2EHGA

Crystal structure of hyperthermophilic archaeal rnase hi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
149
structure length
149
Chain Sequence
MIIGYFDGLCEPKNPGGIATFGFVIYLDNRKIEGYGLAEKPFSINSTNNVAEYSGLICLMETMLRLGISSPIIKGDSQLVIKQMNGEYKVKAKRIIPLYEKAIELKKKLNATLIWVPREENKEADRLSRVAYELVRRGKLRDIGCIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease HI
publication title Crystal Structure of Type 1 RNase H from a Hyperthermophilic Archaeon with Double-stranded RNA-dependent RNase Activity
rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 49
structure length 149
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13456 RVT_3 Reverse transcriptase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ehgA00
4E7HA 1LW2A 3V9ZA 3DLRA 3SQ4A 1CXQA 2G8VA 3AA3A 3TARA 1S1WA 3DM2A 4XIUA 1RDCA 3NHGA 1X9MA 4E7IA 3I0RA 3QO9A 4FJGA 4ICLA 3AO2A 1L5UA 4DLGA 1HJRA 4CJ3A 3OYJA 1ZBIA 4CJLA 3OVNA 4AHVA 4CEOA 5KI6A 1ASUA 2KW4A 3HPOA 1RDAA 2FBTA 2O4GA 4FLTA 3SUQA 1VSMA 4JRPA 1YVUA 3QEXA 4KHSA 3VQEA 1ZBLA 3QNNA 3AO3A 3LPTA 1NKBA 4KPYA 2G8IA 4TSXA 3KLGA 2FBVA 2X6SA 4R5PA 1NK5A 3RMDA 5HBMA 1HYSA 1JLBA 2XY7A 3SNNA 1SKSA 4CK3A 2IAJA 2YNIA 3LALA 4PY5A 3LP0A 3VQ5A 2F8TA 2QKKA 3SQ0A 3S9HA 3DLHA 3VQ8A 4E7JA 4DSEA 1YTAA 4FXDA 4CJ4A 3V1QA 3VQDA 4I2QA 3AVKA 4CHZA 3NGIA 1SL0A 3HVTA 3QIOA 4RW9A 3T3FA 4M3ZA 1S9EA 1Q8IA 5I42A 4CEAA 4CCHA 3PX0A 3MXMA 4CERA 3HYFA 1BCOA 5T7BA 2X74A 3AVFA 3VQPA 3HT3A 3K57A 4B8CA 1EP4A 3IRXA 4CGIA 4LH4A 2VG7A 2VG6A 4B8AB 2OZSA 4DTOA 1DLOA 4CEZA 4FJMA 1C0TA 4OPKA 1KCFA 2RN2A 5FROA 4HUEA 4DTXA 1QSYA 1BIUA 2X78A 5C25A 1RT5A 3ZSQA 4FW2A 1XC9A 4KHUA 1GOAA 4E1NA 4Z4EA 1CZBA 4YNQA 3O4QA 4DSIA 3S3MA 4CF2A 3OJSA 2B5JA 1L3SA 5SZTA 2HB5A 3VQ7A 3ZT0A 2P1JA 3AA4A 4BACA 2G8UA 4CJPA 1FK9A 1IG9A 1QTMA 4CJVA 4FLWA 3JYTA 1NK8A 4C8KA 4HCCA 3AVGA 4O0IA 4M45A 3OYMA 4CEFA 4IG3A 4CJFA 2QXFA 3HM9A 2LSNA 3KLIA 2X6NA 4J2AA 4RW7A 1KLNA 2KFNA 4AHTA 3G0ZA 1Y97A 3MEGA 2HVHA 4Q0BA 4OJRA 4I2PA 3V1RA 3DRPA 3VQQA 4KHNA 4N41A 4KFBA 5HRPA 1NJYA 4CK1A 4FJ8A 3KD1E 5E41A 4FJHA 4PA1A 4AILC 1SKRA 4KHYA 1U49A 4DTPA 1NJWA 1JLAA 3K5LA 2Z1GA 3T19A 2W42A 3C94A 3RRHA 4M3TA 4NCBA 4CGGA 4M3UA 4OKKA 4N76A 1NOYA 3PO5A 1EX4A 4WE1A 3SCXA 2KTQA 3AVNA 1K6YA 4I7FA 3L8BA 3RMCA 4IDKA 2FBYA 5K14A 4FM1A 4CFBA 1SL1A 2PZSA 4J2DA 3DLKA 5HRNA 3QEWA 3ZSWA 2HNZA 3P5JA 1C6VA 1J53A 1WSGA 4NYFA 3ZSRA 3CFRA 2ZD1A 4E3SA 4QCLA 4Z4CA 3ZT1A 3SJJA 3QEIA 1QSSA 2RF2A 1XWLA 2OA8A 4EZ6A 3D0PA 3RR8A 4C8LA 1BISA 3LP1A 3AVCA 4CECA 4DS5A 1TGOA 3ISNC 3ZSYA 4QOZB 1W9HA 3SPZA 1U48A 4OGEA 2HHSA 2AJQA 4FJ5A 1IKVA 1S1UA 4J2EA 4BDZA 3EY1A 2Z1IA 4CJSA 4DTMA 2ZQBA 2XO7A 4FJ7A 4RG8A 2HHTA 4CEEA 2Y1JA 2DFFA 3T1AA 1I3AA 2E6MA 4CK2A 4DU3A 4E1MA 4CJWA 1VSFA 4ZTFA 1TK8A 3QLHA 2YKMA 3DLEA 3BGRA 3ZSXA 1REVA 1VSKA 1JXBA 1RBUA 1WAFA 4FK2A 1NK0A 4KI6A 1A5XA 3OYHA 1WLJA 3TR8A 2DFEA 5J2NA 5CYMA 1CLQA 2P5GA 3CYMA 4B08A 4AHUA 4O0JA 3KIOA 1RT7A 4OKEA 3LZJA 3RMAA 2P51A 2E6LA 4B9VA 4IFYA 1WSFA 4O5BA 5CYQA 3OYBA 1C1BA 4C8NA 4FJIA 2HHQA 4KKOA 2D5RA 4IKFA 3OYEA 3CFOA 1IO2A 4GVMA 4H4OA 1VSEA 3WNEA 3KLEA 2XHBA 4E7KA 4YFUA 4DTNA 4W5QA 5J2MA 3B6OA 3AVJA 3L3VA 1G15A 3WNFA 3NFAA 3RTVA 4KTZA 4NCGA 4CGHA 3TAGA 4Q5VA 3UIQA 4M3RA 4IFVA 4DF4A 1HNIA 3LANA 4BE1A 3MXIA 4PUOA 3VQ9A 1TV6A 1BGXT 3ZT2A 3IG1A 3KK2A 3OS0A 3M8PA 2HW3A 1QQCA 1WSIA 4DQQA 1S5JA 4DFKA 4CHQA 4DQPA 1RBSA 3QESA 1NJZA 4I9LA 2D0BA 3NDKA 4F8RA 3DI6A 1NKEA 3VQAA 4DQRA 1BCMA 4L8RB 1WN7A 2A1RA 4FW1A 1VSLA 4W5TA 2FC0A 4KO0A 4RW8A 1WSHA 5C42A 2VWKA 4CJTA 3O3FA 1WSJA 3L2WA 3OYCA 3V9WA 1TL3A 4CFDA 1J5OA 1TK0A 4HCBA 3KJVA 2Y1IA 3KKRA 3O3GA 3L2UA 3SI6A 2HNDA 2G8WA 3VQBA 3PY8A 1UWBA 3SPYA 3V81A 1J9AA 1YT3A 1NK6A 2EX3A 3NF6A 3RWUA 2YKNA 3NF8A 3LP2A 4CHOA 3OS2A 1KVAA 3DOKA 5HRSA 4G1QA 1GOBA 3PUFA 2Q3SA 4RW6A 3KLFA 1U04A 4B3OA 4RW4A 3WNGA 1X1PA 3WNHA 4FZYA 5J1EA 1HYVA 3AA5X 2G8FA 4PWDA 3NCIA 4FJJA 1LWFA 2IGIA 3V9UA 4CJEA 4B9LA 4DTSA 1U45A 1S6QA 2E4LA 1SV5A 4CJQA 4FK0A 4KB1A 3K2PA 4CIEA 5DMRA 4CEBA 3M8RA 1YTUA 2OPRA 1HNVA 1KFDA 4FJLA 1WNSA 3LWLA 3VN5A 1KTQA 4BE0A 4H4MA 3FFIA 1RILA 4CIGA 3O3HA 1QSLA 3L2VA 1HRHA 3U6FA 4CF9A 3MAQA 4FJXA 4KB0A 5EU7A 1TKTA 3V4IA 3AV9A 5C24A 1F21A 4DLEA 1RT2A 1HPZA 4I9QA 1LWCA 1FKPA 3I0SA 3MEEA 3SV3A 4DS4A 3ITHA 4F3OA 4FM2A 3CM5A 1LAWA 3OYLA 3VQ4A 1Z25A 2RKIA 3HL8A 4ELTA 4KREA 4OVLA 1LW0A 2A1SA 2EHGA 3SQ2A 3H08A 3HP6A 1IH7A 1D9DA 1KRPA 4E89A 1QHTA 2OPSA 4MFBA 4DU1A 1WAJA 1RBVA 2NUBA 5KRSA 3NF9A 4FVMA 1A5VA 1VRTA 2DFHA 3ULDA 3TANA 1S1XA 1XHXA 1Q9XA 4Z4FA 2YNFA 4LSLA 4FJNA 3QIPA 1NOZA 3HP9A 4PQUA 4M3YA 3L2QA 4C8MA 2FBXA 3ZSVA 4N56A 5HP1A 1ASVA 4MQ3A 2ITGA 1T03A 3DRSA 5KRTA 4HUFA 4E7LA 4M42A 3K5OA 1RT1A 3P1GA 1NKCA 2PY5A 4ID5A 1ZBUA 4FLZA 2G8KA 1C1CA 3AVAA 4J2BA 5I3UA 3SUNA 1O1WA 2HMIA 4NCAA 3AVIA 4FZXC 1CXUA 1ZBFA 2ATQA 3NGZA 2D0AA 1GOCA 3SUOA 3VA0A 1L3TA 4OLBA 4CJKA 3TAMA 3OYFA 4LY7A 1MU2A 1IKXA 2HNYA 1C0MA 3NF7A 3K5NA 2BDPA 2ZE2A 3S3OA 2IS3A 4CGFA 3NH1A 4F2SA 3KD5E 2B6AA 2GV9A 3MECA 3KK1A 2QKBA 3NH0A 3F73A 1RDDA 4LSNA 3HK2A 4O44A 5FDLA 1A5WA 4AH9A 3EYZA 1BI4B 2PYLA 1S6PA 1JL1A 3OJUA 3AO1A 1VRUA 4NYNA 1NJXA 1UA1A 2R7YA 3PX6A 4LH5A 3NH2A 4CHNA 2KFZA 4CE9A 1RBRA 2WOMA 4ID1A 2HVIA 2YNHA 1BIZA 3CFPA 3KTQA 1RT6A 3HPGA 3OYGA 1R0AA 1TKXA 1FXXA 2GUIA 3OYAA 4M3WA 4DTRA 1N5YA 3DOLA 2KZMA 1SL2A 3PO4A 3M8SA 1NK4A 4FJ9A 3IS9A 3TAQA 4IBNA 4ZHRA 3OYIA 3CQ8A 3S3NA 1LAVA 1RTHA 3SYZA 3QETA 3ALYA 3PX4A 2F8SA 4CJ5A 5CY4A 4CESA 3I8DA 4JLHA 4EP5A 3DLGA 4DTUA 3SQ1A 1NK7A 1RTDA 1VK0A 3ASMA 1Q9YA 3LAMA 1QS4A 3NE6A 1X9SA 4DSJA 3EZ5A 4K8ZA 2BGGA 4GW6A 4UQGA 4B9NA 4LD0A 3TI0A 4CHYA 4KV8A 4M41A 2OZMA 3ZSOA 3PV8A 2DY4A 1BL3A 3C95A 1D9FA 2VWJA 4JS4A 4CGJA 3V9XA 3B6PA 2YHAA 3TWHA 3NBPA 2OYQA 3V9SA 4E19A 1BHLA 3SUPA 1VSDA 4DSKA 3C6UA 1HQUA 1TVRA 1ZBHA 3AA2A 5CZ1A 4W5RA 1KSPA 2YNGA 4EZ9A 1TKZA 1KVCA 5KGXA 4M3XA 3OY9A 4OGCA 4HUGA 3F9KA 4OKJA 1T05A 4Z4GA 3CG7A 2HHUA 4DQIA 1JLEA 4AHCA 1EXQA 4B9SA 2HHVA 3HJFA 4FLYA 3AO4A 3G10A 4DMNA 3QERA 1T7PA 2IOCA 4KHQA 5D3GA 2KZZA 2IDOA 4F2RA 1C1AA 1W0HA 1ZYQA 2I5JA 1U47A 4K8XA 3LAKA 4QAGA 2G8HA 2RPIA 2XY8A 4DFJA 3U3YA 2ETJA 4N5SA 1U4BA 4B9MA 4DF8A 1XHZA 4KTQA 3AVBA 3K58A 1NK9A 1JLFA 2O4IA 4Y1CA 3OYKA 4CF8A 1TL1A 1L3UA 3TAEA 4C8OA 4E0DA 4CJRA 3ZT3A 4KRFA 5JS1A 3AO5A 3SZ2A 1DTQA 1LWEA 1S9GA 1LV5A 1T8EA 4Y1DA 1HQEA 2VG5A 1J54A 5KGWA 4CF1A 3HSTB 1TK5A 4DSFA 1BQNA 4O55A 3QEPA 4KHWA 1D5AA 1JXEA 3VQ6A 1JKHA 4W5OA 4DFMA 4BWMA 3V1OA 3TAPA 5FRNA 4CHPA 3VA3A 3RMBA 1HYZA 1HMVA 3NGYA 4Z4HA 1B9DA 3V6DA 4DU4A 1JLQA 3K59A 3TABA 1XI1A 3P83D 1JLCA 1N6QA 4FLVA 4FLXA 4FYDA 1ASWA 3U3GA 2JGUA 4KI4A 3E01A 2JLEA 4CEQA 4BE2A 3ZCMA 4EP4A 4ELVA 3O4NA 3AVHA 3DMJA 4ZTJA 5J2QA 5HRRA 4DFPA 2KQ2A 3TAFA 4H8KA 5KTQA 3DRRA 3OYNA 1L3VA 2DTUA 4BDPA 2IC3A 3AVMA 4N47A 4CFAA 3K5MA 5J2PA 1FKOA 4DTJA 4FLUA 2D0CA 3LPUA 3QINA 2OPPA 4DQSA 1CZ9A 4Z0UA 4CFCA 4KAZA 3AVLA 1RTIA 3QNOA 1UAXA 1JLGA 2YV0X 1UA0A 1TAUA 3MEDA 2GBZA 4AHSA 3OYDA 1IKWA 2QK9A 4DSLA 3BDPA 2BE2A 3HO1A 4F3TA 4OLAA 2WONA 3ZT4A 2PYJA 3DLBA 5FRMA 4OPJA 1DTTA 4O4GA 2Z1JA 2P5OA 3RR7A 1X9WA 2Z1HA 1KLMA 2YHBA 3C6TA 4IG0A 3KLHA 3JSMA 4HHTA 4W5NA 4JRQA 5HLFA 4DWIA 1S1TA 1S1VA 2BANA 4BWJA 4JS5A 3CM6A 3HVRA 3NAEA 1RBTA 2B4JA 3MXJA 1TKDA 3QEVA 4B9UA 4KTWA 5CZ2A 3ZSZA 1KFSA 3KK3A 3HPHA 4AHRA 3OS1A 1D8YA 4B9TA 4CIFA 3THVA 3RRGA 2HHWA 1BI4A 5DK5A 5SWMA 1BQMA 4CF0A 3VQCA 4FZZA 1RT3A 4BDYA 1RNHA 4HVJA 4GMJB 4F4KA 4FM0A 3IAYA 4Z4IA 4CGDA 2XRIA 4DG1A 1TAQA 1Z26A 1KVBA 1RCHA 3SV4A 1VSIA 1SKWA 1JL2A 2HHXA 3DYAA 3LZIA 1VSJA 1IKYA 3LWMA 2XY5A 1QE1A 1EETA 2XY6A 2OPQA 1UOCA 1VSHA 1EKEA 1B92A 4FK4A 4FCYA 3L3UA 3LDSA 1WSEA 3A2FA 1B9FA 1ITGA 3LP3A 4CEDA 1SUQA 1I39A 1C0UA 5JS2A 3HXMA 1RTJA 3L2RA 4ELUA 3M8QA 4CJUA 1RT4A 2F96A 4FJKA 3D45A 1RDBA 3KKSA 5HROA 4HTUA
chains in the Genus database with same CATH superfamily
