2EHOD

Crystal structure of human gins complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
182
Chain Sequence
EAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLENAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GINS complex subunit 4
publication title Crystal structure of the human GINS complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 40
structure length 182
sequence length 190
chains with identical sequence H, L
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2ehoD00
3JC6C 2EHOD 3ANWB 2E9XC 2Q9QD
chains in the Genus database with same CATH superfamily
4AKLA 3Q2MA 3NRXA 3FZHB 4K0KT 5JR9B 3RC8A 2PG8A 4O2AE 4PW8A 2ZLYA 3PUAA 2Q9QB 2UXBT 2BS3A 3JC6D 2CRBA 5FY7A 3FXDB 4H63V 3KFWX 4O8SA 5LCYA 2N9DA 3I0QA 2WMOA 3CX6B 2CBJA 1OEDB 1HG5A 3HKCE 2EHOD 1NEKA 3RQUA 2PFVA 2B1EA 5HWXA 5AQQB 5FY1A 4X65T 3J9X1 1FEWA 1KK7A 3MA9A 3ZMZB 3CX8B 2PTFA 3N2OA 3T1HT 4QKNA 4U31A 2LE8A 3O1IA 3RLFF 3QOFA 3ZMTB 4YFSA 4X64T 5AQHB 2VWAA 2MPKA 4UIGA 1HR0T 4DV6T 2WZHA 4DV1T 3FBLA 3AA7B 5HYAA 2IAKA 2KMFA 2CWOA 4QHOA 2C5JA 4I55E 4F8HA 2WMNA 1W0BA 2C5IT 2VQFT 3MK7C 3N9OA 4K0UA 4J2CA 2YK0A 2V7MA 5M4YA 4HN9A 2VVSA 3RGLA 1MIVA 4U7IA 4UVAB 4DV5T 3RYIE 3OKQA 4ISTA 3KDSE 3RIUA 3S4UA 4IE0A 4GIWA 4NIQA 4PAGA 3OTOT 2E9XD 2Y8DA 2WWVA 4YXDA 4EIWA 2E8IA 2KWIB 3AB3B 3MZKB 1D0XA 1FMWA 4P0BA 2IW5B 4NUUA 3HKDE 3HL6A 2WM9A 1E2AA 4QX7B 4ANJA 4CI2B 2LRKA 4HFEA 4YHHT 1HG2A 4YJ2E 3PJAJ 2ZM6T 3PUXF 2IC9A 2W61A 5FVLA 4OYKA 3UU8A 4I0UA 5HEHA 5FXVA 4DNDA 2VASA 1Z0PA 3ANWA 2ZM8A 2A9UA 3CK6A 1S35A 2KZ7B 2HPLA 4IT4A 3OVUA 5KX5E 1UX5A 5CJ5A 2LM2A 2UXCT 3ZN0B 1KNPA 3F31A 3NKZA 3FXEB 4JI1T 5JH7E 2E9XC 4NUVA 3C98B 4YSZA 4AKHA 2A72A 1XWMA 2UUBT 3C51A 3VKHA 3AEEA 3B13A 4ILAA 4YHJA 3WAJA 4U74A 3E0ZA 3P4WA 3X1DA 3ZPOA 4TV9E 4EV6A 2WWUA 4IE7A 2WSSV 5IUXA 3AVRA 3Q9DA 4E7SA 4LFCT 2W67A 2W66A 4JI4T 4ZZBA 1NAFA 4LMKA 3AE2A 3G06A 4U2ZA 4P1NA 3O4XE 2CPTA 1I94T 1SHZC 4ZS2A 1LVFA 3I0OA 2V7IA 3UU6A 4KX6A 1IAPA 4BA9A 3CPZA 4P09A 1CUNA 2IDOB 5IYZE 4IDQA 4LMLA 5LHHB 3L3PA 1IZNB 1D0ZA 4H9SE 3N9PA 3FZFB 3UU3A 5LGTB 2L3LA 3CKDA 5L3GB 4U3CA 4AXPA 4HEAA 2CXFA 1XDPA 3C50A 1Y64B 2DWKA 3RC3A 2XQAA 3TLTA 3E08A 2J62A 4B3RT 1D1AA 2MAWA 3KV4A 5LNKA 3P50A 3ONJA 4EYYR 4L9IA 3PDYA 2MBGA 1UGOA 3LBXA 3CQXC 3UTKA 1D1BA 4A56A 4KHPT 2XQ5A 4YT0A 1VOMA 5ABFB 4Q25A 3FHNA 3EHZA 2D2SA 3DJBA 4BJMA 1QUUA 2OLTA 2XHEB 3LK3B 2K5BB 3Q5DA 3UU5A 3RIUC 4P0AA 1I6ZA 3RF1A 4LF5T 5JDMA 2CXDA 3JADA 3P4RA 2FJDA 2XQYA 2KWHA 3AAAB 2W2UA 2UU9T 2ACXA 4HFIA 4C91A 2X0LB 2XAGB 5JRCA 2RP4A 3I9YA 4YTPA 4HGAA 3ZLIA 1G8XA 2HHHT 4IDPA 3P4SA 2YEVC 2VKDA 3AE3A 1HX1B 1M62A 2J47A 2H7VC 4GOUA 2AXDS 2FBWA 1SA0E 2DHRA 5AQRB 2CBIA 5FYMA 4YTNA 2NOXA 5HEGA 3UT5E 2IHR1 4IHJE 2SPCA 5FXXA 3LK2B 3RHWA 1X9BA 1GQEA 1ZKEA 4H9RC 1Z8UA 4KUMB 4A5XA 3ZCIA 2BG9B 2JIWA 4KBMB 2XAJB 2WZIA 2CE7A 2EHOB 5LA6E 5FY0A 1G73A 3LSVA 2E5LT 4HFDA 3V5SA 1VCSA 3TLSA 1US7B 3MACA 4G63A 3HKBE 3O1JA 2I59A 5HXHA 3AA0B 4B3MT 3A7MA 4JI8T 2F4VT 4O2BE 3CMLA 4AKGA 4DMWA 5FNVE 4X5TA 2E5VA 3ZSSA 1S94A 2FJEA 3BQLA 4UR9A 4DVDA 3UUBA 2V6XA 4PFPA 2V7JA 3NVOA 3UULA 4GYSA 4E7ZA 5JREA 2CXLA 4LFAT 3U78A 3AXJA 3ZMSB 3EVYA 1MMAA 4GKKT 4IL4A 1KFYA 1UX4A 4CXWA 2QA7A 3ZYKA 3Q5EA 2YN6A 1ZEEA 3KV9A 5CGMA 1B7TA 3VR9A 5JR9A 1LRZA 3CQCB 3AECA 3K3NA 2Q9QA 3LFMA 3PUSA 2PBIA 3UUMA 2BKNA 1ZHCA 4QX8B 4NXNT 4ERRA 1ZV4X 1HF8A 4LF7T 2E2AA 2XTLA 5BR8T 4PK4A 2VVNA 4TWFA 4B3ST 1L0VA 5LJMA 5FXZA 2X0HA 1OEDA 2XZEA 4WBNE 2RPAA 5DJQC 3N9NA 4X1KE 5AQMB 4EAHA 3AE6A 2LSGA 3LK42 2M6IA 4EZ4A 2V1DB 3CIRA 3NZQA 1J5ET 2CA5A 2V8SV 4Z8XA 2WB5A 2VK9A 3PUVF 3C64A 3OJAA 2CLYC 3CX7B 1YQ3A 2LEHA 5JDFA 2LSYA 3U3IA 2LSKA 4DO0A 4U2YA 1OXZA 4UVBB 4FI5A 4DR7T 3FBZA 3JAFA 1XMQT 2W00A 3F57A 4UXNB 2JPFA 3PTRB 4IREA 2KNDA 4IE5A 3AEBA 2K9AA 3W15B 4ILCA 2BS2A 3F2EA 5A1LA 2XUEA 4JI5T 3FZKB 3J7Yq 2KSRA 3QB5A 1YD8G 4DV0T 3AE8A 1HX8A 4OHFA 4DV3T 1SUMB 4U33A 4JBWF 1NWMX 1YW0A 3FB2A 2CM0A 3PUGA 3ONXA 2BKOA 2H88A 3CQGB 3BQIA 3ZJ2A 2X9YA 4AQFA 3C4ZA 2N2NA 4PFOA 3PU3A 1AJ3A 2D0UA 1WR6A 2IUBA 5L3DB 3ZT6A 3ETVA 5ABEA 1U4QA 2V7LA 2LOPA 3EI0A 5AQGB 4CQIA 3K8PC 4IE4A 3K3OA 3ZYMA 3IHRA 5BMVE 4KP3C 4TNVA 1ZP0A 3SFEA 4CI3B 1HNZT 5AFUL 5AQUB 4N78D 2MYSA 3M3ZB 4QH4A 2H3RA 3ZT5A 3QC9A 2XAHB 2YDQA 4HWFA 