2EIJH

Bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eijH00
5IY5H 2EILH 3X2QH 1OCRH 3AG2H 3ASOH 2DYSH 3AG4H 2OCCH 2Y69H 2EIMH 1V54H 3AG1H 3WG7H 2DYRH 1OCCH 2EIJH 3AG3H 5B1BH 2ZXWH 5B3SH 3ABLH 1OCOH 2EINH 2EIKH 3ABKH 1V55H 5B1AH 3ASNH 1OCZH 3ABMH
chains in the Genus database with same CATH superfamily
1IUYA 1X1PA 3RKYA 4P9FA 1IN4A 2FBKA 3QU3A 5EGOB 2JA6J 1FYMA 2K85A 4A5MA 3BPVA 2XROA 3WTZA 4ETSA 3OL3A 2Y0SN 2H1KA 1OCPA 3OIOA 4RGUA 2XB0X 2QM3A 2BOLA 2VKEA 1Z0XA 3RYRA 4ZYDA 1VFCA 2XF7A 4ZJZA 2ZXJA 2X6XA 5IP6A 2HR3A 4IO9F 1R4NB 2Z9OA 2HOEA 5CQGA 4IX7A 1M1EB 1E0EA 1H0MA 4YFKF 3CCRI 3WE3A 2IS2A 2K3FA 1IG7A 4ZDLA 1G3TA 1ZHFA 2KISA 3ULQB 4A2UA 2E34A 5H2FC 3UR3C 3KETA 4A3CJ 3IP4B 3HOTA 4W97A 1W36C 2KP6A 3TEDA 2BY0A 5BS6A 1QQIA 4I7HA 1VQ5I 5FLXK 1LDKB 1UELB 2XSJC 1IZ1A 2ZXWH 2R7QA 1IRGA 2LY2A 2NXNB 2VXDA 4NQWA 3JR9A 3QU6A 1D5VA 1ON2A 4PGGA 5FROA 2X85A 3JSOA 3QYEA 2DLLA 2HS5A 2K86A 2UXXA 1UFMA 3RDIA 2ZJRF 2L7MP 2F5FA 3F8NA 4YFNF 3VFZA 1TT0A 1WKMA 1TWFJ 3CDLA 2DPUA 4EJWA 4PSWA 1QVTA 5J1YA 1T6SA 5M5YJ 1LVAA 1WI9A 4RM3A 2GA2A 4M3BA 1MNEA 2A6HF 3E5UA 2R7TA 1T0FC 5K1YA 3MAJA 3BROA 1OR7C 3I59B 3K2ZA 1LQ1A 5DDGA 4KFCA 1AOYA 3ECHA 3E0JB 2NS8A 1EH8A 3J80Z 3LFKA 3FXKA 1WFXA 1TQMA 5EJCA 2VQGA 2EFNA 4BGDA 4XORA 3TDUC 1N25A 3CCVI 3FBNB 1MBKA 4JX6A 3TP0A 1ZH5A 1DGRM 1VZ0A 1FWZA 3DBHB 3MFKA 3WTYC 2PLYA 3JW4A 3RPUD 5LFAA 4ZH4F 2XPVA 3RIRA 2EZLA 4K2EA 3O2PE 1MNMC 1BIBA 3ZQGA 5ICEA 5FKMA 4AYBN 1AKHA 5IYCJ 1K6YA 5J4VA 3CMMA 1IAWA 4ZZDA 2V1UA 3BTJA 2R7ZJ 2K9LA 4LIVA 1Z6RA 3BR5A 1FYKA 1V3FA 3BR2A 4WK8F 3HOVJ 1YE9A 1TBXA 1VNDA 3U9GA 1WI3A 4F7ZA 3RZDJ 4CCNA 4XOTA 4UXNA 4BE1A 3KIOA 1P92A 4M71A 1RKTA 2LY9A 3DTKA 4UUSA 3RQ4A 4CYCB 4J01A 