1LW2A 3SQ4A 1R59O 2G8VA 3DXKA 2O8EB 2F4VK 3VGLA 2BUPA 3DM2A 3ZX3A 4E1JA 1ATRA 3DXMB 1X3MA 1L5UA 2YHYA 4AHVA 4JKGB 3ENOA 3H3NO 1W2BM 2KW4A 3HPOA 4FLTA 4A5BA 4JRPA 1YVUA 4OPHA 3QEXA 2VGMA 1NKBA 4R5PA 3VGMA 4DV2K 4DUYK 3CJAA 1D4XA 4LF5K 4PKIA 3KK7A 4DSEA 4FXDA 4CJ4A 4JKBA 5KQ8A 3VQDA 4CHZA 3HVTA 2IVNA 2KLAA 3CCMN 5I42A 3WQTA 1NGGA 3MXMA 1T6DA 4CERA 3HYFA 5F1XA 3HT3A 4B8CA 3BF1A 3IRXA 3GG4A 1DLOA 4CEZA 3WXJA 1N33K 4HUEA 2EWSA 3A5LC 4E1NA 3ID8A 1L3SA 1K8KA 3OJSA 3VQ7A 3ZT0A 2P1JA 4ILJA 2ZM6K 1QTMA 4FLWA 3JYTA 1NK8A 1GLEG 3HM9A 3KLIA 1HKCA 4PHTX 3JXUA 4RW7A 1KLNA 2KFNA 3BZCA 3I8BA 3MEGA 2HVHA 4Q0BA 1U2VB 3D7EO 3VQQA 3DRPA 2QA4N 5F2RA 1OVYA 4CK1A 3ZX2A 1U49A 2HF4A 1ATSA 2Z1GA 4H0PA 3RRHA 4NCBA 4CGGA 4M3UA 4OKKA 1NOYA 4B1UB 2KTQA 3Q7CA 1K6YA 2WFBA 3RMCA 1SQKA 2HNZA 3CJ7A 3VESA 4YDUC 4CJ7A 2ZD1A 4LC9B 4EZ6A 3SJJA 3O1BA 4OX9K 3D0PA 3FZHA 3ZETB 3ISNC 3QFPA 3ZSYA 4QOZB 1U48A 4OGEA 5M1KA 5I9EB 1QVFM 1IKVA 5LJVA 4J2EA 1WBDA 4WFBL 3VETA 3L4QA 3ENHA 4X64K 5C15A 3T1AA 1I3AA 2FF3B 3TTCA 3H46O 3D2FB 4B9QA 1VSFA 4X66K 2W6KA 3DLEA 3SBTA 4WFAL 2AA4A 3EE9A 3L6QA 4BGAA 1NG9A 2DFEA 5CYMA 4GV3A 1CLQA 2GTDA 5GAEP 3RMAA 3ZEUA 4CZGA 4M7YA 3MN6A 4B9VA 3VF4A 4NO7A 4FJIA 1Z6RA 3G6EN 4BRLA 2O8EA 1IO2A 4H4OA 4BY9C 4E7KA 4YFUA 3B6OA 3NFAA 4IO8A 3UIQA 4M3RA 3DXMA 4PUOA 4BE1A 4U67L 2Q0RA 2YCHA 4JKGA 3GL1A 4BVOA 1BGXT 3NMUA 1T44A 3OTOK 3C0BA 3M8PA 1QQCA 4DFKA 4K42A 3QESA 5C10A 1S72N 3NDKA 4DQRA 4BRDA 2A1RA 4DR3K 4FW1A 4W5TA 2P9IB 4IOCL 2NRXA 2VWKA 3CPEA 3V9WA 4BRIA 2V7ZA 3KKRA 3L2UA 3O1WA 1GLCG 1ZBSA 3O9RA 3RWUA 4B3OA 3FR0A 1GOBA 4RW6A 3PUFA 5M1PA 2ZJRL 1U04A 3WNHA 4FZYA 5AQQA 3AA5X 4G9ZA 3ID6A 4PKHA 4FJJA 3BF3A 1KXPA 2RHKA 4CJEA 4CJQA 4ISEA 3VEZA 3G25A 3Q7BA 3GBTA 1RGIA 2OPRA 1KFDA 4FJLA 3LWLA 1KTQA 4BE0A 4H4MA 1RILA 1QSLA 4FJXA 1TKTA 1RT2A 4I9QA 4DS4A 5C2FA 4LF7K 4DV6K 4ELTA 1Z25A 4DQ8A 3WXKA 3CC7N 4GV6A 2EHGA 1IH7A 4E89A 2OPSA 3QDKA 1BOTO 1QQNA 1RBVA 5KRSA 4FVMA 1N36K 1VRTA 3ULDA 2ASOA 3QIPA 3HP9A 4C8MA 4MQ3A 3U9DA 1ILYA 2G8KA 3M3ZA 3AVAA 5I3UA 2DPNA 1RDWX 3ZETA 3NGZA 1GOCA 3VA0A 4B3SK 4A2AA 3A5NC 4LY7A 1MU2A 1I94K 2HNYA 4BR7A 3S3OA 4CGFA 3NH1A 3LM9A 4CZEA 3HK2A 1RDDA 3CI5A 3FZLA 5FDLA 1XMQK 1KD1O 2GEMA 1BA1A 2PYLA 3OJUA 3AO1A 3D2FA 2I7PA 3TSPA 3PX6A 4LFAK 3U8XA 5CHIA 4CE9A 2HVIA 2JWLA 3FLCO 3CFPA 3KTQA 3HPGA 3OYGA 1FXXA 2GUIA 3OYAA 4EAHD 3AGKA 1VQ7N 3IS9A 4IBNA 3CQ8A 2V52B 2D0PA 1Z05A 3AARA 1YVNA 5CY4A 2A42A 2A6AA 4O5FA 3VEXA 3J80O 4CVNE 4H0TB 4GW6A 4F9OA 4UQGA 2HHHK 3CQXA 4B9NA 3KWIA 4JI7K 2DY4A 5AZJB 1D9FA 2F9TA 1HR0K 3V9SA 3MX5A 4E19A 1FJGK 1BHLA 3C6UA 1VQ8N 1MDUB 1ZBHA 5CZ1A 2YNGA 4HUGA 4IEEA 2P9IA 3HI0A 3MWTA 5TKWA 4AHCA 1EXQA 1HNZK 2HHVA 1NGCA 2WBNA 4DMNA 4BRAA 3QERA 4KHQA 2IOCA 2VCPA 1C1AA 2I5JA 1U47A 4K8XA 4QAGA 2G8HA 1U4BA 4X62K 4LF6K 1XHZA 1JLFA 1TL1A 1OH7A 3SZ2A 4Y1DA 4CF1A 4JKEA 3OW2M 2JWKA 1D5AA 1JXEA 4DFMA 1JKHA 4W5OA 1EWQA 3WT0A 4BWMA 3TAPA 3VA3A 4Z4HA 3TABA 5AQWA 3A8YA 1XI1A 3P83D 3UB5A 3HOTA 3GDQA 3O4NA 4FOEA 4ZTJA 2QWMA 2D4WA 3TAFA 3H45C 1NGBA 1YIJN 1BO5O 2DTUA 1HNWK 4N47A 4CFAA 2A3ZA 3LPUA 4DQSA 2OPPA 5AQNA 3C6HA 1UAXA 3E1YA 2YV0X 1UA0A 3MEDA 4DSLA 2AP1A 3BDPA 3HO1A 3ZT4A 2PYJA 3IDHA 3DLBA 2Z1HA 1KLMA 3C6TA 1YJWN 4JN4A 3JSMA 4DWIA 4BQZA 5BRFA 3HVRA 3NAEA 4DR7K 2B4JA 3MXJA 5EVZA 5CZ2A 3ZSZA 2KKZA 4JI2K 3RRGA 4K25A 5SWMA 4FWSA 3THYB 1NGAA 4BDYA 1N34K 4GMJB 4CGDA 1Z26A 4QS7A 1V4SA 1IV0A 3QICA 1VSIA 3VEVA 1JL2A 3J7YP 5BRDA 1VSJA 1IKYA 2XY5A 5C0YA 1UOCA 1VSHA 2Q0UA 3O8MA 2H3GX 4CZMA 1B9FA 1I39A 3HM8A 4J8FA 3L2RA 1RT4A 5DM6L 3L4IA 1RDBA 3DXKB 4E7HA 4EFHA 2VQEK 3V9ZA 3I56N 2Q1NA 3LDNA 3AA3A 3TARA 1S1WA 4XEIA 5AQFA 1IJJA 1X9MA 3VF6A 3QO9A 4E7IA 1KAYA 3AO2A 4ICLA 4CJ3A 4CJLA 5KI6A 3MWPA 2O4GA 2OTJN 3VQEA 1ZBLA 2E88A 3QNNA 3AO3A 3LPTA 2G8IA 4TSXA 3KLGA 2FBVA 2X6SA 1NK5A 3CC4N 5HBMA 2CH6A 2XY7A 5JLHA 4BR2A 3SNNA 2IAJA 3LALA 4PY5A 3VQ5A 2W41A 3D6RA 3DLHA 3H1VX 4E7JA 3VGKA 2E2NA 1KAXA 3QIOA 4M3ZA 3O4WA 1Q8IA 4NLBA 1Q81O 1BCOA 5T7BA 1Q82O 2F7TA 3FZMA 4LH4A 4B8AB 2A40A 3QMLA 4FWQA 5M1NA 2P9SB 3ZX0A 1KCFA 1S3XA 2E2PA 3ZSQA 1S22A 4YNQA 4DSIA 4CF2A 5IT9O 2ZJPL 3MCPA 3WXLA 4CJPA 1IG9A 4DV3K 1LCUA 4M45A 4CEFA 4XH4A 2QXFA 4GKJK 3R6MA 3GE1A 4BC3A 4N41A 1NJYA 3LM2A 4PA1A 4JI6K 2HBMA 4JKFA 3PO5A 4WE1A 4B1ZA 3SCXA 4I7FA 3L8BA 4XH5A 2FBYA 4FM1A 4CFBA 5AQRA 1MWMA 1VQMN 3DLKA 3QEWA 2PZSA 3CJBA 4J2DA 4B1VA 1C6VA 3UKRA 1NMNA 3ZT1A 3QEIA 1QSSA 4C8LA 4DS5A 5BN9A 1TGOA 3KVGA 1HKBA 3SPZA 3TSUA 3J7AP 4FJ5A 5AQUA 4BGBA 2Z1IA 5JVGL 4DTMA 3THYA 4JD2A 5AQVA 3J7ZO 2ZWHA 2XO7A 4FJ7A 3EKSA 2HHTA 4CEEA 4MLHA 4DU3A 4ZTFA 4QS8A 4IJNA 4CZHA 2YKMA 4FK2A 4PKGA 3VF2A 2QWOA 1K9MO 4DHYA 4KI6A 2V51B 3EEQA 3WUHA 4OKEA 2UUBK 2P51A 2FSJA 4IFYA 4O5BA 5CYQA 1X3NA 4BC2A 3OYBA 4C8NA 2HHQA 2D5RA 4IKFA 4BC5A 4DTNA 3KLEA 1VSEA 4W5QA 3L3VA 3AVJA 3K0SA 1G15A 3CCUN 4KTZA 4NCGA 4CGHA 3LANA 4IOAL 3LL3A 3NVMA 4HWIA 3OS0A 4BREA 5F0XA 2D0BA 1WN7A 4K0KK 3MMVA 4KO0A 5BPLA 1WSJA 4HCBA 1TL3A 1J5OA 3KJVA 3SI6A 4B1XB 4DCHA 1MA9B 1UWBA 3V81A 1J5EK 3M6GA 4JV5K 1J9AA 1NJIO 3NF6A 4CHOA 4DR5K 1DEJA 4G1QA 4L3QA 4A61A 3A0IX 3JS6A 1K73O 1HYVA 4PWDA 4DUZK 2P9SA 4QS9A 5ELZA 1LWFA 4BRMA 4EIAA 2E4LA 4KB1A 5AQGA 3A5MC 3GOIA 3M8RA 3C6AA 1HNVA 3CIPA 1WNSA 4CIGA 3VEYA 3O3HA 1QVGM 4FWOA 4CF9A 5EU7A 4DLEA 3O5BA 1JJ2M 2YI1A 2RKIA 4BG8A 3CPWM 3O80A 1KRPA 5EXWA 1QHTA 4WYBA 4DU1A 1WAJA 2NUBA 3NF9A 1S1XA 3O9TA 2GX9A 4K41A 3AAPA 1NOZA 3SMPA 2VQFK 4N56A 3ZSVA 5JICA 4M42A 3K5OA 2PY5A 4ID5A 4FLZA 4KH5A 2QWPA 3SUNA 2HMIA 1U6ZA 1BA0A 3AVIA 5LL6Z 2QWQA 4AM7A 5E26A 3SUOA 1W7AA 1TUYA 4NB4A 2Q97A 3TAMA 1IKXA 1TYQB 2BDPA 2ZE2A 3KD5E 2GV9A 2O8DA 3MN7A 4LSNA 1A5WA 3WEEB 4AH9A 1JCFA 5BR9A 1BI4B 2O8FB 1VRUA 1UA1A 2R7YA 4JKAA 4BR5A 5M1OA 2WOMA 1BIZA 4KH6A 1RT6A 5B8HA 3THWB 3H3OB 1N5YA 3NVKA 1SL2A 3M8SA 4YOUA 4DV5K 3TAQA 3QB0A 4B1WB 2NRRA 1LAVA 3SYZA 3PX4A 2F8SA 2GUPA 5GADP 4EP5A 5AJ3K 2W40A 1RTDA 2UXBK 1M1KO 1EQYA 3LAMA 3TTFA 4K8ZA 3T7ZA 2IVOA 2GWKA 4KV8A 4CHYA 4GY2B 5LMNK 3ZSOA 3PV8A 2ZF5O 4FWRA 4JS4A 5A2QO 3K9JA 2HMPA 5AQKA 3TWHA 2OYQA 3CMEN 1VSDA 5AQLA 1TVRA 3AA2A 4W5RA 1KSPA 4GV9A 4EZ9A 4M3XA 4OGCA 4ILHA 4Z4GA 4OKJA 1T05A 4DQIA 3E9LA 4IFEA 5C12A 3AO4A 3G10A 2KZZA 4F2RA 3ATVA 1QZ6A 2E2OA 4EHUA 2IVPA 2HSTA 1GLLO 2XY8A 4DFJA 3U3YA 5FLXO 4KTQA 3AVBA 3K58A 4FPBA 5AQSA 1NK9A 5ADXH 2O4IA 1L3UA 4KRFA 4E0DA 4BR4A 4JI0K 4YOXA 5JS1A 3AO5A 1DTQA 1LWEA 5M1QA 1W97L 1HQEA 4V19S 2VG5A 1J54A 2PAVA 4JK9A 5KGWA 3HSTB 4KHWA 1XQSC 2VYPA 3SJHA 3RMBA 1HYZA 5GINA 3K59A 1HLUA 1N6QA 4FLXA 4FYDA 5AQOA 4DR1K 3E01A 2JLEA 3U9ZA 3M1FA 3DMJA 3PSIA 5J2QA 1SS6A 5HRRA 4DFPA 3DRRA 4DV1K 5AQMA 4YOVA 2IC3A 5J2PA 3QINA 5BPNA 1XNRK 4Z0UA 3VEWA 4UY8O 3AVLA 4MO5A 3QNOA 5MLCQ 1TAUA 3CD6N 5GAGP 3HBTA 3SLCA 1WB9A 4OLAA 4H0OA 4BRPA 5FRMA 4OPJA 5EY4A 1DTTA 4O4GA 3RR7A 2YHBA 4I6MB 4PL7A 4HHTA 4W5NA 2E1YA 2BANA 4JS5A 3CM6A 3I55N 1TYQA 3OHRA 1RBTA 3UKUB 3EZWA 3QEVA 1TKDA 4KTWA 1KFSA 4B9UA 1NGDA 3KK3A 2YJFA 3FGUA 3HPHA 4KH4A 4AHRA 3OS1A 4B9TA 1XNQK 3WEEA 2HHWA 3C7NA 1BI4A 2QI2A 2O8FA 2UYTA 3R1XA 5AFUH 1NGHA 4FZZA 1RT3A 1SZ2A 4BRNA 4B3RK 3W0LA 3MDQA 3THWA 2HHXA 1QE1A 1DGKN 4FCYA 3DJCA 3LDSA 1YITN 3KZBA 1ITGA 3LP3A 4LF4K 5JS2A 1RTJA 4CZIA 3HRGA 2FSKA 3DLRA 3TU5A 1Q86O 1RDCA 3NHGA 4DLGA 5EX5A 3OYJA 5EOYA 1VQNN 2FBTA 4KHSA 4OO1J 4KPYA 5AQIA 4JI4K 3L0QA 3RMDA 1M90O 3SMSA 2O8BB 1SKSA 1LOTB 2F8TA 1Q18A 3S9HA 3OA9A 4FL9A 4IDHA 1EO1A 1YAGA 3V1QA 4I2QA 3NGIA 1SL0A 4RW9A 3T3FA 3PX0A 2GELA 5AQYA 2O8CA 2E2QA 3O9UA 1EP4A 4CGIA 2VG7A 2VG6A 4DV7K 4DTOA 4CBUA 2YX6A 4Y0WA 4FJMA 1C0TA 2ZGZA 4BRFA 4OPKA 2RN2A 5FROA 1BIUA 3KHYA 5C25A 4FW2A 4Z4EA 1ATNA 3S3MA 4YOTA 2B5JA 5SZTA 3AA4A 4BACA 2G8UA 1FK9A 4HCCA 4CJVA 3P38A 3T1HK 3BEXA 3OYMA 2QWNA 4GNIA 5KPZA 1KQSM 2LSNA 3RSEB 2X6NA 4A57A 3O6WA 3V1RA 4GVEA 4KFBA 5HRPA 3P31A 4FJ8A 3KD1E 5E41A 5HL7L 4WQ4A 4FJHA 4LFCK 3RVCA 4KHYA 3K5LA 2W42A 3C94A 4M3TA 4FWPA 1EX4A 3AVNA 4A2BA 1DKGD 4IDKA 4KHPK 1SL1A 3UKRB 1K8AO 4I6MA 3P5JA 4NYFA 1WSGA 1OKJA 3ZSRA 3CFRA 4E3SA 2RF2A 1XWLA 2OA8A 3RR8A 4O8KA 1BISA 3LP1A 1HKGA 4ISGA 4IZ9A 4CECA 3THXB 1VHXA 3UKUA 2PFUA 1W9HA 2HHSA 3N4PA 4JD2B 3VOVA 1S1UA 3SAHA 3F5TA 3EY1A 5IWAK 4BRHA 2ZQBA 3IMXA 4RG8A 2Y1JA 2E6MA 3WXIA 1FW6A 4CJWA 3AAQA 3KWGA 4LF9K 4DR6K 1Q7YO 4RWTA 1REVA 1WAFA 1X9JA 5AQXA 1NK0A 1A5XA 4YORA 1WLJA 1XUPO 3N4QA 3K9KA 4DB3A 2P5GA 4O0JA 2VGNA 2E6LA 3B8AX 3TSQA 1V4TA 1WSFA 1C1BA 4KKOA 4WCEL 3VTIA 3CCVN 2P9LB 1R0AA 5FPDA 2XHBA 5J2MA 2P5OA 4WQ5C 1NGFA 3WNFA 3BZKA 4M63C 3RTVA 1VQ4N 4O8UA 4DF4A 1NMDA 3CCJN 3VQ9A 1VQKN 3ZT2A 1QZ5A 5AFUA 2UXCK 1WSIA 4LFBK 4DQPA 1IBMK 4F8RA 3DI6A 1NKEA 1BCMA 1QHAA 4JI5K 4L8RB 2O8BA 2QWLA 2UXDK 3BP8A 2FC0A 4A5AA 5C42A 3O3FA 3L2WA 2P9UB 4CFDA 1TK0A 1JCGA 4FWKA 1RFQA 3HZ6A 2G8WA 2HNDA 2NLXA 3SPYA 4BVPA 2VWBA 1YT3A 5KPTA 4GKKK 2YKNA 3NF8A 2OCEA 1KVAA 1YXQA 2Q3SA 1WUAA 3M5RA 3WNGA 4FSVA 1X1PA 3CETA 3J8AA 3NCIA 5BPMA 3V9UA 2IGIA 4B9LA 1U45A 1S6QA 1SV5A 4FK0A 1EWRA 4BRQA 4CIEA 2UUCK 4CEBA 5E84A 3VN5A 1NNEA 2A5XA 4KB0A 3V4IA 3AV9A 5C24A 1HPZA 1LWCA 3I0SA 3MEEA 3RSEA 3SV3A 4H0XB 3ITHA 4F3OA 5GIOA 3OYLA 3VQ4A 3HL8A 3HP6A 1D9DA 3FZFA 3R9PA 4CBXA 4FWNA 4BR0A 1A5VA 3TANA 2DFHA 4LSLA 2FSNA 4PQUA 5HP1A 3DRSA 4HUFA 4E7LA 3P1GA 1RT1A 3TTDA 5HOOA 1ZBUA 1C1CA 4H5WA 5KPRA 1O1WA 4NCAA 3VPZA 4FZXC 3PLAA 1CXUA 3THXA 3C65A 2D0AA 3E9OA 1XMOK 4OLBA 4CJKA 3OYFA 2ASPA 1HNXK 2RE2A 4BRKA 1HJOA 2O8DB 3NF7A 4YDUA 2IS3A 4F2SA 2QKBA 3MECA 2GWJA 2QWRA 3F73A 3EYZA 5LJWA 1S6PA 1JL1A 4FO0A 3WQUA 4R79A 1NJXA 4H0VB 4IEIA 4CHNA 5AZIB 2KFZA 4ID1A 5AQZA 4CD1A 2YNHA 3FE1A 1P90A 1C0GA 1TKXA 5LMUK 1E3MA 2HOEA 3DOLA 1OH5A 4BROA 3E66A 3S3NA 3F9MA 1RTHA 3CERA 2P9LA 3EN9A 4CJ5A 3I8DA 4C1NK 4DTUA 2CGKA 1VK0A 3ASMA 5JVHL 2NRZA 4CI6A 1X9SA 2BGGA 5KQDA 2OTLN 5LY3A 4M41A 3C95A 4CGJA 2YHAA 4CW7B 4RCHA 1GLDG 5BR8K 1HQUA 1TKZA 2Q31A 1KVCA 5KGXA 2HHUA 2P9UA 3S41A 3HJFA 4FLYA 5D3GA 4JAXA 4AF1A 2IDOA 3U4LA 4NLCA 2CGLA 2A41A 1ZYQA 4H5TA 1OH8A 3LAKA 2ETJA 4DF8A 1E4FT 3MN9A 4Y1CA 3OYKA 4CF8A 3TAEA 1S9GA 1GLBG 1YUWA 1TK5A 4IWVA 4O55A 3H6EA 3VQ6A 