5ABHA 4UF0B 3RIFA 4JI3T 5JDLA 4A97A 4XBFB 3SWHA 2ODVA 3QK6A 3VRBA 3N9QA 2UXDT 2LHNA 4EOZB 1KNZA 4QXHB 4IIJE 4CXXA 2JQKA 4WZXA 4YJ3E 1MNEA 2C0SA 2A2FX 5LP6E 2NR4A 4AIUA 2QYWA 4DUYT 2YOEA 1O3XA 2WCAA 2LOSA 3L09A 2HN2A 4B3TT 5F3JA 3ETUA 5DQVA 2YDRA 4IL9A 4O4LE 3NZPA 5AQKB 2DLRA 2VB6A 5LBQB 5DQWA 1UK5A 2VKHA 1XZYA 1HNXT 1KF6A 2X9XA 4PJNA 2WU2A 2WU5A 4YSYA 5JR9C 4LF6T 2X66A 2Q9QC 3N2GE 2HPJA 1UURA 4DR2T 4WBOA 3IBPA 5FVKA 2WDRA 3MXZA 3ABVA 5KDMC 1OEDC 1WYBA 3TKLB 2MOZA 3DTOA 3RX6A 2X51A 3T8OA 4C90A 2LSJA 2XPKA 3N9MA 3LDQB 3OYXA 3KV6A 2KT9A 4TV8E 2DI4A 4AQYT 5H6QB 5CA0E 3C4XA 2BBHA 4EB6E 3ZN1B 2XQ9A 4IDOA 1U5PA 5ABFA 3CVRA 3ZMUB 3HR0A 2Z6EA 4NXMT 2HH7A 3RYHE 3GN5B 3OYZA 5LG3A 5LGUB 4LF8T 3KBUA 2XQ7A 4QH1A 2HN1A 3P4PA 3RKOA 4LF9T 2K24A 4I4TE 3K3QC 1E7PA 2XM1A 5H6RB 2BDEA 1W09A 2UXNB 3Q5WA 3MKDA 3HKEE 3UFGA 2JMHA 1IBLT 4JI0T 3N9LA 4QXBB 2LJLA 2NTYA 4AQFC 2ZM2A 1D0YA 2VQET 2V6YB 4CXYA 4L5GA 4YTMA 3UQ7A 4HWHA 1M7KA 4HFCA 1VCTA 2YDSA 5EZYE 3LG7A 4DBRA 2B76A 3RRCA 3AA6B 3CWZB 2W0GA 2PJQA 2JJ9A 4X1YE 4F6RC 4ASKA 4AKIA 1HCIA 1MMNA 2BVLA 3KV5A 5L47A 3EDVA 2BS4A 2X9HA 3AAIA 3Q5XA 2BG9A 1W9RA 2LKHA 3N2KE 4TN7B 4YLHA 2EHOA 4I50E 5EK3A 4OX9T 3RPUA 2UUCT 2WDQA 4ILBA 4H9PC 3I9WA 1FMVA 4DR5T 4HFHA 2LSIA 2WDVA 4QH5A 2CHOA 1V9DA 2KINB 4HWIB 2X68A 4KI0F 3NWIA 4ZI3C 1HFAA 4IDZA 3T1YT 3UFEA 3JCFA 2NP9A 4XAXB 2D9DA 5LOVE 4HWCA 5HXCA 5CB4E 1FIOA 5L2LA 4ZS3A 4DR6T 3C4WA 4JYAT 5AQIB 5J1GA 1XMOT 5AQPB 4IGUA 3EDUA 4X66T 2ACZA 4CZZB 4EXTA 2XJ7A 2NW9A 2NWBA 2W4XA 3P4QA 1XDOA 3VHLA 2VKOA 1N36T 1OEDE 3R6NA 3RQWA 1N33T 5FP3A 5LB7B 1BR2A 1SE7A 4GYRA 3SOLA 3OBVE 5DABA 2ZM0A 4HKAA 2OV9A 5HXRA 4BAYB 3E22E 1QSDA 5L4EA 5CFBA 5KXJA 2YKSA 4JEUB 1IJ6A 5AQVB 2G0UA 2WS3A 5LMNT 4OYJA 3AAEB 4DIDB 4AQGA 1HS7A 5HEJA 5JVDE 1BR0A 1JNZA 2E9XB 2WY2A 2LM9A 3RYCE 5L4HA 1BR4A 4ZEYA 3JAEA 2FJBA 2KXPB 1IBMT 3PE0A 2XM2A 4H9NC 3NBXX 2BZBA 2WAUA 3BQKA 1CHUA 1HTJF 1H7CA 2Y48B 5JDHA 3D0TA 3PURA 4QWNB 1QLBA 3QNUA 4HWDA 1UUSA 3VU7H 4UVCB 2RA1A 5JQGE 5E0OA 4U72A 4O4JE 4UV8B 4WW0A 2IIUA 2CEAA 4H9QC 2P9BA 3ZKRA 5L3CB 4WNKA 1KNRA 3PU8A 2L8KA 3KVBA 3FZMB 4X1IE 2CCQA 5GONE 4DBQA 2VL8A 2ODUA 4PNIA 5C8YE 3AE5A 2ZMAA 3ZC0A 3P7IA 3B5MA 1UCUA 1IJ5A 4TNWA 2X0YA 1WCRA 1MMGA 3ZYLA 2YINA 2W63A 4DR1T 4CI1B 2YU2A 4IE6A 5LG4A 5LJNA 2JQ9A 5FL0A 4ADZA 2K48A 5F5WA 3RI5A 5F8PA 3DP7A 2UXXB 4GKJT 2AE9A 4GK5E 3JC6C 4HFVA 4ILUA 5LBMA 2V26A 4H9OC 4JEHB 2JQQA 1MMDA 2XASB 3AEFA 2BG9C 2XQ3A 1BR1A 1Y01A 5L3FB 4BJNA 2EHOC 4PK6A 4UF0A 1VRBA 3P8CD 3AEAA 2BKPA 5LYJE 2XY8B 5EK4A 2DNXA 4QXCB 2R6GF 4U7YA 2Q9QD 4JUYA 4KMCA 2QRXA 5AQSB 2I0MA 1DU2A 2JQHA 2XQ6A 2KLQA 4G2AA 5FXWA 3IA3A 4DR4T 3IEEA 3IF8B 2IC6A 3AE7A 3UUXB 1MIWA 1XNQT 1WYCA 3GMIA 3H37A 1R8IA 3AE9A 1FJGT 5C2TA 3PUQA 5HAXA 4PJMA 1J1JA 4ZOLE 4JI6T 3HI2A 4JLEA 4KHZF 5FMNA 5LMUT 1YXRA 2FUPA 3PUWF 4PK5A 4X20E 2FJAA 4MBQA 3LJCA 2D5UA 2NW7A 2I6HA 4B6XA 3L39A 3FZLB 4CN1A 4UELA 3R84B 3ANWB 5HEUA 3RRWA 3ZMVB 5LGNB 2Y6XA 2JMKA 5IHYA 3I1AA 3ESLA 4EYUA 3O1HA 5HXEA 4ZI2D 1NENA 4MHCA 3GA8A 2WP9A 5LHIB 4MLKA 5JDGA 4EGWA 4PJJA 2XSBA 3ZCJA 2UUAT 3AEDA 3KVAA 3KBTA 1E1HB 3EAMA 3UUNA 1XNRT 3GWHA 3UQ4A 2NTXA 5JTGA 4CN6A 2QVAA 1YQ4A 3TLVA 4M1PA 5FKYA 1T7SA 3VR8A 5TAOA 3QUJA 4H63H 2ES0A 2V7KA 2N1GA 2GK9A 3H3AA 3SS1A 3RH3A 5AQTB 3V5UA 5IWAT 1YKEB 2V5DA 1D1CA 4TUYE 3ZJ1A 2JRKA 3GN5A 1ZOYA 2QGSA 4L0RA 1LVKA 4Z90A 2L9QA 2NW8A 1N34T 2XAQB 4O4HE 4DR3T 1T98A 2K3WA 4ZI2C 4TX5A 3RYFE 5L3EB 3WAKA 5AQFB 5KMGP 5AQOB 4TWDA 3L8RA 1KEYA 3PUZF 3KINB 1WR0A 5HCJA 5J2UE 4ZHQE 2J4GA 2XQ8A 2H89A 4EEBA 4DV7T 1OWAA 4AI6A 2V6YA 2WBLA 2LHRA 2M67A 1T8BA 3OPCA 4UV9B 5EK2A 4UEMA 3AA1B 3TLUA 5HXSA 3TLWA 2CHNA 3PJAA 4DMVA 4COFA 3AE1A 4ZZCA 1N32T 3PV0F 4HFBA 3WI3A 3ONLC 2CLYB 4ZI3D 2DL1A 4DV4T 3B57A 4TZ4C 2BG9E 4ZXLA 5C3JA 3ZEFB 3VRAA 3LBXB 1LKXA 2CWYA 5AQJB 1WLXA 3EABA 5ADXL 2LKGA 3HA4A 4TWHA 5ABGA 5J2TE 3ZT7A 2D0TA 3SRZA 3EUHA 4GK0E 2LRLA 3A8YC 2VL0A 2BBJA 4AKRB 3UU4A 4YY3T 1JNRA 4DV2T 4JV5T 2LT3A 4OFZA 4LFBT 1J5WA 3RIAA 3QB5K 3AEGA 1T72A 3SFDA 4A98A 4AISA 4I43B 3ZSTA 2X67A 4OK0A 4V1Av 3VKGA 4HTEA 5JRCB 5HEOA 5LXTE 3BK9A 1MIYA 4MFRA 5J0ZA 4JI7T 1YKHB 1W0AA 5AQNB 2BVMA 2LLYA 4X62T 4O4IE 2A3DA 4PJLA 4NPPA 3AE4A 2IMLA 4WYVA 4Z91A 3RKGA 2XAFB 5JDQA 2OA5A 2XSAA 4IDNA 2X9WA 1WFDA 2YU1A 1IBKT 3MJXA 3ZC1A 1HNWT 2DCFA 5HCMA 2V5CA 5ETWA 4ISSA 5FL1A 4DUZT 3N5LA 4FJOA 2E9XA 4CN4A 2CMRA 2XQ4A 4YSXA 3NRYA 4EZHA 5HWYA 3PUYF 2C5KT 4XZCA 4LMJA 4MALA 2J1DG 2VURA 3A5XA 2MTQA 3H3MA 2M6BA 4EEDA 4JI2T 2H7OA 5JDNA 1EZ3A 1X79A 4LF4T 2VKJA 1WRDA 3AVSA 3AXJB 2WQYA 2DWGA 5CA1E 3K1SA 5L3BB 3O9XA 5AQLB 2W62A 1MNDA 3M65A 5LHGB 4HE8A 4ZI7E