4LLNA 1MDMA 5JVGF 3ZMUA 1I50J 4XBFA 4CDGA 5HNHA 1YTYA 2QEXI 3GFIA 1TW2A 5FKLA 3GCMA 5ICFA 3KP4A 3JRIA 3KP2A 1T56A 5CVIA 3S1MJ 4EGZA 2ELHA 2FBIA 1ZR4A 2E2IJ 1L3LA 3T8RA 1SEUA 2ZBKA 2DYSH 2COBA 1I6XA 4KYWA 2H27A 2G0EA 2VBXA 2X1CA 2LTPA 3DBRB 3W2AA 2DTRA 3HPGA 4XLEA 3QODA 2EH3A 3K4LA 1Q1HA 4A5NA 1PP8F 2CUZA 2R7FA 4IVNA 1ETOA 3W6JB 4AVPA 3PIPF 4RBOA 4A3FJ 2R7VA 3KP6A 4L5EA 3OS1A 3OYAA 5CVJA 1YW7A 2HPIA 4A0YA 1PUEE 4C2UA 2PEXA 4KA4A 4HX8A 2WC2A 2BY1A 3HRTA 4Y15A 3ZQIA 2KRFA 1XMAA 1P7IA 4M6XA 3A1YA 2ESHA 2L2OA 4IOAF 1S72I 2QQAA 2V9KA 3RKQA 2DA3A 2OUMA 2VC1A 2XV4S 4HSRA 1JUMA 1U9NA 1Z9CA 4A0XA 1TNSA 4U7DA 2L9NA 3HKZN 2DFIA 1JKPC 3CUOA 2Y9YA 3V42A 1FSHA 1ITYA 2A6TA 4I0AA 3ZMSA 1FIPA 2FJ1A 3E7LA 2ZMEB 5FFZA 2O03A 3SZTA 3Q9SA 3F22A 4AM3A 3I55I 1IDZA 3ROUA 1ULYA 1STZA 3OV8A 3WG7H 1GDTA 3A4CA 2R7SA 3BQZA 2AS5F 3F8MA 3FXQA 2DFFA 2ZXIA 3ZQFA 2CSOA 1JGSA 4B48A 1C0WA 2YPRA 3CC7I 2UZKA 3WG9A 1E2XA 1F43A 4L9NA 3OR2C 4HNTA 1BR2A 3I59A 4I2OA 2BY3A 4XLCA 2K9SA 4HDVA 1P7JA 2HQ5A 3QAHA 5EEGA 2EFWA 2IGKA 5F0CA 3ML6A 3MN2A 1HXDA 1MMNA 3Q5FA 3F8BA 2PMUA 3I71A 3COAC 3HIFA 4BKXA 3D5RC 2QLZA 2A05A 1SAUA 1FBSA 1V5EA 3CUQC 3RYPA 2M87A 1R71A 2HDWA 4XKCA 1J75A 3S14J 3CP2A 1A04A 1I3QJ 2L7FP 4EM1A 1T95A 3ABTA 3GVAA 4ABZA 2PJPA 3DKXA 2QSHX 1WH7A 2VQCA 2FU4A 2X0LA 4O6JA 5J47A 4I99C 2MW8A 3SYTA 3TW6A 2LK2A 4G7OF 4JP0A 2LLKA 4CYCA 4HDUA 4ESJA 4ENJA 1O3QA 1JXSA 3BG3A 3EUHA 1DPUA 3BP8A 2LH9A 2ACJA 4GYGA 3O8GA 1QVUA 2NAZA 4Q4ZF 2WAQA 2XB5A 3B6AA 1G6NA 1MIJA 5D4SA 4PUSA 1R00A 4ENKA 5L3BA 3FXMA 5E79C 1H9GA 3SEQA 1QBJA 3S17J 4EVIA 5EEAA 3ZMZA 2V6EA 1BA5A 3OYBA 2FE3A 3BZCA 2HEOA 3R4KA 2W1OA 1ZG5A 3JAMK 1ETQA 1IDYA 2Z33A 4D0PA 1P9QC 1G3YA 1BOAA 1FJLA 