3V1OA 2F9WA 3J81O 4CHPA 2FF6A 2P9PB 3NGYA 1B9DA 3IFRA 1JLCA 1GLAG 3HTVA 2QTDA 2JGUA 1KAZA 4BE2A 4BRGA 4EP4A 4ELVA 2ASMA 2KQ2A 4H8KA 4H5RA 3OYNA 1VQON 1L3VA 3CXCM 3K5MA 1FKOA 4DTJA 5DM7L 2HF3A 1MWKA 3FFKB 4ISFA 1CZ9A 3LDQA 5BN8A 4YHHK 2HBJA 4CFCA 4FPAA 1RTIA 4AHSA 3PIOL 3D2EB 2QK9A 1SAZA 4F3TA 4BC4A 2WONA 4H03B 4MLEA 4BQLA 1GLJO 3VENA 2I7NA 2Z1JA 1NGJA 4U7BA 3W3DA 4IG0A 3KLHA 4JRQA 4RTFD 3SK3A 3C7NB 4OPAA 5JMVA 1D8YA 4CIFA 5DK5A 3O9SA 3WXMB 1BQMA 3O08A 4CF0A 3VQCA 3EE8A 1RNHA 5AZIA 4F4KA 4Z4IA 3IAYA 1TAQA 4B1YB 4FWMA 1SKWA 3DYAA 2XY6A 2OPQA 4FK4A 4WFNL 3L3UA 1E4GT 1WSEA 3A2FA 3HXMA 4K43A 1BUPA 1SUQA 1C0UA 4CD3A 4ELUA 2VWJA 1BU6O 1NU0A 2FXUA 1CXQA 4XIUA 3I0RA 4FJGA 4MO4A 2BTFA 1HJRA 1ZBIA 5CE3A 3OVNA 1HUXA 4CEOA 3CHWA 1ASUA 4JKDA 1RDAA 3SUQA 1VSMA 4BRCA 1Y64A 4H5VA 1NGEA 1HYSA 1JLBA 4CK3A 2YNIA 3BUZB 3LP0A 3EKUA 2QKKA 3SQ0A 1ZXOA 3VQ8A 1YTAA 3AVKA 4JI1K 2O8CB 1S9EA 4CEAA 4CCHA 4IJAA 4NXNK 3OBWA 2X74A 3AVFA 3VQPA 2HBLA 3LDLA 3K57A 1HX1A 1YJ9N 3ATUA 4DTXA 1QSYA 4B3MK 2X78A 3VERA 1RT5A 1XC9A 4KHUA 1GOAA 3LDPA 1CZBA 3O4QA 3CC2N 2P9PA 2HB5A 1CZAN 4C8KA 3AVGA 4O0IA 4FWLA 4IG3A 4JK7A 4CJFA 4DV4K 4J2AA 4AHTA 3G0ZA 1Y97A 4OJRA 4I2PA 4KHNA 1KC8O 3T1YK 1U2VA 4H0YB 4AILC 1SKRA 4DTPA 1NJWA 1JLAA 3T19A 4EHTA 3SAFA 3D2EA 4N76A 1XC3A 3CMAN 3HOSA 5K14A 4YOYA 4JKHA 5HRNA 4JYAK 2Q2RA 3ZSWA 2D0OA 1J53A 4QCLA 4Z4CA 1YF5L 4M7XA 2V7YA 3AVCA 1ESVA 2CH5A 1VQLN 3CCSN 1TUUA 3LDOA 2NZTA 5CR4A 1VQPN 1YI2N 2AJQA 4BDZA 4CJSA 3VTHA 2NNWA 4X65K 4JNEA 5FPNA 4JHDB 2DFFA 4CK2A 4E1MA 3CJ9A 3ULEB 3QLHA 5GIPA 3BGRA 3ZSXA 1VSKA 1JXBA 1RBUA 3E9PA 3OYHA 3TR8A 5J2NA 2P9NB 4DR2K 3CYMA 4B08A 4AHUA 3KIOA 1RT7A 3LZJA 5AQHA 3I33A 4LF8K 3OYEA 3CFOA 3WNEA 4GVMA 1TK8A 3CCEN 3TAGA 3JAMO 3PSFA 4Q5VA 2E1ZA 4IFVA 4JEPA 1HNIA 4C23A 3MXIA 5AQJA 1WOQA 1TV6A 3T69A 3IG1A 3KK2A 2HW3A 4DQQA 4NXMK 1S5JA 4CHQA 1RBSA 4IOXA 4BG9A 1NJZA 2NRVA 4I9LA 3VQAA 4WQ5A 1RDUA 5M1FA 1VQ9N 4PL8A 1VSLA 1BG3A 3SBGA 4AM6A 2ZJQL 4RW8A 4YY3K 3CF5L 1WSHA 4CJTA 3OYCA 4CZLA 2Y1IA 3O3GA 3CCLN 3VQBA 3PY8A 1NK6A 2EX3A 3OS2A 3LP2A 3DOKA 1DT9A 4IXCA 5HRSA 3KLFA 4RW4A 2FLOA 5C2DA 5J1EA 2G8FA 2P9KB 4JI8K 2CGJA 4DTSA 2J4RA 3K2PA 5DMRA 3MK6A 4CZFA 4FVUA 3AGRA 1YTUA 3P39A 2NRTA 3FFIA 3L2VA 1HRHA 4DV0K 3U6FA 3P4IA 3MAQA 1F21A 1IBKK 1FKPA 2PBDA 3TPQA 4FM2A 3CM5A 1VQ5N 3G71N 1LAWA 5ADXA 4KREA 4OVLA 1LW0A 2A1SA 3SQ2A 4FOIA 3H08A 1IG8A 1J6ZA 4MFBA 2OZSA 4Z4FA 3DLLL 2HBKA 1XHXA 1Q9XA 2YNFA 4FJNA 3DAWA 3CCRN 4M3YA 3L2QA 2FBXA 3EL2A 3QFUA 1ASVA 2YHWA 2ITGA 1T03A 5KRTA 3FZKA 3MX2A 5FPMA 1NKCA 4J2BA 3ZLJA 4A59A 2E8AA 3AY9A 5H1SQ 2NRHA 1ZBFA 3IKMA 2ATQA 3BY5A 1L3TA 3OBYA 3G4SN 1C0MA 3K5NA 2OANA 1NLVA 3UE5A 4CBWA 2B6AA 3KK1A 3NH0A 4MDBA 4O44A 4JHDA 2QXLA 1GLFO 4NYNA 4JKCA 3CJ1A 3ULEA 2WC9A 1C0FA 4LH5A 3NH2A 1RBRA 1P8ZA 1VAZA 3A5OC 4M3WA 4DTRA 2KZMA 3PO4A 1NK4A 4FJ9A 2P9NA 3QBXA 2IIRA 4ZHRA 4AQYK 3H1QA 5FPEA 3OYIA 3R8EA 4KBOA 2ITMA 4B3TK 3QETA 3ALYA 4CESA 4JLHA 3VMFB 3DLGA 1NK7A 3SQ1A 1Q9YA 1T3VA 1NM1A 1QS4A 4A62A 3NE6A 5AQTA 2BH1A 2WUSA 3VEOA 4DSJA 3EZ5A 3F2KA 3CJCA 1OH6A 4LD0A 3TI0A 2OZMA 3QBWA 1NGIA 1BL3A 3V9XA 3B6PA 4H5NA 3NBPA 5AZJA 1QQOA 3SUPA 4DSKA 4ILGB 3OY9A 2QW9A 4Z94A 4JI3K 3F9KA 3CG7A 3MN5A 1JLEA 2KHOA 4B9SA 4IO9L 1T7PA 1W0HA 3MCAB 2RPIA 4N5SA 4B9MA 4CZJA 4HTLA 2WTUA 5BRHA 2P9KA 4C8OA 4CJRA 3ZT3A 5JLFA 1LV5A 1G99A 1T8EA 3O9QA 4DSFA 1BQNA 3QEPA 1BWFO 2YHXA 1YJNN 2NRWA 4C1NI 2W6LA 3PIPL 5FRNA 1HMVA 1K8KB 3CQYA 3IUCA 3V6DA 2UU9K 4DU4A 1JLQA 1VQ6N 4CZKA 4FLVA 1ASWA 3U3GA 4WQ4C 4KI4A 4CEQA 3ZCMA 3ZYYX 5BREA 1WBBA 3AVHA 1N32K 2ZGYA 5KTQA 3EO3A 4BDPA 3AVMA 4FLUA 2D0CA 3HSCA 1N8RO 4KAZA 1NWKA 1JLGA 2UUAK 2GBZA 1H1VA 5AR0A 3ENBA 3OYDA 1IKWA 1O13A 2BE2A 4DR4K 2D1KA 1X9WA 3R3LA 1IBLK 1OVQA 5HLFA 1S1TA 2E20A 1S1VA 4BWJA 2QM1A 2YJEA 4YOWA 4XH1A 1JCEA 1T6CA 3CCQN 4JK8A 3DWLA 1QQMA 3THVA 1BDGA 3SAGA 4WF9L 4HVJA 4FM0A 2E5LK 2XRIA 4DG1A 1KVBA 1RCHA 5TKYA 3SV4A 1ZC6A 4MDAA 2Q36A 3LZIA 1YHQN 3LWMA 1EETA 1HPMA 4DKWA 1EKEA 1B92A 2QEXN 5GAHP 1NBWA 4BR9A 4CEDA 3M8QA 4CJUA 2F96A 3ZEUB 4FJKA 3D45A 3KKSA 5AQPA 5HROA 4HTUA
chains in the Genus database with same CATH topology
4E7HA 1LW2A 3V9ZA 3DLRA 3SQ4A 1CXQA 2G8VA 3AA3A 3TARA 1S1WA 3DM2A 4XIUA 1RDCA 3NHGA 1X9MA 4E7IA 3I0RA 3QO9A 4FJGA 4ICLA 3AO2A 1L5UA 4DLGA 1HJRA 4CJ3A 3OYJA 1ZBIA 4CJLA 3OVNA 4AHVA 4CEOA 5KI6A 1ASUA 2KW4A 3HPOA 1RDAA 2FBTA 2O4GA 4FLTA 3SUQA 1VSMA 4JRPA 1YVUA 3QEXA 4KHSA 3VQEA 1ZBLA 3QNNA 3AO3A 3LPTA 1NKBA 4KPYA 2G8IA 4TSXA 3KLGA 2FBVA 2X6SA 4R5PA 1NK5A 3RMDA 5HBMA 1HYSA 1JLBA 2XY7A 3SNNA 1SKSA 4CK3A 2IAJA 2YNIA 3LALA 4PY5A 3LP0A 3VQ5A 2F8TA 2QKKA 3SQ0A 3S9HA 3DLHA 3VQ8A 4E7JA 4DSEA 1YTAA 4FXDA 4CJ4A 3V1QA 3VQDA 4I2QA 3AVKA 4CHZA 3NGIA 1SL0A 3HVTA 3QIOA 4RW9A 3T3FA 4M3ZA 1S9EA 1Q8IA 5I42A 4CEAA 4CCHA 3PX0A 3MXMA 4CERA 3HYFA 1BCOA 5T7BA 2X74A 3AVFA 3VQPA 3HT3A 3K57A 4B8CA 1EP4A 3IRXA 4CGIA 4LH4A 2VG7A 2VG6A 4B8AB 2OZSA 4DTOA 1DLOA 4CEZA 4FJMA 1C0TA 4OPKA 1KCFA 2RN2A 5FROA 4HUEA 4DTXA 1QSYA 1BIUA 2X78A 5C25A 1RT5A 3ZSQA 4FW2A 1XC9A 4KHUA 1GOAA 4E1NA 4Z4EA 1CZBA 4YNQA 3O4QA 4DSIA 3S3MA 4CF2A 3OJSA 2B5JA 1L3SA 5SZTA 2HB5A 3VQ7A 3ZT0A 2P1JA 3AA4A 4BACA 2G8UA 4CJPA 1FK9A 1IG9A 1QTMA 4CJVA 4FLWA 3JYTA 1NK8A 4C8KA 4HCCA 3AVGA 4O0IA 4M45A 3OYMA 4CEFA 4IG3A 4CJFA 2QXFA 3HM9A 2LSNA 3KLIA 2X6NA 4J2AA 4RW7A 1KLNA 2KFNA 4AHTA 3G0ZA 1Y97A 3MEGA 2HVHA 4Q0BA 4OJRA 4I2PA 3V1RA 3DRPA 3VQQA 4KHNA 4N41A 4KFBA 5HRPA 1NJYA 4CK1A 4FJ8A 3KD1E 5E41A 4FJHA 4PA1A 4AILC 1SKRA 4KHYA 1U49A 4DTPA 1NJWA 1JLAA 3K5LA 2Z1GA 3T19A 2W42A 3C94A 3RRHA 4M3TA 4NCBA 4CGGA 4M3UA 4OKKA 4N76A 1NOYA 3PO5A 1EX4A 4WE1A 3SCXA 2KTQA 3AVNA 1K6YA 4I7FA 3L8BA 3RMCA 4IDKA 2FBYA 5K14A 4FM1A 4CFBA 1SL1A 2PZSA 4J2DA 3DLKA 5HRNA 3QEWA 3ZSWA 2HNZA 3P5JA 1C6VA 1J53A 1WSGA 4NYFA 3ZSRA 3CFRA 2ZD1A 4E3SA 4QCLA 4Z4CA 3ZT1A 3SJJA 3QEIA 1QSSA 2RF2A 1XWLA 2OA8A 4EZ6A 3D0PA 3RR8A 4C8LA 1BISA 3LP1A 3AVCA 4CECA 4DS5A 1TGOA 3ISNC 3ZSYA 4QOZB 1W9HA 3SPZA 1U48A 4OGEA 2HHSA 2AJQA 4FJ5A 1IKVA 1S1UA 4J2EA 4BDZA 3EY1A 2Z1IA 4CJSA 4DTMA 2ZQBA 2XO7A 4FJ7A 4RG8A 2HHTA 4CEEA 2Y1JA 2DFFA 3T1AA 1I3AA 2E6MA 4CK2A 4DU3A 4E1MA 4CJWA 1VSFA 4ZTFA 1TK8A 3QLHA 2YKMA 3DLEA 3BGRA 3ZSXA 1REVA 1VSKA 1JXBA 1RBUA 1WAFA 4FK2A 1NK0A 4KI6A 1A5XA 3OYHA 1WLJA 3TR8A 2DFEA 5J2NA 5CYMA 1CLQA 2P5GA 3CYMA 4B08A 4AHUA 4O0JA 3KIOA 1RT7A 4OKEA 3LZJA 3RMAA 2P51A 2E6LA 4B9VA 4IFYA 1WSFA 4O5BA 5CYQA 3OYBA 1C1BA 4C8NA 4FJIA 2HHQA 4KKOA 2D5RA 4IKFA 3OYEA 3CFOA 1IO2A 4GVMA 4H4OA 1VSEA 3WNEA 3KLEA 2XHBA 4E7KA 4YFUA 4DTNA 4W5QA 5J2MA 3B6OA 3AVJA 3L3VA 1G15A 3WNFA 3NFAA 3RTVA 4KTZA 4NCGA 4CGHA 3TAGA 4Q5VA 3UIQA 4M3RA 4IFVA 4DF4A 1HNIA 3LANA 4BE1A 3MXIA 4PUOA 3VQ9A 1TV6A 1BGXT 3ZT2A 3IG1A 3KK2A 3OS0A 3M8PA 2HW3A 1QQCA 1WSIA 4DQQA 1S5JA 4DFKA 4CHQA 4DQPA 1RBSA 3QESA 1NJZA 4I9LA 2D0BA 3NDKA 4F8RA 3DI6A 1NKEA 3VQAA 4DQRA 1BCMA 4L8RB 1WN7A 2A1RA 4FW1A 1VSLA 4W5TA 2FC0A 4KO0A 4RW8A 1WSHA 5C42A 2VWKA 4CJTA 3O3FA 1WSJA 3L2WA 3OYCA 3V9WA 1TL3A 4CFDA 1J5OA 1TK0A 4HCBA 3KJVA 2Y1IA 3KKRA 3O3GA 3L2UA 3SI6A 2HNDA 2G8WA 3VQBA 3PY8A 1UWBA 3SPYA 3V81A 1J9AA 1YT3A 1NK6A 2EX3A 3NF6A 3RWUA 2YKNA 3NF8A 3LP2A 4CHOA 3OS2A 1KVAA 3DOKA 5HRSA 4G1QA 1GOBA 3PUFA 2Q3SA 4RW6A 3KLFA 1U04A 4B3OA 4RW4A 3WNGA 1X1PA 3WNHA 4FZYA 5J1EA 1HYVA 3AA5X 2G8FA 4PWDA 3NCIA 4FJJA 1LWFA 2IGIA 3V9UA 4CJEA 4B9LA 4DTSA 1U45A 1S6QA 2E4LA 1SV5A 4CJQA 4FK0A 4KB1A 3K2PA 4CIEA 5DMRA 4CEBA 3M8RA 1YTUA 2OPRA 1HNVA 1KFDA 4FJLA 1WNSA 3LWLA 3VN5A 1KTQA 4BE0A 4H4MA 3FFIA 1RILA 4CIGA 3O3HA 1QSLA 3L2VA 1HRHA 3U6FA 4CF9A 3MAQA 4FJXA 4KB0A 5EU7A 1TKTA 3V4IA 3AV9A 5C24A 1F21A 4DLEA 1RT2A 1HPZA 4I9QA 1LWCA 1FKPA 3I0SA 3MEEA 3SV3A 4DS4A 3ITHA 4F3OA 4FM2A 3CM5A 1LAWA 3OYLA 3VQ4A 1Z25A 2RKIA 3HL8A 4ELTA 4KREA 4OVLA 1LW0A 2A1SA 2EHGA 3SQ2A 3H08A 3HP6A 1IH7A 1D9DA 1KRPA 4E89A 1QHTA 2OPSA 4MFBA 4DU1A 1WAJA 1RBVA 2NUBA 5KRSA 3NF9A 4FVMA 1A5VA 1VRTA 2DFHA 3ULDA 3TANA 1S1XA 1XHXA 1Q9XA 4Z4FA 2YNFA 4LSLA 4FJNA 3QIPA 1NOZA 3HP9A 4PQUA 4M3YA 3L2QA 4C8MA 2FBXA 3ZSVA 4N56A 5HP1A 1ASVA 4MQ3A 2ITGA 1T03A 3DRSA 5KRTA 4HUFA 4E7LA 4M42A 3K5OA 1RT1A 3P1GA 1NKCA 2PY5A 4ID5A 1ZBUA 4FLZA 2G8KA 1C1CA 3AVAA 4J2BA 5I3UA 3SUNA 1O1WA 2HMIA 4NCAA 3AVIA 4FZXC 1CXUA 1ZBFA 2ATQA 3NGZA 2D0AA 1GOCA 3SUOA 3VA0A 1L3TA 4OLBA 4CJKA 3TAMA 3OYFA 4LY7A 1MU2A 1IKXA 2HNYA 1C0MA 3NF7A 3K5NA 2BDPA 2ZE2A 3S3OA 2IS3A 4CGFA 3NH1A 4F2SA 3KD5E 2B6AA 2GV9A 3MECA 3KK1A 2QKBA 3NH0A 3F73A 1RDDA 4LSNA 3HK2A 4O44A 5FDLA 1A5WA 4AH9A 3EYZA 1BI4B 2PYLA 1S6PA 1JL1A 3OJUA 3AO1A 1VRUA 4NYNA 1NJXA 1UA1A 2R7YA 3PX6A 4LH5A 3NH2A 4CHNA 2KFZA 4CE9A 1RBRA 2WOMA 4ID1A 2HVIA 2YNHA 1BIZA 3CFPA 3KTQA 1RT6A 3HPGA 3OYGA 1R0AA 1TKXA 1FXXA 2GUIA 3OYAA 4M3WA 4DTRA 1N5YA 3DOLA 2KZMA 1SL2A 3PO4A 3M8SA 1NK4A 4FJ9A 3IS9A 3TAQA 4IBNA 4ZHRA 3OYIA 3CQ8A 3S3NA 1LAVA 1RTHA 3SYZA 3QETA 3ALYA 3PX4A 2F8SA 4CJ5A 5CY4A 4CESA 3I8DA 4JLHA 4EP5A 3DLGA 4DTUA 3SQ1A 1NK7A 1RTDA 1VK0A 3ASMA 1Q9YA 3LAMA 1QS4A 3NE6A 