2EIJH

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eijH00
2DYRH 3ASNH 3AG3H 5B3SH 2EIJH 2EINH 2Y69H 1OCZH 1V54H 3ASOH 3WG7H 5B1AH 3AG1H 3ABKH 1OCOH 2DYSH 3ABLH 2EIKH 3X2QH 5IY5H 1OCRH 2EILH 2EIMH 2OCCH 3ABMH 3AG4H 1V55H 5B1BH 1OCCH 2ZXWH 3AG2H
chains in the Genus database with same CATH superfamily
3K1NA 2QCOA 3GFMA 4L9NA 5LGTA 2MD0A 5D5VB 3SJMA 1A6QA 2KQRA 4UVCA 4M3BA 2F4OB 3DP7A 3MKZA 1IRZA 1MBFA 2Y31A 4RLQA 1YO5C 2AHQA 4N9IA 1LKXA 4OIPF 3HHGA 1R71A 2X4HA 2VQGA 2VL8A 4D1QA 5ILUA 2P0WA 1ZHFA 1X1DA 4A3EJ 3DKXA 2LYCA 2DMPA 4RAGA 4PDKA 2V9KA 2ESHA 4BGDA 5DV5A 4ZYHA 4OU0A 1XMXA 2QWWA 3LA2A 4LJZF 2JUGA 4O3MA 2R93J 2DBBA 4QWQA 4KN4X 2OAZA 3ESWB 1XG1A 5KNLA 4Z6YA 4J19A 4A3DJ 1I1GA 3BG5A 2QBYA 3GBGA 1WQ2A 1P6RA 2HOAA 4LIUA 2JN6A 5LEKA 5AIQA 2BY0A 1S7AA 2DLLA 3ZQCA 2V6EA 2OC6A 2GIZA 3E97A 2W1OA 2XASA 5ICGA 4B47A 1G8XA 4JOMA 2CV1A 3MKLA 4ZYAA 4JBAA 5CVVA 5IPAA 5E3NA 3Q5FA 4F3QA 3U21A 5J8CA 5FD5A 3L2RA 1XB4A 4A2UA 4CCMA 1SFOJ 4HLYA 3W6VA 2HXIA 4BKXA 2R7FA 4UB8C 1Z3YA 4W1UA 3PFYA 3FZVA 2DQRA 4BQQA 2LY9A 2Y0SN 3WGHA 3WU2C 2E5ZA 4YELA 3HOWJ 1IRGA 1FEXA 1JKOC 2CG4A 2E60A 3K9TA 1ZRFA 4WXDA 4XKVA 2MFZA 2FNAA 4CUGA 2DA4A 4BJ6C 5GTIC 3A01B 4A3BJ 4BHPA 5DDGA 5L3EA 4OMYA 1XMKA 4RLFA 3OS1A 2KJBA 4A5NA 1I3AA 1FSEA 2DK8A 2O5RA 4IXAA 4CYDA 2DODA 1KU2A 5TISC 5M5YJ 4IO9F 2LKPA 1TWGJ 1D1CA 1TC3C 1IJWC 2VE9A 3JCUC 3JRDA 1JGSA 2NYXA 1T8IA 5BNGA 5IYCJ 3G1OA 5FFZA 2K3PA 2RN7A 2NNYA 2NVXJ 4NQWA 5GADJ 2XF5A 3COAC 1T95A 2L5QA 3KCCA 5TJJA 3IKVA 1S72I 5F04A 2EBIA 3BZCA 1ITYA 3J7ZI 1E3HA 1XPXA 2HXOA 2ZFUA 1J7KA 1F9NA 4B1RA 2ZSHB 4AWXB 3HBLA 1JJ6C 4EJWA 2HTSA 5M5WJ 1Z9CA 1X1AA 3MZYA 4EM2A 4E7JA 1B8IB 5BQTA 4BQOA 4F91B 3CDIA 2DFFA 2K3FA 1G4DA 1YJWI 2DU9A 4YIFA 4F93B 2CQQA 4Y15A 3VYSB 4UUSB 4FX0A 4OMZA 1QBJA 1VQLI 3BR0A 5CVRA 4EMSA 4XRSA 4XRFA 5FJ8J 4WX9A 4DIQA 1K61A 2XPWA 3QRFF 2BZTA 1EA3A 3HM5A 3F22A 4HF0A 2ETHA 2F2EA 2Z3YA 3EQLF 1SC7A 3QOPA 3ZQLA 1VQKI 5C3EJ 3J7YJ 3S3NA 2VJIA 3K10A 5J47A 2XROA 2ZKZA 1NHAA 2F6CA 2VONA 1QVTA 2IJLA 3WHBA 1X2NA 1I6HJ 1REPC 3F8MA 5K5QA 1RR7A 1HW1A 3S3MA 1X2MA 5TRDA 1ON1A 1B9MA 2F5VA 3FWEA 3DCFA 3VYTB 2ZJQF 3HPHA 1MBGA 4IEJA 1F36A 3HXLA 5FKLA 4XR6A 1OR7A 3ZMVA 5DS9A 2EPFA 4OINF 4AVPA 1YS6A 4CCLA 3E6MA 1WJDA 3CMMA 1B4AA 2M4GA 3PUFA 2LBFB 4A3LJ 3BG7A 5JVTA 1YX3A 5EEGA 2X6XA 2V79A 3FXOA 2W4SA 5D5XB 2XF6A 3FISA 2ZJPF 2XHKA 4PGHA 4Q5SF 2B7EA 2DQLA 2H8WA 1BR4A 1FLIA 2ISZA 2UUZA 4JYKA 3P5JA 3F23A 4BY1J 4OAYA 1OLTA 4YFNF 1K7AA 2HWVA 3M8EA 3GFJA 2RQPA 1ETYA 3PNTA 1CQTA 5HLHA 1XDSA 1VQOI 1XD7A 3CP2A 1YTYA 4XLNF 4JX6A 2CUFA 1K4TA 2F4IA 2CGPA 2O7OA 1UHMA 2XUBA 2DW4A 2IA0A 1W0UA 1ZELA 1TLHB 2RC4A 3KEYA 4HSRA 4CO8A 3JR9A 2IRFG 1VF9A 4NQWB 1FMVA 1L0OC 4P9UA 2L02A 2A6HF 2X1DA 1FIPA 5ILSA 5IP7J 1BBYA 1QNTA 4IHXA 2AXLA 3DEWA 1IW7F 2DMNA 2ESNA 1U78A 2M0CA 1DGWY 3OYIA 3F8NA 1LEAA 2Z33A 3IHUA 1U2WA 2HVSA 2LC2A 1M1EB 1LFBA 1D5VA 4ESFA 5JHUA 1H9GA 4G7HF 3A02A 3A0BC 3ZXSA 2V9PA 5EYRA 3W3CA 3M7GA 2R7SA 3O8GA 1ZR4A 1XSDA 3SDGA 2QSHX 2V4JC 3MCZA 1TW3A 2CW8A 4XLHA 2HVRA 1HC8A 1VQPI 1ETOA 4NNJA 2H09A 3GEZA 1VQMI 2E7XA 1WKMA 1OJLA 3RJPA 5FKKA 2DXIA 3PIPF 2R92J 1IDYA 2IT0A 3ZMTA 3MQ0A 1FSHA 3IH3A 4I0BA 1HCRA 4HNVA 1O3QA 5DEQA 5E3LA 2VI6A 4XSXF 3Q9VA 1GDTA 4B3XA 1TZLA 4M3FA 2L9NA 3ELKA 1NG7A 5IT9K 3OYCA 5J4YA 4ABZA 1FYKA 3C3WA 2OD5A 2K4BA 1FOWA 1H9TA 1R23A 3DBRB 3VYUB 3JAMK 1GT0C 2L54A 3PQKA 4UXNA 1XGOA 2J5OA 2BBYA 5AONA 3WTUC 4BDZA 1V5GA 3H0DA 1K83J 2HI3A 1W1WE 2HPIA 3HRTA 4CCOA 3LAJA 1Z67A 4RGSA 1YW8A 3U1KA 1NK3P 5FGMA 1X3WB 4CCNA 1XS9A 3LNQA 3GTKJ 4BJ5C 1ODDA 2BVMA 3CC4I 3CLQA 3LFUA 1USTA 4JP0A 2V1DA 3HOUJ 3GTLJ 4EATA 1TQMA 1U5TB 2VOPA 1YJNI 5GPCA 5GAHJ 2WA0A 4ZYGA 2FA5A 2LMDA 1DPUA 3CCQI 1W5CC 4LMYA 5L3DA 2B63J 3ZMUA 2KIUA 3TO6A 3TOAA 2NXNB 2PEXA 4HW0A 1EV7A 2L4AA 2CMPA 1R58A 3KP6A 4PFOA 2FBHA 2P4WA 1YS7A 5C4XJ 3TO7A 1G2HA 4RS8A 2DMQA 5L3CA 1OCRH 2DFIA 5E1XA 2K9SA 3K4BA 2BW3A 2Q2EA 3AG4H 1YRNA 3BCBA 4U0VA 1L3LA 3DPLC 2KDOA 2ZMEB 2DMTA 1HDDC 1FOKA 4UNOA 2F48A 5C44J 2FU4A 4XORA 1T2KA 1ETVA 5FB2A 5FLVA 2H8RA 1XGMA 2ZBKA 2IAIA 1D1AA 3IAM2 3GYHX 1SFEA 3I4PA 1VQ5I 3FM3A 2JK3A 1A6IA 1OCZH 2ZSIB 1X3UA 5K7FA 1WI3A 2QUFA 1Y8QB 2R7ZJ 2C6YA 3DQVC 2R7DA 3HG9A 4HX8A 1IN7A 2BEOA 1ZG3A 1SMYF 2JPBA 5K5OA 1UJ8A 3R4KA 5B66C 2LKSA 3DKWA 3P7NA 2HOTA 1RZ4A 3GMEA 1OCCH 4E4HA 4RAZA 2JUCA 4NHJA 1MZBA 1WVRA 2CQXA 2DA6A 2FE3A 2IA2A 2N8GA 3BJOA 4RM3A 4ZH4F 5KHDA 1SVOA 2XPVA 3OYEA 2Y69H 3O3KA 3OOPA 2M34A 1KU3A 3DKYA 5K7HA 3HSEA 4KT6A 1USSA 4IHVA 3CC7I 2GXBA 1FP1D 2RDPA 3REOA 1VQ4I 2W57A 2VOOA 1MBEA 3M07A 3K70C 2X6OA 1R5ID 3UNGC 2R5ZA 1P4AA 4DOZA 2AQFA 2M7BA 2L01A 3ROUA 3JW4A 5F0FA 3S2HJ 4X6AJ 2QZ8A 5IP6A 3TW7A 1PVEA 1O4XA 4E7SA 2H6BA 4QSHA 4AIHA 2KDZA 1GVJA 4RAFA 2EJRA 2IBDA 5EGOA 3GTPJ 4BBSJ 4Q4ZF 4IVNA 1Y6IA 4KICA 3MKYB 3W6JB 1OMIA 2WY7Q 2P8TA 4EGZA 2NNNA 3G6EI 1MNDA 2UZKA 3T0YA 3BOQA 2IP2A 3L7WA 4ANJA 3ZOBA 3O2PE 5ICFA 1RETA 3DTIA 1PJRA 1TQPA 1BI2A 1ERDA 2PG4A 2XRLA 3L2QA 1WZ2A 1SVMA 2A6EF 5KAIC 3CJTB 1D0XA 5DM6F 4AIDA 2FJ1A 4IOCF 5D8KB 3OYDA 4DYCA 1A04A 3BR2A 3WTVC 2V1NA 4A6EA 2ZO4A 3OV8A 2R7OA 1S8NA 2RAEA 3CLOA 1BA5A 4IRIA 4I0AA 1QQIA 1S29A 2BY2A 1XX5A 1DDNA 1HW2A 1MSEC 3WTZA 2JJ7A 1VQ9I 1J2XA 3K4NA 3EUHA 2VKHA 5D5UB 3JRBA 3A01A 3RZOJ 3DEUA 4L9JA 4AYBA 2GA2A 3RYPA 3CD6I 2OBPA 4A69C 2O3FA 4PZJA 1IUYA 5IYDJ 3CUQA 1Q1HA 4CXFA 2K5CA 3LAPA 4A3CJ 5E1ZB 4II3A 5A2QK 3OYBA 2RGVA 2XGEA 3BP8A 4BH9A 3ZN1A 3CP8A 2R7QA 1UZCA 4L5IA 3KP4A 3QOEA 3OS2A 4KYWA 2VT2A 3J80K 3JRAA 3ML6A 3LWFA 1YITI 3AKZA 3WU1B 4PCQA 3T8TA 1X1CA 5CLSA 3D5RC 1O3RA 4RAYA 1QHGA 3KLOA 2EFQA 1MJAA 4KMFA 4IRHA 2Y9YA 1WWXA 4LB5A 2HR3A 5KVRA 4LOCA 1STZA 5H6RA 3F6VA 4YIRX 2DFEA 4HA8A 1TBXA 4EJTA 4XM3A 2NS0A 3F72A 5CPRB 4LLGF 3IRQA 1B1BA 3DBHB 2KFDA 2VBXA 3ZN0A 5D5WB 1RNLA 1BR2A 2HZDA 1WHUA 1R1TA 2VPRA 3F8CA 1T6SA 1MGTA 2QBYB 2JA2A 1LVAA 1Q1VA 2KRHA 3V42A 4ZZDA 3U1DA 4CYCA 4BE0A 4WXCA 5AIPA 2CW0F 3BJAA 1T39A 3MKWB 1SD7A 3LFKA 1PUFB 3OYFA 1W36D 2CH0A 3LSGA 3ZPLA 2VKEA 4H0EA 2LREA 3BR5A 4XSZF 2GXGA 2EIKH 3RYRA 1JE8A 2OCEA 3ABUA 1P7JA 1W7PB 2XAFA 3ULQB 3SFZA 4IL6C 4M9XA 4ZTFA 2EZLA 4AUXA 1GV5A 2MD5A 