2HTJA 2VC0A 2H1LA 2IS6A 3ZQQA 2DBBA 2ZJQF 1SFEA 3HYIA 4HV6A 1YX3A 3HOUJ 2CV0A 3H3VK 2HGCA 4PJNA 1W36D 2L4MA 1ONVA 2L3DA 3CJTB 5FFXA 1Z77A 3K7AJ 5F6FA 1N77A 5F1RA 1YFHA 3WHCA 4IRGA 1IJWC 1VQ8I 2LF8A 3EDPA 5DM6F 1Z91A 2HU9A 3FXRA 2R92J 3KE2A 3G2BA 4BY7J 4A3JJ 3OL4A 2DPDA 3KEOA 5JHUA 4UVAA 5C44J 3I54A 3G73A 3TQNA 4CXFA 2WADA 2ZMEA 4MFEA 3NWTA 2W82A 4MTEA 4Y33A 4WX9A 4R1HA 2HXIA 1X58A 1I39A 5D5VB 2EA4A 4TV7A 1AU7A 2MFZA 2P6SA 1HSTA 4L18B 2FBHA 4F55A 3ZN1A 1W5TA 1JJ8C 4ZZLA 3KPHA 2F5EA 2DOAA 4X0GA 3ZCOA 1J9IA 3BZKA 5HLGA 1X4OA 2I8DA 1EH7A 3HJEA 2IA0A 1LFBA 1ETXA 1G8XA 1YRNB 3OMYA 1SFXA 1O7LA 3I4PA 3K4JA 2R7WA 3CUQB 2VJ4A 4R79A 4HG2A 2H94A 5DTDA 2LC2A 2KDZA 4XL9A 1UG2A 3KEQA 4B47A 4E70A 2EQRA 9ANTA 2FOWA 2RREA 3AAFA 4E7SA 5K5RA 3N4MA 2BW3B 3GYHX 4OAZA 1MW7A 5HNFA 5FLXZ 4U0YA 5ILUA 3F21A 5J40A 1UZCA 3EPZA 1SD4A 1K7AA 3GLLA 1IUFA 2JSCA 3OIQA 4IEJA 3ZXSA 2BVLA 4DNCA 4F93B 1BW5A 4L9TA 1ZG3A 4AIDA 1IRXA 2ZNZA 4HAMA 3CMEI 4OIRF 4A3DJ 4LOCA 1ENHA 4CICA 3HTSB 4CGZA 2CO5A 5ERIA 1XS9A 1U3EM 4PZJA 2Q8KA 1ZLKA 2FQ3A 4ZYEA 3DPUA 3GFMA 3H9GA 3ISPA 3ZGKA 2LMDA 2YU9J 5HVQC 2Y30A 4EJOA 2VPRA 2XAUA 2ZSHB 2IS1A 3RKWA 2EBIA 3GTLJ 4WCGA 5FD6A 4U7BA 1IF1A 1KU3A 2YX4A 4M3DA 4XRMA 4A0ZA 5GPCA 2C6YA 2LVSA 3JREA 1E3PA 3HRMA 1Z1DA 3LFUA 1B8IA 1I6HJ 5LRRA 2HOSA 2Y75A 4LITA 2VQLA 3PNTA 4B8XA 4IXAA 3ESWB 2M1BA 4DYCA 4BQAA 1X1CA 3K6GA 3LSJA 3KCCA 5FKKA 1TWAJ 3MKYB 4QWQA 2VOPA 4BYYA 5HLIA 5DCMB 5EZHA 3MZYA 1POGA 3QPSA 5HDKA 4BEHB 2QWWA 5J3LA 1KONA 4YELA 4HPQA 1A31A 2RNGA 2AQEA 4PJJA 5CJ9A 5LEKA 3TO9A 2PFBA 5JHFA 1JUSA 1BI3A 1R23A 5HS8A 1TTYA 2EPFA 3DV8A 2AO9A 2JK3A 3IHUA 1T98A 5BPIA 4MHGA 4XNFA 4WWCA 3W6VA 3OR1C 2A5YB 2STTA 1BL0A 1A6QA 1JTXA 3WE2A 