1X9SA 4DSJA 3EZ5A 4K8ZA 2BGGA 4GW6A 4UQGA 4B9NA 4LD0A 3TI0A 4CHYA 4KV8A 4M41A 2OZMA 3ZSOA 3PV8A 2DY4A 1BL3A 3C95A 1D9FA 2VWJA 4JS4A 4CGJA 3V9XA 3B6PA 2YHAA 3TWHA 3NBPA 2OYQA 3V9SA 4E19A 1BHLA 3SUPA 1VSDA 4DSKA 3C6UA 1HQUA 1TVRA 1ZBHA 3AA2A 5CZ1A 4W5RA 1KSPA 2YNGA 4EZ9A 1TKZA 1KVCA 5KGXA 4M3XA 3OY9A 4OGCA 4HUGA 3F9KA 4OKJA 1T05A 4Z4GA 3CG7A 2HHUA 4DQIA 1JLEA 4AHCA 1EXQA 4B9SA 2HHVA 3HJFA 4FLYA 3AO4A 3G10A 4DMNA 3QERA 1T7PA 2IOCA 4KHQA 5D3GA 2KZZA 2IDOA 4F2RA 1C1AA 1W0HA 1ZYQA 2I5JA 1U47A 4K8XA 3LAKA 4QAGA 2G8HA 2RPIA 2XY8A 4DFJA 3U3YA 2ETJA 4N5SA 1U4BA 4B9MA 4DF8A 1XHZA 4KTQA 3AVBA 3K58A 1NK9A 1JLFA 2O4IA 4Y1CA 3OYKA 4CF8A 1TL1A 1L3UA 3TAEA 4C8OA 4E0DA 4CJRA 3ZT3A 4KRFA 5JS1A 3AO5A 3SZ2A 1DTQA 1LWEA 1S9GA 1LV5A 1T8EA 4Y1DA 1HQEA 2VG5A 1J54A 5KGWA 4CF1A 3HSTB 1TK5A 4DSFA 1BQNA 4O55A 3QEPA 4KHWA 1D5AA 1JXEA 3VQ6A 1JKHA 4W5OA 4DFMA 4BWMA 3V1OA 3TAPA 5FRNA 4CHPA 3VA3A 3RMBA 1HYZA 1HMVA 3NGYA 4Z4HA 1B9DA 3V6DA 4DU4A 1JLQA 3K59A 3TABA 1XI1A 3P83D 1JLCA 1N6QA 4FLVA 4FLXA 4FYDA 1ASWA 3U3GA 2JGUA 4KI4A 3E01A 2JLEA 4CEQA 4BE2A 3ZCMA 4EP4A 4ELVA 3O4NA 3AVHA 3DMJA 4ZTJA 5J2QA 5HRRA 4DFPA 2KQ2A 3TAFA 4H8KA 5KTQA 3DRRA 3OYNA 1L3VA 2DTUA 4BDPA 2IC3A 3AVMA 4N47A 4CFAA 3K5MA 5J2PA 1FKOA 4DTJA 4FLUA 2D0CA 3LPUA 3QINA 2OPPA 4DQSA 1CZ9A 4Z0UA 4CFCA 4KAZA 3AVLA 1RTIA 3QNOA 1UAXA 1JLGA 2YV0X 1UA0A 1TAUA 3MEDA 2GBZA 4AHSA 3OYDA 1IKWA 2QK9A 4DSLA 3BDPA 2BE2A 3HO1A 4F3TA 4OLAA 2WONA 3ZT4A 2PYJA 3DLBA 5FRMA 4OPJA 1DTTA 4O4GA 2Z1JA 2P5OA 3RR7A 1X9WA 2Z1HA 1KLMA 2YHBA 3C6TA 4IG0A 3KLHA 3JSMA 4HHTA 4W5NA 4JRQA 5HLFA 4DWIA 1S1TA 1S1VA 2BANA 4BWJA 4JS5A 3CM6A 3HVRA 3NAEA 1RBTA 2B4JA 3MXJA 1TKDA 3QEVA 4B9UA 4KTWA 5CZ2A 3ZSZA 1KFSA 3KK3A 3HPHA 4AHRA 3OS1A 1D8YA 4B9TA 4CIFA 3THVA 3RRGA 2HHWA 1BI4A 5DK5A 5SWMA 1BQMA 4CF0A 3VQCA 4FZZA 1RT3A 4BDYA 1RNHA 4HVJA 4GMJB 4F4KA 4FM0A 3IAYA 4Z4IA 4CGDA 2XRIA 4DG1A 1TAQA 1Z26A 1KVBA 1RCHA 3SV4A 1VSIA 1SKWA 1JL2A 2HHXA 3DYAA 3LZIA 1VSJA 1IKYA 3LWMA 2XY5A 1QE1A 1EETA 2XY6A 2OPQA 1UOCA 1VSHA 1EKEA 1B92A 4FK4A 4FCYA 3L3UA 3LDSA 1WSEA 3A2FA 1B9FA 1ITGA 3LP3A 4CEDA 1SUQA 1I39A 1C0UA 5JS2A 3HXMA 1RTJA 3L2RA 4ELUA 3M8QA 4CJUA 1RT4A 2F96A 4FJKA 3D45A 1RDBA 3KKSA 5HROA 4HTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7H A;  1LW2 A;  3V9Z A;  3DLR A;  3SQ4 A;  1CXQ A;  2G8V A;  3AA3 A;  3TAR A;  1S1W A;  3DM2 A;  4XIU A;  1RDC A;  3NHG A;  1X9M A;  4E7I A;  3I0R A;  3QO9 A;  4FJG A;  4ICL A;  3AO2 A;  1L5U A;  4DLG A;  1HJR A;  4CJ3 A;  3OYJ A;  1ZBI A;  4CJL A;  3OVN A;  4AHV A;  4CEO A;  5KI6 A;  1ASU A;  2KW4 A;  3HPO A;  1RDA A;  2FBT A;  2O4G A;  4FLT A;  3SUQ A;  1VSM A;  4JRP A;  1YVU A;  3QEX A;  4KHS A;  3VQE A;  1ZBL A;  3QNN A;  3AO3 A;  3LPT A;  1NKB A;  4KPY A;  2G8I A;  4TSX A;  3KLG A;  2FBV A;  2X6S A;  4R5P A;  1NK5 A;  3RMD A;  5HBM A;  1HYS A;  1JLB A;  2XY7 A;  3SNN A;  1SKS A;  4CK3 A;  2IAJ A;  2YNI A;  3LAL A;  4PY5 A;  3LP0 A;  3VQ5 A;  2F8T A;  2QKK A;  3SQ0 A;  3S9H A;  3DLH A;  3VQ8 A;  4E7J A;  4DSE A;  1YTA A;  4FXD A;  4CJ4 A;  3V1Q A;  3VQD A;  4I2Q A;  3AVK A;  4CHZ A;  3NGI A;  1SL0 A;  3HVT A;  3QIO A;  4RW9 A;  3T3F A;  4M3Z A;  1S9E A;  1Q8I A;  5I42 A;  4CEA A;  4CCH A;  3PX0 A;  3MXM A;  4CER A;  3HYF A;  1BCO A;  5T7B A;  2X74 A;  3AVF A;  3VQP A;  3HT3 A;  3K57 A;  4B8C A;  1EP4 A;  3IRX A;  4CGI A;  4LH4 A;  2VG7 A;  2VG6 A;  4B8A B;  2OZS A;  4DTO A;  1DLO A;  4CEZ A;  4FJM A;  1C0T A;  4OPK A;  1KCF A;  2RN2 A;  5FRO A;  4HUE A;  4DTX A;  1QSY A;  1BIU A;  2X78 A;  5C25 A;  1RT5 A;  3ZSQ A;  4FW2 A;  1XC9 A;  4KHU A;  1GOA A;  4E1N A;  4Z4E A;  1CZB A;  4YNQ A;  3O4Q A;  4DSI A;  3S3M A;  4CF2 A;  3OJS A;  2B5J A;  1L3S A;  5SZT A;  2HB5 A;  3VQ7 A;  3ZT0 A;  2P1J A;  3AA4 A;  4BAC A;  2G8U A;  4CJP A;  1FK9 A;  1IG9 A;  1QTM A;  4CJV A;  4FLW A;  3JYT A;  1NK8 A;  4C8K A;  4HCC A;  3AVG A;  4O0I A;  4M45 A;  3OYM A;  4CEF A;  4IG3 A;  4CJF A;  2QXF A;  3HM9 A;  2LSN A;  3KLI A;  2X6N A;  4J2A A;  4RW7 A;  1KLN A;  2KFN A;  4AHT A;  3G0Z A;  1Y97 A;  3MEG A;  2HVH A;  4Q0B A;  4OJR A;  4I2P A;  3V1R A;  3DRP A;  3VQQ A;  4KHN A;  4N41 A;  4KFB A;  5HRP A;  1NJY A;  4CK1 A;  4FJ8 A;  3KD1 E;  5E41 A;  4FJH A;  4PA1 A;  4AIL C;  1SKR A;  4KHY A;  1U49 A;  4DTP A;  1NJW A;  1JLA A;  3K5L A;  2Z1G A;  3T19 A;  2W42 A;  3C94 A;  3RRH A;  4M3T A;  4NCB A;  4CGG A;  4M3U A;  4OKK A;  4N76 A;  1NOY A;  3PO5 A;  1EX4 A;  4WE1 A;  3SCX A;  2KTQ A;  3AVN A;  1K6Y A;  4I7F A;  3L8B A;  3RMC A;  4IDK A;  2FBY A;  5K14 A;  4FM1 A;  4CFB A;  1SL1 A;  2PZS A;  4J2D A;  3DLK A;  5HRN A;  3QEW A;  3ZSW A;  2HNZ A;  3P5J A;  1C6V A;  1J53 A;  1WSG A;  4NYF A;  3ZSR A;  3CFR A;  2ZD1 A;  4E3S A;  4QCL A;  4Z4C A;  3ZT1 A;  3SJJ A;  3QEI A;  1QSS A;  2RF2 A;  1XWL A;  2OA8 A;  4EZ6 A;  3D0P A;  3RR8 A;  4C8L A;  1BIS A;  3LP1 A;  3AVC A;  4CEC A;  4DS5 A;  1TGO A;  3ISN C;  3ZSY A;  4QOZ B;  1W9H A;  3SPZ A;  1U48 A;  4OGE A;  2HHS A;  2AJQ A;  4FJ5 A;  1IKV A;  1S1U A;  4J2E A;  4BDZ A;  3EY1 A;  2Z1I A;  4CJS A;  4DTM A;  2ZQB A;  2XO7 A;  4FJ7 A;  4RG8 A;  2HHT A;  4CEE A;  2Y1J A;  2DFF A;  3T1A A;  1I3A A;  2E6M A;  4CK2 A;  4DU3 A;  4E1M A;  4CJW A;  1VSF A;  4ZTF A;  1TK8 A;  3QLH A;  2YKM A;  3DLE A;  3BGR A;  3ZSX A;  1REV A;  1VSK A;  1JXB A;  1RBU A;  1WAF A;  4FK2 A;  1NK0 A;  4KI6 A;  1A5X A;  3OYH A;  1WLJ A;  3TR8 A;  2DFE A;  5J2N A;  5CYM A;  1CLQ A;  2P5G A;  3CYM A;  4B08 A;  4AHU A;  4O0J A;  3KIO A;  1RT7 A;  4OKE A;  3LZJ A;  3RMA A;  2P51 A;  2E6L A;  4B9V A;  4IFY A;  1WSF A;  4O5B A;  5CYQ A;  3OYB A;  1C1B A;  4C8N A;  4FJI A;  2HHQ A;  4KKO A;  2D5R A;  4IKF A;  3OYE A;  3CFO A;  1IO2 A;  4GVM A;  4H4O A;  1VSE A;  3WNE A;  3KLE A;  2XHB A;  4E7K A;  4YFU A;  4DTN A;  4W5Q A;  5J2M A;  3B6O A;  3AVJ A;  3L3V A;  1G15 A;  3WNF A;  3NFA A;  3RTV A;  4KTZ A;  4NCG A;  4CGH A;  3TAG A;  4Q5V A;  3UIQ A;  4M3R A;  4IFV A;  4DF4 A;  1HNI A;  3LAN A;  4BE1 A;  3MXI A;  4PUO A;  3VQ9 A;  1TV6 A;  1BGX T;  3ZT2 A;  3IG1 A;  3KK2 A;  3OS0 A;  3M8P A;  2HW3 A;  1QQC A;  1WSI A;  4DQQ A;  1S5J A;  4DFK A;  4CHQ A;  4DQP A;  1RBS A;  3QES A;  1NJZ A;  4I9L A;  2D0B A;  3NDK A;  4F8R A;  3DI6 A;  1NKE A;  3VQA A;  4DQR A;  1BCM A;  4L8R B;  1WN7 A;  2A1R A;  4FW1 A;  1VSL A;  4W5T A;  2FC0 A;  4KO0 A;  4RW8 A;  1WSH A;  5C42 A;  2VWK A;  4CJT A;  3O3F A;  1WSJ A;  3L2W A;  3OYC A;  3V9W A;  1TL3 A;  4CFD A;  1J5O A;  1TK0 A;  4HCB A;  3KJV A;  2Y1I A;  3KKR A;  3O3G A;  3L2U A;  3SI6 A;  2HND A;  2G8W A;  3VQB A;  3PY8 A;  1UWB A;  3SPY A;  3V81 A;  1J9A A;  1YT3 A;  1NK6 A;  2EX3 A;  3NF6 A;  3RWU A;  2YKN A;  3NF8 A;  3LP2 A;  4CHO A;  3OS2 A;  1KVA A;  3DOK A;  5HRS A;  4G1Q A;  1GOB A;  3PUF A;  2Q3S A;  4RW6 A;  3KLF A;  1U04 A;  4B3O A;  4RW4 A;  3WNG A;  1X1P A;  3WNH A;  4FZY A;  5J1E A;  1HYV A;  3AA5 X;  2G8F A;  4PWD A;  3NCI A;  4FJJ A;  1LWF A;  2IGI A;  3V9U A;  4CJE A;  4B9L A;  4DTS A;  1U45 A;  1S6Q A;  2E4L A;  1SV5 A;  4CJQ A;  4FK0 A;  4KB1 A;  3K2P A;  4CIE A;  5DMR A;  4CEB A;  3M8R A;  1YTU A;  2OPR A;  1HNV A;  1KFD A;  4FJL A;  1WNS A;  3LWL A;  3VN5 A;  1KTQ A;  4BE0 A;  4H4M A;  3FFI A;  1RIL A;  4CIG A;  3O3H A;  1QSL A;  3L2V A;  1HRH A;  3U6F A;  4CF9 A;  3MAQ A;  4FJX A;  4KB0 A;  5EU7 A;  1TKT A;  3V4I A;  3AV9 A;  5C24 A;  1F21 A;  4DLE A;  1RT2 A;  1HPZ A;  4I9Q A;  1LWC A;  1FKP A;  3I0S A;  3MEE A;  3SV3 A;  4DS4 A;  3ITH A;  4F3O A;  4FM2 A;  3CM5 A;  1LAW A;  3OYL A;  3VQ4 A;  1Z25 A;  2RKI A;  3HL8 A;  4ELT A;  4KRE A;  4OVL A;  1LW0 A;  2A1S A;  2EHG A;  3SQ2 A;  3H08 A;  3HP6 A;  1IH7 A;  1D9D A;  1KRP A;  4E89 A;  1QHT A;  2OPS A;  4MFB A;  4DU1 A;  1WAJ A;  1RBV A;  2NUB A;  5KRS A;  3NF9 A;  4FVM A;  1A5V A;  1VRT A;  2DFH A;  3ULD A;  3TAN A;  1S1X A;  1XHX A;  1Q9X A;  4Z4F A;  2YNF A;  4LSL A;  4FJN A;  3QIP A;  1NOZ A;  3HP9 A;  4PQU A;  4M3Y A;  3L2Q A;  4C8M A;  2FBX A;  3ZSV A;  4N56 A;  5HP1 A;  1ASV A;  4MQ3 A;  2ITG A;  1T03 A;  3DRS A;  5KRT A;  4HUF A;  4E7L A;  4M42 A;  3K5O A;  1RT1 A;  3P1G A;  1NKC A;  2PY5 A;  4ID5 A;  1ZBU A;  4FLZ A;  2G8K A;  1C1C A;  3AVA A;  4J2B A;  5I3U A;  3SUN A;  1O1W A;  2HMI A;  4NCA A;  3AVI A;  4FZX C;  1CXU A;  1ZBF A;  2ATQ A;  3NGZ A;  2D0A A;  1GOC A;  3SUO A;  3VA0 A;  1L3T A;  4OLB A;  4CJK A;  3TAM A;  3OYF A;  4LY7 A;  1MU2 A;  1IKX A;  2HNY A;  1C0M A;  3NF7 A;  3K5N A;  2BDP A;  2ZE2 A;  3S3O A;  2IS3 A;  4CGF A;  3NH1 A;  4F2S A;  3KD5 E;  2B6A A;  2GV9 A;  3MEC A;  3KK1 A;  2QKB A;  3NH0 A;  3F73 A;  1RDD A;  4LSN A;  3HK2 A;  4O44 A;  5FDL A;  1A5W A;  4AH9 A;  3EYZ A;  1BI4 B;  2PYL A;  1S6P A;  1JL1 A;  3OJU A;  3AO1 A;  1VRU A;  4NYN A;  1NJX A;  1UA1 A;  2R7Y A;  3PX6 A;  4LH5 A;  3NH2 A;  4CHN A;  2KFZ A;  4CE9 A;  1RBR A;  2WOM A;  4ID1 