2EIJH

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eijH00
1OCOH 3ASOH 2Y69H 3ASNH 5B3SH 2EIKH 3AG2H 3ABKH 2DYRH 2EIMH 1V54H 2OCCH 3X2QH 1OCRH 2ZXWH 1OCZH 3ABMH 3AG4H 3WG7H 3ABLH 2EILH 2EINH 3AG3H 3AG1H 5IY5H 5B1BH 1V55H 2EIJH 5B1AH 2DYSH 1OCCH
chains in the Genus database with same CATH superfamily
1OCOH 4EJWA 2N8GA 3HOYJ 2DLLA 2PMZA 3OR2C 4M6YA 2GXGA 5FRNA 1SD4A 2XB5A 3HXLA 1W5TA 2AXTC 1WKMA 1B9MA 3GTLJ 4D5CA 2AS5F 2G9WA 4ZDLA 3E5UA 1FYKA 3H36A 1DGWY 2ZNYA 2IRFG 2RV8A 5BOXA 5FB2A 3OY9A 2JA7J 2M8GX 4IHVA 2BEOA 2V9KA 3QPSA 2CUZA 1R49A 3DPTA 3D5SC 3GW2A 1QNTA 5LBQA 1K4TA 2YS9A 2GLOA 2XAGA 4HF2A 1T95A 3VSKA 4XL9A 3NAUA 1FTTA 2K3PA 2QCOA 2VIXA 4IRGA 1R1VA 4GCVA 2D1HA 2VI6A 2BV6A 1EV7A 3GZ5A 4I0BA 3T1BA 4CA0A 2K4JA 1RNLA 3AL0B 2EQRA 3E97A 1A04A 4XBFA 1ZR4A 1BW6A 2K9SA 5IOYA 1O3SA 2RNJA 3ML6A 1XSVA 5D5UB 5D8KB 3K4JA 1RIOH 1J5YA 3BDDA 3FKIJ 2TRTA 3ISPA 4JX5A 2R92J 2H8WA 3O3KA 2R7UA 2X9DA 4OIPF 4F55A 2VJIA 5FJ8J 3UKGA 1FY7A 4PUSA 3AAFA 3I59B 1UB9A 4R1HA 2STWA 4RDUA 2NS7A 1Y1WJ 5D8LB 5TRDA 1XGOA 2KDOA 4GXOA 1FSHA 4PCQA 1K7AA 3C1DA 3BJ6A 2L54A 3HRMA 5GP9A 1DU0A 2LOOA 2ZFWA 2Q2EB 2E1OA 3RYPA 2NVUB 3J7AY 1BN5A 2ADUA 4QPQA 3HHGA 2MH9A 2BXYA 5B1BH 3OYEA 2L4MA 3KEYA 5FKKA 2YU3A 1D8KA 4LG3A 1H9GA 4PJJA 4U0WA 4BJTA 2YX7A 3U21A 1GV2A 3F3XA 4DZJA 3KZIC 3OR1C 3DEUA 1YS7A 3BOQA 2QQBA 4LJZF 1R9TJ 2X1DA 3HPHA 3A02A 1B1BA 4ZZDA 4CZCA 3RDIA 1S5LC 3V8JA 1D3YA 3REOA 1OFCX 1D8JA 4PFPA 2ZO4A 1JE8A 1PVEA 3MQ0A 4U7DA 3GTKJ 5HODA 3KEOA 2BY3A 1T56A 2YR2A 4HG2A 1BIBA 3MVPA 3IAM2 2BYVE 4MO7A 2Q0OA 1LDDA 3G2BA 2KT0A 5CVVA 2GM4A 4DYQA 1FLIA 2M8EA 1V3FA 1I3QJ 5F04A 4Y13A 1WJ5A 5HS7A 4G6TB 1OYWA 3DKWA 3V7SA 4AVZA 1J2XA 2EJRA 2A05A 3LSMA 4IX7A 2OTLI 1M1EB 5J8FA 2X6XA 2QF7A 4A3FJ 2K7LA 2NVQJ 4UB6C 2XB0X 5HLGA 2H1KA 2DPUA 4EEFG 4O5VA 1TZLA 2Y48A 4HPQA 3MD2A 4E4HA 1N75A 2DA5A 2Z99A 1QBJA 4RB0A 3L00A 4WCGA 3PUFA 5EYRA 3JRBA 2XC7A 3KETA 1RI7A 1X4OA 2VQHA 2ZBKA 3BJAA 1OR7A 4A3GJ 2M1BA 2Z16A 1S3JA 5K7HA 3M07A 5AONA 3F8CA 2EIMH 1Z7LA 5EG0A 4I98B 1P92A 4WWCA 3LNQA 2ZFUA 3WGGA 2LY9A 3PM1A 4XRFA 1I50J 2EFQA 2DN0A 4BUPA 4LK1F 5HVQC 5C4JJ 1S7OA 4G6DA 2GQQA 2MBFA 1WQ2A 4BS9A 2IGMA 1MBHA 3CMAI 1VTNC 3ZQLA 4L5IA 2IA1A 4QLCU 1LPQA 2VONA 2V6EA 4M72A 1LVKA 2CW0F 2XSJC 5J1RA 3K4BA 3MZ8A 2PLYA 4XOTA 3NRVA 3GXOA 1GXPA 1KQ8A 1E3HA 5D4SA 1SVOA 1F5TA 2XGDA 3SFZA 2BOLA 1IXSB 3K2ZA 2W24A 1ONVA 1ZRDA 2WB1N 3CJNA 4KIFA 3S3NA 1DP7P 4LD5A 3BQZA 3KEQA 4BY7J 3DKYA 4QWQA 4FASD 4E7LA 1YYVA 3JTGA 5ILSA 2F48A 4RGUA 4RGXA 4HF1A 1W5CC 1TNTA 4XSXF 1RZ4A 3ZQQA 1R7JA 2COBA 2DOFA 2ETHA 4BJ5C 4B44A 3CP8A 2M3AA 1T6SA 2VT2A 1UZCA 1AOYA 2NNNA 2FJ1A 4FQGA 3I53A 3IL2A 1P7JA 2GZWA 2W82A 4XRSA 2BHZA 3F8NA 5DD4A 5F0HA 3SFIA 1Z1DA 3NWTA 2VQGA 4JBAA 4PGGA 3FXLA 3B6CA 2ESHA 4UVBA 3GFJA 1V4RA 3MKLA 4E7SA 4MFDA 4E7IA 3IH2A 2R7VA 2Y31A 3C2GA 3N05A 2VJJA 3MWMA 2R7DA 3EUAA 3T8RA 3VYUB 2H27A 2PJRA 2IS4A 4I0AA 4IPAA 1ZH5A 2VC0A 1Z3XA 3OYMA 2EFWA 3LSTA 1EH7A 1Z6TA 2JTVA 4RGSA 1X2NA 2ZJRF 3FHNA 1AA7A 3V42A 4Q4ZF 2I5UA 2DTZA 5E79C 2F4OB 1VQPI 4ZYDA 2LNBA 2MABA 2PN6A 3QRFF 2XSDC 1MBKA 2BZTA 2FA5A 3CC4I 2DFIA 1F36A 3GBGA 4XOPA 4LFUA 4AIDA 3WE3A 4ZDPA 2UZKA 1IC8A 3W6VA 1HBXG 5GTIC 3L2RA 1LKXA 4MTDA 3VWBA 2DU9A 5DUIA 4O6JA 3L09A 4OOIA 2E34A 3K7AJ 2DYRH 2E1MC 3KIOA 2WAEA 3SEZA 1TC3C 2HQAA 4ZDOA 4G7OF 2BY2A 1WFXA 1ZN2A 5TGTA 4HOBA 5KK1A 1MNEA 4UY8I 2DXIA 2AQFA 2X6YA 3ZN0A 3W2VA 2KISA 3QODA 2LY2A 4ENNA 1Q1HA 2KIFA 2XF7A 1E2XA 4UVCA 4S04A 4C2MJ 4AIJA 5J1UA 2LD5A 4HSTA 1R1TA 2A6TA 2EV5A 4PDKA 2X51A 3OYIA 1LE8A 3ZGKA 3ZMUA 2AHQA 2HFHA 2JJ7A 1UJ8A 4EGYA 5DCFA 3H0DA 2VN2A 1B4AA 3GVAA 3ZMZA 3OSGA 4BXFA 1BJZA 3FXMA 2X4HA 3P5JA 4RB1A 2A6EF 3QU3A 4M6VA 3AL0C 1S9HA 2EZLA 2V26A 4MQ9F 3MKWB 4XKCA 5FGMA 1JUMA 2VJ4A 2WY8Q 3DEWA 3HOUJ 3CUOA 5LHGA 2RREA 2X6WA 4DJAA 2AQEA 2FD5A 3DTIA 3S1QJ 1A31A 3OYNA 2ME6A 3U9GA 1QHHD 2LFBA 3TBIA 4ZYHA 2FNPA 4KUMA 4P55A 5DM7F 1SFUA 3PSFA 3ZMTA 1Z21A 1ZG3A 2I8DA 1ZELA 3PNVA 3HC7A 4LLGF 1IN5A 2K4BA 1YW8A 2JPCA 2IW5A 2KP6A 5EDNA 5FLXZ 3GFLA 5F27A 1IGNA 2W84A 2ME0A 2CG4A 4GYIA 4B8XA 1H89C 1OYYA 2FMLA 3BTJA 1Y0UA 3QOPA 2MFZA 4KMFA 2GOMA 3DBHB 3T5XA 3JAMK 4B47A 3HBLA 2EFNA 2Y30A 2KJBA 4II3A 4EATA 4UB8C 1K61A 4IEJA 2R4GA 1VQKI 4L9VA 1STZA 2LLKA 1G6NA 1LQ1A 4ITVA 4A0XA 4ANJA 3D1NI 2OU2A 4XK4A 4M3FA 5JHUA 5L3CA 3OIOA 5F1JA 5C3EJ 1BI3A 3F8FA 3O8GA 3OL3A 3TMOA 2Y0SN 4M74A 3JRIA 3LSJA 1HQCA 1ZG5A 2JUCA 5DUKA 1HW2A 2OD5A 1TWAJ 3W6KB 1S29A 2OPTA 5FO5A 9ANTA 2R7WA 2W1OA 3M8EA 2Z3YA 2WWYA 1ERDA 5L3DA 5ILUA 5E1WA 4Q5SF 1X58A 3SDBA 1NK3P 5DM6F 1ZRCA 3S3OA 2KIQA 5HLTA 4HDUA 1X19A 2IS6A 2KZGA 2E1CA 3J80K 5E3OA 3F22A 2XUBA 1YX3A 2WAFA 1MW7A 1XS9A 4G8XA 2VBYA 5IYDJ 3BG9A 2CUFA 5GPAA 2L01A 3DKXA 1QQIA 4HBLA 4RA2A 2GAUA 4LIVA 3TDUC 3CCSI 3M8FA 1L3LA 2GXAA 2P6SA 3I58A 2P5KA 3VFZA 4WX9A 3PNYA 1IW7F 5DDGA 4HNUA 3IRQA 1ENHA 1KONA 3H92A 1NTCA 3KLOA 3M4OJ 1UG0A 3WU2C 3F8BA 5DCMA 2NOJB 3CMMA 4JQFA 5IT3A 3JREA 3H3ZA 2G7UA 2Y69H 4WXDA 5B3SH 4KA4A 1BIAA 3CDIA 1XD7A 4GFBA 1NG6A 3M3YJ 1ZRFA 4V2FA 2R7RA 2HI3A 1DPRA 3HTUA 3BPXA 1TQIA 3E6MA 2CUJA 2ZCWA 4ENMA 3FK6A 4C2UA 1SEUA 2V1DA 5IP7J 3E1SA 5E8IA 2FUG2 5D6FA 5FKMA 4XSZF 1LDJA 2GOXB 5BPIA 3S32A 3WG9A 5IPAA 3OOPA 4D1QA 3SYTA 4A12A 4KICA 1BR1A 2M0CA 1MJ9A 5EG0B 3KYDB 2W00A 4O3MA 3BR6A 4ZH4F 1SMTA 4IL6C 2FSWA 2B7EA 3LSPA 3IH4A 2JT1A 3BTIA 4M3DA 1WH5A 5K1YA 4OIOF 1BR4A 4NNJA 3VYTB 3KP7A 3FBNB 5CYVA 3TP0A 2P6TA 4D9JA 4PZJA 1DUXC 3AG3H 2HGCA 1JJ6C 2EZIA 5AIPA 2HKXA 2IP2A 3HYIA 1IXCA 2VKHA 3OS1A 2W48A 4HX8A 3VB2A 3PIOF 2LG4A 1PUFA 3VYSB 4EJTA 3RTRA 1L0OC 3TDZC 1HOMA 2TCTA 5L3FA 3CCRI 1J7KA 2NAZA 3TGNA 4WF2A 5E3MA 3J7YJ 2Y2ZA 3K10A 3S3MA 1Y8QB 3HKZA 2DCEA 4UHTA 1BBYA 2XV4S 1QZZA 3WTWC 2JA5J 4CH7A 2OZ6A 3CCLI 1G8XA 1TLHB 1B8IA 2AO9A 1YLFA 2QENA 2UXNA 4FX4A 3FK7A 3F6VA 3Q5FA 1USTA 1W1WE 1V5EA 3HUGA 3WTTC 1OPCA 2D2WA 2E35A 2O5RA 3K1NA 3K70D 4BU2A 4XLEA 4IKFA 1A5JA 5IOZA 4N9HA 3E6BA 3LWFA 2LBFA 1XDSA 4QPOA 1KU7A 1YOVB 3FZVA 3TOBA 2YSRA 3Q9VA 2R5ZA 3HSEA 3ABUA 1W36C 2R7ZJ 1W7PA 5CVUA 3JRCA 3O2PE 2XAJA 4BBRJ 4IZZA 1O3TA 1QA6A 2VE8A 2PJRB 1T0FC 2JK3A 3EUHC 2A68F 5B5EC 1Y6IA 2CQKA 