1OKRA 2EIJH 3LSMA 3OYEA 4EM0B 4G12A 1U2WA 2BV6A 4FX0A 2NOJB 5LGTA 2EINH 4BHBA 2O7OA 2VIXA 4KN7X 3IWZA 1Z7UA 4YIIA 2HOAA 5J1RA 1T33A 3KP3A 2V1DA 4Y13A 1HDPA 4P55A 1JJ6C 3WTTC 2W57A 3WGHA 2KRHA 1KA8A 4XSZF 1OCRH 1NH3A 2IPQX 1SMTA 1H9TA 1ZGWA 3TOAA 4W1UA 1ZAOA 1IRFA 3NARA 2PQ8A 3GXOA 1G59A 3P5JA 2LKSA 4AIKA 3AFHA 3CDHA 2JA8J 3CCYA 3GFLA 3H1CA 1JI8A 2ZSIB 3ABLH 2CUFA 1R6RA 3K0LA 1O3TA 1K79A 2JA7J 4CZZA 4MNUA 2XAFA 4NC7A 2HI3A 1BW6A 3BLYA 1MJ9A 3C2BA 3VEPA 1ZLJA 4A3GJ 4IQ4A 2PJRA 3X2QH 1VQOI 2JA2A 4ZC3A 3TGNA 3A01A 2BGCA 2Y69H 1VTNC 1FBUA 4M74A 1VQPI 1QNTA 4O5VA 3GEZA 4MO7A 1F36A 4KUMA 3Q0UA 3OYFA 3ERMA 5KHDA 1YLFA 1IV8A 1FC3A 3BDDA 5E3OA 2CQ7A 2R7OA 1UG0A 4JBAA 1V55H 5DD8A 2IGNA 4RLFA 3M07A 2P0WA 1D0XA 2VI6A 4J19A 3BR1A 2Q2EB 3JSPA 1U5TB 4P9UA 3Q0WA 5D8KB 2XF5A 2HKOA 1SFKA 1WZ2A 4BL0B 2ZXHA 4NDLA 4RMNA 1JT6A 2O6GE 1N78A 3GBGA 4U0VA 3DP7A 3J81K 2A5WA 3NQOA 1RI7A 1W7PB 2OZUA 2VE8A 4UHTA 1D8JA 4XN0A 3MD2A 2Q0OA 3I9V2 2TDXA 1FZPB 4XRFA 3WTUC 2KPMA 5BMZA 3PL8A 4IRHA 3CO7C 2RQQA 1X2NA 2VBZA 2GBYA 2L01A 4D9JA 1AKHB 3GF2A 2R5YB 1UMQA 3RSNA 3N97A 2W48A 3LA2A 1BM9A 2I10A 3PUFA 3WTSC 2JMWA 1TC3C 1LFPA 4NNJA 3E6CC 3HUGA 2Z1DA 2OC6A 2E7WA 4ON0A 1KU7A 2EJRA 1OLTA 1OJLA 2VT3A 4BUPA 3IAM2 3P9CA 4N4OB 3BQYA 3LAPA 4UUSB 2MABA 3LSRA 4M6VA 4Y17A 2OQGA 3FDYA 1PDNC 4YIFA 1MDMB 2L7ZA 1H89C 3F6VA 2GLOA 3SDGA 2MD5A 3GUDA 1XSXA 3I4MJ 5D8LB 4UUTA 4XKWA 4E4HA 3JTHA 5JLWA 2VL8A 4BEHA 3WU1B 2W25A 5HS7A 1G3SA 3MKLA 2A69F 3M3YJ 1R4MB 2NRAC 1EF4A 2DMUA 3HOWJ 4RGRA 1YX5A 2HYFA 1BBYA 1HW2A 3I5UA 2CQQA 3EUHC 2HWVA 4PFPA 4QSHA 4IRIA 5F0FA 1TNTA 5H6RA 2H6BA 4HQEA 1XMKA 3FM5A 1DU6A 3ZQCA 1J5YA 4FTHA 3KP5A 2M8GX 2XRLA 4BS9A 1JE8A 2E7XA 3GTOJ 3LWFA 