3HOTA 2UXNA 1O7LA 1TP4A 1JHHA 3L2WA 4ON0A 2K02A 4PJMA 2D1VA 3Q0VA 2DT7B 3IWZA 3FMRA 3HUGB 2VQHA 5E8GA 4I2OA 3HOYJ 3B6CA 5B5EC 3K4JA 3LOCA 1MKMA 4LG0A 2H94A 4HNTA 1XGNA 3GXOA 2BGCA 1SAXA 2Z16A 4A3KJ 1TW2A 1D0YA 2K4JA 1UCRA 1V55H 2GIVA 1DGRM 2L9VA 2MLKA 5CVJA 5IOZA 2W82A 2JQ7A 3H3VK 4N9HA 3BR1A 2KKOA 4M9SA 5ED4A 3Q3SA 5E8IA 1QPIA 4DZJA 5FD6A 1BM9A 1S7EA 2L7FP 3VYRB 3IH2A 5J1RA 3E0JB 3A2KA 3FM5A 3ZCOA 4KITB 3PO3J 2HYJA 3KIOA 1RIOH 1BOAA 4BJTA 4BL0B 3KP7A 3MMYB 3ASOH 1X1BA 4ESJA 1CGPA 1S5LC 3RKYA 3WE3A 3KYDB 4B44A 3KP2A 2CUJA 4K2EA 3X2QH 1H8AC 1N25A 3OL3A 3D5SC 3PSFA 1PUFA 2O8KA 3QPLA 2ZNZA 3VSKA 2QEXI 2W48A 4C30A 3IH4A 3QYFA 2W25A 3OSFA 3GTOJ 1JUMA 2DO7A 2PFBA 3HHHA 4HZFA 4ITVA 4C9YA 2DK5A 4RA2A 2YX7A 3M8FA 5HDGA 2HTJA 4R8HA 2GA1A 2XGXA 3G3ZA 2RNGA 2Y9ZA 2VODA 1TL8A 1ONVA 2VBWA 9ANTA 4ZDPA 3RQIA 1N75A 3TGNA 2QA4I 4C2UA 1EH7A 1BN5A 3EUHC 2JA8J 3R6SA 2R7VA 2KT0A 2QKLB 3IC7A 1QVUA 1LVKA 2E35A 4I09A 5DD8A 1FPQA 1ZGWA 4BUPA 2EZHA 5B3SH 1Z21A 2CQ7A 3PUBA 3Q0WA 3G73A 3ZMDA 5JHFA 5M3MJ 2A69F 3WTXC 1Y0NA 2BV6A 4GCVA 3S2WA 3ZR8X 3WHCA 1YOVB 4FT8A 1W5SA 3A0HC 3RPUA 1YIJI 3RQ4A 4BQNA 2V26A 3I64A 2D1HA 1JUPA 2RKHA 5K7ZA 2O8XA 2COMA 4L9TA 4J01A 1MNMC 4LG0B 1Z7UA 2KL4A 2J5PA 2XDVA 4J00A 4U87A 1BW5A 1TNSA 2VQCA 2VASA 4BHCA 3RPQA 3LSIA 2KZGA 3S93A 3CC2I 2WAQN 1PP7U 1BC8C 5LRSA 1W0TA 4A3MJ 3ABTA 2W24A 3WG7H 2EH3A 2BE5F 2HGCA 1TQIA 2JA6J 3E7LA 2JT1A 3PO2J 1BIAA 2KIFA 1EKEA 3HSRA 2VJJA 1QZZA 1G3WA 1ZGAA 4PUSA 3OL4A 5DCMB 2STTA 2P5KA 3TL4X 3BJ6A 4V19K 2BY1A 4Q48A 1X1PA 1QA6A 3NARA 4XRSG 4UB6C 1X4PA 5E20A 3KP5A 3GTMJ 5L3BA 2JZYA 1T98A 1P4XA 3WTYC 3L00A 3W6KB 2ECBA 3EYYA 4GYGA 6PAXA 1MBHA 2IXSA 1S7OA 2B9SA 4OIQF 1EH8A 2ADUA 3CZ6A 4C2TA 1G59A 4DNCA 3ERED 3S3OA 2TCTA 5F1JA 4UVBA 3ZRGA 4WCGA 1D3YA 2ECCA 3BCAA 1W4MA 4EJUA 1KQ8A 5K1YA 3BTLA 5HVQC 1QZYA 2LRDA 2A05A 2FMLA 5EJCA 1V5FA 5FLXK 2EQRA 4MLOA 2E7WA 1YLFA 2CFXA 4BEHB 1MMDA 2JSCA 1ZARA 1LPQA 3FMSA 3GO5A 3F8BA 1F43A 5E17F 3LSJA 2FQ4A 5IP9J 1SD5A 2EIMH 2XAHA 3I5UA 3ISPA 5EF6A 1MBKA 2W85A 4UV9A 2HQAA 2EA2A 4IHWA 3FMQA 4XQFA 1UFMA 3BQZA 2LNBA 4DYQA 1I3QJ 3DV8A 3PNYA 4M6YA 4V2GA 4L0ZB 2OTJI 5M3FJ 1AOYA 1W7PD 2O61A 3ZQQA 1XCBA 3HEFA 3D5LA 2CUZA 4LD5A 4HLXA 5CQEA 2F4MB 3CDLA 3FHNA 3K4LA 5B1BH 4EJVA 2KIQA 4D7NA 3LMMA 2L7MP 1MH4A 4L18B 1J09A 2P81A 3E5XA 4RB2C 2L9SA 2LOOA 3CO6C 2O0YA 3CUQB 3T8RA 5D6EA 3IP4B 2FRHA 5F64A 1R9TJ 1T56A 3V7RA 3LSRA 1PP8F 3E3VA 5HLGA 1RUOA 1TWAJ 2WV0A 2QQ8A 5CQGA 1QO0D 3HRSA 4KISA 4FX4A 4S0HB 1JKRC 2K40A 2HZTA 2DJIA 3LL7A 1UELB 2WBMA 1SMTA 1LDDA 3DU5A 2QKMB 4G8XA 4V2FA 2M8EA 3P9KA 3A1YA 2ME0A 3VWBA 1IN6A 2AXTC 3VPRA 1FTZA 1R22A 4AVZA 1X3ZB 3E5QA 1WCMJ 4PFPA 4MFDA 4PJLA 1QU3A 2X1EA 2YSRA 3NWTA 4U0YA 2XKOA 3I55I 3C2HA 3IRRA 2X6YA 1FY7A 2VPLA 3GZNB 4R79A 1U0JA 2MA3A 2MC3A 4E70A 1SFUA 1IV6A 2FF4A 1R49A 1I1SA 2DTRA 1TWFJ 1ZTRA 3F0CA 2VXZA 2IGOA 2XSJC 5H20A 1E0EA 3F3XA 4ENNA 2CW7A 4Z2YA 2LBFA 5LD2C 3MZ8A 1WRJA 1HLVA 3V8JA 5BPIA 2CFOA 1HOMA 1R6RA 4FTHA 1UHSA 2QGUA 1XTAA 1O7FA 4EGYA 1MJBA 2ZMEC 1DP7P 4GO1A 4HDUA 3QYBA 2P7CB 3FBIB 1RI7A 4Y3OA 4A3FJ 1T38A 5HLTA 4A93J 4XKCA 2E5NA 5IT3A 2E19A 2LK2A 3R61A 4MFEA 1AKHA 2DOAA 1MMAA 3BLYA 4YRVA 4G7ZF 4UHTA 3PJRA 2QYOA 2CYYA 1ZG5A 3QPTA 2VJ5A 2LP0A 1B8IA 4GYIA 3DPUA 3LA7A 4FCYA 1POGA 4WWCA 3HOSA 2XF7A 2ZJRF 1MW7A 5IT9Z 3ONQA 2DFHA 2LH9A 4M73A 1LE8A 4BE2A 1F5TA 3AG2H 5J1YA 1P92A 1OCTC 2NOGA 2M45A 4GGGA 2EINH 4G6QA 1T08B 1MMGA 1R00A 2UWMA 5F0HA 3CF2A 2ACJA 2FBKA 3PSIA 3CJRB 1H89C 1VZ0A 4ETSA 2RNJA 4MEXF 3U9GA 2CV2A 5ICCA 4BS9A 3DXJF 3ABMH 1Z77A 4QLCU 5DM7F 3HTSB 3CCJI 2R3SA 1RKWA 3SHFA 3OWTA 2AO9A 3VEPA 3G71I 4Y17A 4N4OB 4L5JA 3V4GA 2OZ6A 2QSGX 4MNUA 5IYBJ 4A3JJ 4LG3A 1HF0A 2H27A 2P6TA 2IVMA 1ZGJA 3J81Z 1GLNA 1BI1A 1BJAA 2VBYA 2GOXB 4BQAA 1IF1A 4U7BA 4HEA2 5JLXA 4W97A 3G1LA 1FYLA 3WTTC 2F5CA 2EFOA 3E6BA 3KE2A 2X85A 2R0QC 4IX7A 3TMOA 4HRIA 1FOYA 2A68F 2PMZN 1RUNA 1IN4A 2JPCA 3CTAA 4CDGA 4BDYA 1KYWA 2P5LC 3LSKA 2L2OA 2NAZA 5L3FA 3S8PA 3GTGJ 1WH7A 4AD9A 4F92B 5FKMA 4U7DA 3KFWX 2NOJB 1DU6A 1GXPA 3OIQA 3HKZA 4JQFA 1PUEE 2WB1N 2H1LA 4GRIA 2K9NA 5F1RA 5J8FA 4FE7A 4XKBA 1LNWA 1G6NA 3T1BA 2R7WA 2KLOA 2G9WA 1CF7B 4HDVA 5LHIA 3V7SA 3BY6A 3JAMZ 3OYKA 3SXYA 1R7JA 4XOTA 2JA7J 2R7UA 5FO5A 4HSTA 2Y2ZA 3OYGA 1H0MA 3I54A 2XSDC 3F9KA 4BXUA 3ZMZA 1G3YA 3H0GJ 1UHWA 5CVUA 5FKNA 1IAWA 3M3YJ 2BY3A 1RR8C 2PQ8A 1S9HA 1FP2A 3P9CA 4RGXA 3QU6A 1UG2A 1D8JA 5LBQA 1J5YA 3CJNA 2KRFA 1IUFA 4IOAF 3ABKH 3SEZA 3IL2A 1KA8A 2DA5A 3HIFA 3MVPA 4D0PA 2EWNA 4LB6B 3B73A 3FHZA 3H35A 5D4RA 2DOEA 2BHZA 3KEOA 4XONA 3TEDA 4PSWA 1SFXA 3V8KA 3DLAA 4Y33A 5FLXZ 5ERIA 5HODA 2K7LA 1E17A 2PBIA 4HNUA 2FSWA 2LF8A 2HVQA 2ZB9A 4G6TB 2DT5A 4NUBA 3E6DA 4G12A 3DFGA 3IUOA 3CMYA 2NVTJ 2E2IJ 5EZHA 4OIRF 2OV7A 1F1ZA 5EEHA 3GUDA 5KAFC 1FBQA 5L3GA 4ZDOA 1TT5B 1AHDP 4DJAA 2BXZA 2M5WA 4RBOA 1VFCA 3I58A 4KNYA 3K4CA 4YEJA 1GUUA 2VKVA 3LSTA 3QPSA 1HSTA 3IKTA 2R7TA 3BROA 1YI2I 2CQKA 1CF7A 4OIOF 3HGYA 2ID3A 1IG7A 2IS1A 2ZXWH 3B02A 1SANA 1JT0A 3GTQJ 1UMQA 4GFBA 4II2A 2M4KA 4S04A 1MNEA 3I53A 4XLCA 2CQNA 3KP3A 1FOXA 3DU6A 1UG0A 5J40A 4BACA 3N4MA 3S1QJ 2WAEA 2Y0SA 4EJOA 2PJPA 2DMUA 3PL8A 4A0XA 3JRGA 1I6XA 2K9MA 1XCVA 3BR6A 1YFHA 3OS0A 2YU3A 1ZLJA 2QQ9A 2EFNA 2QENA 3FDYA 3OSGA 3ECHA 4A12A 3TKYA 5C4JJ 4G7OF 5J3LA 1I27A 1ENHA 4EVIA 4NBQA 5LEJA 2PJRA 3EUAA 3BC8A 1WGXA 5DUIA 3CO7C 2GBYA 4Y4RA 4HF1A 1IXCA 4IZZA 3ECOA 3NEUA 1HBXG 2P5VA 3PM1A 1MMNA 5HLIA 5HDKA 2IS6A 4IRGA 5D4SA 4PK4A 1IN8A 1U9OA 4M6VA 1FYMA 4A3GJ 3I59A 3JRCA 1VQ7I 4CHUA 4MTEA 3TP3A 4CZCA 2WC2A 1R1VA 2CWEA 1ZR2A 4GDFA 2LLKA 1RESA 1KU7A 4KN7X 3S1NJ 3BZ6A 1P9QC 1NH3A 3CCUI 2O9LA 3T5XA 2XRNA 3JSPA 2EZIA 3CJQB 4O5VA 1QGPA 3R0AA 4IJAA 1ETXA 3C7JA 3L9FA 2AS5F 2ZCWA 2Y30A 4CICA 3LQRA 4AIKA 1RPWA 2Z99A 4L9VA 3FKJA 4NC8A 4E6KG 1KZHA 5GAEJ 2VUMJ 4PJ0C 1O3TA 1BI0A 2OA4A 4EM1A 1YW9A 5K5RA 2ISYA 1ZQ3P 2XGCA 2R5YA 1U5TA 5J6XA 2DTZA 2WTEA 2Z5UA 1J59A 1TTYA 4ZJZA 4A6DA 4CH7A 3HOZJ 1Z1DA 1ETKA 5LRRA 2R5ZB 2WB1A 4JX4A 3ZGKA 1MIJA 4AM3A 3CMAI 5M5XJ 4CYCB 2ELHA 5J1UA 1JHFA 1MDMA 1FMWA 1SVLA 4B48A 3M1EA 3IV5A 1U3EM 3A03A 4X0GA 2COBA 3DTEA 2HQRA 1N77A 1DU0A 1K6YA 2IGKA 