3PSIA 2K27A 1U5TA 2HOAA 3GCMA 1J0RA 1HW5A 1X1AA 1SD6A 4NQWA 1XC5A 4CYCA 3RI4A 2HOSA 2JVGA 3CF2A 5H6RA 2P5LC 2KRHA 2XF5A 3HM5A 3PJRA 4LLLA 2V1UA 3O6BB 2IT0A 3MN2A 5LGTA 1Z05A 1W0UA 5A2QK 2DA1A 2F2EA 1JGSA 2IVMA 2O03A 5HNFA 1YTYA 3A1YA 4IOAF 2OUMA 1T8IA 4PJ0C 5J47A 5TISC 3VEPA 1ETOA 2DQLA 4KIBA 1JUPA 3DF8A 1K6OA 2VL8A 1ZG1A 2WAQA 4N4NB 3TP3A 2DMTA 2MA3A 3OYCA 1TT5B 2QUFA 3QP6A 1HLVA 1ODDA 1MKMA 3TL4X 3CJTB 1TQMA 4Z2YA 1IV6A 3IKTA 2CS3A 2CMPA 4OAZA 4M3EA 2H8RA 2M7AA 3H3UA 2J5OA 3HSRA 2ZJPF 1ETWA 3GYHX 4IO9F 4KNYA 2HNHA 2VOOA 2VPRA 1U3EM 4C2TA 2BY0A 2CV2A 1E0EA 1EA3A 2K9MA 2CRGA 3DU5A 2FBKA 2QA4I 4UV8A 3ZRGA 1IN6A 2VUMJ 4CXFA 4IHTA 1LE8B 3TW7A 4A3LJ 4UXNA 1OMIA 5ERIA 4CGZA 4OAYA 3UR3C 1LFPA 3L2QA 1YJNI 2XGXA 5HS9A 3E7LA 4GRIA 2XVCA 2IA2A 4E6KG 1DPUA 3BPVA 4UVAA 2LTPA 4IHYA 4AYBN 2HU9A 2LF7A 4BNCA 3VODA 2QSHX 3G6EI 5E3LA 2E1NA 4XNFA 1U0JA 3QOEA 4XKVA 4PJMA 2ZXIA 3MKYB 1Y39A 4BE2A 1TT0A 4A3CJ 1UMQA 3ZQFA 3DTKA 4BGDA 3FM3A 4JYKA 5LGUA 3NWSA 2BVLA 3GTMJ 2BGCA 1K4SA 2ZXHA 2W85A 3S8PA 1IRZA 4EVIA 1T08B 3FXRA 5EEAA 1HCRA 2A69F 2X0LA 1DU6A 4P5OA 2Q1ZB 4F52A 1MJAA 2HZDA 3KX2A 4A3IJ 3ERED 4HAMA 4EQQA 3KPHA 1FZPB 2HQNA 4IOCF 2HXOA 3WTYC 3HPGA 3PIPF 3S2HJ 2ZMEA 5K7FA 1IDYA 1F43A 4AD9A 4RBOA 3PQKA 3HOSA 1TWHJ 3ZQGA 4AC0A 1JKOC 4EJOA 4UUSA 3V8LA 1E17A 2DAOA 1BI1A 2O9LA 1KQ9A 2HXIA 4LLNA 3OS2A 1MSEC 1IDZA 4N9IA 1XG1A 5LLQA 1IUFA 1J9IA 1XDUA 1LUJB 1RKTA 2IGNA 3LA7A 4OMYA 1ZGJA 1AU7A 1T38A 2MC4A 3N97A 1YITI 2JA6J 2O61A 3LA3A 3TOAA 1F4KA 2DFHA 3BR2A 3A03A 3O8HA 4R79A 4L0YB 2G7HA 3ZMDA 1J09A 5IYBJ 2OC6A 2KQRA 3UNGC 3BG5A 4HDVA 5C4XJ 1BI0A 2ECBA 3EYYA 2R3SA 1TW2A 5LHHA 2MD5A 4R8HA 3GTGJ 2LRDA 4G9YA 4M71A 3IH3A 3DWLE 2JA2A 2WB1A 4HLYA 3P9IA 2CYYA 4I09A 1I39A 2R7FA 2EPFA 4HX4A 3CTAA 1W4MA 2CUEA 5J40A 3J81Z 4L5JA 3CC2I 2KMUA 4RS8A 3V4GA 2MW8A 5GAEJ 2R0QC 1ETKA 3NEUA 1R58A 4BYYA 3A4CA 4PFOA 4JOMA 2E36A 4XLCA 2PMZN 5EZGA 3RYRA 1MBGA 5M5XJ 3H5AA 1OR7C 1EH6A 2XPUA 4XICA 1AHDP 1WPKA 3LQQA 1UHSA 5EEGA 1J59A 1KGSA 1XMKA 1ETYA 2OAZA 3LAPA 4F91B 1Q1VA 2P7VB 2V1NA 2X48A 2PFBA 1Y56A 1HSTA 2ELKA 3E6DA 4F92B 3WU1B 3ZQCA 1OCTC 5HDNA 1KA8A 2XAHA 2DOEA 3FX3A 3BZCA 2KL4A 5DEQA 4KFCA 4EJVA 5DCMB 2XKPA 1MH3A 5ICFA 2VB6A 4H0EA 1MBFA 1ORKA 1O3QA 4GO1A 1W7PD 2Z9OA 1YRNA 4XR6A 3J7ZI 2F5FA 1F9NA 2A61A 1C0WA 2CQQA 2OF7A 3OYLA 3FWEA 3RCOA 5ILVA 2HDWA 3ELKA 1S8NA 3H3VK 1FIPA 2P0WA 2PBIA 3BP8A 4W97A 3DLAA 2NNYA 5HDGA 2Y9YA 2EZKA 1TWCJ 3R6SA 3IC7A 2ACJA 2MH2A 3BG3A 1U8RA 2P8TA 1H8AC 1G3WA 2KLOA 5FFXA 2FE3A 1X3UA 2QKLB 2VBWA 2FX0A 1TWGJ 3MKZA 2HKOA 3GLLA 1KZHA 1A35A 3SEQA 3CCYA 2X1EA 4XN3A 3HOZJ 5HLIA 5IP9J 1RRJA 2WC2A 1G2HA 1QVTA 2GIZA 4BDYA 1U6GA 2E7WA 4PJNA 1UELB 2EILH 4P9FA 1R5HA 1PUFB 1USSA 1VZ0A 1X4PA 1W0TA 4Y52J 5EZHA 1RPWA 2VXDA 1TTYA 3QYFA 1NG7A 4XRMA 1YQAA 3S1NJ 4CCLA 1WI3A 2BVMA 2DO7A 1YW9A 2JVHA 3LAJA 3BG7A 5CVIA 1FBQA 2XIGA 3OL4A 4U88A 2VKEA 1B8IB 3M1EA 5FROA 3V7RA 1MMGA 3KP2A 2NVYJ 4YFNF 5E3NA 3ABMH 5E1XA 3CCUI 4I76A 2Y75A 4EMSA 2R7SA 3K6GA 5CPRB 4U7BA 3JRAA 4HNVA 3HUGB 3K1PA 2EV0A 2LYCA 4PK4A 4ABZA 5F1RA 4IRIA 2EB7A 4BQOA 4ZYAA 4W1UA 3JRFA 4MIMA 1MJBA 2LBFB 2A3SA 3H1CA 1YI2I 4AUXA 1BR2A 4J19A 1YIJI 1WJDA 3VSLA 3BJOA 3CO7C 2R5ZB 3CCVI 5LHIA 1TWFJ 1W7PB 2QSFX 3NQOA 4UV9A 3JR9A 2C6YA 5CVRA 3Q0VA 3DP7A 4A69C 4LMYA 1D1CA 5GTHC 1UHMA 1ZLJA 2K3FA 2EFPA 5J4VA 4HLXA 5DV5A 1FX7A 2IS2A 1U5TB 3CQZJ 2CU7A 3CLQA 2JZYA 1N25A 4NQWB 4CYCB 2M2EA 1HF0A 2NVTJ 2YX4A 3P9KA 1CGPA 3C3WA 1QZYA 3Q9SA 3U1KA 3I64A 5M3MJ 1SFOJ 3QPLA 1ZGWA 3F21A 2ISZA 3ONQA 1Z7UA 3DPUA 2F5CA 2DFEA 3OYDA 2DMQA 1YE9A 3U1DA 3EYIA 2WTEA 1P4AA 4L9NA 3K70C 3G3ZA 3W6JB 1Z67A 1R71A 4XRSG 2A5YB 2F6CA 5E8GA 4OU0A 2QLZA 5JVGF 1A6QA 4A5NA 3A0HC 3HZJA 4DOZA 1VI0A 1VQ4I 3ZPLA 4P1WA 3W2WA 2Y0SA 3EETA 1P4WA 2FU4A 4LOCA 2LDUA 4ZTJA 2O8XA 1FBSA 3MFKA 3ZR8X 1I6XA 2HVRA 1WJEA 2WA0A 1AKHA 1XCVA 1RETA 3M9AA 1FNNA 5CJ9A 2F5DA 3RKWA 1EH8A 1HSJA 5EGOA 3F8MA 2RKHA 3DFGA 4ZC3A 3L1PA 4U0YA 4EM1A 4LB5A 3VDXA 2BBYA 1N77A 2FBIA 1QRYA 3GFIA 2VLAA 4DQ2A 4M3BA 1XN7A 3TO9A 2QBYA 3TW6A 1CF7A 3BTCA 2PEXA 2Z1DA 3ZQ7A 3H9GA 1SC7A 2EA4A 3KP4A 2VPLA 3K4MA 1PP7U 2JA8J 3GEZA 5DTDA 2DA2A 2DK5A 1ZLKA 4DBRA 3L2UA 4L5EA 2K9NA 1IRXA 2Q8KA 4X6AJ 4CHUA 1WI9A 3HOVJ 2OCEA 3D5LA 2I10A 2V79A 1ZYRF 2PMUA 5BPDA 3G1LA 1R6RA 3D0SA 2J5PA 2RQQA 2V9VA 5FLXK 4A6EA 3MCZA 4U0VA 5H6QA 4HX7A 5BS6A 1WJAA 1VQMI 4B43A 2DMNA 2E5NA 3CUQA 2CQXA 2E7XA 3FXOA 1G3SA 4BQAA 4LK0F 2LSOA 2NS0A 3BZKA 5BQTA 2IBDA 4BY1J 2XGCA 2HPMA 4A5MA 3LSGA 2OQGA 5ICCA 4KT5C 3I4NJ 3BY6A 1B59A 3ZOBA 3ZQIA 3VOEA 2ZSHB 5E18F 2DPDA 2CGPA 1JHFA 2H09A 3H35A 3MAJA 2ECCA 1GUUA 2WV1A 3DPLC 5FRMA 1P2FA 3K4LA 4XM3A 3WTVC 1YHQI 1VQLI 3LFUA 3OYFA 1X3ZB 4A6DA 1BL0A 3NARA 2V1XA 1R1UA 2HTJA 2ZMEB 4BHBA 2LF8A 2V4JC 2RC4A 1FJLA 3OIQA 3IAS2 3GF2A 3HEFA 3HGGA 4QTRA 4DW6A 4UUSB 3WHBA 2KRFA 1SAXA 2JN6A 5GPCA 4DNCA 4GDFA 4RMNA 4BJ6C 4RM3A 2K9LA 3M8JA 1FWZA 5EJCA 4EM0B 4ZYGA 3CZ6A 3CP2A 2UWMA 4FX0A 4LIUA 1IRFA 2XF6A 4CO8A 1H88C 4G7ZF 1U9OA 3BR0A 4A3MJ 1VQ8I 2CW8A 3FMQA 1WZ2A 1ETVA 3S2DJ 4MFEA 3TO7A 4UUTA 2VQLA 5KAFC 2B9SA 1EF4A 1PJRA 5K5RA 1HC8A 3L9FA 4HRIA 5J1YA 5HNHA 3PO3J 4A2UA 3JSOA 2NXNB 2LREA 5E17F 2OQRA 1QVUA 2CO5A 5E1ZB 1QPMA 3Q0WA 1FTZA 2P7CB 3SDGA 1WGXA 2GWRA 1O57A 3ERMA 3G1MA 1EKEA 4NBQA 2FQ3A 3OYJA 5CQGA 1X1BA 2EBIA 5B1AH 2QSGX 1XGMA 3E0JB 5E20A 2OJED 1HDPA 3S1MJ 4F93B 3J80Z 3DEEA 1Y8RB 5KAIC 5TJJA 5BNGA 1I3AA 1VQ9I 4E7KA 3W3CA 1W5SA 2X6OA 5IYCJ 3GO5A 2L9VA 4HA8A 4NC8A 2HR3A 4CCKA 1BOAA 1D0YA 1MDMA 1WH7A 1V5FA 3IWFA 2MLGA 1FP1D 3E5XA 3EDPA 5F0FA 4IF4A 4I99C 2O3FA 1FMWA 4L9JA 1REPC 2HDCA 1XX5A 4CCMA 3AFHA 1YRNB 3ROUA 4MTEA 2EFOA 4PSXA 4RGRA 2L5QA 4TV7A 1ON1A 5HS8A 2P4WA 1JKRC 1D1AA 1LB2A 2DA4A 5KVRA 4FT8A 3OOUA 3E3VA 5L3BA 1YW7A 2ZJ2A 1ZARA 3R0JA 3CCJI 3K4NA 4HQEA 2FRHA 2HVQA 1FEXA 1D1BA 4E70A 2K5CA 1K6YA 1OQYA 2XAQA 2DDAA 2IA0A 4IVNA 1TP4A 1ZHFA 4GGGA 4RAFA 2JRTA 3KP5A 4RLFA 3K69A 2A5WA 5FLVA 1KYZA 2NS8A 2WBMA 3PUBA 2HYFA 3DBRB 3I71A 4AWXB 3HSFA 2K40A 4CUGA 2JWTA 2JUGA 5IT9K 1UG2A 1LJ9A 4V2GA 1IV8A 1G3YA 4IHSA 2UV1A 4YG2F 4BKXA 1XMXA 2L7FP 1VQ7I 3RIRA 2L7ZA 1IN8A 5B66C 3GX4X 2QQ9A 3VPRA 1ZREA 