chains in the Genus database with same CATH topology
5LYJE 4AKLA 3Q2MA 2H7VC 2DNXA 3NRXA 3OYXA 4GOUA 5EK4A 1SA0E 2DHRA 4QXCB 3KV6A 5JR9B 2Q9QD 4JUYA 2PG8A 3RC8A 4O2AE 4PW8A 5FYMA 2ZLYA 4KMCA 2KT9A 3PUAA 2Q9QB 4TV8E 2NOXA 3JC6D 2KLQA 4G2AA 3UT5E 2DI4A 4IHJE 5FXWA 5FY7A 3FXDB 2SPCA 4H63V 5FXXA 3LK2B 5H6QB 5CA0E 3KFWX 3C4XA 3IEEA 3IF8B 2IC6A 3UUXB 4EB6E 1MIWA 4O8SA 1WYCA 1ZKEA 5LCYA 3ZN1B 3GMIA 3H37A 2N9DA 3I0QA 4H9RC 2WMOA 3CX6B 4KUMB 1U5PA 3ZCIA 1HG5A 3HKCE 2EHOD 3PUQA 4KBMB 2XAJB 5HAXA 2CE7A 4PJMA 2EHOB 3CVRA 5FY0A 5LA6E 1G73A 3ZMUB 4ZOLE 3HR0A 2Z6EA 2HH7A 3RYHE 3V5SA 3GN5B 3OYZA 2PFVA 3HI2A 2B1EA 4JLEA 5LGUB 5HWXA 1US7B 3MACA 4G63A 3HKBE 5FMNA 3KBUA 2I59A 3O1JA 5FY1A 3J9X1 1FEWA 5HXHA 1KK7A 3AA0B 4PK5A 4X20E 4MBQA 3RKOA 3LJCA 3MA9A 4O2BE 3CX8B 3ZMZB 2D5UA 2NW7A 2K24A 4I4TE 3K3QC 3N2OA 3CMLA 4AKGA 4B6XA 5H6RB 4QKNA 4DMWA 2BDEA 2LE8A 5FNVE 3O1IA 2UXNB 3Q5WA 4UELA 3R84B 3ANWB 1S94A 3ZMTB 3RRWA 4YFSA 3MKDA 3HKEE 3ZMVB 5LGNB 3BQLA 2JMHA 2VWAA 4DVDA 2Y6XA 4UIGA 2JMKA 4PFPA 3I1AA 5IHYA 3FBLA 3ESLA 3AA7B 5HYAA 4EYUA 3O1HA 2V7JA 5HXEA 4ZI2D 3N9LA 4QXBB 2LJLA 4MHCA 2NTYA 2IAKA 4AQFC 3UULA 2KMFA 4GYSA 2ZM2A 1D0YA 3GA8A 2CWOA 4E7ZA 5JREA 2CXLA 2C5JA 4I55E 4QHOA 3U78A 3ZMSB 4CXYA 2WMNA 3EVYA 4L5GA 1MMAA 5LHIB 2C5IT 4MLKA 5JDGA 4ZI7E 3MK7C 5EZYE 3N9OA 3LG7A 4PJJA 1UX4A 4CXWA 4K0UA 2QA7A 3ZYKA 4J2CA 2YK0A 2V7MA 3ZCJA 5M4YA 4DBRA 3KVAA 3KBTA 4HN9A 3RRCA 1E1HB 3AA6B 1MIVA 3CWZB 3UUNA 1ZEEA 3GWHA 3KV9A 4UVAB 2NTXA 3RYIE 3OKQA 1B7TA 3KDSE 2W0GA 4ISTA 5JR9A 2PJQA 1LRZA 3CQCB 3S4UA 2JJ9A 4IE0A 4X1YE 3K3NA 2Q9QA 4GIWA 3LFMA 3PUSA 4M1PA 2PBIA 4PAGA 4F6RC 2E9XD 2Y8DA 3UUMA 4ASKA 4AKIA 1ZHCA 5TAOA 1HCIA 4EIWA 2E8IA 4QX8B 2KWIB 3QUJA 4ERRA 1MMNA 4H63H 1ZV4X 3AB3B 3MZKB 1HF8A 1D0XA 2ES0A 2XTLA 2BVLA 1FMWA 4PK4A 4P0BA 2V7KA 3KV5A 2N1GA 2GK9A 3EDVA 3H3AA 5FXZA 3SS1A 5LJMA 2X9HA 3AAIA 2IW5B 4WBNE 3Q5XA 4NUUA 5DJQC 3N9NA 3HKDE 3N2KE 4TN7B 4YLHA 3RH3A 4X1KE 3HL6A 2WM9A 4EAHA 2EHOA 3V5UA 4I50E 5EK3A 2LSGA 1YKEB 4QX7B 3LK42 1D1CA 4EZ4A 4TUYE 2V1DB 3RPUA 3ZJ1A 2JRKA 3GN5A 4ANJA 2QGSA 4CI2B 3NZQA 4L0RA 1LVKA 2CA5A 4H9PC 2L9QA 1HG2A 3I9WA 1FMVA 2NW8A 2LSIA 4Z8XA 4YJ2E 2XAQB 4O4HE 2IC9A 2VK9A 2W61A 4OYKA 1V9DA 2KINB 1T98A 3C64A 5FXVA 3OJAA 4ZI2C 2CLYC 2X68A 3CX7B 4TX5A 4DNDA 3RYFE 5L3EB 2VASA 1HFAA 4ZI3C 3WAKA 5KMGP 1Z0PA 3ANWA 2LEHA 4IDZA 5JDFA 2LSYA 3U3IA 3UFEA 2ZM8A 2LSKA 2NP9A 4XAXB 4DO0A 1OXZA 4UVBB 5LOVE 1S35A 3KINB 2KZ7B 4FI5A 2HPLA 5HXCA 3FBZA 5J2UE 4ZHQE 2W00A 3F57A 4UXNB 2JPFA 5KX5E 3PTRB 1UX5A 5CB4E 1OWAA 2KNDA 4IE5A 4AI6A 1FIOA 2WBLA 5L2LA 4ZS3A 3ZN0B 3C4WA 2LHRA 2M67A 3F31A 2K9AA 4UV9B 3FXEB 4UEMA 3W15B 5EK2A 3AA1B 5JH7E 5J1GA 5HXSA 3F2EA 4IGUA 5A1LA 2E9XC 3EDUA 2XUEA 4NUVA 3C98B 4DMVA 4CZZB 4EXTA 3J7Yq 2NW9A 1YD8G 2NWBA 4AKHA 2A72A 3C51A 3WI3A 3VHLA 4ZI3D 2CLYB 2VKOA 1HX8A 4OHFA 3B57A 4TZ4C 1NWMX 3R6NA 3ZEFB 1YW0A 3VKHA 3FB2A 2CM0A 3PUGA 3B13A 3ONXA 5FP3A 1BR2A 4YHJA 3WAJA 3LBXB 4U74A 3E0ZA 4GYRA 3SOLA 1LKXA 3ZPOA 2CWYA 3OBVE 4TV9E 5DABA 1WLXA 2ZM0A 2WWUA 4HKAA 5HXRA 3CQGB 4BAYB 3E22E 1QSDA 3BQIA 3ZJ2A 2X9YA 4AQFA 3C4ZA 5ADXL 3HA4A 2N2NA 4PFOA 4JEUB 1IJ6A 4IE7A 2WSSV 5J2TE 3PU3A 2G0UA 2D0TA 3SRZA 1AJ3A 2D0UA 3EUHA 3AAEB 4GK0E 4OYJA 4AQGA 1WR6A 3AVRA 1HS7A 3Q9DA 5JVDE 4E7SA 5L3DB 1BR0A 2E9XB 2LM9A 3ETVA 3RYCE 1U4QA 4AKRB 1NAFA 1BR4A 2V7LA 2LOPA 2LT3A 3O4XE 4CQIA 3K8PC 4IE4A 3K3OA 4OFZA 3ZYMA 1SHZC 2KXPB 4ZS2A 3PE0A 3IHRA 4H9NC 3NBXX 2BZBA 2WAUA 1LVFA 5BMVE 3I0OA 3BQKA 2V7IA 4KP3C 1HTJF 1H7CA 1IAPA 4I43B 4CI3B 4BA9A 2X67A 2Y48B 3CPZA 5AFUL 4P09A 1CUNA 3D0TA 5JDHA 3PURA 4N78D 4QWNB 2MYSA 4OK0A 5IYZE 5LHHB 3L3PA 4V1Av 1IZNB 3VKGA 1D0ZA 4H9SE 3VU7H 4UVCB 3N9PA 2H3RA 4HTEA 2RA1A 5JQGE 5JRCB 3QC9A 5E0OA 4U72A 4O4JE 5LXTE 5LGTB 2XAHB 3BK9A 1MIYA 4UV8B 2L3LA 3CKDA 5L3GB 4MFRA 4WW0A 4UF0B 2CEAA 5JDLA 4AXPA 4HEAA 2CXFA 1YKHB 4XBFB 3SWHA 4H9QC 2P9BA 2ODVA 3QK6A 5L3CB 