5FRMA 2JSPA 1MSFC 2Q8KA 1SFKA 1K4SA 2MH2A 1FJLA 1LQ1A 3H5AA 2E36A 1GV2A 5EGOB 5HNFA 1VTNC 3JTGA 3S14J 3S16J 2LSOA 1J0RA 3TBIA 5IOYA 1JGGA 2FNPA 1BR1A 2LDUA 5BOXA 2R4GA 4CA0A 3SZGA 5FLMJ 1Z0XA 3JSOA 4YIIA 1K78A 2VC0A 4AIJA 4DW6A 2FEZA 1J75A 2E34A 2STWA 3WTWC 1Y0UA 2NRAC 1FBSA 3CUOA 4KUMA 2GOMA 5KCMA 2XV4S 1HXDA 3ZQFA 3OYJA 2OF7A 3FXMA 3H92A 3I3LA 4ENJA 1IO2A 3JTHA 4XLAA 3A4CA 3MZHA 3LQQA 3CUQC 4IHYA 3S17J 4QPOA 2PJRB 2XPUA 3BG6A 4FE4A 2LKXA 1J9IA 4M3GA 2M30A 3C18A 1XC5A 1UAAA 2I5UA 3H1CA 2OPTA 3MEXA 4NC7A 1Z91A 2MG4A 3FK7A 3N05A 4RGUA 4IPAA 2KZVA 2QSFX 1T0FC 4E7HA 3OY9A 2L7ZA 1ZLKA 1IDZA 3H5RA 1OCOH 1U9NA 2OTLI 3S2DJ 4Y7NJ 3C2BA 2A5YB 1Z3XA 3CCYA 1QPMA 3HTUA 4XLEA 2MW8A 4HQMA 2TRTA 3ZQIA 4XN0A 2X0LA 2VXDA 2XAGA 4KT5C 1XSVA 2EA4A 2BW3B 2Q2EB 3JREA 3CQZJ 3V7CA 4WK8F 2YUSA 4LFUA 3LA3A 3GX4X 2L3DA 1LB2A 1E2XA 1P4WA 4KFCA 2K27A 4YG2F 2B0LA 1DPRA 1ACIA 4FETA 2H6CA 3OMYA 1YYVA 4HYEA 1KQ0A 3SEQA 2WAQA 1ORKA 2E2JJ 1A36A 1VQ6I 1EH6A 1HDPA 2EV5A 2D45A 2WAFA 2Z2SB 4MQ9F 5GP9A 1R5GA 3K4MA 2JVGA 2R7XA 1WJFA 2CSOA 1Z7LA 3RZDJ 2W00A 2MYSA 1FTTA 4BU2A 1W7PA 4Q47A 2AQEA 2CS3A 1HW5A 3BR3A 1MMSA 2HKOA 3H3UA 3E1SA 2UV1A 4EM0B 3QPHA 4F52A 1R4NB 1WJEA 3DLLF 4PJJA 1D8KA 2IPQX 4EV0A 4RMNA 3FXRA 1ZRCA 2E1NA 3D1NI 4FASD 3GW2A 2DAOA 1HA8A 3BQYA 3K6GA 4KIFA 3H36A 3WE2A 1S6LA 3DF8A 5DUKA 2DYRH 2JTVA 4JX5A 4PGGA 3GZ5A 4N0BA 1D5YA 2NS7A 1OYYA 1WPKA 4ZDLA 2GZWA 5HS8A 3HSFA 3F6OA 2A3SA 5EG0A 1YG2A 3S32A 4B8XA 3TP0A 2LY1A 1B72A 3K1MA 2HPMA 3CCRI 2ZNYA 4M9ZA 5LLQA 2CU7A 5LGUA 4RB1A 1AWCA 1G3TA 1AKHB 2EILH 3W2VA 1MBJA 5ICEA 3PIOF 1BW6A 2ELKA 3OYHA 3SDBA 2JRMA 3LSPA 4BXFA 4KIBA 5HOOA 1OFCX 3AG3H 2OQRA 2Z9OA 3PFIA 1T0FA 1XN7A 4B09A 4XOPA 2V9VA 3EUKL 1VQ8I 1B72B 4MEYF 2MC4A 2ME6A 3CCSI 2K86A 2PI0A 2VKDA 1TWCJ 1E3OC 5E3OA 3R0JA 1K6OA 2L0KA 4DQ2A 4WF2A 5DCMA 3VOEA 4HX7A 4C2MJ 2GAUA 2ZFWA 2EK5A 2M2EA 2H1KA 4XICA 2QF7A 1FZPB 3PNVA 1BJZA 2LFBA 3SYTA 3MFKA 1FX7A 1QZEA 4P1WA 1V3FA 4I76A 4ENMA 4HBLA 2ZXJA 2ZMEA 2HOSA 4KJZA 1D1BA 1MD0A 3FF5A 4XIDA 2QQAA 1VNDA 1YIOA 1IXSB 5JFRA 3C1DA 4I99C 3I9V2 1R4MB 3G4SI 2HQNA 2CJJA 2DJNA 2FOWA 2RREA 1U8RA 3K2AA 4I7HA 2D2WA 1NG6A 2E1OA 3WG9A 3NQOA 2QM3A 1IRXA 2GXAA 4IKFA 4B43A 3K1PA 5E1WA 2XB5A 3SQNA 3J7AY 1IC8A 5HS9A 4Y13A 3M1CA 3S1MJ 3CCEI 3QU3A 3RDIA 2YPRA 5FKOA 2FXAA 4RDUA 1W36C 2XGDA 1OCPA 3TDZC 5GTHC 4WXHA 3HC7A 2O03A 4BYYA 1U6GA 1I5ZA 2L7KA 2JWTA 4E7KA 1F4KA 1R5HA 5EDNA 1W5TA 3HRMA 1N78A 1T33A 2LF7A 1JJ8C 3NRVA 3L1PA 2LR8A 1HQCA 2MGQA 3TO9A 3M4OJ 3O6BB 4G9YA 1IGNA 2BHYA 4KA4A 3K2ZA 1ZKGA 3VFZA 3JRFA 2QLZA 1U5TC 3K69A 3KEQA 2DYSH 3ABLH 1TWHJ 3AL0C 3GWZA 5HDNA 3HRUA 3AAFA 1ETQA 4AYBN 3V8LA 1S3JA 5H2FC 4AU7A 2DA1A 1X58A 1YJ9I 3KYCB 1LFUP 2YS9A 4XMYA 4BXXJ 2Y0MA 4M72A 1PDNC 1NK2P 3I4MJ 4HOBA 5A2QZ 4UUSA 2CO5A 1NTCA 4A5MA 3HPGA 3K7AJ 2WWYA 3J7AO 3OOUA 2V1XA 4FQGA 4RB0A 2X9DA 2L9RA 3C2GA 4B4CA 4EQQA 2D5VA 3EYIA 2IW5A 1BIBA 2EFPA 1V54H 3HJEA 2EB7A 3SFIA 4ZC3A 5H6QA 1A31A 3NAUA 3GLLA 3L2UA 2FQ3A 3H5NA 2XKPA 1A35A 2K9LA 1Y39A 3P9IA 5GPAA 1GHCA 3LSHA 5BS6A 2CRGA 2ICWG 1WJ5A 4GXOA 3DTKA 1B6AA 1Y1VJ 3GFLA 3OR2C 1Z6TA 3FXJA 2LD5A 1OYWA 1BI3A 2HOEA 3Q0UA 1HKQA 1IRFA 3BDDA 1BL0A 4PJNA 3I4NJ 2A61A 2PMUA 2K85A 2KPMA 4OAZA 3MWMA 1EF4A 1LDJA 5CKTA 3L09A 2EZKA 3D0SA 2OU2A 2EIJH 2LTPA 2E1MB 2R5YB 4UUVA 2XC7A 4ENKA 2A07F 2LVSA 4A0ZA 1XSXA 2MABA 3VDXA 3HUGA 4D5FA 2NS8A 3UKGA 1WSUA 3MD2A 4IQ4A 2M7AA 4ASNA 1LUJB 2XAJA 2KIMA 4XLFA 3OYNA 5D6FA 5JLWA 2EV6A 3G2BA 4TV7A 5DYMA 1JUSA 4MGRA 3HDDA 2FD5A 2FMYA 1JTXA 5LGNA 1HKSA 1IN5A 2HYFA 2GLOA 1C0WA 2M3AA 4MIMA 1KGSA 1Y1WJ 3WGIA 3I59B 5EEAA 4L5EA 2DPUA 1OISA 1FWZA 3R60A 1FC3A 3FXQA 5ILVA 1MJ9A 4BBRJ 2XIGA 3F21A 4HAMA 4LK0F 1HKTA 1P2FA 2VBZA 2W84A 4XNFA 4I6ZA 3LSMA 3BG3A 4D7MA 2NVUB 3H9GA 3HGGA 5E79C 3ZP5A 2PMZA 3AG1H 4RB3C 1IXRC 1MDMB 5FRNA 3FK6A 2L4MA 2Q0OA 3HZJA 3I71A 1LDKB 2R7RA 4E7LA 1YX5A 5JR3A 5E18F 3BWGA 1JKPC 5F6FA 4D9JA 3K4KA 2I10A 1PYVA 4BY7J 3W2WA 1LFPA 1HSJA 2DDAA 3CCMI 4LITA 2IS4A 2PLYA 4QPQA 1RC9A 2M8GX 4RGRA 3E6CC 3QP6A 3ZQGA 2NVYJ 3CCVI 2ID6A 1D0ZA 4DZPA 2F5DA 4R1HA 5HNHA 4I98B 4UUTA 5B1AH 4FISA 1K79A 3TDUC 3BPXA 3VSLA 4G94A 5EG0B 2MBFA 4A0YA 1YRNB 2Q1ZB 3TW6A 3ZQ7A 1X19A 2CUEA 3KPHA 4MQVA 4P55A 4LK1F 4IHTA 2ZC2A 4I02A 4KMUX 4E7ZA 3QWLA 2VE8A 1FBUA 3IAS2 1ZH5A 1JKQC 4XKWA 3S15J 2XAUA 1ON2A 4C3HJ 5F0CA 3PQJA 2ELJA 1APLC 2E1CA 5LFAA 2FOKA 3F8FA 2KRCA 2LG4A 5JVGF 4Y52J 2FUG2 3MAJA 2DI3A 3UR3C 3OYLA 2V1UA 5EZGA 2IA1A 2RV8A 4ZTJA 3SZPA 3RI4A 3CCLI 3BPVA 4HG2A 4CGZA 1O3SA 2G7UA 2DOFA 3QAHA 1FT9A 1O57A 5CYVA 2IS2A 1WFXA 3HL2A 5BPDA 3KZYA 1KU9A 2F5FA 1YHQI 4C3IJ 2DN0A 5TGTA 3K0LA 4IQJA 3U2RA 1ZYRF 4CCKA 2YU9J 2UXXA 4N4NB 4KIGA 1BOBA 1BC7C 3RIRA 1RKTA 1Z6RA 1GXQA 1ULYA 3JRHA 4XL9A 3QQAA 2OJED 3RPUD 1UB9A 1ZN2A 1QRYA 3GVAA 2HFHA 3I56I 1SD6A 2VJ4A 3H9QA 3QODA 2OUMA 3FBNB 3RTRA 5FROA 4QIWN 1ZREA 1JI8A 2ZXIA 3EPZA 4I01A 1FIAA 4LGWA 4CCJA 3JRIA 2IGNA 4YFXF 2HDWA 1WH5A 2V7FA 4P5OA 1K78B 3O8HA 1E3PA 2A5WA 4DYRA 3RKQA 2KISA 3WGGA 1JTYA 3ASNH 2DA7A 2IEKA 3CDHA 4BHBA 1OPCA 4M3EA 2MLGA 3Q9SA 2NVQJ 1R36A 2K9QA 1Y8RB 2M1BA 4XLPF 1QHHD 3WTSC 1YE9A 2JMWA 4P96A 1KONA 1YW7A 2HDDA 3BG9A 3BT9A 2HU9A 2M0MA 3M9AA 1Z05A 4BEHA 4NB5A 2XVCA 1U8BA 1LEBA 2PMHA 4DBQA 1H88C 3KLNA 1SEUA 5CJ9A 2EFWA 3ZMSA 3W2AA 4MTDA 4RM2A 3CMEI 2KHMA 2DDBA 5LHHA 2VB6A 1I50J 3RCOA 2O6GE 1B9NA 4PSXA 5BMZA 4IF4A 3DBLB 5J4VA 2OZUA 3RKXA 4ZYEA 2VT3A 3L2VA 2KP6A 1ZK8A 2HKXA 3GCMA 4U88A 2KMUA 5LHGA 4JK1X 4YFKF 4H4KC 4EEFG 1SD4A 3H9JA 5DD4A 3HOVJ 2RQQA 2HNHA 3DEEA 3L2CA 3I0TA 1JXSA 5GAGJ 1V5EA 3J80Z 1G3SA 2JA5J 1AU7A 4XBFA 1VI0A 4G6DA 4IHSA 1EJ9A 4ESBA 2WV1A 2X48A 2YR2A 4FHTA 2QVOA 2JRTA 2PN6A 3G1MA 4HV6A 3WODF 4XK4A 4F7ZA 3B6AA 4OWRB 1WJAA 2M9HA 3HB9A 5JI6A 4M74A 4HPQA 4XRMA 3AFHA 3GTJJ 2OCCH 3VODA 2HDCA 3WU0A 3N97A 3HOXJ 2X6WA 3NWSA 3BTCA 3DWLE 2DA3A 3OIPA 3KYLA 3FXLA 2DPDA 3FKIJ 2GQQA 3SZTA 3GF2A 4HQEA 1JT6A 2VIXA 5KK1A 1YQAA 3J81K 2RVCA 2X51A 2BOLA 1AA7A 4UVAA 3HYIA 4AC0A 5F08A 4BAYA 1ETWA 1OKRA 3QYEA 4LLNA 2G7HA 4UY8I 2EV0A 2DT6A 2XB0X 2KJCA 2CV0A 2GWRA 2G0EA 3AL0B 3TOBA 2BVLA 1I39A 2BYVE 2WADA 4LLLA 2HEOA 4C3JJ 3BTIA 3EETA 1ZG1A 