1SANA 2K02A 1LEAA 4WXCA 4C3IJ 2LP0A 4LG0A 4ZTFA 3K2AA 4RAGA 2JPBA 1I6HJ 4D7NA 5LRRA 4BQQA 1JGGA 4XORA 1BA5A 3HOXJ 1FIAA 1JT6A 1OLTA 2QZ8A 4ZYEA 2IGKA 3B02A 2HOEA 4M9XA 5D5WB 1LVAA 3KZZA 2YU9J 4DIQA 1SVLA 2L9SA 2XASA 1WWXA 2F5EA 1GT0C 3MMYB 1MH4A 4S0HB 1K83J 1RUOA 3S14J 2DMPA 4MEXF 2LKXA 3FF5A 1P4XA 3ASOH 4I6ZA 3KLNA 3WE2A 3HRSA 2QVOA 3AG2H 3S1RJ 3FMSA 2RQPA 1S6LA 2O7OA 4IQ4A 4ESJA 5JHFA 3S15J 3C18A 3K4KA 1PYVA 2EV6A 3GZNB 2VE9A 3ULQB 3WU0A 1K78A 1YFHA 1F1ZA 2HWVA 4ZJZA 2XAUA 5CKTA 4CCJA 1RUNA 1JTYA 3K9TA 1KU3A 3R0AA 4JX6A 1CQTA 3HG9A 1VQOI 3DU6A 2KIUA 4DYCA 3IRRA 5J4YA 2MC3A 3ECOA 3QYBA 1ZAOA 3TKYA 2JSCA 3QWLA 1D5YA 4OIRF 2VXZA 4LITA 2XHKA 4BXXJ 3EUHA 5KHDA 4AIHA 3DV8A 1JUSA 1APLC 3RQIA 1T39A 3RZOJ 3G1OA 4II2A 3PL8A 3G71I 3BLYA 1AKHB 3BCBA 3GZ6A 4BHPA 3I54A 2MG4A 2W57A 2CQ7A 4HZFA 3HOTA 1ZR2A 3IWZA 5EGOB 2LR8A 4DYRA 1G59A 2CV1A 2M30A 1MMAA 4A3EJ 2F4MB 4XN0A 1XSDA 2P81A 5JI6A 1E3OC 3QPHA 5H20A 2XRLA 2QBYB 3VYRB 2RDPA 1CF7B 3OV8A 3BROA 3L7WA 3RPUA 5HLHA 3I9V2 2DMUA 2Y9ZA 4PJLA 1SAUA 1BC7C 1IG7A 2VQCA 3LSHA 4B4CA 3OYHA 2BHYA 4B48A 5M5WJ 3FKJA 4ESFA 3A01A 2E2HJ 3FXUA 2CFXA 2STTA 1TL8A 3GMEA 2VBXA 1HW1A 4KN4X 2E1MB 4J01A 4HV5A 2M5WA 1KQ0A 3BWGA 2WV0A 2DJIA 2FOWA 4NDLA 2ZMEC 1R5ID 1S7AA 2ZXJA 3DCFA 3PNTA 5L3EA 2ZNZA 3SZGA 3LSRA 3MZYA 1I5ZA 3OYKA 1O3RA 2IGOA 3CUQB 4ESBA 5J8CA 2R7TA 5IP6A 3OYGA 3WTSC 2HYJA 3BTLA 4FETA 3WTXC 1XPXA 4HNTA 5D5VB 4IQJA 3P9CA 2ICWG 3IUOA 1ZKGA 3T0YA 1XB4A 1U8BA 4G6QA 2ID6A 1IN4A 3PFYA 4FE4A 3H5RA 3F72A 2CH0A 3QAHA 1XGNA 1JI8A 1MIJA 2KZVA 1D0XA 2ZB9A 4CDGA 2VT3A 2FXAA 4BQNA 1VQ5I 2HPIA 1IZ1A 2HOTA 3CCQI 2VASA 2EINH 5ICEA 2L9NA 2UXXA 2M4KA 2XRNA 3RKXA 4BHCA 3FMRA 2WAQN 1I1SA 1JHHA 1OCCH 2QQ8A 3LA2A 3A0BC 3TQNA 1U9NA 3LSKA 4HEA2 4RM2A 3FM5A 2V6CA 3B73A 2JSPA 3QU6A 1OCZH 2ID3A 3F0CA 2QYOA 3J81K 1O7LA 3GTPJ 2BW3A 3S16J 2VJ5A 4EM2A 2MLKA 3DXJF 1FOXA 2BE5F 1RC9A 1SFKA 3GFMA 3HRUA 4C3JJ 4Y3OA 1B72A 3G4SI 1E3PA 5C44J 3RKQA 2VBZA 5D5XB 4HSRA 2DQRA 3M1CA 3LOCA 1WHUA 4CSWA 4I7HA 1MNDA 1BI2A 2PI0A 2VC1A 2W4SA 1VQNI 1HA8A 4Z6YA 3BR5A 3U2RA 3TEDA 4N0BA 2OCCH 3HRTA 5M3FJ 4CCNA 4KIGA 1R4MB 3I0TA 1WJFA 3GTJJ 1KYWA 3COAC 2XDVA 3CO6C 2NYXA 1BC8C 4BAYA 5LGNA 4LB6B 2OA4A 1Z77A 4FISA 3WODF 4L18B 3RPQA 4AU7A 2XPWA 4IXAA 1IAWA 3HIFA 4LGWA 2LKPA 3SJMA 3HB9A 4ON0A 5F08A 4DBQA 3I3LA 1VNDA 3HDDA 1MDMB 3WGIA 3SHFA 5JLWA 4KMUX 2RNGA 2K9QA 3X2QH 4C3HJ 1K79A 1IJWC 2PQ8A 3ESWB 2CSOA 4XKWA 4G7HF 1LEBA 2D1VA 4HV6A 4Y17A 2KFDA 1GLNA 4C9YA 4IHXA 5FKOA 2YUSA 1FYLA 3RSNA 2O6GE 2L7MP 3HTSB 4JK1X 2QGUA 4D5FA 4FE7A 2DA3A 2COMA 2PJPA 4M9ZA 3ZMSA 3KYCB 1B9NA 2KJCA 3PO2J 1OYIA 2IAIA 3AG4H 3JRHA 3E6CC 2IPQX 2Z33A 4QIWN 3FDYA 2D5VA 1X3WB 2EZHA 3CMEI 1FSEA 1ZK8A 3WTZA 4WXHA 1SMYF 4Y4RA 4YIFA 4KDPA 1OKRA 3D5RC 4PGHA 1G4DA 5JR3A 5M5YJ 2LKSA 1W36D 4NC7A 4K2EA 1QGPA 1ZGAA 2HQ5A 3QQAA 4ASNA 1S72I 3H9QA 3K1MA 4B3AA 1BM9A 4WK8F 2FOKA 3BZ6A 4JP0A 5LFAA 3GLXA 1I1GA 1V54H 2L2OA 4D7MA 5JVTA 4CZZA 2ZXWH 2H6CA 4KN7X 5FFZA 4RLQA 2O0YA 3V8KA 1NH3A 5CLSA 2Z5UA 1TW3A 2M9HA 4Y7NJ 3QPTA 4NHJA 3F6OA 3RJPA 4LG0B 3WGHA 1T2KA 3EQLF 3IV5A 2NVXJ 5DD8A 5HDKA 3OYAA 2R7QA 4D0PA 5HOOA 4ENJA 3FXKA 3BG6A 2DJNA 3N4MA 3WHCA 1TNSA 1YIOA 4I01A 4QSHA 3RPUD 2X85A 3BCAA 4OINF 3HL2A 3CF5F 3IKVA 2WADA 4U87A 1JKQC 3ZN1A 1HKTA 2X1CA 5LEKA 2CJJA 4JX4A 4EJUA 4XIDA 2IEKA 4EV0A 3KYLA 3B6AA 5LEJA 2VODA 1A6IA 3L2VA 3J7AO 4IHWA 3QP5A 4YELA 1ITYA 2LH9A 2MGQA 1MNMC 1FOKA 4ETSA 1PP8F 1SVMA 2O8KA 1YJWI 2LY1A 2BY1A 2L4AA 3GTOJ 3SXYA 5FKLA 1POGA 5JLXA 5H2FC 4MNUA 1R23A 3BC8A 1D0ZA 2OBPA 3HGYA 1Y0NA 2R5YA 1MD0A 3SZPA 1K78B 2ZC2A 3FISA 5GAHJ 2ISYA 4IJAA 1ZTRA 4BEHA 4I2OA 2FEZA 3ABLH 2QM3A 1P6RA 4RB3C 3H9JA 2DT5A 3FIWA 3CCMI 1V55H 3CLOA 1WSUA 3I56I 6PAXA 2NOGA 4Q47A 2Y0MA 3OWTA 1HKQA 1QO0D 3PQJA 3S2WA 4X1EA 1YX5A 4XLNF 1PUEE 2L7KA 4UUVA 3K0LA 4KISA 2R7XA 4X0GA 2M7BA 4MHGA 5L3GA 1FOYA 1GVJA 4A3KJ 3H0GJ 4B1RA 1FOWA 4ZZLA 4G94A 2FF4A 4YEJA 2H1LA 1O7FA 4AIKA 2B63J 2RN7A 1T98A 4H4KC 3CUQC 2E2JJ 2DYSH 2IS1A 2ELJA 2P5VA 1RR7A 1X1PA 4A3BJ 5J6XA 3JTHA 3A2KA 1J75A 3OIPA 3SQNA 1R4NB 3DLLF 5GADJ 3RKYA 1X2MA 2XPVA 3WTUC 3C7JA 2L3DA 1YS6A 1XSXA 2PX9A 4N4OB 2G0EA 1SFEA 3A01B 3TO6A 3IHUA 2EWNA 3K4CA 1U2WA 1LDKB 3AG1H 3Q0UA 2HTSA 4MGRA 2DT6A 4YFKF 4NC6A 3CD6I 1OISA 2IXSA 2MYSA 1MGTA 4OWRB 1RESA 4S05A 4AVPA 1JTXA 2CQNA 5LD2C 2DT7B 4F7ZA 4OMZA 2M0MA 2JQ7A 4A0ZA 5K7ZA 3WG7H 1D5VA 3L2WA 1JXSA 3GWZA 1JJ8C 3DBLB 3ZXSA 1XMAA 2MSYA 3LQRA 4DGWB 3OMYA 3BR1A 1EJ9A 1SFXA 3JW4A 5FD6A 2GBYA 3LFKA 1MSFC 3E5QA 4KJZA 3JRGA 1XTAA 3MZHA 2FNAA 1FPQA 1G3TA 3S17J 1NHAA 2LVSA 3I59A 3DTEA 1IXRC 2XROA 2E2IJ 1Z0XA 3Q3SA 1FMVA 2AXLA 2RGVA 3CC7I 2CWEA 4BH9A 1X1CA 4L9TA 2DA6A 4CICA 1KU2A 3JAMZ 4HQMA 1DGRM 3ZMVA 2OV7A 2E71A 2Q2EA 1GDTA 1KU9A 4M73A 3R61A 2PG4A 3I5UA 3PFIA 3JCUC 2ZKZA 2R93J 3OYBA 2Z2SB 2A07F 2YPRA 2M45A 1GXQA 3KFWX 4XLFA 1IUYA 5KNLA 2KHMA 1LFUP 2K85A 2BW3B 5FLMJ 5DS9A 1P7IA 4B09A 2ZJQF 5GAGJ 1YG2A 1IF1A 4XMYA 3RQ4A 2VOPA 5F6FA 1B72B 4XLPF 2CFOA 3ABTA 2QWWA 5K5QA 1ETXA 3L2CA 1Z9CA 3I4PA 1MMNA 1ULYA 1QPIA 1DQUA 1ON2A 1VFCA 1R22A 2CV0A 3BT9A 1MBEA 2ZSIB 3FXQA 4YRVA 3ZP5A 4E7HA 2DDBA 4NUBA 1QHGA 4PSWA 4MLOA 2W7NA 4BACA 5AIQA 3FHZA 2VKDA 2M4GA 2FQ4A 1LFBA 5CQEA 1S7EA 4L0ZB 1HKSA 1GVDA 1RKWA 4E7JA 1OCPA 4A3JJ 2KKOA 1ETQA 4M9SA 1FT9A 4KT6A 1FC3A 4KYWA 4EGZA 3HOWJ 2HEOA 2M34A 2RAEA 4BBSJ 5F0CA 3ECHA 2JMWA 2QEXI 2V7FA 3LMMA 3P7NA 5F64A 2VKVA 5ICGA 4XONA 4BDZA 1WVRA 5LRSA 2H94A 1IN7A 2EIKH 2F5VA 2E60A 2DA7A 2HYGD 2DK8A 1JKPC 1T33A 1YJ9I 4MEYF 3HHHA 1X1DA 1ACIA 1GHCA 1R5GA 1R00A 5D4RA 1MMDA 3KZYA 2GXBA 1AWCA 2B0LA 3C2BA 3F23A 5IY5H 2H6BA 1RR8C 3GTQJ 2KDZA 2IJLA 2D45A 2HVSA 4Y15A 1SD5A 1WJCA 2CW7A 3FXJA 1IRGA 2TDXA 4A0YA 4XQFA 3OSFA 3M7GA 2FMYA 4CYDA 4MQVA 3CDLA 1H9TA 2HDDA 1WRJA 1BOBA 5EEHA 2PMHA 2ESNA 3T8TA 1BW5A 1Z91A 4F3QA 4A3DJ 1QZEA 2R7OA 3C2HA 1H0MA 5BMZA 3BR3A 4RB2C 3KCCA 1YO5C 2DODA 2BXZA 2F4IA 2E19A 1OJLA 2OZUA 4FTHA 3KE2A 3GUDA 4ENKA 4XLHA 1WCMJ 1JT0A 2LK2A 1IO2A 2EK5A 3KP3A 5ED4A 2KIMA 4P9UA 2DTRA 1FYMA 3JRDA 5EF6A 1ZQ3P 2DI3A 1U5TC 3ASNH 2XGEA 1TQPA 2MD0A 4V19K 4NB5A 4YIIA 5FKNA 3OS0A 1OCRH 2DFFA 2XAFA 3AKZA 