A;  2HVI A;  2YNH A;  1BIZ A;  3CFP A;  3KTQ A;  1RT6 A;  3HPG A;  3OYG A;  1R0A A;  1TKX A;  1FXX A;  2GUI A;  3OYA A;  4M3W A;  4DTR A;  1N5Y A;  3DOL A;  2KZM A;  1SL2 A;  3PO4 A;  3M8S A;  1NK4 A;  4FJ9 A;  3IS9 A;  3TAQ A;  4IBN A;  4ZHR A;  3OYI A;  3CQ8 A;  3S3N A;  1LAV A;  1RTH A;  3SYZ A;  3QET A;  3ALY A;  3PX4 A;  2F8S A;  4CJ5 A;  5CY4 A;  4CES A;  3I8D A;  4JLH A;  4EP5 A;  3DLG A;  4DTU A;  3SQ1 A;  1NK7 A;  1RTD A;  1VK0 A;  3ASM A;  1Q9Y A;  3LAM A;  1QS4 A;  3NE6 A;  1X9S A;  4DSJ A;  3EZ5 A;  4K8Z A;  2BGG A;  4GW6 A;  4UQG A;  4B9N A;  4LD0 A;  3TI0 A;  4CHY A;  4KV8 A;  4M41 A;  2OZM A;  3ZSO A;  3PV8 A;  2DY4 A;  1BL3 A;  3C95 A;  1D9F A;  2VWJ A;  4JS4 A;  4CGJ A;  3V9X A;  3B6P A;  2YHA A;  3TWH A;  3NBP A;  2OYQ A;  3V9S A;  4E19 A;  1BHL A;  3SUP A;  1VSD A;  4DSK A;  3C6U A;  1HQU A;  1TVR A;  1ZBH A;  3AA2 A;  5CZ1 A;  4W5R A;  1KSP A;  2YNG A;  4EZ9 A;  1TKZ A;  1KVC A;  5KGX A;  4M3X A;  3OY9 A;  4OGC A;  4HUG A;  3F9K A;  4OKJ A;  1T05 A;  4Z4G A;  3CG7 A;  2HHU A;  4DQI A;  1JLE A;  4AHC A;  1EXQ A;  4B9S A;  2HHV A;  3HJF A;  4FLY A;  3AO4 A;  3G10 A;  4DMN A;  3QER A;  1T7P A;  2IOC A;  4KHQ A;  5D3G A;  2KZZ A;  2IDO A;  4F2R A;  1C1A A;  1W0H A;  1ZYQ A;  2I5J A;  1U47 A;  4K8X A;  3LAK A;  4QAG A;  2G8H A;  2RPI A;  2XY8 A;  4DFJ A;  3U3Y A;  2ETJ A;  4N5S A;  1U4B A;  4B9M A;  4DF8 A;  1XHZ A;  4KTQ A;  3AVB A;  3K58 A;  1NK9 A;  1JLF A;  2O4I A;  4Y1C A;  3OYK A;  4CF8 A;  1TL1 A;  1L3U A;  3TAE A;  4C8O A;  4E0D A;  4CJR A;  3ZT3 A;  4KRF A;  5JS1 A;  3AO5 A;  3SZ2 A;  1DTQ A;  1LWE A;  1S9G A;  1LV5 A;  1T8E A;  4Y1D A;  1HQE A;  2VG5 A;  1J54 A;  5KGW A;  4CF1 A;  3HST B;  1TK5 A;  4DSF A;  1BQN A;  4O55 A;  3QEP A;  4KHW A;  1D5A A;  1JXE A;  3VQ6 A;  1JKH A;  4W5O A;  4DFM A;  4BWM A;  3V1O A;  3TAP A;  5FRN A;  4CHP A;  3VA3 A;  3RMB A;  1HYZ A;  1HMV A;  3NGY A;  4Z4H A;  1B9D A;  3V6D A;  4DU4 A;  1JLQ A;  3K59 A;  3TAB A;  1XI1 A;  3P83 D;  1JLC A;  1N6Q A;  4FLV A;  4FLX A;  4FYD A;  1ASW A;  3U3G A;  2JGU A;  4KI4 A;  3E01 A;  2JLE A;  4CEQ A;  4BE2 A;  3ZCM A;  4EP4 A;  4ELV A;  3O4N A;  3AVH A;  3DMJ A;  4ZTJ A;  5J2Q A;  5HRR A;  4DFP A;  2KQ2 A;  3TAF A;  4H8K A;  5KTQ A;  3DRR A;  3OYN A;  1L3V A;  2DTU A;  4BDP A;  2IC3 A;  3AVM A;  4N47 A;  4CFA A;  3K5M A;  5J2P A;  1FKO A;  4DTJ A;  4FLU A;  2D0C A;  3LPU A;  3QIN A;  2OPP A;  4DQS A;  1CZ9 A;  4Z0U A;  4CFC A;  4KAZ A;  3AVL A;  1RTI A;  3QNO A;  1UAX A;  1JLG A;  2YV0 X;  1UA0 A;  1TAU A;  3MED A;  2GBZ A;  4AHS A;  3OYD A;  1IKW A;  2QK9 A;  4DSL A;  3BDP A;  2BE2 A;  3HO1 A;  4F3T A;  4OLA A;  2WON A;  3ZT4 A;  2PYJ A;  3DLB A;  5FRM A;  4OPJ A;  1DTT A;  4O4G A;  2Z1J A;  2P5O A;  3RR7 A;  1X9W A;  2Z1H A;  1KLM A;  2YHB A;  3C6T A;  4IG0 A;  3KLH A;  3JSM A;  4HHT A;  4W5N A;  4JRQ A;  5HLF A;  4DWI A;  1S1T A;  1S1V A;  2BAN A;  4BWJ A;  4JS5 A;  3CM6 A;  3HVR A;  3NAE A;  1RBT A;  2B4J A;  3MXJ A;  1TKD A;  3QEV A;  4B9U A;  4KTW A;  5CZ2 A;  3ZSZ A;  1KFS A;  3KK3 A;  3HPH A;  4AHR A;  3OS1 A;  1D8Y A;  4B9T A;  4CIF A;  3THV A;  3RRG A;  2HHW A;  1BI4 A;  5DK5 A;  5SWM A;  1BQM A;  4CF0 A;  3VQC A;  4FZZ A;  1RT3 A;  4BDY A;  1RNH A;  4HVJ A;  4GMJ B;  4F4K A;  4FM0 A;  3IAY A;  4Z4I A;  4CGD A;  2XRI A;  4DG1 A;  1TAQ A;  1Z26 A;  1KVB A;  1RCH A;  3SV4 A;  1VSI A;  1SKW A;  1JL2 A;  2HHX A;  3DYA A;  3LZI A;  1VSJ A;  1IKY A;  3LWM A;  2XY5 A;  1QE1 A;  1EET A;  2XY6 A;  2OPQ A;  1UOC A;  1VSH A;  1EKE A;  1B92 A;  4FK4 A;  4FCY A;  3L3U A;  3LDS A;  1WSE A;  3A2F A;  1B9F A;  1ITG A;  3LP3 A;  4CED A;  1SUQ A;  1I39 A;  1C0U A;  5JS2 A;  3HXM A;  1RTJ A;  3L2R A;  4ELU A;  3M8Q A;  4CJU A;  1RT4 A;  2F96 A;  4FJK A;  3D45 A;  1RDB A;  3KKS A;  5HRO A;  4HTU A; 
#chains in the Genus database with same CATH topology
 1LW2 A;  3SQ4 A;  1R59 O;  2G8V A;  3DXK A;  2O8E B;  2F4V K;  3VGL A;  2BUP A;  3DM2 A;  3ZX3 A;  4E1J A;  1ATR A;  3DXM B;  1X3M A;  1L5U A;  2YHY A;  4AHV A;  4JKG B;  3ENO A;  3H3N O;  1W2B M;  2KW4 A;  3HPO A;  4FLT A;  4A5B A;  4JRP A;  1YVU A;  4OPH A;  3QEX A;  2VGM A;  1NKB A;  4R5P A;  3VGM A;  4DV2 K;  4DUY K;  3CJA A;  1D4X A;  4LF5 K;  4PKI A;  3KK7 A;  4DSE A;  4FXD A;  4CJ4 A;  4JKB A;  5KQ8 A;  3VQD A;  4CHZ A;  3HVT A;  2IVN A;  2KLA A;  3CCM N;  5I42 A;  3WQT A;  1NGG A;  3MXM A;  1T6D A;  4CER A;  3HYF A;  5F1X A;  3HT3 A;  4B8C A;  3BF1 A;  3IRX A;  3GG4 A;  1DLO A;  4CEZ A;  3WXJ A;  1N33 K;  4HUE A;  2EWS A;  3A5L C;  4E1N A;  3ID8 A;  1L3S A;  1K8K A;  3OJS A;  3VQ7 A;  3ZT0 A;  2P1J A;  4ILJ A;  2ZM6 K;  1QTM A;  4FLW A;  3JYT A;  1NK8 A;  1GLE G;  3HM9 A;  3KLI A;  1HKC A;  4PHT X;  3JXU A;  4RW7 A;  1KLN A;  2KFN A;  3BZC A;  3I8B A;  3MEG A;  2HVH A;  4Q0B A;  1U2V B;  3D7E O;  3VQQ A;  3DRP A;  2QA4 N;  5F2R A;  1OVY A;  4CK1 A;  3ZX2 A;  1U49 A;  2HF4 A;  1ATS A;  2Z1G A;  4H0P A;  3RRH A;  4NCB A;  4CGG A;  4M3U A;  4OKK A;  1NOY A;  4B1U B;  2KTQ A;  3Q7C A;  1K6Y A;  2WFB A;  3RMC A;  1SQK A;  2HNZ A;  3CJ7 A;  3VES A;  4YDU C;  4CJ7 A;  2ZD1 A;  4LC9 B;  4EZ6 A;  3SJJ A;  3O1B A;  4OX9 K;  3D0P A;  3FZH A;  3ZET B;  3ISN C;  3QFP A;  3ZSY A;  4QOZ B;  1U48 A;  4OGE A;  5M1K A;  5I9E B;  1QVF M;  1IKV A;  5LJV A;  4J2E A;  1WBD A;  4WFB L;  3VET A;  3L4Q A;  3ENH A;  4X64 K;  5C15 A;  3T1A A;  1I3A A;  2FF3 B;  3TTC A;  3H46 O;  3D2F B;  4B9Q A;  1VSF A;  4X66 K;  2W6K A;  3DLE A;  3SBT A;  4WFA L;  2AA4 A;  3EE9 A;  3L6Q A;  4BGA A;  1NG9 A;  2DFE A;  5CYM A;  4GV3 A;  1CLQ A;  2GTD A;  5GAE P;  3RMA A;  3ZEU A;  4CZG A;  4M7Y A;  3MN6 A;  4B9V A;  3VF4 A;  4NO7 A;  4FJI A;  1Z6R A;  3G6E N;  4BRL A;  2O8E A;  1IO2 A;  4H4O A;  4BY9 C;  4E7K A;  4YFU A;  3B6O A;  3NFA A;  4IO8 A;  3UIQ A;  4M3R A;  3DXM A;  4PUO A;  4BE1 A;  4U67 L;  2Q0R A;  2YCH A;  4JKG A;  3GL1 A;  4BVO A;  1BGX T;  3NMU A;  1T44 A;  3OTO K;  3C0B A;  3M8P A;  1QQC A;  4DFK A;  4K42 A;  3QES A;  5C10 A;  1S72 N;  3NDK A;  4DQR A;  4BRD A;  2A1R A;  4DR3 K;  4FW1 A;  4W5T A;  2P9I B;  4IOC L;  2NRX A;  2VWK A;  3CPE A;  3V9W A;  4BRI A;  2V7Z A;  3KKR A;  3L2U A;  3O1W A;  1GLC G;  1ZBS A;  3O9R A;  3RWU A;  4B3O A;  3FR0 A;  1GOB A;  4RW6 A;  3PUF A;  5M1P A;  2ZJR L;  1U04 A;  3WNH A;  4FZY A;  5AQQ A;  3AA5 X;  4G9Z A;  3ID6 A;  4PKH A;  4FJJ A;  3BF3 A;  1KXP A;  2RHK A;  4CJE A;  4CJQ A;  4ISE A;  3VEZ A;  3G25 A;  3Q7B A;  3GBT A;  1RGI A;  2OPR A;  1KFD A;  4FJL A;  3LWL A;  1KTQ A;  4BE0 A;  4H4M A;  1RIL A;  1QSL A;  4FJX A;  1TKT A;  1RT2 A;  4I9Q A;  4DS4 A;  5C2F A;  4LF7 K;  4DV6 K;  4ELT A;  1Z25 A;  4DQ8 A;  3WXK A;  3CC7 N;  4GV6 A;  2EHG A;  1IH7 A;  4E89 A;  2OPS A;  3QDK A;  1BOT O;  1QQN A;  1RBV A;  5KRS A;  4FVM A;  1N36 K;  1VRT A;  3ULD A;  2ASO A;  3QIP A;  3HP9 A;  4C8M A;  4MQ3 A;  3U9D A;  1ILY A;  2G8K A;  3M3Z A;  3AVA A;  5I3U A;  2DPN A;  1RDW X;  3ZET A;  3NGZ A;  1GOC A;  3VA0 A;  4B3S K;  4A2A A;  3A5N C;  4LY7 A;  1MU2 A;  1I94 K;  2HNY A;  4BR7 A;  3S3O A;  4CGF A;  3NH1 A;  3LM9 A;  4CZE A;  3HK2 A;  1RDD A;  3CI5 A;  3FZL A;  5FDL A;  1XMQ K;  1KD1 O;  2GEM A;  1BA1 A;  2PYL A;  3OJU A;  3AO1 A;  3D2F A;  2I7P A;  3TSP A;  3PX6 A;  4LFA K;  3U8X A;  5CHI A;  4CE9 A;  2HVI A;  2JWL A;  3FLC O;  3CFP A;  3KTQ A;  3HPG A;  3OYG A;  1FXX A;  2GUI A;  3OYA A;  4EAH D;  3AGK A;  1VQ7 N;  3IS9 A;  4IBN A;  3CQ8 A;  2V52 B;  2D0P A;  1Z05 A;  3AAR A;  1YVN A;  5CY4 A;  2A42 A;  2A6A A;  4O5F A;  3VEX A;  3J80 O;  4CVN E;  4H0T B;  4GW6 A;  4F9O A;  4UQG A;  2HHH K;  3CQX A;  4B9N A;  3KWI A;  4JI7 K;  2DY4 A;  5AZJ B;  1D9F A;  2F9T A;  1HR0 K;  3V9S A;  3MX5 A;  4E19 A;  1FJG K;  1BHL A;  3C6U A;  1VQ8 N;  1MDU B;  1ZBH A;  5CZ1 A;  2YNG A;  4HUG A;  4IEE A;  2P9I A;  3HI0 A;  3MWT A;  5TKW A;  4AHC A;  1EXQ A;  1HNZ K;  2HHV A;  1NGC A;  2WBN A;  4DMN A;  4BRA A;  3QER A;  4KHQ A;  2IOC A;  2VCP A;  1C1A A;  2I5J A;  1U47 A;  4K8X A;  4QAG A;  2G8H A;  1U4B A;  4X62 K;  4LF6 K;  1XHZ A;  1JLF A;  1TL1 A;  1OH7 A;  3SZ2 A;  4Y1D A;  4CF1 A;  4JKE A;  3OW2 M;  2JWK A;  1D5A A;  1JXE A;  4DFM A;  1JKH A;  4W5O A;  1EWQ A;  3WT0 A;  4BWM A;  3TAP A;  3VA3 A;  4Z4H A;  3TAB A;  5AQW A;  3A8Y A;  1XI1 A;  3P83 D;  3UB5 A;  3HOT A;  3GDQ A;  3O4N A;  4FOE A;  4ZTJ A;  2QWM A;  2D4W A;  3TAF A;  3H45 C;  1NGB A;  1YIJ N;  1BO5 O;  2DTU A;  1HNW K;  4N47 A;  4CFA A;  2A3Z A;  3LPU A;  4DQS A;  2OPP A;  5AQN A;  3C6H A;  1UAX A;  3E1Y A;  2YV0 X;  1UA0 A;  3MED A;  4DSL A;  2AP1 A;  3BDP A;  3HO1 A;  3ZT4 A;  2PYJ A;  3IDH A;  3DLB A;  2Z1H A;  1KLM A;  3C6T A;  1YJW N;  4JN4 A;  3JSM A;  4DWI A;  4BQZ A;  5BRF A;  3HVR A;  3NAE A;  4DR7 K;  2B4J A;  3MXJ A;  5EVZ A;  5CZ2 A;  3ZSZ A;  2KKZ A;  4JI2 K;  3RRG A;  4K25 A;  