3C50A 4WNKA 1Y64B 2BVMA 2DWKA 3RC3A 3N9QA 3E08A 2LHNA 4O4IE 3PU8A 4EOZB 2A3DA 2L8KA 4PJLA 3KVBA 1KNZA 4QXHB 1D1AA 4IIJE 4CXXA 3KV4A 5LNKA 4X1IE 2CCQA 5GONE 4DBQA 4YJ3E 4EYYR 2VL8A 2ODUA 4PNIA 5C8YE 4L9IA 1MNEA 3PDYA 2MBGA 2C0SA 2A2FX 2ZMAA 3LBXA 3ZC0A 5LP6E 2XAFB 3P7IA 2OA5A 5JDQA 3CQXC 3UTKA 1D1BA 1UCUA 2X9WA 1IJ5A 2YU1A 4A56A 1O3XA 1MMGA 2LOSA 3L09A 3MJXA 3ZYLA 3ZC1A 1VOMA 2DCFA 5F3JA 2YINA 3ETUA 2W63A 5DQVA 5ETWA 3FHNA 4ISSA 4O4LE 3NZPA 3N5LA 4FJOA 2DLRA 4CI1B 2VB6A 2D2SA 2E9XA 2YU2A 4IE6A 5LG4A 5LBQB 3DJBA 5DQWA 4BJMA 5LJNA 1QUUA 2CMRA 2VKHA 2XHEB 3LK3B 4ADZA 3NRYA 4EZHA 5HWYA 2K48A 2X9XA 2C5KT 2K5BB 4PJNA 4XZCA 5JR9C 5F8PA 3DP7A 2X66A 2J1DG 2Q9QC 3N2GE 4MALA 3A5XA 4P0AA 2UXXB 2MTQA 2HPJA 4GK5E 3JC6C 5JDMA 2CXDA 4HFVA 4WBOA 4ILUA 2H7OA 3IBPA 5JDNA 1EZ3A 2XQYA 1X79A 3MXZA 2KWHA 3AAAB 5LBMA 2V26A 4H9OC 4JEHB 2JQQA 1MMDA 2XASB 2ACXA 5KDMC 2VKJA 4C91A 3AVSA 1WRDA 1WYBA 2X0LB 3TKLB 2XAGB 5JRCA 1BR1A 4BJNA 2DWGA 2MOZA 2RP4A 3DTOA 3RX6A 2EHOC 5CA1E 5L3FB 4PK6A 5L3BB 2X51A 3I9YA 3O9XA 3T8OA 2W62A 4HGAA 3ZLIA 1MNDA 1G8XA 2LSJA 4C90A 3M65A 5LHGB 2YEVC 4UF0A 1VRBA 2VKDA 3P8CD 4HE8A 3N9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC6 C;  2EHO D;  3ANW B;  2E9X C;  2Q9Q D; 
#chains in the Genus database with same CATH topology
 4AKL A;  3Q2M A;  3NRX A;  3FZH B;  4K0K T;  5JR9 B;  3RC8 A;  2PG8 A;  4O2A E;  4PW8 A;  2ZLY A;  3PUA A;  2Q9Q B;  2UXB T;  2BS3 A;  3JC6 D;  2CRB A;  5FY7 A;  3FXD B;  4H63 V;  3KFW X;  4O8S A;  5LCY A;  2N9D A;  3I0Q A;  2WMO A;  3CX6 B;  2CBJ A;  1OED B;  1HG5 A;  3HKC E;  2EHO D;  1NEK A;  3RQU A;  2PFV A;  2B1E A;  5HWX A;  5AQQ B;  5FY1 A;  4X65 T;  3J9X 1;  1FEW A;  1KK7 A;  3MA9 A;  3ZMZ B;  3CX8 B;  2PTF A;  3N2O A;  3T1H T;  4QKN A;  4U31 A;  2LE8 A;  3O1I A;  3RLF F;  3QOF A;  3ZMT B;  4YFS A;  4X64 T;  5AQH B;  2VWA A;  2MPK A;  4UIG A;  1HR0 T;  4DV6 T;  2WZH A;  4DV1 T;  3FBL A;  3AA7 B;  5HYA A;  2IAK A;  2KMF A;  2CWO A;  4QHO A;  2C5J A;  4I55 E;  4F8H A;  2WMN A;  1W0B A;  2C5I T;  2VQF T;  3MK7 C;  3N9O A;  4K0U A;  4J2C A;  2YK0 A;  2V7M A;  5M4Y A;  4HN9 A;  2VVS A;  3RGL A;  1MIV A;  4U7I A;  4UVA B;  4DV5 T;  3RYI E;  3OKQ A;  4IST A;  3KDS E;  3RIU A;  3S4U A;  4IE0 A;  4GIW A;  4NIQ A;  4PAG A;  3OTO T;  2E9X D;  2Y8D A;  2WWV A;  4YXD A;  4EIW A;  2E8I A;  2KWI B;  3AB3 B;  3MZK B;  1D0X A;  1FMW A;  4P0B A;  2IW5 B;  4NUU A;  3HKD E;  3HL6 A;  2WM9 A;  1E2A A;  4QX7 B;  4ANJ A;  4CI2 B;  2LRK A;  4HFE A;  4YHH T;  1HG2 A;  4YJ2 E;  3PJA J;  2ZM6 T;  3PUX F;  2IC9 A;  2W61 A;  5FVL A;  4OYK A;  3UU8 A;  4I0U A;  5HEH A;  5FXV A;  4DND A;  2VAS A;  1Z0P A;  3ANW A;  2ZM8 A;  2A9U A;  3CK6 A;  1S35 A;  2KZ7 B;  2HPL A;  4IT4 A;  3OVU A;  5KX5 E;  1UX5 A;  5CJ5 A;  2LM2 A;  2UXC T;  3ZN0 B;  1KNP A;  3F31 A;  3NKZ A;  3FXE B;  4JI1 T;  5JH7 E;  2E9X C;  4NUV A;  3C98 B;  4YSZ A;  4AKH A;  2A72 A;  1XWM A;  2UUB T;  3C51 A;  3VKH A;  3AEE A;  3B13 A;  4ILA A;  4YHJ A;  3WAJ A;  4U74 A;  3E0Z A;  3P4W A;  3X1D A;  3ZPO A;  4TV9 E;  4EV6 A;  2WWU A;  4IE7 A;  2WSS V;  5IUX A;  3AVR A;  3Q9D A;  4E7S A;  4LFC T;  2W67 A;  2W66 A;  4JI4 T;  4ZZB A;  1NAF A;  4LMK A;  3AE2 A;  3G06 A;  4U2Z A;  4P1N A;  3O4X E;  2CPT A;  1I94 T;  1SHZ C;  4ZS2 A;  1LVF A;  3I0O A;  2V7I A;  3UU6 A;  4KX6 A;  1IAP A;  4BA9 A;  3CPZ A;  4P09 A;  1CUN A;  2IDO B;  5IYZ E;  4IDQ A;  4LML A;  5LHH B;  3L3P A;  1IZN B;  1D0Z A;  4H9S E;  3N9P A;  3FZF B;  3UU3 A;  5LGT B;  2L3L A;  3CKD A;  5L3G B;  4U3C A;  4AXP A;  4HEA A;  2CXF A;  1XDP A;  3C50 A;  1Y64 B;  2DWK A;  3RC3 A;  2XQA A;  3TLT A;  3E08 A;  2J62 A;  4B3R T;  1D1A A;  2MAW A;  3KV4 A;  5LNK A;  3P50 A;  3ONJ A;  4EYY R;  4L9I A;  3PDY A;  2MBG A;  1UGO A;  3LBX A;  3CQX C;  3UTK A;  1D1B A;  4A56 A;  4KHP T;  2XQ5 A;  4YT0 A;  1VOM A;  5ABF B;  4Q25 A;  3FHN A;  3EHZ A;  2D2S A;  3DJB A;  4BJM A;  1QUU A;  2OLT A;  2XHE B;  3LK3 B;  2K5B B;  3Q5D A;  3UU5 A;  3RIU C;  4P0A A;  1I6Z A;  3RF1 A;  4LF5 T;  5JDM A;  2CXD A;  3JAD A;  3P4R A;  2FJD A;  2XQY A;  2KWH A;  3AAA B;  2W2U A;  2UU9 T;  2ACX A;  4HFI A;  4C91 A;  2X0L B;  2XAG B;  5JRC A;  2RP4 A;  3I9Y A;  4YTP A;  4HGA A;  3ZLI A;  1G8X