1V5GA 2OTJI 3EUKL 4DZPA 4OIQF 3CJRB 2WY7Q 3I55I 1B6AA 5IT9Z 4XKBA 4CCOA 2DBBA 3CDHA 3DQVC 3BQYA 2NRAC 2EIJH 4AM3A 4AYBA 3F9KA 3MEXA 3RZDJ 2FBHA 1A36A 4RAYA 2GA1A 4I02A 2DOAA 1FP2A 3CMYA 4BE0A 1I27A 5KCMA 5K5OA 1NK2P 2HZTA 1GV5A 2E5ZA 4C30A 3CCEI 4G12A 4M3GA 2L02A 5DYMA 2GA2A 4KITB 4YIRX 1VF9A 4A93J 4Q48A 1QU3A 2HS5A 2HQRA 3IP4B 1SD7A 1TBXA 3G73A 1UFMA 2L9RA 2DW4A 4M6XA 5FD5A 2R5YB 3R60A 1O4XA 2QKMB 1MBJA 4BEHB 3LSIA 3H5NA 4BXUA 1Z6RA 2V9PA 4Y33A 2ELHA 3V7CA 4HYEA 4XLAA 2LC2A 5JFRA 1UAAA 1U78A 5J3LA 1N78A 2LMDA 2K86A 1T0FA 2XKOA 1MZBA 1Y1VJ 4P96A 2KRCA 3ZQHA 4HF0A 4RAZA 2UUZA 3JSPA 5A2QZ 3S93A 1R36A 3KP6A 3I4MJ 4FCYA 4UNOA 3FBIB 1LNWA 3SZTA 3W2AA 2EH3A 3EPZA 4YFXF 1FBUA 3CESA 4FHTA 4IRHA 4GYGA 1DP3A 3R4KA 3ABKH 2A6HF 3CJQB 2JRMA 2L0KA 1MMSA 3HKZN 1XGSA 2EA2A 2GIVA 4HW0A 1VQ6I 3LL7A 1XCBA 1PDNC 3HJEA 3QYEA 2M87A 1UHWA 3ZCOA 1BJAA 1HDDC 1HXDA 5CVJA 2RVCA 5D6EA 4BE1A 1UCRA 1WJBA 4J00A 4E7ZA 1P9QC 1Z3YA 2QQAA 2W25A 2KPMA 4B3XA 1DDNA 4BL0B
chains in the Genus database with same CATH topology
1OCOH 3ASOH 2Y69H 3ASNH 5B3SH 2EIKH 3AG2H 3ABKH 2DYRH 2EIMH 1V54H 2OCCH 3X2QH 1OCRH 2ZXWH 1OCZH 3ABMH 3AG4H 3WG7H 3ABLH 2EILH 2EINH 3AG3H 3AG1H 5IY5H 5B1BH 1V55H 2EIJH 5B1AH 2DYSH 1OCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO H;  3ASO H;  2Y69 H;  3ASN H;  5B3S H;  2EIK H;  3AG2 H;  3ABK H;  2DYR H;  2EIM H;  1V54 H;  2OCC H;  3X2Q H;  1OCR H;  2ZXW H;  1OCZ H;  3ABM H;  3AG4 H;  3WG7 H;  3ABL H;  2EIL H;  2EIN H;  3AG3 H;  3AG1 H;  5IY5 H;  5B1B H;  1V55 H;  2EIJ H;  5B1A H;  2DYS H;  1OCC H; 
#chains in the Genus database with same CATH topology
 1OCO H;  4EJW A;  2N8G A;  3HOY J;  2DLL A;  2PMZ A;  3OR2 C;  4M6Y A;  2GXG A;  5FRN A;  1SD4 A;  2XB5 A;  3HXL A;  1W5T A;  2AXT C;  1WKM A;  1B9M A;  3GTL J;  4D5C A;  2AS5 F;  2G9W A;  4ZDL A;  3E5U A;  1FYK A;  3H36 A;  1DGW Y;  2ZNY A;  2IRF G;  2RV8 A;  5BOX A;  5FB2 A;  3OY9 A;  2JA7 J;  2M8G X;  4IHV A;  2BEO A;  2V9K A;  3QPS A;  2CUZ A;  1R49 A;  3DPT A;  3D5S C;  3GW2 A;  1QNT A;  5LBQ A;  1K4T A;  2YS9 A;  2GLO A;  2XAG A;  4HF2 A;  1T95 A;  3VSK A;  4XL9 A;  3NAU A;  1FTT A;  2K3P A;  2QCO A;  2VIX A;  4IRG A;  1R1V A;  4GCV A;  2D1H A;  2VI6 A;  2BV6 A;  1EV7 A;  3GZ5 A;  4I0B A;  3T1B A;  4CA0 A;  2K4J A;  1RNL A;  3AL0 B;  2EQR A;  3E97 A;  1A04 A;  4XBF A;  1ZR4 A;  1BW6 A;  2K9S A;  5IOY A;  1O3S A;  2RNJ A;  3ML6 A;  1XSV A;  5D5U B;  5D8K B;  3K4J A;  1RIO H;  1J5Y A;  3BDD A;  3FKI J;  2TRT A;  3ISP A;  4JX5 A;  2R92 J;  2H8W A;  3O3K A;  2R7U A;  2X9D A;  4OIP F;  4F55 A;  2VJI A;  5FJ8 J;  3UKG A;  1FY7 A;  4PUS A;  3AAF A;  3I59 B;  1UB9 A;  4R1H A;  2STW A;  4RDU A;  2NS7 A;  1Y1W J;  5D8L B;  5TRD A;  1XGO A;  2KDO A;  4GXO A;  1FSH A;  4PCQ A;  1K7A A;  3C1D A;  3BJ6 A;  2L54 A;  3HRM A;  5GP9 A;  1DU0 A;  2LOO A;  2ZFW A;  2Q2E B;  2E1O A;  3RYP A;  2NVU B;  3J7A Y;  1BN5 A;  2ADU A;  4QPQ A;  3HHG A;  2MH9 A;  2BXY A;  5B1B H;  3OYE A;  2L4M A;  3KEY A;  5FKK A;  2YU3 A;  1D8K A;  4LG3 A;  1H9G A;  4PJJ A;  4U0W A;  4BJT A;  2YX7 A;  3U21 A;  1GV2 A;  3F3X A;  4DZJ A;  3KZI C;  3OR1 C;  3DEU A;  1YS7 A;  3BOQ A;  2QQB A;  4LJZ F;  1R9T J;  2X1D A;  3HPH A;  3A02 A;  1B1B A;  4ZZD A;  4CZC A;  3RDI A;  1S5L C;  3V8J A;  1D3Y A;  3REO A;  1OFC X;  1D8J A;  4PFP A;  2ZO4 A;  1JE8 A;  1PVE A;  3MQ0 A;  4U7D A;  3GTK J;  5HOD A;  3KEO A;  2BY3 A;  1T56 A;  2YR2 A;  4HG2 A;  1BIB A;  3MVP A;  3IAM 2;  2BYV E;  4MO7 A;  2Q0O A;  1LDD A;  3G2B A;  2KT0 A;  5CVV A;  2GM4 A;  4DYQ A;  1FLI A;  2M8E A;  1V3F A;  1I3Q J;  5F04 A;  4Y13 A;  1WJ5 A;  5HS7 A;  4G6T B;  1OYW A;  3DKW A;  3V7S A;  4AVZ A;  1J2X A;  2EJR A;  2A05 A;  3LSM A;  4IX7 A;  2OTL I;  1M1E B;  5J8F A;  2X6X A;  2QF7 A;  4A3F J;  2K7L A;  2NVQ J;  4UB6 C;  2XB0 X;  5HLG A;  2H1K A;  2DPU A;  4EEF G;  4O5V A;  1TZL A;  2Y48 A;  4HPQ A;  3MD2 A;  4E4H A;  1N75 A;  2DA5 A;  2Z99 A;  1QBJ A;  4RB0 A;  3L00 A;  4WCG A;  3PUF A;  5EYR A;  3JRB A;  2XC7 A;  3KET A;  1RI7 A;  1X4O A;  2VQH A;  2ZBK A;  3BJA A;  1OR7 A;  4A3G J;  2M1B A;  2Z16 A;  1S3J A;  5K7H A;  3M07 A;  5AON A;  3F8C A;  2EIM H;  1Z7L A;  5EG0 A;  4I98 B;  1P92 A;  4WWC A;  3LNQ A;  2ZFU A;  3WGG A;  2LY9 A;  3PM1 A;  4XRF A;  1I50 J;  2EFQ A;  2DN0 A;  4BUP A;  4LK1 F;  5HVQ C;  5C4J J;  1S7O A;  4G6D A;  2GQQ A;  2MBF A;  1WQ2 A;  4BS9 A;  2IGM A;  1MBH A;  3CMA I;  1VTN C;  3ZQL A;  4L5I A;  2IA1 A;  4QLC U;  1LPQ A;  2VON A;  2V6E A;  4M72 A;  1LVK A;  2CW0 F;  2XSJ C;  5J1R A;  3K4B A;  3MZ8 A;  2PLY A;  4XOT A;  3NRV A;  3GXO A;  1GXP A;  1KQ8 A;  1E3H A;  5D4S A;  1SVO A;  1F5T A;  2XGD A;  3SFZ A;  2BOL A;  1IXS B;  3K2Z A;  2W24 A;  1ONV A;  1ZRD A;  2WB1 N;  3CJN A;  4KIF A;  3S3N A;  1DP7 P;  4LD5 A;  3BQZ A;  3KEQ A;  4BY7 J;  3DKY A;  4QWQ A;  4FAS D;  4E7L A;  1YYV A;  3JTG A;  5ILS A;  2F48 A;  4RGU A;  4RGX A;  4HF1 A;  1W5C C;  1TNT A;  4XSX F;  1RZ4 A;  3ZQQ A;  1R7J A;  2COB A;  2DOF A;  2ETH A;  4BJ5 C;  4B44 A;  3CP8 A;  2M3A A;  1T6S A;  2VT2 A;  1UZC A;  1AOY A;  2NNN A;  2FJ1 A;  4FQG A;  3I53 A;  3IL2 A;  1P7J A;  2GZW A;  2W82 A;  4XRS A;  2BHZ A;  3F8N A;  5DD4 A;  5F0H A;  3SFI A;  1Z1D A;  3NWT A;  2VQG A;  4JBA A;  4PGG A;  3FXL A;  3B6C A;  2ESH A;  4UVB A;  3GFJ A;  1V4R A;  3MKL A;  4E7S A;  4MFD A;  4E7I A;  3IH2 A;  2R7V A;  2Y31 A;  3C2G A;  3N05 A;  2VJJ A;  3MWM A;  2R7D A;  3EUA A;  3T8R A;  3VYU B;  2H27 A;  2PJR A;  2IS4 A;  4I0A A;  4IPA A;  1ZH5 A;  2VC0 A;  1Z3X A;  3OYM A;  2EFW A;  3LST A;  1EH7 A;  1Z6T A;  2JTV A;  4RGS A;  1X2N A;  2ZJR F;  3FHN A;  1AA7 A;  3V42 A;  4Q4Z F;  2I5U A;  2DTZ A;  5E79 C;  2F4O B;  1VQP I;  4ZYD A;  2LNB A;  2MAB A;  2PN6 A;  3QRF F;  2XSD C;  1MBK A;  2BZT A;  2FA5 A;  3CC4 I;  2DFI A;  1F36 A;  3GBG A;  4XOP A;  4LFU A;  4AID A;  3WE3 A;  4ZDP A;  2UZK A;  1IC8 A;  3W6V A;  1HBX G;  5GTI C;  3L2R A;  1LKX A;  4MTD A;  3VWB A;  2DU9 A;  5DUI A;  4O6J A;  3L09 A;  4OOI A;  2E34 A;  3K7A J;  2DYR H;  2E1M C;  3KIO A;  2WAE A;  3SEZ A;  