1GVDA 3DPTA 3CESA 4QTRA 3QP5A 4M71A 4XN3A 3KETA 2I8DA 2GM4A 3BTJA 3KX2A 1XMAA 2VC1A 1R1UA 3MN2A 4NC6A 1DUXC 4DBRA 3OR1C 1FNNA 1KYZA 1X4OA 4A3IJ 1IV8A 5DTDA 2MH9A 3KZZA 3CF5F 3BZKA 2OQGA 1P7IA 1IZ1A 3ZQHA 4BE1A 2QQBA 1WJCA 2Y75A 2WY8Q 3OYMA 4NDLA 2PX9A 1WJBA 2HS5A 4M3DA 4ZZLA 3RKWA 1Y56A 2F5EA 1XDUA 4BNCA 5HS7A 2V6CA 2X1CA 2TDXA 4U0WA 1RRJA 4DGWB 2E2HJ 5FFXA 4UV8A 4P9FA 2VLAA 1XGSA 3S1RJ 4HF2A 4L0YB 2P7VB 2JVHA 1WI9A 2BXYA 4X1EA 3EDPA 1TNTA 2HYGD 3KZIC 2FX0A 2FBIA 2HQ5A 3OIOA 2LY2A 1KQ9A 1VQNI 4S05A 1A5JA 5E3MA 1MH3A 2IGMA 3GFIA 1TT0A 3FIWA 1SAUA 4MO7A 3IWFA 3E5UA 4OOIA 5DCFA 2E1MC 3K70D 3FXUA 4LIVA 3ERMA 2DA2A 5D8LB 2M87A 2P6SA 1OR7C 2XAQA 3GZ6A 4B3AA 2W7NA 1ZAOA 3OYAA 3GLXA 3H3ZA 4ZYDA 2ZXHA 4M6XA 1ZRDA 3VB2A 1LJ9A 2A6TA 3TQNA 4E7IA 4CZZA 4CSWA 1DP3A 4HV5A 5IY5H 2E71A 3HKZN 5CVIA 3RSNA 2MSYA 1OQYA 3M8JA 4F55A 1V4RA 2ZJ2A 4O6JA 4HX4A 3FXKA 4MHGA 2YX4A 1OYIA 1LE8B 4KDPA 2VQLA 5F27A 1DQUA 2Y48A 4D5CA 1B59A 2DCEA 2Z1DA 2VN2A 3FX3A
chains in the Genus database with same CATH topology
2DYRH 3ASNH 3AG3H 5B3SH 2EIJH 2EINH 2Y69H 1OCZH 1V54H 3ASOH 3WG7H 5B1AH 3AG1H 3ABKH 1OCOH 2DYSH 3ABLH 2EIKH 3X2QH 5IY5H 1OCRH 2EILH 2EIMH 2OCCH 3ABMH 3AG4H 1V55H 5B1BH 1OCCH 2ZXWH 3AG2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR H;  3ASN H;  3AG3 H;  5B3S H;  2EIJ H;  2EIN H;  2Y69 H;  1OCZ H;  1V54 H;  3ASO H;  3WG7 H;  5B1A H;  3AG1 H;  3ABK H;  1OCO H;  2DYS H;  3ABL H;  2EIK H;  3X2Q H;  5IY5 H;  1OCR H;  2EIL H;  2EIM H;  2OCC H;  3ABM H;  3AG4 H;  1V55 H;  5B1B H;  1OCC H;  2ZXW H;  3AG2 H; 
#chains in the Genus database with same CATH topology
 3K1N A;  2QCO A;  3GFM A;  4L9N A;  5LGT A;  2MD0 A;  5D5V B;  3SJM A;  1A6Q A;  2KQR A;  4UVC A;  4M3B A;  2F4O B;  3DP7 A;  3MKZ A;  1IRZ A;  1MBF A;  2Y31 A;  4RLQ A;  1YO5 C;  2AHQ A;  4N9I A;  1LKX A;  4OIP F;  3HHG A;  1R71 A;  2X4H A;  2VQG A;  2VL8 A;  4D1Q A;  5ILU A;  2P0W A;  1ZHF A;  1X1D A;  4A3E J;  3DKX A;  2LYC A;  2DMP A;  4RAG A;  4PDK A;  2V9K A;  2ESH A;  4BGD A;  5DV5 A;  4ZYH A;  4OU0 A;  1XMX A;  2QWW A;  3LA2 A;  4LJZ F;  2JUG A;  4O3M A;  2R93 J;  2DBB A;  4QWQ A;  4KN4 X;  2OAZ A;  3ESW B;  1XG1 A;  5KNL A;  4Z6Y A;  4J19 A;  4A3D J;  1I1G A;  3BG5 A;  2QBY A;  3GBG A;  1WQ2 A;  1P6R A;  2HOA A;  4LIU A;  2JN6 A;  5LEK A;  5AIQ A;  2BY0 A;  1S7A A;  2DLL A;  3ZQC A;  2V6E A;  2OC6 A;  2GIZ A;  3E97 A;  2W1O A;  2XAS A;  5ICG A;  4B47 A;  1G8X A;  4JOM A;  2CV1 A;  3MKL A;  4ZYA A;  4JBA A;  5CVV A;  5IPA A;  5E3N A;  3Q5F A;  4F3Q A;  3U21 A;  5J8C A;  5FD5 A;  3L2R A;  1XB4 A;  4A2U A;  4CCM A;  1SFO J;  4HLY A;  3W6V A;  2HXI A;  4BKX A;  2R7F A;  4UB8 C;  1Z3Y A;  4W1U A;  3PFY A;  3FZV A;  2DQR A;  4BQQ A;  2LY9 A;  2Y0S N;  3WGH A;  3WU2 C;  2E5Z A;  4YEL A;  3HOW J;  1IRG A;  1FEX A;  1JKO C;  2CG4 A;  2E60 A;  3K9T A;  1ZRF A;  4WXD A;  4XKV A;  2MFZ A;  2FNA A;  4CUG A;  2DA4 A;  4BJ6 C;  5GTI C;  3A01 B;  4A3B J;  4BHP A;  5DDG A;  5L3E A;  4OMY A;  1XMK A;  4RLF A;  3OS1 A;  2KJB A;  4A5N A;  1I3A A;  1FSE A;  2DK8 A;  2O5R A;  4IXA A;  4CYD A;  2DOD A;  1KU2 A;  5TIS C;  5M5Y J;  4IO9 F;  2LKP A;  1TWG J;  1D1C A;  1TC3 C;  1IJW C;  2VE9 A;  3JCU C;  3JRD A;  1JGS A;  2NYX A;  1T8I A;  5BNG A;  5IYC J;  3G1O A;  5FFZ A;  2K3P A;  2RN7 A;  2NNY A;  2NVX J;  4NQW A;  5GAD J;  2XF5 A;  3COA C;  1T95 A;  2L5Q A;  3KCC A;  5TJJ A;  3IKV A;  1S72 I;  5F04 A;  2EBI A;  3BZC A;  1ITY A;  3J7Z I;  1E3H A;  1XPX A;  2HXO A;  2ZFU A;  1J7K A;  1F9N A;  4B1R A;  2ZSH B;  4AWX B;  3HBL A;  1JJ6 C;  4EJW A;  2HTS A;  5M5W J;  1Z9C A;  1X1A A;  3MZY A;  4EM2 A;  4E7J A;  1B8I B;  5BQT A;  4BQO A;  4F91 B;  3CDI A;  2DFF A;  2K3F A;  1G4D A;  1YJW I;  2DU9 A;  4YIF A;  4F93 B;  2CQQ A;  4Y15 A;  3VYS B;  4UUS B;  4FX0 A;  4OMZ A;  1QBJ A;  1VQL I;  3BR0 A;  5CVR A;  4EMS A;  4XRS A;  4XRF A;  5FJ8 J;  4WX9 A;  4DIQ A;  1K61 A;  2XPW A;  3QRF F;  2BZT A;  1EA3 A;  3HM5 A;  3F22 A;  4HF0 A;  2ETH A;  2F2E A;  2Z3Y A;  3EQL F;  1SC7 A;  3QOP A;  3ZQL A;  1VQK I;  5C3E J;  3J7Y J;  3S3N A;  2VJI A;  3K10 A;  5J47 A;  2XRO A;  2ZKZ A;  1NHA A;  2F6C A;  2VON A;  1QVT A;  2IJL A;  3WHB A;  1X2N A;  1I6H J;  1REP C;  3F8M A;  5K5Q A;  1RR7 A;  1HW1 A;  3S3M A;  1X2M A;  5TRD A;  1ON1 A;  1B9M A;  2F5V A;  3FWE A;  3DCF A;  3VYT B;  2ZJQ F;  3HPH A;  1MBG A;  4IEJ A;  1F36 A;  3HXL A;  5FKL A;  4XR6 A;  1OR7 A;  3ZMV A;  5DS9 A;  2EPF A;  4OIN F;  4AVP A;  1YS6 A;  4CCL A;  3E6M A;  1WJD A;  3CMM A;  1B4A A;  2M4G A;  3PUF A;  2LBF B;  4A3L J;  3BG7 A;  5JVT A;  1YX3 A;  5EEG A;  2X6X A;  2V79 A;  3FXO A;  2W4S A;  5D5X B;  2XF6 A;  3FIS A;  2ZJP F;  2XHK A;  4PGH A;  4Q5S F;  2B7E A;  2DQL A;  2H8W A;  1BR4 A;  1FLI A;  2ISZ A;  2UUZ A;  4JYK A;  3P5J A;  3F23 A;  4BY1 J;  4OAY A;  1OLT A;  4YFN F;  1K7A A;  2HWV A;  3M8E A;  3GFJ A;  2RQP A;  1ETY A;  3PNT A;  1CQT A;  5HLH A;  1XDS A;  1VQO I;  1XD7 A;  3CP2 A;  1YTY A;  4XLN F;  4JX6 A;  2CUF A;  1K4T A;  2F4I A;  2CGP A;  2O7O A;  1UHM A;  2XUB A;  2DW4 A;  2IA0 A;  1W0U A;  1ZEL A;  1TLH B;  2RC4 A;  3KEY A;  4HSR A;  4CO8 A;  3JR9 A;  2IRF G;  1VF9 A;  4NQW B;  1FMV A;  1L0O C;  4P9U A;  2L02 A;  2A6H F;  2X1D A;  1FIP A;  5ILS A;  5IP7 J;  1BBY A;  1QNT A;  4IHX A;  2AXL A;  3DEW A;  1IW7 F;  2DMN A;  2ESN A;  1U78 A;  2M0C A;  1DGW Y;  3OYI A;  3F8N A;  1LEA A;  2Z33 A;  3IHU A;  1U2W A;  2HVS A;  2LC2 A;  1M1E B;  1LFB A;  1D5V A;  4ESF A;  5JHU A;  1H9G A;  4G7H F;  3A02 A;  3A0B C;  3ZXS A;  2V9P A;  5EYR A;  3W3C A;  3M7G A;  2R7S A;  3O8G A;  1ZR4 A;  1XSD A;  3SDG A;  2QSH X;  2V4J C;  3MCZ A;  1TW3 A;  2CW8 A;  4XLH A;  2HVR A;  1HC8 A;  1VQP I;  1ETO A;  4NNJ A;  2H09 A;  3GEZ A;  1VQM I;  2E7X A;  1WKM A;  1OJL A;  3RJP A;  5FKK A;  2DXI A;  3PIP F;  2R92 J;  1IDY A;  2IT0 A;  3ZMT A;  3MQ0 A;  1FSH A;  3IH3 A;  4I0B A;  1HCR A;  4HNV A;  1O3Q A;  5DEQ A;  5E3L A;  2VI6 A;  4XSX F;  3Q9V A;  1GDT A;  4B3X A;  1TZL A;  4M3F A;  2L9N A;  3ELK A;  1NG7 A;  5IT9 K;  3OYC A;  5J4Y A;  