A;  2HHH T;  4IDP A;  3P4S A;  2YEV C;  2VKD A;  3AE3 A;  1HX1 B;  1M62 A;  2J47 A;  2H7V C;  4GOU A;  2AXD S;  2FBW A;  1SA0 E;  2DHR A;  5AQR B;  2CBI A;  5FYM A;  4YTN A;  2NOX A;  5HEG A;  3UT5 E;  2IHR 1;  4IHJ E;  2SPC A;  5FXX A;  3LK2 B;  3RHW A;  1X9B A;  1GQE A;  1ZKE A;  4H9R C;  1Z8U A;  4KUM B;  4A5X A;  3ZCI A;  2BG9 B;  2JIW A;  4KBM B;  2XAJ B;  2WZI A;  2CE7 A;  2EHO B;  5LA6 E;  5FY0 A;  1G73 A;  3LSV A;  2E5L T;  4HFD A;  3V5S A;  1VCS A;  3TLS A;  1US7 B;  3MAC A;  4G63 A;  3HKB E;  3O1J A;  2I59 A;  5HXH A;  3AA0 B;  4B3M T;  3A7M A;  4JI8 T;  2F4V T;  4O2B E;  3CML A;  4AKG A;  4DMW A;  5FNV E;  4X5T A;  2E5V A;  3ZSS A;  1S94 A;  2FJE A;  3BQL A;  4UR9 A;  4DVD A;  3UUB A;  2V6X A;  4PFP A;  2V7J A;  3NVO A;  3UUL A;  4GYS A;  4E7Z A;  5JRE A;  2CXL A;  4LFA T;  3U78 A;  3AXJ A;  3ZMS B;  3EVY A;  1MMA A;  4GKK T;  4IL4 A;  1KFY A;  1UX4 A;  4CXW A;  2QA7 A;  3ZYK A;  3Q5E A;  2YN6 A;  1ZEE A;  3KV9 A;  5CGM A;  1B7T A;  3VR9 A;  5JR9 A;  1LRZ A;  3CQC B;  3AEC A;  3K3N A;  2Q9Q A;  3LFM A;  3PUS A;  2PBI A;  3UUM A;  2BKN A;  1ZHC A;  4QX8 B;  4NXN T;  4ERR A;  1ZV4 X;  1HF8 A;  4LF7 T;  2E2A A;  2XTL A;  5BR8 T;  4PK4 A;  2VVN A;  4TWF A;  4B3S T;  1L0V A;  5LJM A;  5FXZ A;  2X0H A;  1OED A;  2XZE A;  4WBN E;  2RPA A;  5DJQ C;  3N9N A;  4X1K E;  5AQM B;  4EAH A;  3AE6 A;  2LSG A;  3LK4 2;  2M6I A;  4EZ4 A;  2V1D B;  3CIR A;  3NZQ A;  1J5E T;  2CA5 A;  2V8S V;  4Z8X A;  2WB5 A;  2VK9 A;  3PUV F;  3C64 A;  3OJA A;  2CLY C;  3CX7 B;  1YQ3 A;  2LEH A;  5JDF A;  2LSY A;  3U3I A;  2LSK A;  4DO0 A;  4U2Y A;  1OXZ A;  4UVB B;  4FI5 A;  4DR7 T;  3FBZ A;  3JAF A;  1XMQ T;  2W00 A;  3F57 A;  4UXN B;  2JPF A;  3PTR B;  4IRE A;  2KND A;  4IE5 A;  3AEB A;  2K9A A;  3W15 B;  4ILC A;  2BS2 A;  3F2E A;  5A1L A;  2XUE A;  4JI5 T;  3FZK B;  3J7Y q;  2KSR A;  3QB5 A;  1YD8 G;  4DV0 T;  3AE8 A;  1HX8 A;  4OHF A;  4DV3 T;  1SUM B;  4U33 A;  4JBW F;  1NWM X;  1YW0 A;  3FB2 A;  2CM0 A;  3PUG A;  3ONX A;  2BKO A;  2H88 A;  3CQG B;  3BQI A;  3ZJ2 A;  2X9Y A;  4AQF A;  3C4Z A;  2N2N A;  4PFO A;  3PU3 A;  1AJ3 A;  2D0U A;  1WR6 A;  2IUB A;  5L3D B;  3ZT6 A;  3ETV A;  5ABE A;  1U4Q A;  2V7L A;  2LOP A;  3EI0 A;  5AQG B;  4CQI A;  3K8P C;  4IE4 A;  3K3O A;  3ZYM A;  3IHR A;  5BMV E;  4KP3 C;  4TNV A;  1ZP0 A;  3SFE A;  4CI3 B;  1HNZ T;  5AFU L;  5AQU B;  4N78 D;  2MYS A;  3M3Z B;  4QH4 A;  2H3R A;  3ZT5 A;  3QC9 A;  2XAH B;  2YDQ A;  4HWF A;  5ABH A;  4UF0 B;  3RIF A;  4JI3 T;  5JDL A;  4A97 A;  4XBF B;  3SWH A;  2ODV A;  3QK6 A;  3VRB A;  3N9Q A;  2UXD T;  2LHN A;  4EOZ B;  1KNZ A;  4QXH B;  4IIJ E;  4CXX A;  2JQK A;  4WZX A;  4YJ3 E;  1MNE A;  2C0S A;  2A2F X;  5LP6 E;  2NR4 A;  4AIU A;  2QYW A;  4DUY T;  2YOE A;  1O3X A;  2WCA A;  2LOS A;  3L09 A;  2HN2 A;  4B3T T;  5F3J A;  3ETU A;  5DQV A;  2YDR A;  4IL9 A;  4O4L E;  3NZP A;  5AQK B;  2DLR A;  2VB6 A;  5LBQ B;  5DQW A;  1UK5 A;  2VKH A;  1XZY A;  1HNX T;  1KF6 A;  2X9X A;  4PJN A;  2WU2 A;  2WU5 A;  4YSY A;  5JR9 C;  4LF6 T;  2X66 A;  2Q9Q C;  3N2G E;  2HPJ A;  1UUR A;  4DR2 T;  4WBO A;  3IBP A;  5FVK A;  2WDR A;  3MXZ A;  3ABV A;  5KDM C;  1OED C;  1WYB A;  3TKL B;  2MOZ A;  3DTO A;  3RX6 A;  2X51 A;  3T8O A;  4C90 A;  2LSJ A;  2XPK A;  3N9M A;  3LDQ B;  3OYX A;  3KV6 A;  2KT9 A;  4TV8 E;  2DI4 A;  4AQY T;  5H6Q B;  5CA0 E;  3C4X A;  2BBH A;  4EB6 E;  3ZN1 B;  2XQ9 A;  4IDO A;  1U5P A;  5ABF A;  3CVR A;  3ZMU B;  3HR0 A;  2Z6E A;  4NXM T;  2HH7 A;  3RYH E;  3GN5 B;  3OYZ A;  5LG3 A;  5LGU B;  4LF8 T;  3KBU A;  2XQ7 A;  4QH1 A;  2HN1 A;  3P4P A;  3RKO A;  4LF9 T;  2K24 A;  4I4T E;  3K3Q C;  1E7P A;  2XM1 A;  5H6R B;  2BDE A;  1W09 A;  2UXN B;  3Q5W A;  3MKD A;  3HKE E;  3UFG A;  2JMH A;  1IBL T;  4JI0 T;  3N9L A;  4QXB B;  2LJL A;  2NTY A;  4AQF C;  2ZM2 A;  1D0Y A;  2VQE T;  2V6Y B;  4CXY A;  4L5G A;  4YTM A;  3UQ7 A;  4HWH A;  1M7K A;  4HFC A;  1VCT A;  2YDS A;  5EZY E;  3LG7 A;  4DBR A;  2B76 A;  3RRC A;  3AA6 B;  3CWZ B;  2W0G A;  2PJQ A;  2JJ9 A;  4X1Y E;  4F6R C;  4ASK A;  4AKI A;  1HCI A;  1MMN A;  2BVL A;  3KV5 A;  5L47 A;  3EDV A;  2BS4 A;  2X9H A;  3AAI A;  3Q5X A;  2BG9 A;  1W9R A;  2LKH A;  3N2K E;  4TN7 B;  4YLH