4FJI A;  1L3U A;  4CJP A;  4RW7 A;  4CGG A;  3ZT1 A;  3M8P A;  4CJU A;  5EU7 A;  3HPO A;  1XHX A;  2OZS A;  3OYM A;  3MEC A;  3KLF A;  3LAL A;  4M41 A;  4HCB A;  4E3S A;  3OYD A;  2G8F A;  1VSE A;  1D9D A;  4CEE A;  1ZYQ A;  4DQP A;  3LZI A;  1ZBL A;  3DLH A;  3LWM A;  2JLE A;  2FBT A;  2HMI A;  4PQU A;  3D45 A;  4G1Q A;  4KHW A;  4CHO A;  2E6L A;  1W0H A;  3QIO A;  5HRO A;  2QKK A;  3C94 A;  4ELT A;  4GMJ B;  4KHU A;  4M3R A;  3CQ8 A;  1C0T A;  4PA1 A;  1YT3 A;  3AVC A;  4BWM A;  4KAZ A;  2PYL A;  4KHS A;  1HNV A;  1WN7 A;  2OPS A;  1UWB A;  4DFM A;  1NOZ A;  3AO1 A;  4PY5 A;  3HVR A;  3OYL A;  1TVR A;  1VRU A;  3HPH A;  3FFI A;  1BIU A;  4R5P A;  4J2A A;  4B3O A;  4ID5 A;  1ASV A;  3RMD A;  4FJH A;  3CFR A;  4Z4C A;  3ZCM A;  4DLG A;  4TSX A;  1S1U A;  2OPR A;  4H8K A;  4KB1 A;  4IG0 A;  4CJL A;  4UQG A;  3F73 A;  3SQ2 A;  4BDY A;  4FK0 A;  3F9K A;  4M45 A;  1SL2 A;  1TAU A;  4CK1 A;  3K58 A;  5D3G A;  4CED A;  3LP2 A;  2Y1I A;  2E6M A;  3TAG A;  3QEP A;  4MFB A;  3SCX A;  3AA3 A;  3OVN A;  4N47 A;  3K5N A;  1S6Q A;  4JRQ A;  2G8V A;  5FDL A;  1HQE A;  3SV3 A;  1Q9X A;  3TAE A;  3RMC A;  4C8O A;  1WAJ A;  4I2Q A;  2D0C A;  4E1N A;  3QEX A;  1L3V A;  5K14 A;  4ZTJ A;  3KD1 E;  1HRH A;  1XWL A;  4OPK A;  5J2N A;  1L5U A;  1S5J A;  2F96 A;  4KKO A;  1QS4 A;  4LH5 A;  4CIE A;  1L3S A;  4E0D A;  1CZB A;  1IKY A;  2HHW A;  4I2P A;  4HVJ A;  2XHB A;  1QE1 A;  4FK4 A;  3LAK A;  3TAN A;  2HW3 A;  3U3G A;  1J5O A;  4J2D A;  2KFN A;  4C8L A;  3AVG A;  2PZS A;  2RF2 A;  4DSL A;  4K8Z A;  3HT3 A;  2FBX A;  3CYM A;  4RG8 A;  2B5J A;  3SPY A;  3EYZ A;  1CXQ A;  3NH1 A;  2YKM A;  3L2U A;  4KRF A;  4KI6 A;  3JYT A;  2IS3 A;  3I0R A;  3HXM A;  4FM1 A;  4IFY A;  1NK0 A;  4FZZ A;  4CIG A;  4J2B A;  4E19 A;  1C1C A;  2W42 A;  2E4L A;  3O3G A;  2HHU A;  1O1W A;  4M42 A;  2BGG A;  1EKE A;  4OGE A;  3NBP A;  1S1W A;  5JS2 A;  3QET A;  4C8N A;  3NCI A;  2R7Y A;  3V4I A;  4O44 A;  1ASW A;  4KTZ A;  1YTA A;  3DRP A;  2YNH A;  3HST B;  3L3U A;  4BAC A;  4DLE A;  1A5W A;  3V6D A;  2P5G A;  3PV8 A;  2VWJ A;  4F3O A;  1RT3 A;  4EP5 A;  1W9H A;  3KK1 A;  3THV A;  2BDP A;  4DSK A;  1R0A A;  3KD5 E;  4N41 A;  3L2W A;  1WSJ A;  2P51 A;  2QXF A;  1TK0 A;  3DRR A;  1WSH A;  2G8K A;  4ZTF A;  3V1R A;  4OKK A;  4KI4 A;  4CES A;  1TAQ A;  4FLY A;  4ELV A;  2RN2 A;  5C42 A;  3QNN A;  4N56 A;  3S3M A;  1JL1 A;  3KK3 A;  4OLB A;  4CIF A;  3QIN A;  4AHT A;  4L8R B;  3C95 A;  4MQ3 A;  5HP1 A;  1X9S A;  4AIL C;  1Q9Y A;  4FJG A;  4KB0 A;  3OJS A;  2D5R A;  5C25 A;  1NJX A;  3NF9 A;  1RBS A;  3IS9 A;  2P1J A;  1EET A;  3L8B A;  2KQ2 A;  4Z4H A;  3SNN A;  3IAY A;  1REV A;  1VSF A;  3DLB A;  1BCO A;  4ELU A;  1LW0 A;  1RTI A;  2ZE2 A;  1CLQ A;  4QOZ B;  1B9F A;  2LSN A;  4CJF A;  3I8D A;  3OYH A;  4FM2 A;  1Z25 A;  1C6V A;  4OPJ A;  1RBR A;  4B8A B;  4DTP A;  3OYI A;  2HNZ A;  4DU3 A;  1U48 A;  3BDP A;  1Y97 A;  2VG6 A;  1TKZ A;  3NF8 A;  4Z4I A;  1LAV A;  1C0U A;  3O3H A;  4NCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...