1TC3 C;  2HQA A;  4ZDO A;  4G7O F;  2BY2 A;  1WFX A;  1ZN2 A;  5TGT A;  4HOB A;  5KK1 A;  1MNE A;  4UY8 I;  2DXI A;  2AQF A;  2X6Y A;  3ZN0 A;  3W2V A;  2KIS A;  3QOD A;  2LY2 A;  4ENN A;  1Q1H A;  2KIF A;  2XF7 A;  1E2X A;  4UVC A;  4S04 A;  4C2M J;  4AIJ A;  5J1U A;  2LD5 A;  4HST A;  1R1T A;  2A6T A;  2EV5 A;  4PDK A;  2X51 A;  3OYI A;  1LE8 A;  3ZGK A;  3ZMU A;  2AHQ A;  2HFH A;  2JJ7 A;  1UJ8 A;  4EGY A;  5DCF A;  3H0D A;  2VN2 A;  1B4A A;  3GVA A;  3ZMZ A;  3OSG A;  4BXF A;  1BJZ A;  3FXM A;  2X4H A;  3P5J A;  4RB1 A;  2A6E F;  3QU3 A;  4M6V A;  3AL0 C;  1S9H A;  2EZL A;  2V26 A;  4MQ9 F;  3MKW B;  4XKC A;  5FGM A;  1JUM A;  2VJ4 A;  2WY8 Q;  3DEW A;  3HOU J;  3CUO A;  5LHG A;  2RRE A;  2X6W A;  4DJA A;  2AQE A;  2FD5 A;  3DTI A;  3S1Q J;  1A31 A;  3OYN A;  2ME6 A;  3U9G A;  1QHH D;  2LFB A;  3TBI A;  4ZYH A;  2FNP A;  4KUM A;  4P55 A;  5DM7 F;  1SFU A;  3PSF A;  3ZMT A;  1Z21 A;  1ZG3 A;  2I8D A;  1ZEL A;  3PNV A;  3HC7 A;  4LLG F;  1IN5 A;  2K4B A;  1YW8 A;  2JPC A;  2IW5 A;  2KP6 A;  5EDN A;  5FLX Z;  3GFL A;  5F27 A;  1IGN A;  2W84 A;  2ME0 A;  2CG4 A;  4GYI A;  4B8X A;  1H89 C;  1OYY A;  2FML A;  3BTJ A;  1Y0U A;  3QOP A;  2MFZ A;  4KMF A;  2GOM A;  3DBH B;  3T5X A;  3JAM K;  4B47 A;  3HBL A;  2EFN A;  2Y30 A;  2KJB A;  4II3 A;  4EAT A;  4UB8 C;  1K61 A;  4IEJ A;  2R4G A;  1VQK I;  4L9V A;  1STZ A;  2LLK A;  1G6N A;  1LQ1 A;  4ITV A;  4A0X A;  4ANJ A;  3D1N I;  2OU2 A;  4XK4 A;  4M3F A;  5JHU A;  5L3C A;  3OIO A;  5F1J A;  5C3E J;  1BI3 A;  3F8F A;  3O8G A;  3OL3 A;  3TMO A;  2Y0S N;  4M74 A;  3JRI A;  3LSJ A;  1HQC A;  1ZG5 A;  2JUC A;  5DUK A;  1HW2 A;  2OD5 A;  1TWA J;  3W6K B;  1S29 A;  2OPT A;  5FO5 A;  9ANT A;  2R7W A;  2W1O A;  3M8E A;  2Z3Y A;  2WWY A;  1ERD A;  5L3D A;  5ILU A;  5E1W A;  4Q5S F;  1X58 A;  3SDB A;  1NK3 P;  5DM6 F;  1ZRC A;  3S3O A;  2KIQ A;  5HLT A;  4HDU A;  1X19 A;  2IS6 A;  2KZG A;  2E1C A;  3J80 K;  5E3O A;  3F22 A;  2XUB A;  1YX3 A;  2WAF A;  1MW7 A;  1XS9 A;  4G8X A;  2VBY A;  5IYD J;  3BG9 A;  2CUF A;  5GPA A;  2L01 A;  3DKX A;  1QQI A;  4HBL A;  4RA2 A;  2GAU A;  4LIV A;  3TDU C;  3CCS I;  3M8F A;  1L3L A;  2GXA A;  2P6S A;  3I58 A;  2P5K A;  3VFZ A;  4WX9 A;  3PNY A;  1IW7 F;  5DDG A;  4HNU A;  3IRQ A;  1ENH A;  1KON A;  3H92 A;  1NTC A;  3KLO A;  3M4O J;  1UG0 A;  3WU2 C;  3F8B A;  5DCM A;  2NOJ B;  3CMM A;  4JQF A;  5IT3 A;  3JRE A;  3H3Z A;  2G7U A;  2Y69 H;  4WXD A;  5B3S H;  4KA4 A;  1BIA A;  3CDI A;  1XD7 A;  4GFB A;  1NG6 A;  3M3Y J;  1ZRF A;  4V2F A;  2R7R A;  2HI3 A;  1DPR A;  3HTU A;  3BPX A;  1TQI A;  3E6M A;  2CUJ A;  2ZCW A;  4ENM A;  3FK6 A;  4C2U A;  1SEU A;  2V1D A;  5IP7 J;  3E1S A;  5E8I A;  2FUG 2;  5D6F A;  5FKM A;  4XSZ F;  1LDJ A;  2GOX B;  5BPI A;  3S32 A;  3WG9 A;  5IPA A;  3OOP A;  4D1Q A;  3SYT A;  4A12 A;  4KIC A;  1BR1 A;  2M0C A;  1MJ9 A;  5EG0 B;  3KYD B;  2W00 A;  4O3M A;  3BR6 A;  4ZH4 F;  1SMT A;  4IL6 C;  2FSW A;  2B7E A;  3LSP A;  3IH4 A;  2JT1 A;  3BTI A;  4M3D A;  1WH5 A;  5K1Y A;  4OIO F;  1BR4 A;  4NNJ A;  3VYT B;  3KP7 A;  3FBN B;  5CYV A;  3TP0 A;  2P6T A;  4D9J A;  4PZJ A;  1DUX C;  3AG3 H;  2HGC A;  1JJ6 C;  2EZI A;  5AIP A;  2HKX A;  2IP2 A;  3HYI A;  1IXC A;  2VKH A;  3OS1 A;  2W48 A;  4HX8 A;  3VB2 A;  3PIO F;  2LG4 A;  1PUF A;  3VYS B;  4EJT A;  3RTR A;  1L0O C;  3TDZ C;  1HOM A;  2TCT A;  5L3F A;  3CCR I;  1J7K A;  2NAZ A;  3TGN A;  4WF2 A;  5E3M A;  3J7Y J;  2Y2Z A;  3K10 A;  3S3M A;  1Y8Q B;  3HKZ A;  2DCE A;  4UHT A;  1BBY A;  2XV4 S;  1QZZ A;  3WTW C;  2JA5 J;  4CH7 A;  2OZ6 A;  3CCL I;  1G8X A;  1TLH B;  1B8I A;  2AO9 A;  1YLF A;  2QEN A;  2UXN A;  4FX4 A;  3FK7 A;  3F6V A;  3Q5F A;  1UST A;  1W1W E;  1V5E A;  3HUG A;  3WTT C;  1OPC A;  2D2W A;  2E35 A;  2O5R A;  3K1N A;  3K70 D;  4BU2 A;  4XLE A;  4IKF A;  1A5J A;  5IOZ A;  4N9H A;  3E6B A;  3LWF A;  2LBF A;  1XDS A;  4QPO A;  1KU7 A;  1YOV B;  3FZV A;  3TOB A;  2YSR A;  3Q9V A;  2R5Z A;  3HSE A;  3ABU A;  1W36 C;  2R7Z J;  1W7P A;  5CVU A;  3JRC A;  3O2P E;  2XAJ A;  4BBR J;  4IZZ A;  1O3T A;  1QA6 A;  2VE8 A;  2PJR B;  1T0F C;  2JK3 A;  3EUH C;  2A68 F;  5B5E C;  1Y6I A;  2CQK A;  3PSI A;  2K27 A;  1U5T A;  2HOA A;  3GCM A;  1J0R A;  1HW5 A;  1X1A A;  1SD6 A;  4NQW A;  1XC5 A;  4CYC A;  3RI4 A;  2HOS A;  2JVG A;  3CF2 A;  5H6R A;  2P5L C;  2KRH A;  2XF5 A;  3HM5 A;  3PJR A;  4LLL A;  2V1U A;  3O6B B;  2IT0 A;  3MN2 A;  5LGT A;  1Z05 A;  1W0U A;  5A2Q K;  2DA1 A;  2F2E A;  1JGS A;  2IVM A;  2O03 A;  5HNF A;  1YTY A;  3A1Y A;  4IOA F;  2OUM A;  1T8I A;  4PJ0 C;  5J47 A;  5TIS C;  3VEP A;  1ETO A;  2DQL A;  4KIB A;  1JUP A;  3DF8 A;  1K6O A;  2VL8 A;  1ZG1 A;  2WAQ A;  4N4N B;  3TP3 A;  2DMT A;  2MA3 A;  3OYC A;  1TT5 B;  2QUF A;  3QP6 A;  1HLV A;  1ODD A;  1MKM A;  3TL4 X;  3CJT B;  1TQM A;  4Z2Y A;  1IV6 A;  3IKT A;  2CS3 A;  2CMP A;  4OAZ A;  4M3E A;  2H8R A;  2M7A A;  3H3U A;  2J5O A;  3HSR A;  2ZJP F;  1ETW A;  3GYH X;  4IO9 F;  4KNY A;  2HNH A;  2VOO A;  2VPR A;  1U3E M;  4C2T A;  2BY0 A;  2CV2 A;  1E0E A;  1EA3 A;  2K9M A;  2CRG A;  3DU5 A;  2FBK A;  2QA4 I;  4UV8 A;  3ZRG A;  1IN6 A;  2VUM J;  4CXF A;  4IHT A;  1LE8 B;  3TW7 A;  4A3L J;  4UXN A;  1OMI A;  5ERI A;  4CGZ A;  4OAY A;  3UR3 C;  1LFP A;  3L2Q A;  1YJN I;  2XGX A;  5HS9 A;  3E7L A;  4GRI A;  2XVC A;  2IA2 A;  4E6K G;  1DPU A;  3BPV A;  4UVA A;  2LTP A;  4IHY A;  4AYB N;  2HU9 A;  2LF7 A;  4BNC A;  3VOD A;  2QSH X;  3G6E I;  5E3L A;  2E1N A;  4XNF A;  1U0J A;  3QOE A;  4XKV A;  4PJM A;  2ZXI A;  3MKY B;  1Y39 A;  4BE2 A;  1TT0 A;  4A3C J;  1UMQ A;  3ZQF A;  3DTK A;  4BGD A;  3FM3 A;  4JYK A;  5LGU A;  3NWS A;  2BVL A;  3GTM J;  2BGC A;  1K4S A;  2ZXH A;  2W85 A;  3S8P A;  1IRZ A;  4EVI A;  1T08 B;  3FXR A;  5EEA A;  1HCR A;  2A69 F;  2X0L A;  1DU6 A;  4P5O A;  2Q1Z B;  4F52 A;  1MJA A;  2HZD A;  3KX2 A;  4A3I J;  3ERE D;  4HAM A;  4EQQ A;  3KPH A;  1FZP B;  2HQN A;  4IOC F;  2HXO A;  3WTY C;  3HPG A;  3PIP F;  3S2H J;  2ZME A;  5K7F A;  1IDY A;  1F43 A;  4AD9 A;  4RBO A;  3PQK A;  3HOS