4ABZ A;  1FYK A;  3C3W A;  2OD5 A;  2K4B A;  1FOW A;  1H9T A;  1R23 A;  3DBR B;  3VYU B;  3JAM K;  1GT0 C;  2L54 A;  3PQK A;  4UXN A;  1XGO A;  2J5O A;  2BBY A;  5AON A;  3WTU C;  4BDZ A;  1V5G A;  3H0D A;  1K83 J;  2HI3 A;  1W1W E;  2HPI A;  3HRT A;  4CCO A;  3LAJ A;  1Z67 A;  4RGS A;  1YW8 A;  3U1K A;  1NK3 P;  5FGM A;  1X3W B;  4CCN A;  1XS9 A;  3LNQ A;  3GTK J;  4BJ5 C;  1ODD A;  2BVM A;  3CC4 I;  3CLQ A;  3LFU A;  1UST A;  4JP0 A;  2V1D A;  3HOU J;  3GTL J;  4EAT A;  1TQM A;  1U5T B;  2VOP A;  1YJN I;  5GPC A;  5GAH J;  2WA0 A;  4ZYG A;  2FA5 A;  2LMD A;  1DPU A;  3CCQ I;  1W5C C;  4LMY A;  5L3D A;  2B63 J;  3ZMU A;  2KIU A;  3TO6 A;  3TOA A;  2NXN B;  2PEX A;  4HW0 A;  1EV7 A;  2L4A A;  2CMP A;  1R58 A;  3KP6 A;  4PFO A;  2FBH A;  2P4W A;  1YS7 A;  5C4X J;  3TO7 A;  1G2H A;  4RS8 A;  2DMQ A;  5L3C A;  1OCR H;  2DFI A;  5E1X A;  2K9S A;  3K4B A;  2BW3 A;  2Q2E A;  3AG4 H;  1YRN A;  3BCB A;  4U0V A;  1L3L A;  3DPL C;  2KDO A;  2ZME B;  2DMT A;  1HDD C;  1FOK A;  4UNO A;  2F48 A;  5C44 J;  2FU4 A;  4XOR A;  1T2K A;  1ETV A;  5FB2 A;  5FLV A;  2H8R A;  1XGM A;  2ZBK A;  2IAI A;  1D1A A;  3IAM 2;  3GYH X;  1SFE A;  3I4P A;  1VQ5 I;  3FM3 A;  2JK3 A;  1A6I A;  1OCZ H;  2ZSI B;  1X3U A;  5K7F A;  1WI3 A;  2QUF A;  1Y8Q B;  2R7Z J;  2C6Y A;  3DQV C;  2R7D A;  3HG9 A;  4HX8 A;  1IN7 A;  2BEO A;  1ZG3 A;  1SMY F;  2JPB A;  5K5O A;  1UJ8 A;  3R4K A;  5B66 C;  2LKS A;  3DKW A;  3P7N A;  2HOT A;  1RZ4 A;  3GME A;  1OCC H;  4E4H A;  4RAZ A;  2JUC A;  4NHJ A;  1MZB A;  1WVR A;  2CQX A;  2DA6 A;  2FE3 A;  2IA2 A;  2N8G A;  3BJO A;  4RM3 A;  4ZH4 F;  5KHD A;  1SVO A;  2XPV A;  3OYE A;  2Y69 H;  3O3K A;  3OOP A;  2M34 A;  1KU3 A;  3DKY A;  5K7H A;  3HSE A;  4KT6 A;  1USS A;  4IHV A;  3CC7 I;  2GXB A;  1FP1 D;  2RDP A;  3REO A;  1VQ4 I;  2W57 A;  2VOO A;  1MBE A;  3M07 A;  3K70 C;  2X6O A;  1R5I D;  3UNG C;  2R5Z A;  1P4A A;  4DOZ A;  2AQF A;  2M7B A;  2L01 A;  3ROU A;  3JW4 A;  5F0F A;  3S2H J;  4X6A J;  2QZ8 A;  5IP6 A;  3TW7 A;  1PVE A;  1O4X A;  4E7S A;  2H6B A;  4QSH A;  4AIH A;  2KDZ A;  1GVJ A;  4RAF A;  2EJR A;  2IBD A;  5EGO A;  3GTP J;  4BBS J;  4Q4Z F;  4IVN A;  1Y6I A;  4KIC A;  3MKY B;  3W6J B;  1OMI A;  2WY7 Q;  2P8T A;  4EGZ A;  2NNN A;  3G6E I;  1MND A;  2UZK A;  3T0Y A;  3BOQ A;  2IP2 A;  3L7W A;  4ANJ A;  3ZOB A;  3O2P E;  5ICF A;  1RET A;  3DTI A;  1PJR A;  1TQP A;  1BI2 A;  1ERD A;  2PG4 A;  2XRL A;  3L2Q A;  1WZ2 A;  1SVM A;  2A6E F;  5KAI C;  3CJT B;  1D0X A;  5DM6 F;  4AID A;  2FJ1 A;  4IOC F;  5D8K B;  3OYD A;  4DYC A;  1A04 A;  3BR2 A;  3WTV C;  2V1N A;  4A6E A;  2ZO4 A;  3OV8 A;  2R7O A;  1S8N A;  2RAE A;  3CLO A;  1BA5 A;  4IRI A;  4I0A A;  1QQI A;  1S29 A;  2BY2 A;  1XX5 A;  1DDN A;  1HW2 A;  1MSE C;  3WTZ A;  2JJ7 A;  1VQ9 I;  1J2X A;  3K4N A;  3EUH A;  2VKH A;  5D5U B;  3JRB A;  3A01 A;  3RZO J;  3DEU A;  4L9J A;  4AYB A;  2GA2 A;  3RYP A;  3CD6 I;  2OBP A;  4A69 C;  2O3F A;  4PZJ A;  1IUY A;  5IYD J;  3CUQ A;  1Q1H A;  4CXF A;  2K5C A;  3LAP A;  4A3C J;  5E1Z B;  4II3 A;  5A2Q K;  3OYB A;  2RGV A;  2XGE A;  3BP8 A;  4BH9 A;  3ZN1 A;  3CP8 A;  2R7Q A;  1UZC A;  4L5I A;  3KP4 A;  3QOE A;  3OS2 A;  4KYW A;  2VT2 A;  3J80 K;  3JRA A;  3ML6 A;  3LWF A;  1YIT I;  3AKZ A;  3WU1 B;  4PCQ A;  3T8T A;  1X1C A;  5CLS A;  3D5R C;  1O3R A;  4RAY A;  1QHG A;  3KLO A;  2EFQ A;  1MJA A;  4KMF A;  4IRH A;  2Y9Y A;  1WWX A;  4LB5 A;  2HR3 A;  5KVR A;  4LOC A;  1STZ A;  5H6R A;  3F6V A;  4YIR X;  2DFE A;  4HA8 A;  1TBX A;  4EJT A;  4XM3 A;  2NS0 A;  3F72 A;  5CPR B;  4LLG F;  3IRQ A;  1B1B A;  3DBH B;  2KFD A;  2VBX A;  3ZN0 A;  5D5W B;  1RNL A;  1BR2 A;  2HZD A;  1WHU A;  1R1T A;  2VPR A;  3F8C A;  1T6S A;  1MGT A;  2QBY B;  2JA2 A;  1LVA A;  1Q1V A;  2KRH A;  3V42 A;  4ZZD A;  3U1D A;  4CYC A;  4BE0 A;  4WXC A;  5AIP A;  2CW0 F;  3BJA A;  1T39 A;  3MKW B;  1SD7 A;  3LFK A;  1PUF B;  3OYF A;  1W36 D;  2CH0 A;  3LSG A;  3ZPL A;  2VKE A;  4H0E A;  2LRE A;  3BR5 A;  4XSZ F;  2GXG A;  2EIK H;  3RYR A;  1JE8 A;  2OCE A;  3ABU A;  1P7J A;  1W7P B;  2XAF A;  3ULQ B;  3SFZ A;  4IL6 C;  4M9X A;  4ZTF A;  2EZL A;  4AUX A;  1GV5 A;  2MD5 A;  3HOT A;  2UXN A;  1O7L A;  1TP4 A;  1JHH A;  3L2W A;  4ON0 A;  2K02 A;  4PJM A;  2D1V A;  3Q0V A;  2DT7 B;  3IWZ A;  3FMR A;  3HUG B;  2VQH A;  5E8G A;  4I2O A;  3HOY J;  3B6C A;  5B5E C;  3K4J A;  3LOC A;  1MKM A;  4LG0 A;  2H94 A;  4HNT A;  1XGN A;  3GXO A;  2BGC A;  1SAX A;  2Z16 A;  4A3K J;  1TW2 A;  1D0Y A;  2K4J A;  1UCR A;  1V55 H;  2GIV A;  1DGR M;  2L9V A;  2MLK A;  5CVJ A;  5IOZ A;  2W82 A;  2JQ7 A;  3H3V K;  4N9H A;  3BR1 A;  2KKO A;  4M9S A;  5ED4 A;  3Q3S A;  5E8I A;  1QPI A;  4DZJ A;  5FD6 A;  1BM9 A;  1S7E A;  2L7F P;  3VYR B;  3IH2 A;  5J1R A;  3E0J B;  3A2K A;  3FM5 A;  3ZCO A;  4KIT B;  3PO3 J;  2HYJ A;  3KIO A;  1RIO H;  1BOA A;  4BJT A;  4BL0 B;  3KP7 A;  3MMY B;  3ASO H;  1X1B A;  4ESJ A;  1CGP A;  1S5L C;  3RKY A;  3WE3 A;  3KYD B;  4B44 A;  3KP2 A;  2CUJ A;  4K2E A;  3X2Q H;  1H8A C;  1N25 A;  3OL3 A;  3D5S C;  3PSF A;  1PUF A;  2O8K A;  3QPL A;  2ZNZ A;  3VSK A;  2QEX I;  2W48 A;  4C30 A;  3IH4 A;  3QYF A;  2W25 A;  3OSF A;  3GTO J;  1JUM A;  2DO7 A;  2PFB A;  3HHH A;  4HZF A;  4ITV A;  4C9Y A;  2DK5 A;  4RA2 A;  2YX7 A;  3M8F A;  5HDG A;  2HTJ A;  4R8H A;  2GA1 A;  2XGX A;  3G3Z A;  2RNG A;  2Y9Z A;  2VOD A;  1TL8 A;  1ONV A;  2VBW A;  9ANT A;  4ZDP A;  3RQI A;  1N75 A;  3TGN A;  2QA4 I;  4C2U A;  1EH7 A;  1BN5 A;  3EUH C;  2JA8 J;  3R6S A;  2R7V A;  2KT0 A;  2QKL B;  3IC7 A;  1QVU A;  1LVK A;  2E35 A;  4I09 A;  5DD8 A;  1FPQ A;  1ZGW A;  4BUP A;  2EZH A;  5B3S H;  1Z21 A;  2CQ7 A;  3PUB A;  3Q0W A;  3G73 A;  3ZMD A;  5JHF A;  5M3M J;  2A69 F;  3WTX C;  1Y0N A;  2BV6 A;  4GCV A;  3S2W A;  3ZR8 X;  3WHC A;  1YOV B;  4FT8 A;  1W5S A;  3A0H C;  3RPU A;  1YIJ I;  3RQ4 A;  4BQN A;  2V26 A;  3I64 A;  2D1H A;  1JUP A;  2RKH A;  5K7Z A;  2O8X A;  2COM A;  4L9T A;  4J01 A;  1MNM C;  4LG0 B;  1Z7U A;  2KL4 A;  2J5P A;  2XDV A;  4J00 A;  4U87 A;  1BW5 A;  1TNS