5SWM A;  4FWS A;  3THY B;  1NGA A;  4BDY A;  1N34 K;  4GMJ B;  4CGD A;  1Z26 A;  4QS7 A;  1V4S A;  1IV0 A;  3QIC A;  1VSI A;  3VEV A;  1JL2 A;  3J7Y P;  5BRD A;  1VSJ A;  1IKY A;  2XY5 A;  5C0Y A;  1UOC A;  1VSH A;  2Q0U A;  3O8M A;  2H3G X;  4CZM A;  1B9F A;  1I39 A;  3HM8 A;  4J8F A;  3L2R A;  1RT4 A;  5DM6 L;  3L4I A;  1RDB A;  3DXK B;  4E7H A;  4EFH A;  2VQE K;  3V9Z A;  3I56 N;  2Q1N A;  3LDN A;  3AA3 A;  3TAR A;  1S1W A;  4XEI A;  5AQF A;  1IJJ A;  1X9M A;  3VF6 A;  3QO9 A;  4E7I A;  1KAY A;  3AO2 A;  4ICL A;  4CJ3 A;  4CJL A;  5KI6 A;  3MWP A;  2O4G A;  2OTJ N;  3VQE A;  1ZBL A;  2E88 A;  3QNN A;  3AO3 A;  3LPT A;  2G8I A;  4TSX A;  3KLG A;  2FBV A;  2X6S A;  1NK5 A;  3CC4 N;  5HBM A;  2CH6 A;  2XY7 A;  5JLH A;  4BR2 A;  3SNN A;  2IAJ A;  3LAL A;  4PY5 A;  3VQ5 A;  2W41 A;  3D6R A;  3DLH A;  3H1V X;  4E7J A;  3VGK A;  2E2N A;  1KAX A;  3QIO A;  4M3Z A;  3O4W A;  1Q8I A;  4NLB A;  1Q81 O;  1BCO A;  5T7B A;  1Q82 O;  2F7T A;  3FZM A;  4LH4 A;  4B8A B;  2A40 A;  3QML A;  4FWQ A;  5M1N A;  2P9S B;  3ZX0 A;  1KCF A;  1S3X A;  2E2P A;  3ZSQ A;  1S22 A;  4YNQ A;  4DSI A;  4CF2 A;  5IT9 O;  2ZJP L;  3MCP A;  3WXL A;  4CJP A;  1IG9 A;  4DV3 K;  1LCU A;  4M45 A;  4CEF A;  4XH4 A;  2QXF A;  4GKJ K;  3R6M A;  3GE1 A;  4BC3 A;  4N41 A;  1NJY A;  3LM2 A;  4PA1 A;  4JI6 K;  2HBM A;  4JKF A;  3PO5 A;  4WE1 A;  4B1Z A;  3SCX A;  4I7F A;  3L8B A;  4XH5 A;  2FBY A;  4FM1 A;  4CFB A;  5AQR A;  1MWM A;  1VQM N;  3DLK A;  3QEW A;  2PZS A;  3CJB A;  4J2D A;  4B1V A;  1C6V A;  3UKR A;  1NMN A;  3ZT1 A;  3QEI A;  1QSS A;  4C8L A;  4DS5 A;  5BN9 A;  1TGO A;  3KVG A;  1HKB A;  3SPZ A;  3TSU A;  3J7A P;  4FJ5 A;  5AQU A;  4BGB A;  2Z1I A;  5JVG L;  4DTM A;  3THY A;  4JD2 A;  5AQV A;  3J7Z O;  2ZWH A;  2XO7 A;  4FJ7 A;  3EKS A;  2HHT A;  4CEE A;  4MLH A;  4DU3 A;  4ZTF A;  4QS8 A;  4IJN A;  4CZH A;  2YKM A;  4FK2 A;  4PKG A;  3VF2 A;  2QWO A;  1K9M O;  4DHY A;  4KI6 A;  2V51 B;  3EEQ A;  3WUH A;  4OKE A;  2UUB K;  2P51 A;  2FSJ A;  4IFY A;  4O5B A;  5CYQ A;  1X3N A;  4BC2 A;  3OYB A;  4C8N A;  2HHQ A;  2D5R A;  4IKF A;  4BC5 A;  4DTN A;  3KLE A;  1VSE A;  4W5Q A;  3L3V A;  3AVJ A;  3K0S A;  1G15 A;  3CCU N;  4KTZ A;  4NCG A;  4CGH A;  3LAN A;  4IOA L;  3LL3 A;  3NVM A;  4HWI A;  3OS0 A;  4BRE A;  5F0X A;  2D0B A;  1WN7 A;  4K0K K;  3MMV A;  4KO0 A;  5BPL A;  1WSJ A;  4HCB A;  1TL3 A;  1J5O A;  3KJV A;  3SI6 A;  4B1X B;  4DCH A;  1MA9 B;  1UWB A;  3V81 A;  1J5E K;  3M6G A;  4JV5 K;  1J9A A;  1NJI O;  3NF6 A;  4CHO A;  4DR5 K;  1DEJ A;  4G1Q A;  4L3Q A;  4A61 A;  3A0I X;  3JS6 A;  1K73 O;  1HYV A;  4PWD A;  4DUZ K;  2P9S A;  4QS9 A;  5ELZ A;  1LWF A;  4BRM A;  4EIA A;  2E4L A;  4KB1 A;  5AQG A;  3A5M C;  3GOI A;  3M8R A;  3C6A A;  1HNV A;  3CIP A;  1WNS A;  4CIG A;  3VEY A;  3O3H A;  1QVG M;  4FWO A;  4CF9 A;  5EU7 A;  4DLE A;  3O5B A;  1JJ2 M;  2YI1 A;  2RKI A;  4BG8 A;  3CPW M;  3O80 A;  1KRP A;  5EXW A;  1QHT A;  4WYB A;  4DU1 A;  1WAJ A;  2NUB A;  3NF9 A;  1S1X A;  3O9T A;  2GX9 A;  4K41 A;  3AAP A;  1NOZ A;  3SMP A;  2VQF K;  4N56 A;  3ZSV A;  5JIC A;  4M42 A;  3K5O A;  2PY5 A;  4ID5 A;  4FLZ A;  4KH5 A;  2QWP A;  3SUN A;  2HMI A;  1U6Z A;  1BA0 A;  3AVI A;  5LL6 Z;  2QWQ A;  4AM7 A;  5E26 A;  3SUO A;  1W7A A;  1TUY A;  4NB4 A;  2Q97 A;  3TAM A;  1IKX A;  1TYQ B;  2BDP A;  2ZE2 A;  3KD5 E;  2GV9 A;  2O8D A;  3MN7 A;  4LSN A;  1A5W A;  3WEE B;  4AH9 A;  1JCF A;  5BR9 A;  1BI4 B;  2O8F B;  1VRU A;  1UA1 A;  2R7Y A;  4JKA A;  4BR5 A;  5M1O A;  2WOM A;  1BIZ A;  4KH6 A;  1RT6 A;  5B8H A;  3THW B;  3H3O B;  1N5Y A;  3NVK A;  1SL2 A;  3M8S A;  4YOU A;  4DV5 K;  3TAQ A;  3QB0 A;  4B1W B;  2NRR A;  1LAV A;  3SYZ A;  3PX4 A;  2F8S A;  2GUP A;  5GAD P;  4EP5 A;  5AJ3 K;  2W40 A;  1RTD A;  2UXB K;  1M1K O;  1EQY A;  3LAM A;  3TTF A;  4K8Z A;  3T7Z A;  2IVO A;  2GWK A;  4KV8 A;  4CHY A;  4GY2 B;  5LMN K;  3ZSO A;  3PV8 A;  2ZF5 O;  4FWR A;  4JS4 A;  5A2Q O;  3K9J A;  2HMP A;  5AQK A;  3TWH A;  2OYQ A;  3CME N;  1VSD A;  5AQL A;  1TVR A;  3AA2 A;  4W5R A;  1KSP A;  4GV9 A;  4EZ9 A;  4M3X A;  4OGC A;  4ILH A;  4Z4G A;  4OKJ A;  1T05 A;  4DQI A;  3E9L A;  4IFE A;  5C12 A;  3AO4 A;  3G10 A;  2KZZ A;  4F2R A;  3ATV A;  1QZ6 A;  2E2O A;  4EHU A;  2IVP A;  2HST A;  1GLL O;  2XY8 A;  4DFJ A;  3U3Y A;  5FLX O;  4KTQ A;  3AVB A;  3K58 A;  4FPB A;  5AQS A;  1NK9 A;  5ADX H;  2O4I A;  1L3U A;  4KRF A;  4E0D A;  4BR4 A;  4JI0 K;  4YOX A;  5JS1 A;  3AO5 A;  1DTQ A;  1LWE A;  5M1Q A;  1W97 L;  1HQE A;  4V19 S;  2VG5 A;  1J54 A;  2PAV A;  4JK9 A;  5KGW A;  3HST B;  4KHW A;  1XQS C;  2VYP A;  3SJH A;  3RMB A;  1HYZ A;  5GIN A;  3K59 A;  1HLU A;  1N6Q A;  4FLX A;  4FYD A;  5AQO A;  4DR1 K;  3E01 A;  2JLE A;  3U9Z A;  3M1F A;  3DMJ A;  3PSI A;  5J2Q A;  1SS6 A;  5HRR A;  4DFP A;  3DRR A;  4DV1 K;  5AQM A;  4YOV A;  2IC3 A;  5J2P A;  3QIN A;  5BPN A;  1XNR K;  4Z0U A;  3VEW A;  4UY8 O;  3AVL A;  4MO5 A;  3QNO A;  5MLC Q;  1TAU A;  3CD6 N;  5GAG P;  3HBT A;  3SLC A;  1WB9 A;  4OLA A;  4H0O A;  4BRP A;  5FRM A;  4OPJ A;  5EY4 A;  1DTT A;  4O4G A;  3RR7 A;  2YHB A;  4I6M B;  4PL7 A;  4HHT A;  4W5N A;  2E1Y A;  2BAN A;  4JS5 A;  3CM6 A;  3I55 N;  1TYQ A;  3OHR A;  1RBT A;  3UKU B;  3EZW A;  3QEV A;  1TKD A;  4KTW A;  1KFS A;  4B9U A;  1NGD A;  3KK3 A;  2YJF A;  3FGU A;  3HPH A;  4KH4 A;  4AHR A;  3OS1 A;  4B9T A;  1XNQ K;  3WEE A;  2HHW A;  3C7N A;  1BI4 A;  2QI2 A;  2O8F A;  2UYT A;  3R1X A;  5AFU H;  1NGH A;  4FZZ A;  1RT3 A;  1SZ2 A;  4BRN A;  4B3R K;  3W0L A;  3MDQ A;  3THW A;  2HHX A;  1QE1 A;  1DGK N;  4FCY A;  3DJC A;  3LDS A;  1YIT N;  3KZB A;  1ITG A;  3LP3 A;  4LF4 K;  5JS2 A;  1RTJ A;  4CZI A;  3HRG A;  2FSK A;  3DLR A;  3TU5 A;  1Q86 O;  1RDC A;  3NHG A;  4DLG A;  5EX5 A;  3OYJ A;  5EOY A;  1VQN N;  2FBT A;  4KHS A;  4OO1 J;  4KPY A;  5AQI A;  4JI4 K;  3L0Q A;  3RMD A;  1M90 O;  3SMS A;  2O8B B;  1SKS A;  1LOT B;  2F8T A;  1Q18 A;  3S9H A;  3OA9 A;  4FL9 A;  4IDH A;  1EO1 A;  1YAG A;  3V1Q A;  4I2Q A;  3NGI A;  1SL0 A;  4RW9 A;  3T3F A;  3PX0 A;  2GEL A;  5AQY A;  2O8C A;  2E2Q A;  3O9U A;  1EP4 A;  4CGI A;  2VG7 A;  2VG6 A;  4DV7 K;  4DTO A;  4CBU A;  2YX6 A;  4Y0W A;  4FJM A;  1C0T A;  2ZGZ A;  4BRF A;  4OPK A;  2RN2 A;  5FRO A;  1BIU A;  3KHY A;  5C25 A;  4FW2 A;  4Z4E A;  1ATN A;  3S3M A;  4YOT A;  2B5J A;  5SZT A;  3AA4 A;  4BAC A;  2G8U A;  1FK9 A;  4HCC A;  4CJV A;  3P38 A;  3T1H K;  3BEX A;  3OYM A;  2QWN A;  4GNI A;  5KPZ A;  1KQS M;  2LSN A;  3RSE B;  2X6N A;  4A57 A;  3O6W A;  3V1R A;  4GVE A;  4KFB A;  5HRP A;  3P31 A;  4FJ8 A;  3KD1 E;  5E41 A;  5HL7 L;  4WQ4 A;  4FJH A;  4LFC K;  3RVC A;  4KHY A;  3K5L A;  2W42 A;  3C94 A;  4M3T A;  4FWP A;  1EX4 A;  3AVN A;  4A2B A;  1DKG D;  4IDK A;  4KHP K;  1SL1 A;  3UKR B;  1K8A O;  4I6M A;  3P5J A;  4NYF A;  1WSG A;  1OKJ A;  3ZSR A;  3CFR A;  4E3S A;  2RF2 A;  1XWL A;  2OA8 A;  3RR8 A;  4O8K A;  1BIS A;  3LP1 A;  1HKG A;  4ISG A;  4IZ9 A;  4CEC A;  3THX B;  1VHX A;  3UKU A;  2PFU A;  1W9H A;  2HHS A;  3N4P A;  4JD2 B;  3VOV A;  1S1U A;  3SAH A;  3F5T A;  3EY1 A;  5IWA K;  4BRH A;  2ZQB A;  3IMX A;  4RG8 A;  2Y1J A;  2E6M A;  3WXI A;  1FW6 A;  4CJW A;  3AAQ A;  3KWG A;  4LF9 K;  4DR6 K;  1Q7Y O;  4RWT A;  1REV A;  1WAF A;  1X9J A;  5AQX A;  1NK0 A;  1A5X A;  4YOR A;  1WLJ A;  1XUP O;  3N4Q A;  3K9K A;  4DB3 A;  2P5G A;  4O0J A;  2VGN A;  2E6L A;  3B8A X;  3TSQ A;  1V4T A;  1WSF A;  1C1B A;  4KKO A;  4WCE L;  3VTI A;  3CCV N;  2P9L B;  1R0A A;  5FPD A;  2XHB A;  5J2M A;  2P5O A;  4WQ5 C;  1NGF A;  3WNF A;  3BZK A;  4M63 C;  3RTV A;  1VQ4 N;  4O8U A;  4DF4 A;  1NMD A;  3CCJ N;  3VQ9 A;  1VQK N;  3ZT2 A;  1QZ5 A;  5AFU A;  2UXC K;  1WSI A;  4LFB K;  4DQP A;  1IBM K;  4F8R A;  3DI6 A;  1NKE A;  1BCM A;  1QHA A;  4JI5 K;  4L8R B;  2O8B A;  2QWL A;  2UXD K;  3BP8 A;  2FC0 A;  4A5A A;  5C42 A;  3O3F A;  3L2W A;  2P9U B;  4CFD A;  1TK0 A;  1JCG A;  4FWK A;  1RFQ A;  3HZ6 A;  2G8W A;  2HND A;  2NLX A;  3SPY A;  4BVP A;  2VWB A;  1YT3 A;  5KPT A;  4GKK K;  2YKN A;  3NF8 A;  2OCE A;  1KVA A;  1YXQ A;  2Q3S A;  1WUA A;  3M5R A;  3WNG A;  4FSV A;  1X1P A;  3CET A;  3J8A A;  3NCI A;  5BPM A;  3V9U A;  2IGI A;  4B9L A;  1U45 A;  1S6Q A;  1SV5 A;  4FK0 A;  1EWR A;  4BRQ A;  4CIE A;  2UUC K;  4CEB A;  5E84 A;  3VN5 A;  1NNE A;  2A5X A;  4KB0 A;  3V4I A;  3AV9 A;  5C24 A;  1HPZ A;  1LWC A;  3I0S A;  3MEE A;  3RSE A;  3SV3 A;  4H0X B;  3ITH A;  4F3O A;  5GIO A;  3OYL A;  3VQ4 A;  3HL8 A;  3HP6 A;  1D9D A;  3FZF A;  3R9P A;  4CBX A;  4FWN A;  4BR0 A;  1A5V A;  3TAN A;  2DFH A;  4LSL A;  2FSN A;  4PQU A;  5HP1 A;  3DRS A;  4HUF A;  4E7L A;  3P1G A;  1RT1 A;  3TTD A;  5HOO A;  1ZBU A;  1C1C A;  4H5W A;  5KPR A;  1O1W A;  4NCA A;  3VPZ A;  4FZX C;  3PLA A;  1CXU A;  3THX A;  3C65 A;  2D0A A;  