A;  1TWH J;  3ZQG A;  4AC0 A;  1JKO C;  4EJO A;  4UUS A;  3V8L A;  1E17 A;  2DAO A;  1BI1 A;  2O9L A;  1KQ9 A;  2HXI A;  4LLN A;  3OS2 A;  1MSE C;  1IDZ A;  4N9I A;  1XG1 A;  5LLQ A;  1IUF A;  1J9I A;  1XDU A;  1LUJ B;  1RKT A;  2IGN A;  3LA7 A;  4OMY A;  1ZGJ A;  1AU7 A;  1T38 A;  2MC4 A;  3N97 A;  1YIT I;  2JA6 J;  2O61 A;  3LA3 A;  3TOA A;  1F4K A;  2DFH A;  3BR2 A;  3A03 A;  3O8H A;  4R79 A;  4L0Y B;  2G7H A;  3ZMD A;  1J09 A;  5IYB J;  2OC6 A;  2KQR A;  3UNG C;  3BG5 A;  4HDV A;  5C4X J;  1BI0 A;  2ECB A;  3EYY A;  2R3S A;  1TW2 A;  5LHH A;  2MD5 A;  4R8H A;  3GTG J;  2LRD A;  4G9Y A;  4M71 A;  3IH3 A;  3DWL E;  2JA2 A;  2WB1 A;  4HLY A;  3P9I A;  2CYY A;  4I09 A;  1I39 A;  2R7F A;  2EPF A;  4HX4 A;  3CTA A;  1W4M A;  2CUE A;  5J40 A;  3J81 Z;  4L5J A;  3CC2 I;  2KMU A;  4RS8 A;  3V4G A;  2MW8 A;  5GAE J;  2R0Q C;  1ETK A;  3NEU A;  1R58 A;  4BYY A;  3A4C A;  4PFO A;  4JOM A;  2E36 A;  4XLC A;  2PMZ N;  5EZG A;  3RYR A;  1MBG A;  5M5X J;  3H5A A;  1OR7 C;  1EH6 A;  2XPU A;  4XIC A;  1AHD P;  1WPK A;  3LQQ A;  1UHS A;  5EEG A;  1J59 A;  1KGS A;  1XMK A;  1ETY A;  2OAZ A;  3LAP A;  4F91 B;  1Q1V A;  2P7V B;  2V1N A;  2X48 A;  2PFB A;  1Y56 A;  1HST A;  2ELK A;  3E6D A;  4F92 B;  3WU1 B;  3ZQC A;  1OCT C;  5HDN A;  1KA8 A;  2XAH A;  2DOE A;  3FX3 A;  3BZC A;  2KL4 A;  5DEQ A;  4KFC A;  4EJV A;  5DCM B;  2XKP A;  1MH3 A;  5ICF A;  2VB6 A;  4H0E A;  1MBF A;  1ORK A;  1O3Q A;  4GO1 A;  1W7P D;  2Z9O A;  1YRN A;  4XR6 A;  3J7Z I;  2F5F A;  1F9N A;  2A61 A;  1C0W A;  2CQQ A;  2OF7 A;  3OYL A;  3FWE A;  3RCO A;  5ILV A;  2HDW A;  3ELK A;  1S8N A;  3H3V K;  1FIP A;  2P0W A;  2PBI A;  3BP8 A;  4W97 A;  3DLA A;  2NNY A;  5HDG A;  2Y9Y A;  2EZK A;  1TWC J;  3R6S A;  3IC7 A;  2ACJ A;  2MH2 A;  3BG3 A;  1U8R A;  2P8T A;  1H8A C;  1G3W A;  2KLO A;  5FFX A;  2FE3 A;  1X3U A;  2QKL B;  2VBW A;  2FX0 A;  1TWG J;  3MKZ A;  2HKO A;  3GLL A;  1KZH A;  1A35 A;  3SEQ A;  3CCY A;  2X1E A;  4XN3 A;  3HOZ J;  5HLI A;  5IP9 J;  1RRJ A;  2WC2 A;  1G2H A;  1QVT A;  2GIZ A;  4BDY A;  1U6G A;  2E7W A;  4PJN A;  1UEL B;  2EIL H;  4P9F A;  1R5H A;  1PUF B;  1USS A;  1VZ0 A;  1X4P A;  1W0T A;  4Y52 J;  5EZH A;  1RPW A;  2VXD A;  1TTY A;  3QYF A;  1NG7 A;  4XRM A;  1YQA A;  3S1N J;  4CCL A;  1WI3 A;  2BVM A;  2DO7 A;  1YW9 A;  2JVH A;  3LAJ A;  3BG7 A;  5CVI A;  1FBQ A;  2XIG A;  3OL4 A;  4U88 A;  2VKE A;  1B8I B;  3M1E A;  5FRO A;  3V7R A;  1MMG A;  3KP2 A;  2NVY J;  4YFN F;  5E3N A;  3ABM H;  5E1X A;  3CCU I;  4I76 A;  2Y75 A;  4EMS A;  2R7S A;  3K6G A;  5CPR B;  4U7B A;  3JRA A;  4HNV A;  3HUG B;  3K1P A;  2EV0 A;  2LYC A;  4PK4 A;  4ABZ A;  5F1R A;  4IRI A;  2EB7 A;  4BQO A;  4ZYA A;  4W1U A;  3JRF A;  4MIM A;  1MJB A;  2LBF B;  2A3S A;  3H1C A;  1YI2 I;  4AUX A;  1BR2 A;  4J19 A;  1YIJ I;  1WJD A;  3VSL A;  3BJO A;  3CO7 C;  2R5Z B;  3CCV I;  5LHI A;  1TWF J;  1W7P B;  2QSF X;  3NQO A;  4UV9 A;  3JR9 A;  2C6Y A;  5CVR A;  3Q0V A;  3DP7 A;  4A69 C;  4LMY A;  1D1C A;  5GTH C;  1UHM A;  1ZLJ A;  2K3F A;  2EFP A;  5J4V A;  4HLX A;  5DV5 A;  1FX7 A;  2IS2 A;  1U5T B;  3CQZ J;  2CU7 A;  3CLQ A;  2JZY A;  1N25 A;  4NQW B;  4CYC B;  2M2E A;  1HF0 A;  2NVT J;  2YX4 A;  3P9K A;  1CGP A;  3C3W A;  1QZY A;  3Q9S A;  3U1K A;  3I64 A;  5M3M J;  1SFO J;  3QPL A;  1ZGW A;  3F21 A;  2ISZ A;  3ONQ A;  1Z7U A;  3DPU A;  2F5C A;  2DFE A;  3OYD A;  2DMQ A;  1YE9 A;  3U1D A;  3EYI A;  2WTE A;  1P4A A;  4L9N A;  3K70 C;  3G3Z A;  3W6J B;  1Z67 A;  1R71 A;  4XRS G;  2A5Y B;  2F6C A;  5E8G A;  4OU0 A;  2QLZ A;  5JVG F;  1A6Q A;  4A5N A;  3A0H C;  3HZJ A;  4DOZ A;  1VI0 A;  1VQ4 I;  3ZPL A;  4P1W A;  3W2W A;  2Y0S A;  3EET A;  1P4W A;  2FU4 A;  4LOC A;  2LDU A;  4ZTJ A;  2O8X A;  1FBS A;  3MFK A;  3ZR8 X;  1I6X A;  2HVR A;  1WJE A;  2WA0 A;  1AKH A;  1XCV A;  1RET A;  3M9A A;  1FNN A;  5CJ9 A;  2F5D A;  3RKW A;  1EH8 A;  1HSJ A;  5EGO A;  3F8M A;  2RKH A;  3DFG A;  4ZC3 A;  3L1P A;  4U0Y A;  4EM1 A;  4LB5 A;  3VDX A;  2BBY A;  1N77 A;  2FBI A;  1QRY A;  3GFI A;  2VLA A;  4DQ2 A;  4M3B A;  1XN7 A;  3TO9 A;  2QBY A;  3TW6 A;  1CF7 A;  3BTC A;  2PEX A;  2Z1D A;  3ZQ7 A;  3H9G A;  1SC7 A;  2EA4 A;  3KP4 A;  2VPL A;  3K4M A;  1PP7 U;  2JA8 J;  3GEZ A;  5DTD A;  2DA2 A;  2DK5 A;  1ZLK A;  4DBR A;  3L2U A;  4L5E A;  2K9N A;  1IRX A;  2Q8K A;  4X6A J;  4CHU A;  1WI9 A;  3HOV J;  2OCE A;  3D5L A;  2I10 A;  2V79 A;  1ZYR F;  2PMU A;  5BPD A;  3G1L A;  1R6R A;  3D0S A;  2J5P A;  2RQQ A;  2V9V A;  5FLX K;  4A6E A;  3MCZ A;  4U0V A;  5H6Q A;  4HX7 A;  5BS6 A;  1WJA A;  1VQM I;  4B43 A;  2DMN A;  2E5N A;  3CUQ A;  2CQX A;  2E7X A;  3FXO A;  1G3S A;  4BQA A;  4LK0 F;  2LSO A;  2NS0 A;  3BZK A;  5BQT A;  2IBD A;  4BY1 J;  2XGC A;  2HPM A;  4A5M A;  3LSG A;  2OQG A;  5ICC A;  4KT5 C;  3I4N J;  3BY6 A;  1B59 A;  3ZOB A;  3ZQI A;  3VOE A;  2ZSH B;  5E18 F;  2DPD A;  2CGP A;  1JHF A;  2H09 A;  3H35 A;  3MAJ A;  2ECC A;  1GUU A;  2WV1 A;  3DPL C;  5FRM A;  1P2F A;  3K4L A;  4XM3 A;  3WTV C;  1YHQ I;  1VQL I;  3LFU A;  3OYF A;  1X3Z B;  4A6D A;  1BL0 A;  3NAR A;  2V1X A;  1R1U A;  2HTJ A;  2ZME B;  4BHB A;  2LF8 A;  2V4J C;  2RC4 A;  1FJL A;  3OIQ A;  3IAS 2;  3GF2 A;  3HEF A;  3HGG A;  4QTR A;  4DW6 A;  4UUS B;  3WHB A;  2KRF A;  1SAX A;  2JN6 A;  5GPC A;  4DNC A;  4GDF A;  4RMN A;  4BJ6 C;  4RM3 A;  2K9L A;  3M8J A;  1FWZ A;  5EJC A;  4EM0 B;  4ZYG A;  3CZ6 A;  3CP2 A;  2UWM A;  4FX0 A;  4LIU A;  1IRF A;  2XF6 A;  4CO8 A;  1H88 C;  4G7Z F;  1U9O A;  3BR0 A;  4A3M J;  1VQ8 I;  2CW8 A;  3FMQ A;  1WZ2 A;  1ETV A;  3S2D J;  4MFE A;  3TO7 A;  4UUT A;  2VQL A;  5KAF C;  2B9S A;  1EF4 A;  1PJR A;  5K5R A;  1HC8 A;  3L9F A;  4HRI A;  5J1Y A;  5HNH A;  3PO3 J;  4A2U A;  3JSO A;  2NXN B;  2LRE A;  5E17 F;  2OQR A;  1QVU A;  2CO5 A;  5E1Z B;  1QPM A;  3Q0W A;  1FTZ A;  2P7C B;  3SDG A;  1WGX A;  2GWR A;  1O57 A;  3ERM A;  3G1M A;  1EKE A;  4NBQ A;  2FQ3 A;  3OYJ A;  5CQG A;  1X1B A;  2EBI A;  5B1A H;  2QSG X;  1XGM A;  3E0J B;  5E20 A;  2OJE D;  1HDP A;  3S1M J;  4F93 B;  3J80 