A;  2EHO A;  4I50 E;  5EK3 A;  4OX9 T;  3RPU A;  2UUC T;  2WDQ A;  4ILB A;  4H9P C;  3I9W A;  1FMV A;  4DR5 T;  4HFH A;  2LSI A;  2WDV A;  4QH5 A;  2CHO A;  1V9D A;  2KIN B;  4HWI B;  2X68 A;  4KI0 F;  3NWI A;  4ZI3 C;  1HFA A;  4IDZ A;  3T1Y T;  3UFE A;  3JCF A;  2NP9 A;  4XAX B;  2D9D A;  5LOV E;  4HWC A;  5HXC A;  5CB4 E;  1FIO A;  5L2L A;  4ZS3 A;  4DR6 T;  3C4W A;  4JYA T;  5AQI B;  5J1G A;  1XMO T;  5AQP B;  4IGU A;  3EDU A;  4X66 T;  2ACZ A;  4CZZ B;  4EXT A;  2XJ7 A;  2NW9 A;  2NWB A;  2W4X A;  3P4Q A;  1XDO A;  3VHL A;  2VKO A;  1N36 T;  1OED E;  3R6N A;  3RQW A;  1N33 T;  5FP3 A;  5LB7 B;  1BR2 A;  1SE7 A;  4GYR A;  3SOL A;  3OBV E;  5DAB A;  2ZM0 A;  4HKA A;  2OV9 A;  5HXR A;  4BAY B;  3E22 E;  1QSD A;  5L4E A;  5CFB A;  5KXJ A;  2YKS A;  4JEU B;  1IJ6 A;  5AQV B;  2G0U A;  2WS3 A;  5LMN T;  4OYJ A;  3AAE B;  4DID B;  4AQG A;  1HS7 A;  5HEJ A;  5JVD E;  1BR0 A;  1JNZ A;  2E9X B;  2WY2 A;  2LM9 A;  3RYC E;  5L4H A;  1BR4 A;  4ZEY A;  3JAE A;  2FJB A;  2KXP B;  1IBM T;  3PE0 A;  2XM2 A;  4H9N C;  3NBX X;  2BZB A;  2WAU A;  3BQK A;  1CHU A;  1HTJ F;  1H7C A;  2Y48 B;  5JDH A;  3D0T A;  3PUR A;  4QWN B;  1QLB A;  3QNU A;  4HWD A;  1UUS A;  3VU7 H;  4UVC B;  2RA1 A;  5JQG E;  5E0O A;  4U72 A;  4O4J E;  4UV8 B;  4WW0 A;  2IIU A;  2CEA A;  4H9Q C;  2P9B A;  3ZKR A;  5L3C B;  4WNK A;  1KNR A;  3PU8 A;  2L8K A;  3KVB A;  3FZM B;  4X1I E;  2CCQ A;  5GON E;  4DBQ A;  2VL8 A;  2ODU A;  4PNI A;  5C8Y E;  3AE5 A;  2ZMA A;  3ZC0 A;  3P7I A;  3B5M A;  1UCU A;  1IJ5 A;  4TNW A;  2X0Y A;  1WCR A;  1MMG A;  3ZYL A;  2YIN A;  2W63 A;  4DR1 T;  4CI1 B;  2YU2 A;  4IE6 A;  5LG4 A;  5LJN A;  2JQ9 A;  5FL0 A;  4ADZ A;  2K48 A;  5F5W A;  3RI5 A;  5F8P A;  3DP7 A;  2UXX B;  4GKJ T;  2AE9 A;  4GK5 E;  3JC6 C;  4HFV A;  4ILU A;  5LBM A;  2V26 A;  4H9O C;  4JEH B;  2JQQ A;  1MMD A;  2XAS B;  3AEF A;  2BG9 C;  2XQ3 A;  1BR1 A;  1Y01 A;  5L3F B;  4BJN A;  2EHO C;  4PK6 A;  4UF0 A;  1VRB A;  3P8C D;  3AEA A;  2BKP A;  5LYJ E;  2XY8 B;  5EK4 A;  2DNX A;  4QXC B;  2R6G F;  4U7Y A;  2Q9Q D;  4JUY A;  4KMC A;  2QRX A;  5AQS B;  2I0M A;  1DU2 A;  2JQH A;  2XQ6 A;  2KLQ A;  4G2A A;  5FXW A;  3IA3 A;  4DR4 T;  3IEE A;  3IF8 B;  2IC6 A;  3AE7 A;  3UUX B;  1MIW A;  1XNQ T;  1WYC A;  3GMI A;  3H37 A;  1R8I A;  3AE9 A;  1FJG T;  5C2T A;  3PUQ A;  5HAX A;  4PJM A;  1J1J A;  4ZOL E;  4JI6 T;  3HI2 A;  4JLE A;  4KHZ F;  5FMN A;  5LMU T;  1YXR A;  2FUP A;  3PUW F;  4PK5 A;  4X20 E;  2FJA A;  4MBQ A;  3LJC A;  2D5U A;  2NW7 A;  2I6H A;  4B6X A;  3L39 A;  3FZL B;  4CN1 A;  4UEL A;  3R84 B;  3ANW B;  5HEU A;  3RRW A;  3ZMV B;  5LGN B;  2Y6X A;  2JMK A;  5IHY A;  3I1A A;  3ESL A;  4EYU A;  3O1H A;  5HXE A;  4ZI2 D;  1NEN A;  4MHC A;  3GA8 A;  2WP9 A;  5LHI B;  4MLK A;  5JDG A;  4EGW A;  4PJJ A;  2XSB A;  3ZCJ A;  2UUA T;  3AED A;  3KVA A;  3KBT A;  1E1H B;  3EAM A;  3UUN A;  1XNR T;  3GWH A;  3UQ4 A;  2NTX A;  5JTG A;  4CN6 A;  2QVA A;  1YQ4 A;  3TLV A;  4M1P A;  5FKY A;  1T7S A;  3VR8 A;  5TAO A;  3QUJ A;  4H63 H;  2ES0 A;  2V7K A;  2N1G A;  2GK9 A;  3H3A A;  3SS1 A;  3RH3 A;  5AQT B;  3V5U A;  5IWA T;  1YKE B;  2V5D A;  1D1C A;  4TUY E;  3ZJ1 A;  2JRK A;  3GN5 A;  1ZOY A;  2QGS A;  4L0R A;  1LVK A;  4Z90 A;  2L9Q A;  2NW8 A;  1N34 T;  2XAQ B;  4O4H E;  4DR3 T;  1T98 A;  2K3W A;  4ZI2 C;  4TX5 A;  3RYF E;  5L3E B;  3WAK A;  5AQF B;  5KMG P;  5AQO B;  4TWD A;  3L8R A;  1KEY A;  3PUZ F;  3KIN B;  1WR0 A;  5HCJ A;  5J2U E;  4ZHQ E;  2J4G A;  2XQ8 A;  2H89 A;  4EEB A;  4DV7 T;  1OWA A;  4AI6 A;  2V6Y A;  2WBL A;  2LHR A;  2M67 A;  1T8B A;  3OPC A;  4UV9 B;  5EK2 A;  4UEM A;  3AA1 B;  3TLU A;  5HXS A;  3TLW A;  2CHN A;  3PJA A;  4DMV A;  4COF A;  3AE1 A;  4ZZC A;  1N32 T;  3PV0 F;  4HFB A;  3WI3 A;  3ONL C;  2CLY B;  4ZI3 D;  2DL1 A;  4DV4 T;  3B57 A;  4TZ4 C;  2BG9 E;  4ZXL A;  5C3J A;  3ZEF B;  3VRA A;  3LBX B;  1LKX A;  2CWY A;  5AQJ B;  1WLX A;  3EAB A;  5ADX L;  2LKG A;  3HA4 A;  4TWH A;  5ABG A;  5J2T E;  3ZT7 A;  2D0T A;  3SRZ A;  3EUH A;  4GK0 E;  2LRL A;  3A8Y C;  2VL0 A;  2BBJ A;  4AKR B;  3UU4 A;  4YY3 T;  1JNR A;  4DV2 T;  4JV5 T;  2LT3 A;  4OFZ A;  4LFB T;  1J5W A;  3RIA A;  3QB5 K;  3AEG A;  1T72 A;  