3E9O A;  1XMO K;  4OLB A;  4CJK A;  3OYF A;  2ASP A;  1HNX K;  2RE2 A;  4BRK A;  1HJO A;  2O8D B;  3NF7 A;  4YDU A;  2IS3 A;  4F2S A;  2QKB A;  3MEC A;  2GWJ A;  2QWR A;  3F73 A;  3EYZ A;  5LJW A;  1S6P A;  1JL1 A;  4FO0 A;  3WQU A;  4R79 A;  1NJX A;  4H0V B;  4IEI A;  4CHN A;  5AZI B;  2KFZ A;  4ID1 A;  5AQZ A;  4CD1 A;  2YNH A;  3FE1 A;  1P90 A;  1C0G A;  1TKX A;  5LMU K;  1E3M A;  2HOE A;  3DOL A;  1OH5 A;  4BRO A;  3E66 A;  3S3N A;  3F9M A;  1RTH A;  3CER A;  2P9L A;  3EN9 A;  4CJ5 A;  3I8D A;  4C1N K;  4DTU A;  2CGK A;  1VK0 A;  3ASM A;  5JVH L;  2NRZ A;  4CI6 A;  1X9S A;  2BGG A;  5KQD A;  2OTL N;  5LY3 A;  4M41 A;  3C95 A;  4CGJ A;  2YHA A;  4CW7 B;  4RCH A;  1GLD G;  5BR8 K;  1HQU A;  1TKZ A;  2Q31 A;  1KVC A;  5KGX A;  2HHU A;  2P9U A;  3S41 A;  3HJF A;  4FLY A;  5D3G A;  4JAX A;  4AF1 A;  2IDO A;  3U4L A;  4NLC A;  2CGL A;  2A41 A;  1ZYQ A;  4H5T A;  1OH8 A;  3LAK A;  2ETJ A;  4DF8 A;  1E4F T;  3MN9 A;  4Y1C A;  3OYK A;  4CF8 A;  3TAE A;  1S9G A;  1GLB G;  1YUW A;  1TK5 A;  4IWV A;  4O55 A;  3H6E A;  3VQ6 A;  3V1O A;  2F9W A;  3J81 O;  4CHP A;  2FF6 A;  2P9P B;  3NGY A;  1B9D A;  3IFR A;  1JLC A;  1GLA G;  3HTV A;  2QTD A;  2JGU A;  1KAZ A;  4BE2 A;  4BRG A;  4EP4 A;  4ELV A;  2ASM A;  2KQ2 A;  4H8K A;  4H5R A;  3OYN A;  1VQO N;  1L3V A;  3CXC M;  3K5M A;  1FKO A;  4DTJ A;  5DM7 L;  2HF3 A;  1MWK A;  3FFK B;  4ISF A;  1CZ9 A;  3LDQ A;  5BN8 A;  4YHH K;  2HBJ A;  4CFC A;  4FPA A;  1RTI A;  4AHS A;  3PIO L;  3D2E B;  2QK9 A;  1SAZ A;  4F3T A;  4BC4 A;  2WON A;  4H03 B;  4MLE A;  4BQL A;  1GLJ O;  3VEN A;  2I7N A;  2Z1J A;  1NGJ A;  4U7B A;  3W3D A;  4IG0 A;  3KLH A;  4JRQ A;  4RTF D;  3SK3 A;  3C7N B;  4OPA A;  5JMV A;  1D8Y A;  4CIF A;  5DK5 A;  3O9S A;  3WXM B;  1BQM A;  3O08 A;  4CF0 A;  3VQC A;  3EE8 A;  1RNH A;  5AZI A;  4F4K A;  4Z4I A;  3IAY A;  1TAQ A;  4B1Y B;  4FWM A;  1SKW A;  3DYA A;  2XY6 A;  2OPQ A;  4FK4 A;  4WFN L;  3L3U A;  1E4G T;  1WSE A;  3A2F A;  3HXM A;  4K43 A;  1BUP A;  1SUQ A;  1C0U A;  4CD3 A;  4ELU A;  2VWJ A;  1BU6 O;  1NU0 A;  2FXU A;  1CXQ A;  4XIU A;  3I0R A;  4FJG A;  4MO4 A;  2BTF A;  1HJR A;  1ZBI A;  5CE3 A;  3OVN A;  1HUX A;  4CEO A;  3CHW A;  1ASU A;  4JKD A;  1RDA A;  3SUQ A;  1VSM A;  4BRC A;  1Y64 A;  4H5V A;  1NGE A;  1HYS A;  1JLB A;  4CK3 A;  2YNI A;  3BUZ B;  3LP0 A;  3EKU A;  2QKK A;  3SQ0 A;  1ZXO A;  3VQ8 A;  1YTA A;  3AVK A;  4JI1 K;  2O8C B;  1S9E A;  4CEA A;  4CCH A;  4IJA A;  4NXN K;  3OBW A;  2X74 A;  3AVF A;  3VQP A;  2HBL A;  3LDL A;  3K57 A;  1HX1 A;  1YJ9 N;  3ATU A;  4DTX A;  1QSY A;  4B3M K;  2X78 A;  3VER A;  1RT5 A;  1XC9 A;  4KHU A;  1GOA A;  3LDP A;  1CZB A;  3O4Q A;  3CC2 N;  2P9P A;  2HB5 A;  1CZA N;  4C8K A;  3AVG A;  4O0I A;  4FWL A;  4IG3 A;  4JK7 A;  4CJF A;  4DV4 K;  4J2A A;  4AHT A;  3G0Z A;  1Y97 A;  4OJR A;  4I2P A;  4KHN A;  1KC8 O;  3T1Y K;  1U2V A;  4H0Y B;  4AIL C;  1SKR A;  4DTP A;  1NJW A;  1JLA A;  3T19 A;  4EHT A;  3SAF A;  3D2E A;  4N76 A;  1XC3 A;  3CMA N;  3HOS A;  5K14 A;  4YOY A;  4JKH A;  5HRN A;  4JYA K;  2Q2R A;  3ZSW A;  2D0O A;  1J53 A;  4QCL A;  4Z4C A;  1YF5 L;  4M7X A;  2V7Y A;  3AVC A;  1ESV A;  2CH5 A;  1VQL N;  3CCS N;  1TUU A;  3LDO A;  2NZT A;  5CR4 A;  1VQP N;  1YI2 N;  2AJQ A;  4BDZ A;  4CJS A;  3VTH A;  2NNW A;  4X65 K;  4JNE A;  5FPN A;  4JHD B;  2DFF A;  4CK2 A;  4E1M A;  3CJ9 A;  3ULE B;  3QLH A;  5GIP A;  3BGR A;  3ZSX A;  1VSK A;  1JXB A;  1RBU A;  3E9P A;  3OYH A;  3TR8 A;  5J2N A;  2P9N B;  4DR2 K;  3CYM A;  4B08 A;  4AHU A;  3KIO A;  1RT7 A;  3LZJ A;  5AQH A;  3I33 A;  4LF8 K;  3OYE A;  3CFO A;  3WNE A;  4GVM A;  1TK8 A;  3CCE N;  3TAG A;  3JAM O;  3PSF A;  4Q5V A;  2E1Z A;  4IFV A;  4JEP A;  1HNI A;  4C23 A;  3MXI A;  5AQJ A;  1WOQ A;  1TV6 A;  3T69 A;  3IG1 A;  3KK2 A;  2HW3 A;  4DQQ A;  4NXM K;  1S5J A;  4CHQ A;  1RBS A;  4IOX A;  4BG9 A;  1NJZ A;  2NRV A;  4I9L A;  3VQA A;  4WQ5 A;  1RDU A;  5M1F A;  1VQ9 N;  4PL8 A;  1VSL A;  1BG3 A;  3SBG A;  4AM6 A;  2ZJQ L;  4RW8 A;  4YY3 K;  3CF5 L;  1WSH A;  4CJT A;  3OYC A;  4CZL A;  2Y1I A;  3O3G A;  3CCL N;  3VQB A;  3PY8 A;  1NK6 A;  2EX3 A;  3OS2 A;  3LP2 A;  3DOK A;  1DT9 A;  4IXC A;  5HRS A;  3KLF A;  4RW4 A;  2FLO A;  5C2D A;  5J1E A;  2G8F A;  2P9K B;  4JI8 K;  2CGJ A;  4DTS A;  2J4R A;  3K2P A;  5DMR A;  3MK6 A;  4CZF A;  4FVU A;  3AGR A;  1YTU A;  3P39 A;  2NRT A;  3FFI A;  3L2V A;  1HRH A;  4DV0 K;  3U6F A;  3P4I A;  3MAQ A;  1F21 A;  1IBK K;  1FKP A;  2PBD A;  3TPQ A;  4FM2 A;  3CM5 A;  1VQ5 N;  3G71 N;  1LAW A;  5ADX A;  4KRE A;  4OVL A;  1LW0 A;  2A1S A;  3SQ2 A;  4FOI A;  3H08 A;  1IG8 A;  1J6Z A;  4MFB A;  2OZS A;  4Z4F A;  3DLL L;  2HBK A;  1XHX A;  1Q9X A;  2YNF A;  4FJN A;  3DAW A;  3CCR N;  4M3Y A;  3L2Q A;  2FBX A;  3EL2 A;  3QFU A;  1ASV A;  2YHW A;  2ITG A;  1T03 A;  5KRT A;  3FZK A;  3MX2 A;  5FPM A;  1NKC A;  4J2B A;  3ZLJ A;  4A59 A;  2E8A A;  3AY9 A;  5H1S Q;  2NRH A;  1ZBF A;  3IKM A;  2ATQ A;  3BY5 A;  1L3T A;  3OBY A;  3G4S N;  1C0M A;  3K5N A;  2OAN A;  1NLV A;  3UE5 A;  4CBW A;  2B6A A;  3KK1 A;  3NH0 A;  4MDB A;  4O44 A;  4JHD A;  2QXL A;  1GLF O;  4NYN A;  4JKC A;  3CJ1 A;  3ULE A;  2WC9 A;  1C0F A;  4LH5 A;  3NH2 A;  1RBR A;  1P8Z A;  1VAZ A;  3A5O C;  4M3W A;  4DTR A;  2KZM A;  3PO4 A;  1NK4 A;  4FJ9 A;  2P9N A;  3QBX A;  2IIR A;  4ZHR A;  4AQY K;  3H1Q A;  5FPE A;  3OYI A;  3R8E A;  4KBO A;  2ITM A;  4B3T K;  3QET A;  3ALY A;  4CES A;  4JLH A;  3VMF B;  3DLG A;  1NK7 A;  3SQ1 A;  1Q9Y A;  1T3V A;  1NM1 A;  1QS4 A;  4A62 A;  3NE6 A;  5AQT A;  2BH1 A;  2WUS A;  3VEO A;  4DSJ A;  3EZ5 A;  3F2K A;  3CJC A;  1OH6 A;  4LD0 A;  3TI0 A;  2OZM A;  3QBW A;  1NGI A;  1BL3 A;  3V9X A;  3B6P A;  4H5N A;  3NBP A;  5AZJ A;  1QQO A;  3SUP A;  4DSK A;  4ILG B;  3OY9 A;  2QW9 A;  4Z94 A;  4JI3 K;  3F9K A;  3CG7 A;  3MN5 A;  1JLE A;  2KHO A;  4B9S A;  4IO9 L;  1T7P A;  1W0H A;  3MCA B;  2RPI A;  4N5S A;  4B9M A;  4CZJ A;  4HTL A;  2WTU A;  5BRH A;  2P9K A;  4C8O A;  4CJR A;  3ZT3 A;  5JLF A;  1LV5 A;  1G99 A;  1T8E A;  3O9Q A;  4DSF A;  1BQN A;  3QEP A;  1BWF O;  2YHX A;  1YJN N;  2NRW A;  4C1N I;  2W6L A;  3PIP L;  5FRN A;  1HMV A;  1K8K B;  3CQY A;  3IUC A;  3V6D A;  2UU9 K;  4DU4 A;  1JLQ A;  1VQ6 N;  4CZK A;  4FLV A;  1ASW A;  3U3G A;  4WQ4 C;  4KI4 A;  4CEQ A;  3ZCM A;  3ZYY X;  5BRE A;  1WBB A;  3AVH A;  1N32 K;  2ZGY A;  5KTQ A;  3EO3 A;  4BDP A;  3AVM A;  4FLU A;  2D0C A;  3HSC A;  1N8R O;  4KAZ A;  1NWK A;  1JLG A;  2UUA K;  2GBZ A;  1H1V A;  5AR0 A;  3ENB A;  3OYD A;  1IKW A;  1O13 A;  2BE2 A;  4DR4 K;  2D1K A;  1X9W A;  3R3L A;  1IBL K;  1OVQ A;  5HLF A;  1S1T A;  2E20 A;  1S1V A;  4BWJ A;  2QM1 A;  2YJE A;  4YOW A;  4XH1 A;  1JCE A;  1T6C A;  3CCQ N;  4JK8 A;  3DWL A;  1QQM A;  3THV A;  1BDG A;  3SAG A;  4WF9 L;  4HVJ A;  4FM0 A;  2E5L K;  2XRI A;  4DG1 A;  1KVB A;  1RCH A;  5TKY A;  3SV4 A;  1ZC6 A;  4MDA A;  2Q36 A;  3LZI A;  1YHQ N;  3LWM A;  1EET A;  1HPM A;  4DKW A;  1EKE A;  1B92 A;  2QEX N;  5GAH P;  1NBW A;  4BR9 A;  4CED A;  3M8Q A;  4CJU A;  2F96 A;  3ZEU B;  4FJK A;  3D45 A;  3KKS A;  5AQP A;  5HRO A;  4HTU A; 
#chains in the Genus database with same CATH homology
 4E7H A;  1LW2 A;  3V9Z A;  3DLR A;  3SQ4 A;  1CXQ A;  2G8V A;  3AA3 A;  3TAR A;  1S1W A;  3DM2 A;  4XIU A;  1RDC A;  3NHG A;  1X9M A;  4E7I A;  3I0R A;  3QO9 A;  4FJG A;  4ICL A;  3AO2 A;  1L5U A;  4DLG A;  1HJR A;  4CJ3 A;  3OYJ A;  1ZBI A;  4CJL A;  3OVN A;  4AHV A;  4CEO A;  5KI6 A;  1ASU A;  2KW4 A;  3HPO A;  1RDA A;  2FBT A;  2O4G A;  4FLT A;  3SUQ A;  1VSM A;  4JRP A;  1YVU A;  3QEX A;  4KHS A;  3VQE A;  1ZBL A;  3QNN A;  3AO3 A;  3LPT A;  1NKB A;  4KPY A;  2G8I A;  4TSX A;  3KLG A;  2FBV A;  2X6S A;  4R5P A;  1NK5 A;  3RMD A;  5HBM A;  1HYS A;  1JLB A;  2XY7 A;  3SNN A;  1SKS A;  4CK3 A;  2IAJ A;  2YNI A;  3LAL A;  4PY5 A;  3LP0 A;  3VQ5 A;  2F8T A;  2QKK A;  3SQ0 A;  3S9H A;  3DLH A;  3VQ8 A;  4E7J A;  4DSE A;  1YTA A;  4FXD A;  4CJ4 A;  3V1Q A;  3VQD A;  4I2Q A;  3AVK A;  4CHZ A;  3NGI A;  1SL0 A;  3HVT A;  3QIO A;  4RW9 A;  3T3F A;  4M3Z A;  1S9E A;  1Q8I A;  5I42 A;  4CEA A;  4CCH A;  3PX0 A;  3MXM A;  4CER A;  3HYF A;  1BCO A;  5T7B A;  2X74 A;  3AVF A;  3VQP A;  3HT3 A;  3K57 A;  4B8C A;  1EP4 A;  3IRX A;  4CGI A;  4LH4 A;  2VG7 A;  2VG6 A;  4B8A B;  2OZS A;  4DTO A;  1DLO A;  4CEZ A;  4FJM A;  1C0T A;  4OPK A;  1KCF A;  2RN2 A;  5FRO A;  4HUE A;  4DTX A;  1QSY A;  1BIU A;  2X78 A;  5C25 A;  1RT5 A;  3ZSQ A;  4FW2 A;  1XC9 A;  4KHU A;  1GOA A;  4E1N A;  4Z4E A;  1CZB A;  4YNQ A;  3O4Q A;  4DSI A;  3S3M A;  4CF2 A;  3OJS A;  2B5J A;  1L3S A;  5SZT A;  2HB5 A;  3VQ7 A;  3ZT0 A;  2P1J A;  3AA4 A;  4BAC A;  2G8U A;  4CJP A;  1FK9 A;  1IG9 A;  1QTM A;  4CJV A;  4FLW A;  3JYT A;  1NK8 A;  4C8K A;  4HCC A;  3AVG