Z;  3DEE A;  1Y8R B;  5KAI C;  5TJJ A;  5BNG A;  1I3A A;  1VQ9 I;  4E7K A;  3W3C A;  1W5S A;  2X6O A;  5IYC J;  3GO5 A;  2L9V A;  4HA8 A;  4NC8 A;  2HR3 A;  4CCK A;  1BOA A;  1D0Y A;  1MDM A;  1WH7 A;  1V5F A;  3IWF A;  2MLG A;  1FP1 D;  3E5X A;  3EDP A;  5F0F A;  4IF4 A;  4I99 C;  2O3F A;  1FMW A;  4L9J A;  1REP C;  2HDC A;  1XX5 A;  4CCM A;  3AFH A;  1YRN B;  3ROU A;  4MTE A;  2EFO A;  4PSX A;  4RGR A;  2L5Q A;  4TV7 A;  1ON1 A;  5HS8 A;  2P4W A;  1JKR C;  1D1A A;  1LB2 A;  2DA4 A;  5KVR A;  4FT8 A;  3OOU A;  3E3V A;  5L3B A;  1YW7 A;  2ZJ2 A;  1ZAR A;  3R0J A;  3CCJ I;  3K4N A;  4HQE A;  2FRH A;  2HVQ A;  1FEX A;  1D1B A;  4E70 A;  2K5C A;  1K6Y A;  1OQY A;  2XAQ A;  2DDA A;  2IA0 A;  4IVN A;  1TP4 A;  1ZHF A;  4GGG A;  4RAF A;  2JRT A;  3KP5 A;  4RLF A;  3K69 A;  2A5W A;  5FLV A;  1KYZ A;  2NS8 A;  2WBM A;  3PUB A;  2HYF A;  3DBR B;  3I71 A;  4AWX B;  3HSF A;  2K40 A;  4CUG A;  2JWT A;  2JUG A;  5IT9 K;  1UG2 A;  1LJ9 A;  4V2G A;  1IV8 A;  1G3Y A;  4IHS A;  2UV1 A;  4YG2 F;  4BKX A;  1XMX A;  2L7F P;  1VQ7 I;  3RIR A;  2L7Z A;  1IN8 A;  5B66 C;  3GX4 X;  2QQ9 A;  3VPR A;  1ZRE A;  1SAN A;  2K02 A;  1LEA A;  4WXC A;  4C3I J;  2LP0 A;  4LG0 A;  4ZTF A;  3K2A A;  4RAG A;  2JPB A;  1I6H J;  4D7N A;  5LRR A;  4BQQ A;  1JGG A;  4XOR A;  1BA5 A;  3HOX J;  1FIA A;  1JT6 A;  1OLT A;  2QZ8 A;  4ZYE A;  2IGK A;  3B02 A;  2HOE A;  4M9X A;  5D5W B;  1LVA A;  3KZZ A;  2YU9 J;  4DIQ A;  1SVL A;  2L9S A;  2XAS A;  1WWX A;  2F5E A;  1GT0 C;  3MMY B;  1MH4 A;  4S0H B;  1K83 J;  1RUO A;  3S14 J;  2DMP A;  4MEX F;  2LKX A;  3FF5 A;  1P4X A;  3ASO H;  4I6Z A;  3KLN A;  3WE2 A;  3HRS A;  2QVO A;  3AG2 H;  3S1R J;  3FMS A;  2RQP A;  1S6L A;  2O7O A;  4IQ4 A;  4ESJ A;  5JHF A;  3S15 J;  3C18 A;  3K4K A;  1PYV A;  2EV6 A;  3GZN B;  2VE9 A;  3ULQ B;  3WU0 A;  1K78 A;  1YFH A;  1F1Z A;  2HWV A;  4ZJZ A;  2XAU A;  5CKT A;  4CCJ A;  1RUN A;  1JTY A;  3K9T A;  1KU3 A;  3R0A A;  4JX6 A;  1CQT A;  3HG9 A;  1VQO I;  3DU6 A;  2KIU A;  4DYC A;  3IRR A;  5J4Y A;  2MC3 A;  3ECO A;  3QYB A;  1ZAO A;  3TKY A;  2JSC A;  3QWL A;  1D5Y A;  4OIR F;  2VXZ A;  4LIT A;  2XHK A;  4BXX J;  3EUH A;  5KHD A;  4AIH A;  3DV8 A;  1JUS A;  1APL C;  3RQI A;  1T39 A;  3RZO J;  3G1O A;  4II2 A;  3PL8 A;  3G71 I;  3BLY A;  1AKH B;  3BCB A;  3GZ6 A;  4BHP A;  3I54 A;  2MG4 A;  2W57 A;  2CQ7 A;  4HZF A;  3HOT A;  1ZR2 A;  3IWZ A;  5EGO B;  2LR8 A;  4DYR A;  1G59 A;  2CV1 A;  2M30 A;  1MMA A;  4A3E J;  2F4M B;  4XN0 A;  1XSD A;  2P81 A;  5JI6 A;  1E3O C;  3QPH A;  5H20 A;  2XRL A;  2QBY B;  3VYR B;  2RDP A;  1CF7 B;  3OV8 A;  3BRO A;  3L7W A;  3RPU A;  5HLH A;  3I9V 2;  2DMU A;  2Y9Z A;  4PJL A;  1SAU A;  1BC7 C;  1IG7 A;  2VQC A;  3LSH A;  4B4C A;  3OYH A;  2BHY A;  4B48 A;  5M5W J;  3FKJ A;  4ESF A;  3A01 A;  2E2H J;  3FXU A;  2CFX A;  2STT A;  1TL8 A;  3GME A;  2VBX A;  1HW1 A;  4KN4 X;  2E1M B;  4J01 A;  4HV5 A;  2M5W A;  1KQ0 A;  3BWG A;  2WV0 A;  2DJI A;  2FOW A;  4NDL A;  2ZME C;  1R5I D;  1S7A A;  2ZXJ A;  3DCF A;  3PNT A;  5L3E A;  2ZNZ A;  3SZG A;  3LSR A;  3MZY A;  1I5Z A;  3OYK A;  1O3R A;  2IGO A;  3CUQ B;  4ESB A;  5J8C A;  2R7T A;  5IP6 A;  3OYG A;  3WTS C;  2HYJ A;  3BTL A;  4FET A;  3WTX C;  1XPX A;  4HNT A;  5D5V B;  4IQJ A;  3P9C A;  2ICW G;  3IUO A;  1ZKG A;  3T0Y A;  1XB4 A;  1U8B A;  4G6Q A;  2ID6 A;  1IN4 A;  3PFY A;  4FE4 A;  3H5R A;  3F72 A;  2CH0 A;  3QAH A;  1XGN A;  1JI8 A;  1MIJ A;  2KZV A;  1D0X A;  2ZB9 A;  4CDG A;  2VT3 A;  2FXA A;  4BQN A;  1VQ5 I;  2HPI A;  1IZ1 A;  2HOT A;  3CCQ I;  2VAS A;  2EIN H;  5ICE A;  2L9N A;  2UXX A;  2M4K A;  2XRN A;  3RKX A;  4BHC A;  3FMR A;  2WAQ N;  1I1S A;  1JHH A;  1OCC H;  2QQ8 A;  3LA2 A;  3A0B C;  3TQN A;  1U9N A;  3LSK A;  4HEA 2;  4RM2 A;  3FM5 A;  2V6C A;  3B73 A;  2JSP A;  3QU6 A;  1OCZ H;  2ID3 A;  3F0C A;  2QYO A;  3J81 K;  1O7L A;  3GTP J;  2BW3 A;  3S16 J;  2VJ5 A;  4EM2 A;  2MLK A;  3DXJ F;  1FOX A;  2BE5 F;  1RC9 A;  1SFK A;  3GFM A;  3HRU A;  4C3J J;  4Y3O A;  1B72 A;  3G4S I;  1E3P A;  5C44 J;  3RKQ A;  2VBZ A;  5D5X B;  4HSR A;  2DQR A;  3M1C A;  3LOC A;  1WHU A;  4CSW A;  4I7H A;  1MND A;  1BI2 A;  2PI0 A;  2VC1 A;  2W4S A;  1VQN I;  1HA8 A;  4Z6Y A;  3BR5 A;  3U2R A;  3TED A;  4N0B A;  2OCC H;  3HRT A;  5M3F J;  4CCN A;  4KIG A;  1R4M B;  3I0T A;  1WJF A;  3GTJ J;  1KYW A;  3COA C;  2XDV A;  3CO6 C;  2NYX A;  1BC8 C;  4BAY A;  5LGN A;  4LB6 B;  2OA4 A;  1Z77 A;  4FIS A;  3WOD F;  4L18 B;  3RPQ A;  4AU7 A;  2XPW A;  4IXA A;  1IAW A;  3HIF A;  4LGW A;  2LKP A;  3SJM A;  3HB9 A;  4ON0 A;  5F08 A;  4DBQ A;  3I3L A;  1VND A;  3HDD A;  1MDM B;  3WGI A;  3SHF A;  5JLW A;  4KMU X;  2RNG A;  2K9Q A;  3X2Q H;  4C3H J;  1K79 A;  1IJW C;  2PQ8 A;  3ESW B;  2CSO A;  4XKW A;  4G7H F;  1LEB A;  2D1V A;  4HV6 A;  4Y17 A;  2KFD A;  1GLN A;  4C9Y A;  4IHX A;  5FKO A;  2YUS A;  1FYL A;  3RSN A;  2O6G E;  2L7M P;  3HTS B;  4JK1 X;  2QGU A;  4D5F A;  4FE7 A;  2DA3 A;  2COM A;  2PJP A;  4M9Z A;  3ZMS A;  3KYC B;  1B9N A;  2KJC A;  3PO2 J;  1OYI A;  2IAI A;  3AG4 H;  3JRH A;  3E6C C;  2IPQ X;  2Z33 A;  4QIW N;  3FDY A;  2D5V A;  1X3W B;  2EZH A;  3CME I;  1FSE A;  1ZK8 A;  3WTZ A;  4WXH A;  1SMY F;  4Y4R A;  4YIF A;  4KDP A;  1OKR A;  3D5R C;  4PGH A;  1G4D A;  5JR3 A;  5M5Y J;  2LKS A;  1W36 D;  4NC7 A;  4K2E A;  1QGP A;  1ZGA A;  2HQ5 A;  3QQA A;  4ASN A;  1S72 I;  3H9Q A;  3K1M A;  4B3A A;  1BM9 A;  4WK8 F;  2FOK A;  3BZ6 A;  4JP0 A;  5LFA A;  3GLX A;  1I1G A;  1V54 H;  2L2O A;  4D7M A;  5JVT A;  4CZZ A;  2ZXW H;  2H6C A;  4KN7 X;  5FFZ A;  4RLQ A;  2O0Y A;  3V8K A;  1NH3 A;  5CLS A;  2Z5U A;  1TW3 A;  2M9H A;  4Y7N J;  3QPT A;  4NHJ A;  3F6O A;  3RJP A;  4LG0 B;  3WGH A;  1T2K A;  3EQL F;  3IV5 A;  2NVX J;  5DD8 A;  5HDK A;  3OYA A;  2R7Q A;  4D0P A;  5HOO A;  4ENJ A;  3FXK A;  3BG6 A;  2DJN A;  3N4M A;  3WHC A;  1TNS A;  1YIO A;  4I01 A;  4QSH A;  3RPU D;  2X85 A;  3BCA A;  4OIN F;  3HL2 A;  3CF5 F;  3IKV A;  2WAD A;  4U87 A;  1JKQ C;  3ZN1 A;  1HKT A;  2X1C A;  5LEK A;  2CJJ A;  4JX4 