3SFD A;  4A98 A;  4AIS A;  4I43 B;  3ZST A;  2X67 A;  4OK0 A;  4V1A v;  3VKG A;  4HTE A;  5JRC B;  5HEO A;  5LXT E;  3BK9 A;  1MIY A;  4MFR A;  5J0Z A;  4JI7 T;  1YKH B;  1W0A A;  5AQN B;  2BVM A;  2LLY A;  4X62 T;  4O4I E;  2A3D A;  4PJL A;  4NPP A;  3AE4 A;  2IML A;  4WYV A;  4Z91 A;  3RKG A;  2XAF B;  5JDQ A;  2OA5 A;  2XSA A;  4IDN A;  2X9W A;  1WFD A;  2YU1 A;  1IBK T;  3MJX A;  3ZC1 A;  1HNW T;  2DCF A;  5HCM A;  2V5C A;  5ETW A;  4ISS A;  5FL1 A;  4DUZ T;  3N5L A;  4FJO A;  2E9X A;  4CN4 A;  2CMR A;  2XQ4 A;  4YSX A;  3NRY A;  4EZH A;  5HWY A;  3PUY F;  2C5K T;  4XZC A;  4LMJ A;  4MAL A;  2J1D G;  2VUR A;  3A5X A;  2MTQ A;  3H3M A;  2M6B A;  4EED A;  4JI2 T;  2H7O A;  5JDN A;  1EZ3 A;  1X79 A;  4LF4 T;  2VKJ A;  1WRD A;  3AVS A;  3AXJ B;  2WQY A;  2DWG A;  5CA1 E;  3K1S A;  5L3B B;  3O9X A;  5AQL B;  2W62 A;  1MND A;  3M65 A;  5LHG B;  4HE8 A;  4ZI7 E; 
#chains in the Genus database with same CATH homology
 5LYJ E;  4AKL A;  3Q2M A;  2H7V C;  2DNX A;  3NRX A;  3OYX A;  4GOU A;  5EK4 A;  1SA0 E;  2DHR A;  4QXC B;  3KV6 A;  5JR9 B;  2Q9Q D;  4JUY A;  2PG8 A;  3RC8 A;  4O2A E;  4PW8 A;  5FYM A;  2ZLY A;  4KMC A;  2KT9 A;  3PUA A;  2Q9Q B;  4TV8 E;  2NOX A;  3JC6 D;  2KLQ A;  4G2A A;  3UT5 E;  2DI4 A;  4IHJ E;  5FXW A;  5FY7 A;  3FXD B;  2SPC A;  4H63 V;  5FXX A;  3LK2 B;  5H6Q B;  5CA0 E;  3KFW X;  3C4X A;  3IEE A;  3IF8 B;  2IC6 A;  3UUX B;  4EB6 E;  1MIW A;  4O8S A;  1WYC A;  1ZKE A;  5LCY A;  3ZN1 B;  3GMI A;  3H37 A;  2N9D A;  3I0Q A;  4H9R C;  2WMO A;  3CX6 B;  4KUM B;  1U5P A;  3ZCI A;  1HG5 A;  3HKC E;  2EHO D;  3PUQ A;  4KBM B;  2XAJ B;  5HAX A;  2CE7 A;  4PJM A;  2EHO B;  3CVR A;  5FY0 A;  5LA6 E;  1G73 A;  3ZMU B;  4ZOL E;  3HR0 A;  2Z6E A;  2HH7 A;  3RYH E;  3V5S A;  3GN5 B;  3OYZ A;  2PFV A;  3HI2 A;  2B1E A;  4JLE A;  5LGU B;  5HWX A;  1US7 B;  3MAC A;  4G63 A;  3HKB E;  5FMN A;  3KBU A;  2I59 A;  3O1J A;  5FY1 A;  3J9X 1;  1FEW A;  5HXH A;  1KK7 A;  3AA0 B;  4PK5 A;  4X20 E;  4MBQ A;  3RKO A;  3LJC A;  3MA9 A;  4O2B E;  3CX8 B;  3ZMZ B;  2D5U A;  2NW7 A;  2K24 A;  4I4T E;  3K3Q C;  3N2O A;  3CML A;  4AKG A;  4B6X A;  5H6R B;  4QKN A;  4DMW A;  2BDE A;  2LE8 A;  5FNV E;  3O1I A;  2UXN B;  3Q5W A;  4UEL A;  3R84 B;  3ANW B;  1S94 A;  3ZMT B;  3RRW A;  4YFS A;  3MKD A;  3HKE E;  3ZMV B;  5LGN B;  3BQL A;  2JMH A;  2VWA A;  4DVD A;  2Y6X A;  4UIG A;  2JMK A;  4PFP A;  3I1A A;  5IHY A;  3FBL A;  3ESL A;  3AA7 B;  5HYA A;  4EYU A;  3O1H A;  2V7J A;  5HXE A;  4ZI2 D;  3N9L A;  4QXB B;  2LJL A;  4MHC A;  2NTY A;  2IAK A;  4AQF C;  3UUL A;  2KMF A;  4GYS A;  2ZM2 A;  1D0Y A;  3GA8 A;  2CWO A;  4E7Z A;  5JRE A;  2CXL A;  2C5J A;  4I55 E;  4QHO A;  3U78 A;  3ZMS B;  4CXY A;  2WMN A;  3EVY A;  4L5G A;  1MMA A;  5LHI B;  2C5I T;  4MLK A;  5JDG A;  4ZI7 E;  3MK7 C;  5EZY E;  3N9O A;  3LG7 A;  4PJJ A;  1UX4 A;  4CXW A;  4K0U A;  2QA7 A;  3ZYK A;  4J2C A;  2YK0 A;  2V7M A;  3ZCJ A;  5M4Y A;  4DBR A;  3KVA A;  3KBT A;  4HN9 A;  3RRC A;  1E1H B;  3AA6 B;  1MIV A;  3CWZ B;  3UUN A;  1ZEE A;  3GWH A;  3KV9 A;  4UVA B;  2NTX A;  3RYI E;  3OKQ A;  1B7T A;  3KDS E;  2W0G A;  4IST A;  5JR9 A;  2PJQ A;  1LRZ A;  3CQC B;  3S4U A;  2JJ9 A;  4IE0 A;  4X1Y E;  3K3N A;  2Q9Q A;  4GIW A;  3LFM A;  3PUS A;  4M1P A;  2PBI A;  4PAG A;  4F6R C;  2E9X D;  2Y8D A;  3UUM A;  4ASK A;  4AKI A;  1ZHC A;  5TAO A;  1HCI A;  4EIW A;  2E8I A;  4QX8 B;  2KWI B;  3QUJ A;  4ERR A;  1MMN A;  4H63 H;  1ZV4 X;  3AB3 B;  3MZK B;  1HF8 A;  1D0X A;  2ES0 A;  2XTL A;  2BVL A;  1FMW A;  4PK4 A;  4P0B A;  2V7K A;  3KV5 A;  2N1G A;  2GK9 A;  3EDV A;  3H3A A;  5FXZ A;  3SS1 A;  5LJM A;  2X9H A;  3AAI A;  2IW5 B;  4WBN E;  3Q5X A;  4NUU A;  5DJQ C;  3N9N A;  3HKD E;  3N2K E;  4TN7 B;  4YLH A;  3RH3 A;  4X1K E;  3HL6 A;  2WM9 A;  4EAH A;  2EHO A;  3V5U A;  4I50 E;  5EK3 A;  2LSG A;  1YKE B;  4QX7 B;  3LK4 2;  1D1C A;  4EZ4 A;  4TUY E;  2V1D B;  3RPU A;  3ZJ1 A;  2JRK A;  3GN5 A;  4ANJ A;  2QGS A;  4CI2 B;  3NZQ A;  4L0R A;  1LVK A;  2CA5 A;  4H9P C;  2L9Q A;  1HG2 A;  3I9W A;  1FMV A;  2NW8 A;  2LSI A;  4Z8X A;  4YJ2 E;  2XAQ B;  4O4H E;  2IC9 A;  2VK9 A;  2W61 A;  4OYK A;  1V9D A;  2KIN B;  1T98 A;  3C64 A;  5FXV A;  