A;  2VQC A;  2VAS A;  4BHC A;  3RPQ A;  3LSI A;  2KZG A;  3S93 A;  3CC2 I;  2WAQ N;  1PP7 U;  1BC8 C;  5LRS A;  1W0T A;  4A3M J;  3ABT A;  2W24 A;  3WG7 H;  2EH3 A;  2BE5 F;  2HGC A;  1TQI A;  2JA6 J;  3E7L A;  2JT1 A;  3PO2 J;  1BIA A;  2KIF A;  1EKE A;  3HSR A;  2VJJ A;  1QZZ A;  1G3W A;  1ZGA A;  4PUS A;  3OL4 A;  5DCM B;  2STT A;  2P5K A;  3TL4 X;  3BJ6 A;  4V19 K;  2BY1 A;  4Q48 A;  1X1P A;  1QA6 A;  3NAR A;  4XRS G;  4UB6 C;  1X4P A;  5E20 A;  3KP5 A;  3GTM J;  5L3B A;  2JZY A;  1T98 A;  1P4X A;  3WTY C;  3L00 A;  3W6K B;  2ECB A;  3EYY A;  4GYG A;  6PAX A;  1MBH A;  2IXS A;  1S7O A;  2B9S A;  4OIQ F;  1EH8 A;  2ADU A;  3CZ6 A;  4C2T A;  1G59 A;  4DNC A;  3ERE D;  3S3O A;  2TCT A;  5F1J A;  4UVB A;  3ZRG A;  4WCG A;  1D3Y A;  2ECC A;  3BCA A;  1W4M A;  4EJU A;  1KQ8 A;  5K1Y A;  3BTL A;  5HVQ C;  1QZY A;  2LRD A;  2A05 A;  2FML A;  5EJC A;  1V5F A;  5FLX K;  2EQR A;  4MLO A;  2E7W A;  1YLF A;  2CFX A;  4BEH B;  1MMD A;  2JSC A;  1ZAR A;  1LPQ A;  3FMS A;  3GO5 A;  3F8B A;  1F43 A;  5E17 F;  3LSJ A;  2FQ4 A;  5IP9 J;  1SD5 A;  2EIM H;  2XAH A;  3I5U A;  3ISP A;  5EF6 A;  1MBK A;  2W85 A;  4UV9 A;  2HQA A;  2EA2 A;  4IHW A;  3FMQ A;  4XQF A;  1UFM A;  3BQZ A;  2LNB A;  4DYQ A;  1I3Q J;  3DV8 A;  3PNY A;  4M6Y A;  4V2G A;  4L0Z B;  2OTJ I;  5M3F J;  1AOY A;  1W7P D;  2O61 A;  3ZQQ A;  1XCB A;  3HEF A;  3D5L A;  2CUZ A;  4LD5 A;  4HLX A;  5CQE A;  2F4M B;  3CDL A;  3FHN A;  3K4L A;  5B1B H;  4EJV A;  2KIQ A;  4D7N A;  3LMM A;  2L7M P;  1MH4 A;  4L18 B;  1J09 A;  2P81 A;  3E5X A;  4RB2 C;  2L9S A;  2LOO A;  3CO6 C;  2O0Y A;  3CUQ B;  3T8R A;  5D6E A;  3IP4 B;  2FRH A;  5F64 A;  1R9T J;  1T56 A;  3V7R A;  3LSR A;  1PP8 F;  3E3V A;  5HLG A;  1RUO A;  1TWA J;  2WV0 A;  2QQ8 A;  5CQG A;  1QO0 D;  3HRS A;  4KIS A;  4FX4 A;  4S0H B;  1JKR C;  2K40 A;  2HZT A;  2DJI A;  3LL7 A;  1UEL B;  2WBM A;  1SMT A;  1LDD A;  3DU5 A;  2QKM B;  4G8X A;  4V2F A;  2M8E A;  3P9K A;  3A1Y A;  2ME0 A;  3VWB A;  1IN6 A;  2AXT C;  3VPR A;  1FTZ A;  1R22 A;  4AVZ A;  1X3Z B;  3E5Q A;  1WCM J;  4PFP A;  4MFD A;  4PJL A;  1QU3 A;  2X1E A;  2YSR A;  3NWT A;  4U0Y A;  2XKO A;  3I55 I;  3C2H A;  3IRR A;  2X6Y A;  1FY7 A;  2VPL A;  3GZN B;  4R79 A;  1U0J A;  2MA3 A;  2MC3 A;  4E70 A;  1SFU A;  1IV6 A;  2FF4 A;  1R49 A;  1I1S A;  2DTR A;  1TWF J;  1ZTR A;  3F0C A;  2VXZ A;  2IGO A;  2XSJ C;  5H20 A;  1E0E A;  3F3X A;  4ENN A;  2CW7 A;  4Z2Y A;  2LBF A;  5LD2 C;  3MZ8 A;  1WRJ A;  1HLV A;  3V8J A;  5BPI A;  2CFO A;  1HOM A;  1R6R A;  4FTH A;  1UHS A;  2QGU A;  1XTA A;  1O7F A;  4EGY A;  1MJB A;  2ZME C;  1DP7 P;  4GO1 A;  4HDU A;  3QYB A;  2P7C B;  3FBI B;  1RI7 A;  4Y3O A;  4A3F J;  1T38 A;  5HLT A;  4A93 J;  4XKC A;  2E5N A;  5IT3 A;  2E19 A;  2LK2 A;  3R61 A;  4MFE A;  1AKH A;  2DOA A;  1MMA A;  3BLY A;  4YRV A;  4G7Z F;  4UHT A;  3PJR A;  2QYO A;  2CYY A;  1ZG5 A;  3QPT A;  2VJ5 A;  2LP0 A;  1B8I A;  4GYI A;  3DPU A;  3LA7 A;  4FCY A;  1POG A;  4WWC A;  3HOS A;  2XF7 A;  2ZJR F;  1MW7 A;  5IT9 Z;  3ONQ A;  2DFH A;  2LH9 A;  4M73 A;  1LE8 A;  4BE2 A;  1F5T A;  3AG2 H;  5J1Y A;  1P92 A;  1OCT C;  2NOG A;  2M45 A;  4GGG A;  2EIN H;  4G6Q A;  1T08 B;  1MMG A;  1R00 A;  2UWM A;  5F0H A;  3CF2 A;  2ACJ A;  2FBK A;  3PSI A;  3CJR B;  1H89 C;  1VZ0 A;  4ETS A;  2RNJ A;  4MEX F;  3U9G A;  2CV2 A;  5ICC A;  4BS9 A;  3DXJ F;  3ABM H;  1Z77 A;  4QLC U;  5DM7 F;  3HTS B;  3CCJ I;  2R3S A;  1RKW A;  3SHF A;  3OWT A;  2AO9 A;  3VEP A;  3G71 I;  4Y17 A;  4N4O B;  4L5J A;  3V4G A;  2OZ6 A;  2QSG X;  4MNU A;  5IYB J;  4A3J J;  4LG3 A;  1HF0 A;  2H27 A;  2P6T A;  2IVM A;  1ZGJ A;  3J81 Z;  1GLN A;  1BI1 A;  1BJA A;  2VBY A;  2GOX B;  4BQA A;  1IF1 A;  4U7B A;  4HEA 2;  5JLX A;  4W97 A;  3G1L A;  1FYL A;  3WTT C;  2F5C A;  2EFO A;  3E6B A;  3KE2 A;  2X85 A;  2R0Q C;  4IX7 A;  3TMO A;  4HRI A;  1FOY A;  2A68 F;  2PMZ N;  1RUN A;  1IN4 A;  2JPC A;  3CTA A;  4CDG A;  4BDY A;  1KYW A;  2P5L C;  3LSK A;  2L2O A;  2NAZ A;  5L3F A;  3S8P A;  3GTG J;  1WH7 A;  4AD9 A;  4F92 B;  5FKM A;  4U7D A;  3KFW X;  2NOJ B;  1DU6 A;  1GXP A;  3OIQ A;  3HKZ A;  4JQF A;  1PUE E;  2WB1 N;  2H1L A;  4GRI A;  2K9N A;  5F1R A;  5J8F A;  4FE7 A;  4XKB A;  1LNW A;  1G6N A;  3T1B A;  2R7W A;  2KLO A;  2G9W A;  1CF7 B;  4HDV A;  5LHI A;  3V7S A;  3BY6 A;  3JAM Z;  3OYK A;  3SXY A;  1R7J A;  4XOT A;  2JA7 J;  2R7U A;  5FO5 A;  4HST A;  2Y2Z A;  3OYG A;  1H0M A;  3I54 A;  2XSD C;  3F9K A;  4BXU A;  3ZMZ A;  1G3Y A;  3H0G J;  1UHW A;  5CVU A;  5FKN A;  1IAW A;  3M3Y J;  2BY3 A;  1RR8 C;  2PQ8 A;  1S9H A;  1FP2 A;  3P9C A;  4RGX A;  3QU6 A;  1UG2 A;  1D8J A;  5LBQ A;  1J5Y A;  3CJN A;  2KRF A;  1IUF A;  4IOA F;  3ABK H;  3SEZ A;  3IL2 A;  1KA8 A;  2DA5 A;  3HIF A;  3MVP A;  4D0P A;  2EWN A;  4LB6 B;  3B73 A;  3FHZ A;  3H35 A;  5D4R A;  2DOE A;  2BHZ A;  3KEO A;  4XON A;  3TED A;  4PSW A;  1SFX A;  3V8K A;  3DLA A;  4Y33 A;  5FLX Z;  5ERI A;  5HOD A;  2K7L A;  1E17 A;  2PBI A;  4HNU A;  2FSW A;  2LF8 A;  2HVQ A;  2ZB9 A;  4G6T B;  2DT5 A;  4NUB A;  3E6D A;  4G12 A;  3DFG A;  3IUO A;  3CMY A;  2NVT J;  2E2I J;  5EZH A;  4OIR F;  2OV7 A;  1F1Z A;  5EEH A;  3GUD A;  5KAF C;  1FBQ A;  5L3G A;  4ZDO A;  1TT5 B;  1AHD P;  4DJA A;  2BXZ A;  2M5W A;  4RBO A;  1VFC A;  3I58 A;  4KNY A;  3K4C A;  4YEJ A;  1GUU A;  2VKV A;  3LST A;  3QPS A;  1HST A;  3IKT A;  2R7T A;  3BRO A;  1YI2 I;  2CQK A;  1CF7 A;  4OIO F;  3HGY A;  2ID3 A;  1IG7 A;  2IS1 A;  2ZXW H;  3B02 A;  1SAN A;  1JT0 A;  3GTQ J;  1UMQ A;  4GFB A;  4II2 A;  2M4K A;  4S04 A;  1MNE A;  3I53 A;  4XLC A;  2CQN A;  3KP3 A;  1FOX A;  3DU6 A;  1UG0 A;  5J40 A;  4BAC A;  3N4M A;  3S1Q J;  2WAE A;  2Y0S A;  4EJO A;  2PJP A;  2DMU A;  3PL8 A;  4A0X A;  3JRG A;  1I6X A;  2K9M A;  1XCV A;  3BR6 A;  1YFH A;  3OS0 A;  2YU3 A;  1ZLJ A;  2QQ9 A;  2EFN A;  2QEN A;  3FDY A;  3OSG A;  3ECH A;  4A12 A;  3TKY A;  5C4J J;  4G7O F;  5J3L A;  1I27 A;  1ENH A;  4EVI A;  4NBQ A;  5LEJ A;  2PJR A;  3EUA A;  3BC8 A;  1WGX A;  5DUI A;  3CO7 C;  2GBY A;  4Y4R