A;  4EJU A;  4XID A;  2IEK A;  4EV0 A;  3KYL A;  3B6A A;  5LEJ A;  2VOD A;  1A6I A;  3L2V A;  3J7A O;  4IHW A;  3QP5 A;  4YEL A;  1ITY A;  2LH9 A;  2MGQ A;  1MNM C;  1FOK A;  4ETS A;  1PP8 F;  1SVM A;  2O8K A;  1YJW I;  2LY1 A;  2BY1 A;  2L4A A;  3GTO J;  3SXY A;  5FKL A;  1POG A;  5JLX A;  5H2F C;  4MNU A;  1R23 A;  3BC8 A;  1D0Z A;  2OBP A;  3HGY A;  1Y0N A;  2R5Y A;  1MD0 A;  3SZP A;  1K78 B;  2ZC2 A;  3FIS A;  5GAH J;  2ISY A;  4IJA A;  1ZTR A;  4BEH A;  4I2O A;  2FEZ A;  3ABL H;  2QM3 A;  1P6R A;  4RB3 C;  3H9J A;  2DT5 A;  3FIW A;  3CCM I;  1V55 H;  3CLO A;  1WSU A;  3I56 I;  6PAX A;  2NOG A;  4Q47 A;  2Y0M A;  3OWT A;  1HKQ A;  1QO0 D;  3PQJ A;  3S2W A;  4X1E A;  1YX5 A;  4XLN F;  1PUE E;  2L7K A;  4UUV A;  3K0L A;  4KIS A;  2R7X A;  4X0G A;  2M7B A;  4MHG A;  5L3G A;  1FOY A;  1GVJ A;  4A3K J;  3H0G J;  4B1R A;  1FOW A;  4ZZL A;  4G94 A;  2FF4 A;  4YEJ A;  2H1L A;  1O7F A;  4AIK A;  2B63 J;  2RN7 A;  1T98 A;  4H4K C;  3CUQ C;  2E2J J;  2DYS H;  2IS1 A;  2ELJ A;  2P5V A;  1RR7 A;  1X1P A;  4A3B J;  5J6X A;  3JTH A;  3A2K A;  1J75 A;  3OIP A;  3SQN A;  1R4N B;  3DLL F;  5GAD J;  3RKY A;  1X2M A;  2XPV A;  3WTU C;  3C7J A;  2L3D A;  1YS6 A;  1XSX A;  2PX9 A;  4N4O B;  2G0E A;  1SFE A;  3A01 B;  3TO6 A;  3IHU A;  2EWN A;  3K4C A;  1U2W A;  1LDK B;  3AG1 H;  3Q0U A;  2HTS A;  4MGR A;  2DT6 A;  4YFK F;  4NC6 A;  3CD6 I;  1OIS A;  2IXS A;  2MYS A;  1MGT A;  4OWR B;  1RES A;  4S05 A;  4AVP A;  1JTX A;  2CQN A;  5LD2 C;  2DT7 B;  4F7Z A;  4OMZ A;  2M0M A;  2JQ7 A;  4A0Z A;  5K7Z A;  3WG7 H;  1D5V A;  3L2W A;  1JXS A;  3GWZ A;  1JJ8 C;  3DBL B;  3ZXS A;  1XMA A;  2MSY A;  3LQR A;  4DGW B;  3OMY A;  3BR1 A;  1EJ9 A;  1SFX A;  3JW4 A;  5FD6 A;  2GBY A;  3LFK A;  1MSF C;  3E5Q A;  4KJZ A;  3JRG A;  1XTA A;  3MZH A;  2FNA A;  1FPQ A;  1G3T A;  3S17 J;  1NHA A;  2LVS A;  3I59 A;  3DTE A;  1IXR C;  2XRO A;  2E2I J;  1Z0X A;  3Q3S A;  1FMV A;  2AXL A;  2RGV A;  3CC7 I;  2CWE A;  4BH9 A;  1X1C A;  4L9T A;  2DA6 A;  4CIC A;  1KU2 A;  3JAM Z;  4HQM A;  1DGR M;  3ZMV A;  2OV7 A;  2E71 A;  2Q2E A;  1GDT A;  1KU9 A;  4M73 A;  3R61 A;  2PG4 A;  3I5U A;  3PFI A;  3JCU C;  2ZKZ A;  2R93 J;  3OYB A;  2Z2S B;  2A07 F;  2YPR A;  2M45 A;  1GXQ A;  3KFW X;  4XLF A;  1IUY A;  5KNL A;  2KHM A;  1LFU P;  2K85 A;  2BW3 B;  5FLM J;  5DS9 A;  1P7I A;  4B09 A;  2ZJQ F;  5GAG J;  1YG2 A;  1IF1 A;  4XMY A;  3RQ4 A;  2VOP A;  5F6F A;  1B72 B;  4XLP F;  2CFO A;  3ABT A;  2QWW A;  5K5Q A;  1ETX A;  3L2C A;  1Z9C A;  3I4P A;  1MMN A;  1ULY A;  1QPI A;  1DQU A;  1ON2 A;  1VFC A;  1R22 A;  2CV0 A;  3BT9 A;  1MBE A;  2ZSI B;  3FXQ A;  4YRV A;  3ZP5 A;  4E7H A;  2DDB A;  4NUB A;  1QHG A;  4PSW A;  4MLO A;  2W7N A;  4BAC A;  5AIQ A;  3FHZ A;  2VKD A;  2M4G A;  2FQ4 A;  1LFB A;  5CQE A;  1S7E A;  4L0Z B;  1HKS A;  1GVD A;  1RKW A;  4E7J A;  1OCP A;  4A3J J;  2KKO A;  1ETQ A;  4M9S A;  1FT9 A;  4KT6 A;  1FC3 A;  4KYW A;  4EGZ A;  3HOW J;  2HEO A;  2M34 A;  2RAE A;  4BBS J;  5F0C A;  3ECH A;  2JMW A;  2QEX I;  2V7F A;  3LMM A;  3P7N A;  5F64 A;  2VKV A;  5ICG A;  4XON A;  4BDZ A;  1WVR A;  5LRS A;  2H94 A;  1IN7 A;  2EIK H;  2F5V A;  2E60 A;  2DA7 A;  2HYG D;  2DK8 A;  1JKP C;  1T33 A;  1YJ9 I;  4MEY F;  3HHH A;  1X1D A;  1ACI A;  1GHC A;  1R5G A;  1R00 A;  5D4R A;  1MMD A;  3KZY A;  2GXB A;  1AWC A;  2B0L A;  3C2B A;  3F23 A;  5IY5 H;  2H6B A;  1RR8 C;  3GTQ J;  2KDZ A;  2IJL A;  2D45 A;  2HVS A;  4Y15 A;  1SD5 A;  1WJC A;  2CW7 A;  3FXJ A;  1IRG A;  2TDX A;  4A0Y A;  4XQF A;  3OSF A;  3M7G A;  2FMY A;  4CYD A;  4MQV A;  3CDL A;  1H9T A;  2HDD A;  1WRJ A;  1BOB A;  5EEH A;  2PMH A;  2ESN A;  3T8T A;  1BW5 A;  1Z91 A;  4F3Q A;  4A3D J;  1QZE A;  2R7O A;  3C2H A;  1H0M A;  5BMZ A;  3BR3 A;  4RB2 C;  3KCC A;  1YO5 C;  2DOD A;  2BXZ A;  2F4I A;  2E19 A;  1OJL A;  2OZU A;  4FTH A;  3KE2 A;  3GUD A;  4ENK A;  4XLH A;  1WCM J;  1JT0 A;  2LK2 A;  1IO2 A;  2EK5 A;  3KP3 A;  5ED4 A;  2KIM A;  4P9U A;  2DTR A;  1FYM A;  3JRD A;  5EF6 A;  1ZQ3 P;  2DI3 A;  1U5T C;  3ASN H;  2XGE A;  1TQP A;  2MD0 A;  4V19 K;  4NB5 A;  4YII A;  5FKN A;  3OS0 A;  1OCR H;  2DFF A;  2XAF A;  3AKZ A;  1V5G A;  2OTJ I;  3EUK L;  4DZP A;  4OIQ F;  3CJR B;  2WY7 Q;  3I55 I;  1B6A A;  5IT9 Z;  4XKB A;  4CCO A;  2DBB A;  3CDH A;  3DQV C;  3BQY A;  2NRA C;  2EIJ H;  4AM3 A;  4AYB A;  3F9K A;  3MEX A;  3RZD J;  2FBH A;  1A36 A;  4RAY A;  2GA1 A;  4I02 A;  2DOA A;  1FP2 A;  3CMY A;  4BE0 A;  1I27 A;  5KCM A;  5K5O A;  1NK2 P;  2HZT A;  1GV5 A;  2E5Z A;  4C30 A;  3CCE I;  4G12 A;  4M3G A;  2L02 A;  5DYM A;  2GA2 A;  4KIT B;  4YIR X;  1VF9 A;  4A93 J;  4Q48 A;  1QU3 A;  2HS5 A;  2HQR A;  3IP4 B;  1SD7 A;  1TBX A;  3G73 A;  1UFM A;  2L9R A;  2DW4 A;  4M6X A;  5FD5 A;  2R5Y B;  3R60 A;  1O4X A;  2QKM B;  1MBJ A;  4BEH B;  3LSI A;  3H5N A;  4BXU A;  1Z6R A;  2V9P A;  4Y33 A;  2ELH A;  3V7C A;  4HYE A;  4XLA A;  2LC2 A;  5JFR A;  1UAA A;  1U78 A;  5J3L A;  1N78 A;  2LMD A;  2K86 A;  1T0F A;  2XKO A;  1MZB A;  1Y1V J;  4P96 A;  2KRC A;  3ZQH A;  4HF0 A;  4RAZ A;  2UUZ A;  3JSP A;  5A2Q Z;  3S93 A;  1R36 A;  3KP6 A;  3I4M J;  4FCY A;  4UNO A;  3FBI B;  1LNW A;  3SZT A;  3W2A A;  2EH3 A;  3EPZ A;  4YFX F;  1FBU A;  3CES A;  4FHT A;  4IRH A;  4GYG A;  1DP3 A;  3R4K A;  3ABK H;  2A6H F;  3CJQ B;  2JRM A;  2L0K A;  1MMS A;  3HKZ N;  1XGS A;  2EA2 A;  2GIV A;  4HW0 A;  1VQ6 I;  3LL7 A;  1XCB A;  1PDN C;  3HJE A;  3QYE A;  2M87 A;  1UHW A;  3ZCO A;  1BJA A;  1HDD C;  1HXD A;  5CVJ A;  2RVC A;  5D6E A;  4BE1 A;  1UCR A;  1WJB A;  4J00 A;  4E7Z A;  1P9Q C;  1Z3Y A;  2QQA A;  2W25 A;  2KPM A;  4B3X A;  1DDN A;  4BL0 B; 
#chains in the Genus database with same CATH homology
 1OCO H;  3ASO H;  2Y69 H;  3ASN H;  5B3S H;  2EIK H;  3AG2 H;  3ABK H;  2DYR H;  2EIM H;  1V54 H;  2OCC H;  3X2Q H;  1OCR H;  2ZXW H;  1OCZ H;  3ABM H;  3AG4 H;  3WG7 H;  3ABL H;  2EIL H;  2EIN H;  3AG3 H;  3AG1 H;  5IY5 H;  5B1B H;  1V55 H;  2EIJ H;  5B1A H;  2DYS H;  1OCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...