3OJA A;  4ZI2 C;  2CLY C;  2X68 A;  3CX7 B;  4TX5 A;  4DND A;  3RYF E;  5L3E B;  2VAS A;  1HFA A;  4ZI3 C;  3WAK A;  5KMG P;  1Z0P A;  3ANW A;  2LEH A;  4IDZ A;  5JDF A;  2LSY A;  3U3I A;  3UFE A;  2ZM8 A;  2LSK A;  2NP9 A;  4XAX B;  4DO0 A;  1OXZ A;  4UVB B;  5LOV E;  1S35 A;  3KIN B;  2KZ7 B;  4FI5 A;  2HPL A;  5HXC A;  3FBZ A;  5J2U E;  4ZHQ E;  2W00 A;  3F57 A;  4UXN B;  2JPF A;  5KX5 E;  3PTR B;  1UX5 A;  5CB4 E;  1OWA A;  2KND A;  4IE5 A;  4AI6 A;  1FIO A;  2WBL A;  5L2L A;  4ZS3 A;  3ZN0 B;  3C4W A;  2LHR A;  2M67 A;  3F31 A;  2K9A A;  4UV9 B;  3FXE B;  4UEM A;  3W15 B;  5EK2 A;  3AA1 B;  5JH7 E;  5J1G A;  5HXS A;  3F2E A;  4IGU A;  5A1L A;  2E9X C;  3EDU A;  2XUE A;  4NUV A;  3C98 B;  4DMV A;  4CZZ B;  4EXT A;  3J7Y q;  2NW9 A;  1YD8 G;  2NWB A;  4AKH A;  2A72 A;  3C51 A;  3WI3 A;  3VHL A;  4ZI3 D;  2CLY B;  2VKO A;  1HX8 A;  4OHF A;  3B57 A;  4TZ4 C;  1NWM X;  3R6N A;  3ZEF B;  1YW0 A;  3VKH A;  3FB2 A;  2CM0 A;  3PUG A;  3B13 A;  3ONX A;  5FP3 A;  1BR2 A;  4YHJ A;  3WAJ A;  3LBX B;  4U74 A;  3E0Z A;  4GYR A;  3SOL A;  1LKX A;  3ZPO A;  2CWY A;  3OBV E;  4TV9 E;  5DAB A;  1WLX A;  2ZM0 A;  2WWU A;  4HKA A;  5HXR A;  3CQG B;  4BAY B;  3E22 E;  1QSD A;  3BQI A;  3ZJ2 A;  2X9Y A;  4AQF A;  3C4Z A;  5ADX L;  3HA4 A;  2N2N A;  4PFO A;  4JEU B;  1IJ6 A;  4IE7 A;  2WSS V;  5J2T E;  3PU3 A;  2G0U A;  2D0T A;  3SRZ A;  1AJ3 A;  2D0U A;  3EUH A;  3AAE B;  4GK0 E;  4OYJ A;  4AQG A;  1WR6 A;  3AVR A;  1HS7 A;  3Q9D A;  5JVD E;  4E7S A;  5L3D B;  1BR0 A;  2E9X B;  2LM9 A;  3ETV A;  3RYC E;  1U4Q A;  4AKR B;  1NAF A;  1BR4 A;  2V7L A;  2LOP A;  2LT3 A;  3O4X E;  4CQI A;  3K8P C;  4IE4 A;  3K3O A;  4OFZ A;  3ZYM A;  1SHZ C;  2KXP B;  4ZS2 A;  3PE0 A;  3IHR A;  4H9N C;  3NBX X;  2BZB A;  2WAU A;  1LVF A;  5BMV E;  3I0O A;  3BQK A;  2V7I A;  4KP3 C;  1HTJ F;  1H7C A;  1IAP A;  4I43 B;  4CI3 B;  4BA9 A;  2X67 A;  2Y48 B;  3CPZ A;  5AFU L;  4P09 A;  1CUN A;  3D0T A;  5JDH A;  3PUR A;  4N78 D;  4QWN B;  2MYS A;  4OK0 A;  5IYZ E;  5LHH B;  3L3P A;  4V1A v;  1IZN B;  3VKG A;  1D0Z A;  4H9S E;  3VU7 H;  4UVC B;  3N9P A;  2H3R A;  4HTE A;  2RA1 A;  5JQG E;  5JRC B;  3QC9 A;  5E0O A;  4U72 A;  4O4J E;  5LXT E;  5LGT B;  2XAH B;  3BK9 A;  1MIY A;  4UV8 B;  2L3L A;  3CKD A;  5L3G B;  4MFR A;  4WW0 A;  4UF0 B;  2CEA A;  5JDL A;  4AXP A;  4HEA A;  2CXF A;  1YKH B;  4XBF B;  3SWH A;  4H9Q C;  2P9B A;  2ODV A;  3QK6 A;  5L3C B;  3C50 A;  4WNK A;  1Y64 B;  2BVM A;  2DWK A;  3RC3 A;  3N9Q A;  3E08 A;  2LHN A;  4O4I E;  3PU8 A;  4EOZ B;  2A3D A;  2L8K A;  4PJL A;  3KVB A;  1KNZ A;  4QXH B;  1D1A A;  4IIJ E;  4CXX A;  3KV4 A;  5LNK A;  4X1I E;  2CCQ A;  5GON E;  4DBQ A;  4YJ3 E;  4EYY R;  2VL8 A;  2ODU A;  4PNI A;  5C8Y E;  4L9I A;  1MNE A;  3PDY A;  2MBG A;  2C0S A;  2A2F X;  2ZMA A;  3LBX A;  3ZC0 A;  5LP6 E;  2XAF B;  3P7I A;  2OA5 A;  5JDQ A;  3CQX C;  3UTK A;  1D1B A;  1UCU A;  2X9W A;  1IJ5 A;  2YU1 A;  4A56 A;  1O3X A;  1MMG A;  2LOS A;  3L09 A;  3MJX A;  3ZYL A;  3ZC1 A;  1VOM A;  2DCF A;  5F3J A;  2YIN A;  3ETU A;  2W63 A;  5DQV A;  5ETW A;  3FHN A;  4ISS A;  4O4L E;  3NZP A;  3N5L A;  4FJO A;  2DLR A;  4CI1 B;  2VB6 A;  2D2S A;  2E9X A;  2YU2 A;  4IE6 A;  5LG4 A;  5LBQ B;  3DJB A;  5DQW A;  4BJM A;  5LJN A;  1QUU A;  2CMR A;  2VKH A;  2XHE B;  3LK3 B;  4ADZ A;  3NRY A;  4EZH A;  5HWY A;  2K48 A;  2X9X A;  2C5K T;  2K5B B;  4PJN A;  4XZC A;  5JR9 C;  5F8P A;  3DP7 A;  2X66 A;  2J1D G;  2Q9Q C;  3N2G E;  4MAL A;  3A5X A;  4P0A A;  2UXX B;  2MTQ A;  2HPJ A;  4GK5 E;  3JC6 C;  5JDM A;  2CXD A;  4HFV A;  4WBO A;  4ILU A;  2H7O A;  3IBP A;  5JDN A;  1EZ3 A;  2XQY A;  1X79 A;  3MXZ A;  2KWH A;  3AAA B;  5LBM A;  2V26 A;  4H9O C;  4JEH B;  2JQQ A;  1MMD A;  2XAS B;  2ACX A;  5KDM C;  2VKJ A;  4C91 A;  3AVS A;  1WRD A;  1WYB A;  2X0L B;  3TKL B;  2XAG B;  5JRC A;  1BR1 A;  4BJN A;  2DWG A;  2MOZ A;  2RP4 A;  3DTO A;  3RX6 A;  2EHO C;  5CA1 E;  5L3F B;  4PK6 A;  5L3B B;  2X51 A;  3I9Y A;  3O9X A;  3T8O A;  2W62 A;  4HGA A;  3ZLI A;  1MND A;  1G8X A;  2LSJ A;  4C90 A;  3M65 A;  5LHG B;  2YEV C;  4UF0 A;  1VRB A;  2VKD A;  3P8C D;  4HE8 A;  3N9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...