A;  4HF1 A;  1IXC A;  4IZZ A;  3ECO A;  3NEU A;  1HBX G;  2P5V A;  3PM1 A;  1MMN A;  5HLI A;  5HDK A;  2IS6 A;  4IRG A;  5D4S A;  4PK4 A;  1IN8 A;  1U9O A;  4M6V A;  1FYM A;  4A3G J;  3I59 A;  3JRC A;  1VQ7 I;  4CHU A;  4MTE A;  3TP3 A;  4CZC A;  2WC2 A;  1R1V A;  2CWE A;  1ZR2 A;  4GDF A;  2LLK A;  1RES A;  1KU7 A;  4KN7 X;  3S1N J;  3BZ6 A;  1P9Q C;  1NH3 A;  3CCU I;  2O9L A;  3T5X A;  2XRN A;  3JSP A;  2EZI A;  3CJQ B;  4O5V A;  1QGP A;  3R0A A;  4IJA A;  1ETX A;  3C7J A;  3L9F A;  2AS5 F;  2ZCW A;  2Y30 A;  4CIC A;  3LQR A;  4AIK A;  1RPW A;  2Z99 A;  4L9V A;  3FKJ A;  4NC8 A;  4E6K G;  1KZH A;  5GAE J;  2VUM J;  4PJ0 C;  1O3T A;  1BI0 A;  2OA4 A;  4EM1 A;  1YW9 A;  5K5R A;  2ISY A;  1ZQ3 P;  2XGC A;  2R5Y A;  1U5T A;  5J6X A;  2DTZ A;  2WTE A;  2Z5U A;  1J59 A;  1TTY A;  4ZJZ A;  4A6D A;  4CH7 A;  3HOZ J;  1Z1D A;  1ETK A;  5LRR A;  2R5Z B;  2WB1 A;  4JX4 A;  3ZGK A;  1MIJ A;  4AM3 A;  3CMA I;  5M5X J;  4CYC B;  2ELH A;  5J1U A;  1JHF A;  1MDM A;  1FMW A;  1SVL A;  4B48 A;  3M1E A;  3IV5 A;  1U3E M;  3A03 A;  4X0G A;  2COB A;  3DTE A;  2HQR A;  1N77 A;  1DU0 A;  1K6Y A;  2IGK A;  5FRM A;  2JSP A;  1MSF C;  2Q8K A;  1SFK A;  1K4S A;  2MH2 A;  1FJL A;  1LQ1 A;  3H5A A;  2E36 A;  1GV2 A;  5EGO B;  5HNF A;  1VTN C;  3JTG A;  3S14 J;  3S16 J;  2LSO A;  1J0R A;  3TBI A;  5IOY A;  1JGG A;  2FNP A;  1BR1 A;  2LDU A;  5BOX A;  2R4G A;  4CA0 A;  3SZG A;  5FLM J;  1Z0X A;  3JSO A;  4YII A;  1K78 A;  2VC0 A;  4AIJ A;  4DW6 A;  2FEZ A;  1J75 A;  2E34 A;  2STW A;  3WTW C;  1Y0U A;  2NRA C;  1FBS A;  3CUO A;  4KUM A;  2GOM A;  5KCM A;  2XV4 S;  1HXD A;  3ZQF A;  3OYJ A;  2OF7 A;  3FXM A;  3H92 A;  3I3L A;  4ENJ A;  1IO2 A;  3JTH A;  4XLA A;  3A4C A;  3MZH A;  3LQQ A;  3CUQ C;  4IHY A;  3S17 J;  4QPO A;  2PJR B;  2XPU A;  3BG6 A;  4FE4 A;  2LKX A;  1J9I A;  4M3G A;  2M30 A;  3C18 A;  1XC5 A;  1UAA A;  2I5U A;  3H1C A;  2OPT A;  3MEX A;  4NC7 A;  1Z91 A;  2MG4 A;  3FK7 A;  3N05 A;  4RGU A;  4IPA A;  2KZV A;  2QSF X;  1T0F C;  4E7H A;  3OY9 A;  2L7Z A;  1ZLK A;  1IDZ A;  3H5R A;  1OCO H;  1U9N A;  2OTL I;  3S2D J;  4Y7N J;  3C2B A;  2A5Y B;  1Z3X A;  3CCY A;  1QPM A;  3HTU A;  4XLE A;  2MW8 A;  4HQM A;  2TRT A;  3ZQI A;  4XN0 A;  2X0L A;  2VXD A;  2XAG A;  4KT5 C;  1XSV A;  2EA4 A;  2BW3 B;  2Q2E B;  3JRE A;  3CQZ J;  3V7C A;  4WK8 F;  2YUS A;  4LFU A;  3LA3 A;  3GX4 X;  2L3D A;  1LB2 A;  1E2X A;  1P4W A;  4KFC A;  2K27 A;  4YG2 F;  2B0L A;  1DPR A;  1ACI A;  4FET A;  2H6C A;  3OMY A;  1YYV A;  4HYE A;  1KQ0 A;  3SEQ A;  2WAQ A;  1ORK A;  2E2J J;  1A36 A;  1VQ6 I;  1EH6 A;  1HDP A;  2EV5 A;  2D45 A;  2WAF A;  2Z2S B;  4MQ9 F;  5GP9 A;  1R5G A;  3K4M A;  2JVG A;  2R7X A;  1WJF A;  2CSO A;  1Z7L A;  3RZD J;  2W00 A;  2MYS A;  1FTT A;  4BU2 A;  1W7P A;  4Q47 A;  2AQE A;  2CS3 A;  1HW5 A;  3BR3 A;  1MMS A;  2HKO A;  3H3U A;  3E1S A;  2UV1 A;  4EM0 B;  3QPH A;  4F52 A;  1R4N B;  1WJE A;  3DLL F;  4PJJ A;  1D8K A;  2IPQ X;  4EV0 A;  4RMN A;  3FXR A;  1ZRC A;  2E1N A;  3D1N I;  4FAS D;  3GW2 A;  2DAO A;  1HA8 A;  3BQY A;  3K6G A;  4KIF A;  3H36 A;  3WE2 A;  1S6L A;  3DF8 A;  5DUK A;  2DYR H;  2JTV A;  4JX5 A;  4PGG A;  3GZ5 A;  4N0B A;  1D5Y A;  2NS7 A;  1OYY A;  1WPK A;  4ZDL A;  2GZW A;  5HS8 A;  3HSF A;  3F6O A;  2A3S A;  5EG0 A;  1YG2 A;  3S32 A;  4B8X A;  3TP0 A;  2LY1 A;  1B72 A;  3K1M A;  2HPM A;  3CCR I;  2ZNY A;  4M9Z A;  5LLQ A;  2CU7 A;  5LGU A;  4RB1 A;  1AWC A;  1G3T A;  1AKH B;  2EIL H;  3W2V A;  1MBJ A;  5ICE A;  3PIO F;  1BW6 A;  2ELK A;  3OYH A;  3SDB A;  2JRM A;  3LSP A;  4BXF A;  4KIB A;  5HOO A;  1OFC X;  3AG3 H;  2OQR A;  2Z9O A;  3PFI A;  1T0F A;  1XN7 A;  4B09 A;  4XOP A;  2V9V A;  3EUK L;  1VQ8 I;  1B72 B;  4MEY F;  2MC4 A;  2ME6 A;  3CCS I;  2K86 A;  2PI0 A;  2VKD A;  1TWC J;  1E3O C;  5E3O A;  3R0J A;  1K6O A;  2L0K A;  4DQ2 A;  4WF2 A;  5DCM A;  3VOE A;  4HX7 A;  4C2M J;  2GAU A;  2ZFW A;  2EK5 A;  2M2E A;  2H1K A;  4XIC A;  2QF7 A;  1FZP B;  3PNV A;  1BJZ A;  2LFB A;  3SYT A;  3MFK A;  1FX7 A;  1QZE A;  4P1W A;  1V3F A;  4I76 A;  4ENM A;  4HBL A;  2ZXJ A;  2ZME A;  2HOS A;  4KJZ A;  1D1B A;  1MD0 A;  3FF5 A;  4XID A;  2QQA A;  1VND A;  1YIO A;  1IXS B;  5JFR A;  3C1D A;  4I99 C;  3I9V 2;  1R4M B;  3G4S I;  2HQN A;  2CJJ A;  2DJN A;  2FOW A;  2RRE A;  1U8R A;  3K2A A;  4I7H A;  2D2W A;  1NG6 A;  2E1O A;  3WG9 A;  3NQO A;  2QM3 A;  1IRX A;  2GXA A;  4IKF A;  4B43 A;  3K1P A;  5E1W A;  2XB5 A;  3SQN A;  3J7A Y;  1IC8 A;  5HS9 A;  4Y13 A;  3M1C A;  3S1M J;  3CCE I;  3QU3 A;  3RDI A;  2YPR A;  5FKO A;  2FXA A;  4RDU A;  1W36 C;  2XGD A;  1OCP A;  3TDZ C;  5GTH C;  4WXH A;  3HC7 A;  2O03 A;  4BYY A;  1U6G A;  1I5Z A;  2L7K A;  2JWT A;  4E7K A;  1F4K A;  1R5H A;  5EDN A;  1W5T A;  3HRM A;  1N78 A;  1T33 A;  2LF7 A;  1JJ8 C;  3NRV A;  3L1P A;  2LR8 A;  1HQC A;  2MGQ A;  3TO9 A;  3M4O J;  3O6B B;  4G9Y A;  1IGN A;  2BHY A;  4KA4 A;  3K2Z A;  1ZKG A;  3VFZ A;  3JRF A;  2QLZ A;  1U5T C;  3K69 A;  3KEQ A;  2DYS H;  3ABL H;  1TWH J;  3AL0 C;  3GWZ A;  5HDN A;  3HRU A;  3AAF A;  1ETQ A;  4AYB N;  3V8L A;  1S3J A;  5H2F C;  4AU7 A;  2DA1 A;  1X58 A;  1YJ9 I;  3KYC B;  1LFU P;  2YS9 A;  4XMY A;  4BXX J;  2Y0M A;  4M72 A;  1PDN C;  1NK2 P;  3I4M J;  4HOB A;  5A2Q Z;  4UUS A;  2CO5 A;  1NTC A;  4A5M A;  3HPG A;  3K7A J;  2WWY A;  3J7A O;  3OOU A;  2V1X A;  4FQG A;  4RB0 A;  2X9D A;  2L9R A;  3C2G A;  4B4C A;  4EQQ A;  2D5V A;  3EYI A;  2IW5 A;  1BIB A;  2EFP A;  1V54 H;  3HJE A;  2EB7 A;  3SFI A;  4ZC3 A;  5H6Q A;  1A31 A;  3NAU A;  3GLL A;  3L2U A;  2FQ3 A;  3H5N A;  2XKP A;  1A35 A;  2K9L A;  1Y39 A;  3P9I A;  5GPA A;  1GHC A;  3LSH A;  5BS6 A;  2CRG A;  2ICW G;  1WJ5 A;  4GXO A;  3DTK A;  1B6A A;  1Y1V J;  3GFL A;  3OR2 C;  1Z6T A;  3FXJ A;  2LD5 A;  1OYW A;  1BI3 A;  2HOE A;  3Q0U A;  1HKQ A;  1IRF A;  3BDD A;  1BL0 A;  4PJN A;  3I4N J;  2A61 A;  2PMU A;  2K85 A;  2KPM A;  4OAZ A;  3MWM A;  1EF4 A;  1LDJ A;  5CKT A;  3L09 A;  2EZK A;  3D0S A;  2OU2 A;  2EIJ H;  2LTP A;  2E1M B;  2R5Y B;  4UUV A;  2XC7 