A;  4O0I A;  4M45 A;  3OYM A;  4CEF A;  4IG3 A;  4CJF A;  2QXF A;  3HM9 A;  2LSN A;  3KLI A;  2X6N A;  4J2A A;  4RW7 A;  1KLN A;  2KFN A;  4AHT A;  3G0Z A;  1Y97 A;  3MEG A;  2HVH A;  4Q0B A;  4OJR A;  4I2P A;  3V1R A;  3DRP A;  3VQQ A;  4KHN A;  4N41 A;  4KFB A;  5HRP A;  1NJY A;  4CK1 A;  4FJ8 A;  3KD1 E;  5E41 A;  4FJH A;  4PA1 A;  4AIL C;  1SKR A;  4KHY A;  1U49 A;  4DTP A;  1NJW A;  1JLA A;  3K5L A;  2Z1G A;  3T19 A;  2W42 A;  3C94 A;  3RRH A;  4M3T A;  4NCB A;  4CGG A;  4M3U A;  4OKK A;  4N76 A;  1NOY A;  3PO5 A;  1EX4 A;  4WE1 A;  3SCX A;  2KTQ A;  3AVN A;  1K6Y A;  4I7F A;  3L8B A;  3RMC A;  4IDK A;  2FBY A;  5K14 A;  4FM1 A;  4CFB A;  1SL1 A;  2PZS A;  4J2D A;  3DLK A;  5HRN A;  3QEW A;  3ZSW A;  2HNZ A;  3P5J A;  1C6V A;  1J53 A;  1WSG A;  4NYF A;  3ZSR A;  3CFR A;  2ZD1 A;  4E3S A;  4QCL A;  4Z4C A;  3ZT1 A;  3SJJ A;  3QEI A;  1QSS A;  2RF2 A;  1XWL A;  2OA8 A;  4EZ6 A;  3D0P A;  3RR8 A;  4C8L A;  1BIS A;  3LP1 A;  3AVC A;  4CEC A;  4DS5 A;  1TGO A;  3ISN C;  3ZSY A;  4QOZ B;  1W9H A;  3SPZ A;  1U48 A;  4OGE A;  2HHS A;  2AJQ A;  4FJ5 A;  1IKV A;  1S1U A;  4J2E A;  4BDZ A;  3EY1 A;  2Z1I A;  4CJS A;  4DTM A;  2ZQB A;  2XO7 A;  4FJ7 A;  4RG8 A;  2HHT A;  4CEE A;  2Y1J A;  2DFF A;  3T1A A;  1I3A A;  2E6M A;  4CK2 A;  4DU3 A;  4E1M A;  4CJW A;  1VSF A;  4ZTF A;  1TK8 A;  3QLH A;  2YKM A;  3DLE A;  3BGR A;  3ZSX A;  1REV A;  1VSK A;  1JXB A;  1RBU A;  1WAF A;  4FK2 A;  1NK0 A;  4KI6 A;  1A5X A;  3OYH A;  1WLJ A;  3TR8 A;  2DFE A;  5J2N A;  5CYM A;  1CLQ A;  2P5G A;  3CYM A;  4B08 A;  4AHU A;  4O0J A;  3KIO A;  1RT7 A;  4OKE A;  3LZJ A;  3RMA A;  2P51 A;  2E6L A;  4B9V A;  4IFY A;  1WSF A;  4O5B A;  5CYQ A;  3OYB A;  1C1B A;  4C8N A;  4FJI A;  2HHQ A;  4KKO A;  2D5R A;  4IKF A;  3OYE A;  3CFO A;  1IO2 A;  4GVM A;  4H4O A;  1VSE A;  3WNE A;  3KLE A;  2XHB A;  4E7K A;  4YFU A;  4DTN A;  4W5Q A;  5J2M A;  3B6O A;  3AVJ A;  3L3V A;  1G15 A;  3WNF A;  3NFA A;  3RTV A;  4KTZ A;  4NCG A;  4CGH A;  3TAG A;  4Q5V A;  3UIQ A;  4M3R A;  4IFV A;  4DF4 A;  1HNI A;  3LAN A;  4BE1 A;  3MXI A;  4PUO A;  3VQ9 A;  1TV6 A;  1BGX T;  3ZT2 A;  3IG1 A;  3KK2 A;  3OS0 A;  3M8P A;  2HW3 A;  1QQC A;  1WSI A;  4DQQ A;  1S5J A;  4DFK A;  4CHQ A;  4DQP A;  1RBS A;  3QES A;  1NJZ A;  4I9L A;  2D0B A;  3NDK A;  4F8R A;  3DI6 A;  1NKE A;  3VQA A;  4DQR A;  1BCM A;  4L8R B;  1WN7 A;  2A1R A;  4FW1 A;  1VSL A;  4W5T A;  2FC0 A;  4KO0 A;  4RW8 A;  1WSH A;  5C42 A;  2VWK A;  4CJT A;  3O3F A;  1WSJ A;  3L2W A;  3OYC A;  3V9W A;  1TL3 A;  4CFD A;  1J5O A;  1TK0 A;  4HCB A;  3KJV A;  2Y1I A;  3KKR A;  3O3G A;  3L2U A;  3SI6 A;  2HND A;  2G8W A;  3VQB A;  3PY8 A;  1UWB A;  3SPY A;  3V81 A;  1J9A A;  1YT3 A;  1NK6 A;  2EX3 A;  3NF6 A;  3RWU A;  2YKN A;  3NF8 A;  3LP2 A;  4CHO A;  3OS2 A;  1KVA A;  3DOK A;  5HRS A;  4G1Q A;  1GOB A;  3PUF A;  2Q3S A;  4RW6 A;  3KLF A;  1U04 A;  4B3O A;  4RW4 A;  3WNG A;  1X1P A;  3WNH A;  4FZY A;  5J1E A;  1HYV A;  3AA5 X;  2G8F A;  4PWD A;  3NCI A;  4FJJ A;  1LWF A;  2IGI A;  3V9U A;  4CJE A;  4B9L A;  4DTS A;  1U45 A;  1S6Q A;  2E4L A;  1SV5 A;  4CJQ A;  4FK0 A;  4KB1 A;  3K2P A;  4CIE A;  5DMR A;  4CEB A;  3M8R A;  1YTU A;  2OPR A;  1HNV A;  1KFD A;  4FJL A;  1WNS A;  3LWL A;  3VN5 A;  1KTQ A;  4BE0 A;  4H4M A;  3FFI A;  1RIL A;  4CIG A;  3O3H A;  1QSL A;  3L2V A;  1HRH A;  3U6F A;  4CF9 A;  3MAQ A;  4FJX A;  4KB0 A;  5EU7 A;  1TKT A;  3V4I A;  3AV9 A;  5C24 A;  1F21 A;  4DLE A;  1RT2 A;  1HPZ A;  4I9Q A;  1LWC A;  1FKP A;  3I0S A;  3MEE A;  3SV3 A;  4DS4 A;  3ITH A;  4F3O A;  4FM2 A;  3CM5 A;  1LAW A;  3OYL A;  3VQ4 A;  1Z25 A;  2RKI A;  3HL8 A;  4ELT A;  4KRE A;  4OVL A;  1LW0 A;  2A1S A;  2EHG A;  3SQ2 A;  3H08 A;  3HP6 A;  1IH7 A;  1D9D A;  1KRP A;  4E89 A;  1QHT A;  2OPS A;  4MFB A;  4DU1 A;  1WAJ A;  1RBV A;  2NUB A;  5KRS A;  3NF9 A;  4FVM A;  1A5V A;  1VRT A;  2DFH A;  3ULD A;  3TAN A;  1S1X A;  1XHX A;  1Q9X A;  4Z4F A;  2YNF A;  4LSL A;  4FJN A;  3QIP A;  1NOZ A;  3HP9 A;  4PQU A;  4M3Y A;  3L2Q A;  4C8M A;  2FBX A;  3ZSV A;  4N56 A;  5HP1 A;  1ASV A;  4MQ3 A;  2ITG A;  1T03 A;  3DRS A;  5KRT A;  4HUF A;  4E7L A;  4M42 A;  3K5O A;  1RT1 A;  3P1G A;  1NKC A;  2PY5 A;  4ID5 A;  1ZBU A;  4FLZ A;  2G8K A;  1C1C A;  3AVA A;  4J2B A;  5I3U A;  3SUN A;  1O1W A;  2HMI A;  4NCA A;  3AVI A;  4FZX C;  1CXU A;  1ZBF A;  2ATQ A;  3NGZ A;  2D0A A;  1GOC A;  3SUO A;  3VA0 A;  1L3T A;  4OLB A;  4CJK A;  3TAM A;  3OYF A;  4LY7 A;  1MU2 A;  1IKX A;  2HNY A;  1C0M A;  3NF7 A;  3K5N A;  2BDP A;  2ZE2 A;  3S3O A;  2IS3 A;  4CGF A;  3NH1 A;  4F2S A;  3KD5 E;  2B6A A;  2GV9 A;  3MEC A;  3KK1 A;  2QKB A;  3NH0 A;  3F73 A;  1RDD A;  4LSN A;  3HK2 A;  4O44 A;  5FDL A;  1A5W A;  4AH9 A;  3EYZ A;  1BI4 B;  2PYL A;  1S6P A;  1JL1 A;  3OJU A;  3AO1 A;  1VRU A;  4NYN A;  1NJX A;  1UA1 A;  2R7Y A;  3PX6 A;  4LH5 A;  3NH2 A;  4CHN A;  2KFZ A;  4CE9 A;  1RBR A;  2WOM A;  4ID1 A;  2HVI A;  2YNH A;  1BIZ A;  3CFP A;  3KTQ A;  1RT6 A;  3HPG A;  3OYG A;  1R0A A;  1TKX A;  1FXX A;  2GUI A;  3OYA A;  4M3W A;  4DTR A;  1N5Y A;  3DOL A;  2KZM A;  1SL2 A;  3PO4 A;  3M8S A;  1NK4 A;  4FJ9 A;  3IS9 A;  3TAQ A;  4IBN A;  4ZHR A;  3OYI A;  3CQ8 A;  3S3N A;  1LAV A;  1RTH A;  3SYZ A;  3QET A;  3ALY A;  3PX4 A;  2F8S A;  4CJ5 A;  5CY4 A;  4CES A;  3I8D A;  4JLH A;  4EP5 A;  3DLG A;  4DTU A;  3SQ1 A;  1NK7 A;  1RTD A;  1VK0 A;  3ASM A;  1Q9Y A;  3LAM A;  1QS4 A;  3NE6 A;  1X9S A;  4DSJ A;  3EZ5 A;  4K8Z A;  2BGG A;  4GW6 A;  4UQG A;  4B9N A;  4LD0 A;  3TI0 A;  4CHY A;  4KV8 A;  4M41 A;  2OZM A;  3ZSO A;  3PV8 A;  2DY4 A;  1BL3 A;  3C95 A;  1D9F A;  2VWJ A;  4JS4 A;  4CGJ A;  3V9X A;  3B6P A;  2YHA A;  3TWH A;  3NBP A;  2OYQ A;  3V9S A;  4E19 A;  1BHL A;  3SUP A;  1VSD A;  4DSK A;  3C6U A;  1HQU A;  1TVR A;  1ZBH A;  3AA2 A;  5CZ1 A;  4W5R A;  1KSP A;  2YNG A;  4EZ9 A;  1TKZ A;  1KVC A;  5KGX A;  4M3X A;  3OY9 A;  4OGC A;  4HUG A;  3F9K A;  4OKJ A;  1T05 A;  4Z4G A;  3CG7 A;  2HHU A;  4DQI A;  1JLE A;  4AHC A;  1EXQ A;  4B9S A;  2HHV A;  3HJF A;  4FLY A;  3AO4 A;  3G10 A;  4DMN A;  3QER A;  1T7P A;  2IOC A;  4KHQ A;  5D3G A;  2KZZ A;  2IDO A;  4F2R A;  1C1A A;  1W0H A;  1ZYQ A;  2I5J A;  1U47 A;  4K8X A;  3LAK A;  4QAG A;  2G8H A;  2RPI A;  2XY8 A;  4DFJ A;  3U3Y A;  2ETJ A;  4N5S A;  1U4B A;  4B9M A;  4DF8 A;  1XHZ A;  4KTQ A;  3AVB A;  3K58 A;  1NK9 A;  1JLF A;  2O4I A;  4Y1C A;  3OYK A;  4CF8 A;  1TL1 A;  1L3U A;  3TAE A;  4C8O A;  4E0D A;  4CJR A;  3ZT3 A;  4KRF A;  5JS1 A;  3AO5 A;  3SZ2 A;  1DTQ A;  1LWE A;  1S9G A;  1LV5 A;  1T8E A;  4Y1D A;  1HQE A;  2VG5 A;  1J54 A;  5KGW A;  4CF1 A;  3HST B;  1TK5 A;  4DSF A;  1BQN A;  4O55 A;  3QEP A;  4KHW A;  1D5A A;  1JXE A;  3VQ6 A;  1JKH A;  4W5O A;  4DFM A;  4BWM A;  3V1O A;  3TAP A;  5FRN A;  4CHP A;  3VA3 A;  3RMB A;  1HYZ A;  1HMV A;  3NGY A;  4Z4H A;  1B9D A;  3V6D A;  4DU4 A;  1JLQ A;  3K59 A;  3TAB A;  1XI1 A;  3P83 D;  1JLC A;  1N6Q A;  4FLV A;  4FLX A;  4FYD A;  1ASW A;  3U3G A;  2JGU A;  4KI4 A;  3E01 A;  2JLE A;  4CEQ A;  4BE2 A;  3ZCM A;  4EP4 A;  4ELV A;  3O4N A;  3AVH A;  3DMJ A;  4ZTJ A;  5J2Q A;  5HRR A;  4DFP A;  2KQ2 A;  3TAF A;  4H8K A;  5KTQ A;  3DRR A;  3OYN A;  1L3V A;  2DTU A;  4BDP A;  2IC3 A;  3AVM A;  4N47 A;  4CFA A;  3K5M A;  5J2P A;  1FKO A;  4DTJ A;  4FLU A;  2D0C A;  3LPU A;  3QIN A;  2OPP A;  4DQS A;  1CZ9 A;  4Z0U A;  4CFC A;  4KAZ A;  3AVL A;  1RTI A;  3QNO A;  1UAX A;  1JLG A;  2YV0 X;  1UA0 A;  1TAU A;  3MED A;  2GBZ A;  4AHS A;  3OYD A;  1IKW A;  2QK9 A;  4DSL A;  3BDP A;  2BE2 A;  3HO1 A;  4F3T A;  4OLA A;  2WON A;  3ZT4 A;  2PYJ A;  3DLB A;  5FRM A;  4OPJ A;  1DTT A;  4O4G A;  2Z1J A;  2P5O A;  3RR7 A;  1X9W A;  2Z1H A;  1KLM A;  2YHB A;  3C6T A;  4IG0 A;  3KLH A;  3JSM A;  4HHT A;  4W5N A;  4JRQ A;  5HLF A;  4DWI A;  1S1T A;  1S1V A;  2BAN A;  4BWJ A;  4JS5 A;  3CM6 A;  3HVR A;  3NAE A;  1RBT A;  2B4J A;  3MXJ A;  1TKD A;  3QEV A;  4B9U A;  4KTW A;  5CZ2 A;  3ZSZ A;  1KFS A;  3KK3 A;  3HPH A;  4AHR A;  3OS1 A;  1D8Y A;  4B9T A;  4CIF A;  3THV A;  3RRG A;  2HHW A;  1BI4 A;  5DK5 A;  5SWM A;  1BQM A;  4CF0 A;  3VQC A;  4FZZ A;  1RT3 A;  4BDY A;  1RNH A;  4HVJ A;  4GMJ B;  4F4K A;  4FM0 A;  3IAY A;  4Z4I A;  4CGD A;  2XRI A;  4DG1 A;  1TAQ A;  1Z26 A;  1KVB A;  1RCH A;  3SV4 A;  1VSI A;  1SKW A;  1JL2 A;  2HHX A;  3DYA A;  3LZI A;  1VSJ A;  1IKY A;  3LWM A;  2XY5 A;  1QE1 A;  1EET A;  2XY6 A;  2OPQ A;  1UOC A;  1VSH A;  1EKE A;  1B92 A;  4FK4 A;  4FCY A;  3L3U A;  3LDS A;  1WSE A;  3A2F A;  1B9F A;  1ITG A;  3LP3 A;  4CED A;  1SUQ A;  1I39 A;  1C0U A;  5JS2 A;  3HXM A;  1RTJ A;  3L2R A;  4ELU A;  3M8Q A;  4CJU A;  1RT4 A;  2F96 A;  4FJK A;  3D45 A;  1RDB A;  3KKS A;  5HRO A;  4HTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...