A;  4ENK A;  2A07 F;  2LVS A;  4A0Z A;  1XSX A;  2MAB A;  3VDX A;  3HUG A;  4D5F A;  2NS8 A;  3UKG A;  1WSU A;  3MD2 A;  4IQ4 A;  2M7A A;  4ASN A;  1LUJ B;  2XAJ A;  2KIM A;  4XLF A;  3OYN A;  5D6F A;  5JLW A;  2EV6 A;  3G2B A;  4TV7 A;  5DYM A;  1JUS A;  4MGR A;  3HDD A;  2FD5 A;  2FMY A;  1JTX A;  5LGN A;  1HKS A;  1IN5 A;  2HYF A;  2GLO A;  1C0W A;  2M3A A;  4MIM A;  1KGS A;  1Y1W J;  3WGI A;  3I59 B;  5EEA A;  4L5E A;  2DPU A;  1OIS A;  1FWZ A;  3R60 A;  1FC3 A;  3FXQ A;  5ILV A;  1MJ9 A;  4BBR J;  2XIG A;  3F21 A;  4HAM A;  4LK0 F;  1HKT A;  1P2F A;  2VBZ A;  2W84 A;  4XNF A;  4I6Z A;  3LSM A;  3BG3 A;  4D7M A;  2NVU B;  3H9G A;  3HGG A;  5E79 C;  3ZP5 A;  2PMZ A;  3AG1 H;  4RB3 C;  1IXR C;  1MDM B;  5FRN A;  3FK6 A;  2L4M A;  2Q0O A;  3HZJ A;  3I71 A;  1LDK B;  2R7R A;  4E7L A;  1YX5 A;  5JR3 A;  5E18 F;  3BWG A;  1JKP C;  5F6F A;  4D9J A;  3K4K A;  2I10 A;  1PYV A;  4BY7 J;  3W2W A;  1LFP A;  1HSJ A;  2DDA A;  3CCM I;  4LIT A;  2IS4 A;  2PLY A;  4QPQ A;  1RC9 A;  2M8G X;  4RGR A;  3E6C C;  3QP6 A;  3ZQG A;  2NVY J;  3CCV I;  2ID6 A;  1D0Z A;  4DZP A;  2F5D A;  4R1H A;  5HNH A;  4I98 B;  4UUT A;  5B1A H;  4FIS A;  1K79 A;  3TDU C;  3BPX A;  3VSL A;  4G94 A;  5EG0 B;  2MBF A;  4A0Y A;  1YRN B;  2Q1Z B;  3TW6 A;  3ZQ7 A;  1X19 A;  2CUE A;  3KPH A;  4MQV A;  4P55 A;  4LK1 F;  4IHT A;  2ZC2 A;  4I02 A;  4KMU X;  4E7Z A;  3QWL A;  2VE8 A;  1FBU A;  3IAS 2;  1ZH5 A;  1JKQ C;  4XKW A;  3S15 J;  2XAU A;  1ON2 A;  4C3H J;  5F0C A;  3PQJ A;  2ELJ A;  1APL C;  2E1C A;  5LFA A;  2FOK A;  3F8F A;  2KRC A;  2LG4 A;  5JVG F;  4Y52 J;  2FUG 2;  3MAJ A;  2DI3 A;  3UR3 C;  3OYL A;  2V1U A;  5EZG A;  2IA1 A;  2RV8 A;  4ZTJ A;  3SZP A;  3RI4 A;  3CCL I;  3BPV A;  4HG2 A;  4CGZ A;  1O3S A;  2G7U A;  2DOF A;  3QAH A;  1FT9 A;  1O57 A;  5CYV A;  2IS2 A;  1WFX A;  3HL2 A;  5BPD A;  3KZY A;  1KU9 A;  2F5F A;  1YHQ I;  4C3I J;  2DN0 A;  5TGT A;  3K0L A;  4IQJ A;  3U2R A;  1ZYR F;  4CCK A;  2YU9 J;  2UXX A;  4N4N B;  4KIG A;  1BOB A;  1BC7 C;  3RIR A;  1RKT A;  1Z6R A;  1GXQ A;  1ULY A;  3JRH A;  4XL9 A;  3QQA A;  2OJE D;  3RPU D;  1UB9 A;  1ZN2 A;  1QRY A;  3GVA A;  2HFH A;  3I56 I;  1SD6 A;  2VJ4 A;  3H9Q A;  3QOD A;  2OUM A;  3FBN B;  3RTR A;  5FRO A;  4QIW N;  1ZRE A;  1JI8 A;  2ZXI A;  3EPZ A;  4I01 A;  1FIA A;  4LGW A;  4CCJ A;  3JRI A;  2IGN A;  4YFX F;  2HDW A;  1WH5 A;  2V7F A;  4P5O A;  1K78 B;  3O8H A;  1E3P A;  2A5W A;  4DYR A;  3RKQ A;  2KIS A;  3WGG A;  1JTY A;  3ASN H;  2DA7 A;  2IEK A;  3CDH A;  4BHB A;  1OPC A;  4M3E A;  2MLG A;  3Q9S A;  2NVQ J;  1R36 A;  2K9Q A;  1Y8R B;  2M1B A;  4XLP F;  1QHH D;  3WTS C;  1YE9 A;  2JMW A;  4P96 A;  1KON A;  1YW7 A;  2HDD A;  3BG9 A;  3BT9 A;  2HU9 A;  2M0M A;  3M9A A;  1Z05 A;  4BEH A;  4NB5 A;  2XVC A;  1U8B A;  1LEB A;  2PMH A;  4DBQ A;  1H88 C;  3KLN A;  1SEU A;  5CJ9 A;  2EFW A;  3ZMS A;  3W2A A;  4MTD A;  4RM2 A;  3CME I;  2KHM A;  2DDB A;  5LHH A;  2VB6 A;  1I50 J;  3RCO A;  2O6G E;  1B9N A;  4PSX A;  5BMZ A;  4IF4 A;  3DBL B;  5J4V A;  2OZU A;  3RKX A;  4ZYE A;  2VT3 A;  3L2V A;  2KP6 A;  1ZK8 A;  2HKX A;  3GCM A;  4U88 A;  2KMU A;  5LHG A;  4JK1 X;  4YFK F;  4H4K C;  4EEF G;  1SD4 A;  3H9J A;  5DD4 A;  3HOV J;  2RQQ A;  2HNH A;  3DEE A;  3L2C A;  3I0T A;  1JXS A;  5GAG J;  1V5E A;  3J80 Z;  1G3S A;  2JA5 J;  1AU7 A;  4XBF A;  1VI0 A;  4G6D A;  4IHS A;  1EJ9 A;  4ESB A;  2WV1 A;  2X48 A;  2YR2 A;  4FHT A;  2QVO A;  2JRT A;  2PN6 A;  3G1M A;  4HV6 A;  3WOD F;  4XK4 A;  4F7Z A;  3B6A A;  4OWR B;  1WJA A;  2M9H A;  3HB9 A;  5JI6 A;  4M74 A;  4HPQ A;  4XRM A;  3AFH A;  3GTJ J;  2OCC H;  3VOD A;  2HDC A;  3WU0 A;  3N97 A;  3HOX J;  2X6W A;  3NWS A;  3BTC A;  3DWL E;  2DA3 A;  3OIP A;  3KYL A;  3FXL A;  2DPD A;  3FKI J;  2GQQ A;  3SZT A;  3GF2 A;  4HQE A;  1JT6 A;  2VIX A;  5KK1 A;  1YQA A;  3J81 K;  2RVC A;  2X51 A;  2BOL A;  1AA7 A;  4UVA A;  3HYI A;  4AC0 A;  5F08 A;  4BAY A;  1ETW A;  1OKR A;  3QYE A;  4LLN A;  2G7H A;  4UY8 I;  2EV0 A;  2DT6 A;  2XB0 X;  2KJC A;  2CV0 A;  2GWR A;  2G0E A;  3AL0 B;  3TOB A;  2BVL A;  1I39 A;  2BYV E;  2WAD A;  4LLL A;  2HEO A;  4C3J J;  3BTI A;  3EET A;  1ZG1 A;  1GVD A;  3DPT A;  3CES A;  4QTR A;  3QP5 A;  4M71 A;  4XN3 A;  3KET A;  2I8D A;  2GM4 A;  3BTJ A;  3KX2 A;  1XMA A;  2VC1 A;  1R1U A;  3MN2 A;  4NC6 A;  1DUX C;  4DBR A;  3OR1 C;  1FNN A;  1KYZ A;  1X4O A;  4A3I J;  1IV8 A;  5DTD A;  2MH9 A;  3KZZ A;  3CF5 F;  3BZK A;  2OQG A;  1P7I A;  1IZ1 A;  3ZQH A;  4BE1 A;  2QQB A;  1WJC A;  2Y75 A;  2WY8 Q;  3OYM A;  4NDL A;  2PX9 A;  1WJB A;  2HS5 A;  4M3D A;  4ZZL A;  3RKW A;  1Y56 A;  2F5E A;  1XDU A;  4BNC A;  5HS7 A;  2V6C A;  2X1C A;  2TDX A;  4U0W A;  1RRJ A;  4DGW B;  2E2H J;  5FFX A;  4UV8 A;  4P9F A;  2VLA A;  1XGS A;  3S1R J;  4HF2 A;  4L0Y B;  2P7V B;  2JVH A;  1WI9 A;  2BXY A;  4X1E A;  3EDP A;  1TNT A;  2HYG D;  3KZI C;  2FX0 A;  2FBI A;  2HQ5 A;  3OIO A;  2LY2 A;  1KQ9 A;  1VQN I;  4S05 A;  1A5J A;  5E3M A;  1MH3 A;  2IGM A;  3GFI A;  1TT0 A;  3FIW A;  1SAU A;  4MO7 A;  3IWF A;  3E5U A;  4OOI A;  5DCF A;  2E1M C;  3K70 D;  3FXU A;  4LIV A;  3ERM A;  2DA2 A;  5D8L B;  2M87 A;  2P6S A;  1OR7 C;  2XAQ A;  3GZ6 A;  4B3A A;  2W7N A;  1ZAO A;  3OYA A;  3GLX A;  3H3Z A;  4ZYD A;  2ZXH A;  4M6X A;  1ZRD A;  3VB2 A;  1LJ9 A;  2A6T A;  3TQN A;  4E7I A;  4CZZ A;  4CSW A;  1DP3 A;  4HV5 A;  5IY5 H;  2E71 A;  3HKZ N;  5CVI A;  3RSN A;  2MSY A;  1OQY A;  3M8J A;  4F55 A;  1V4R A;  2ZJ2 A;  4O6J A;  4HX4 A;  3FXK A;  4MHG A;  2YX4 A;  1OYI A;  1LE8 B;  4KDP A;  2VQL A;  5F27 A;  1DQU A;  2Y48 A;  4D5C A;  1B59 A;  2DCE A;  2Z1D A;  2VN2 A;  3FX3 A; 
#chains in the Genus database with same CATH homology
 2DYR H;  3ASN H;  3AG3 H;  5B3S H;  2EIJ H;  2EIN H;  2Y69 H;  1OCZ H;  1V54 H;  3ASO H;  3WG7 H;  5B1A H;  3AG1 H;  3ABK H;  1OCO H;  2DYS H;  3ABL H;  2EIK H;  3X2Q H;  5IY5 H;  1OCR H;  2EIL H;  2EIM H;  2OCC H;  3ABM H;  3AG4 H;  1V55 H;  5B1B H;  1OCC H;  2ZXW H;  3AG2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...