1AA7A 2GIZA 5M3FJ 1X1DA 1U0JA 2PG4A 3G3ZA 4XQFA 2VASA 2DA2A 4A3MJ 2PMHA 5DUIA 2P81A 1KQ0A 5ICCA 2JQ7A 5H6QA 3QPHA 3V8KA 2ELJA 5ILVA 2L5QA 4B3XA 2K3PA 5E18F 1YW9A 4E7HA 5EZGA 5E1XA 3T1BA 2COMA 1NK2P 5FGMA 4IPAA 2YU3A 3FMSA 4IKFA 3R61A 4EV0A 1XGMA 4JX4A 2M7AA 1LE8B 1P2FA 4M73A 5GADJ 3C18A 4G7ZF 2DA7A 3CTAA 3K69A 3IV5A 3FXJA 3BG9A 3IRQA 3PSIA 3JAMZ 2PMZA 4MGRA 1H88C 3H92A 4DBRA 2IS4A 3F3XA 2FX0A 2X4HA 2GAUA 3OSGA 1BI0A 1IO2A 4Y4RA 3TO6A 3MKZA 1GV2A 3OYNA 2XGCA 3RPQA 4BHPA 1B59A 1ERDA 2O8KA 3L2UA 3DEEA 1WJCA 2ZMEC 2CQKA 3H9JA 3WTWC 3VODA 4S05A 2WA0A 1TQIA 5IYDJ 3PJRA 2O3FA 2OCEA 2Q2EA 1U5TA 3WTVC 1OQYA 3LQQA 4Q47A 1IW7F 1OMIA 4C3JJ 1NHAA 3Q3SA 2CW7A 3LSGA 2O61A 3BR0A 2G7UA 5E1ZB 4II2A 1VQ9I 5FO5A 3V7CA 3HSEA 3U21A 4KIGA 5GAHJ 2R7RA 3RI4A 2VE9A 2QZ8A 4XONA 2V79A 2IGMA 4D7NA 4EJTA 3RZOJ 1W7PA 4LMYA 2DMTA 2DTZA 4EEFG 4YFXF 5KAFC 2V9PA 2NVXJ 3OS2A 1QA6A 3OYIA 4F3QA 3RPUA 1Y39A 1FBQA 1J09A 3HRUA 5D6EA 3TL4X 5KK1A 3LSKA 4IJAA 1X4PA 2DA4A 2R5YA 2F4MB 3TMOA 3F9KA 4BHCA 3UKGA 4BQNA 5K7ZA 4WF2A 4JX5A 1A5JA 1TT5B 3H0DA 4E7LA 2A07F 1TW3A 1R1UA 1O3RA 1J59A 1HKQA 2H8RA 1V54H 1LEBA 4ZDOA 1HSJA 4HV5A 1CF7A 4M9ZA 1ZRDA 2XAGA 5GP9A 1XB4A 4L9JA 4BACA 1F1ZA 3IH4A 1X3UA 4XKBA 1MGTA 1ZK8A 2HQNA 3HC7A 5DUKA 2WB1N 2OQRA 5H20A 2DT5A 3M1CA 3NEUA 2BVMA 1SFOJ 1QHGA 1JGGA 2KHMA 1OYIA 2H09A 3IKVA 2FQ4A 2FD5A 1DQUA 2DO7A 2JSPA 4DIQA 3HGYA 4P5OA 4KICA 4IHXA 5EEHA 2VOOA 3CJQB 1D0ZA 4Y3OA 1MBHA 2VKDA 3H35A 3WTXC 3DWLE 1JHFA 1RUNA 2KIQA 4GGGA 2MC3A 3FXUA 1OCTC 1RESA 3WODF 4I6ZA 4B4CA 1IN8A 2L02A 3KZIC 3FBIB 4HZFA 1W0UA 1DP3A 2CV1A 3DPTA 3CESA 3BJ6A 2K02A 4A3LJ 2DYRH 2ECCA 4HOBA 3K4KA 2F4OB 1E3OC 2IT0A 2V9VA 1R7JA 3KZZA 4M9SA 1LE8A 2DW4A 1D0YA 2GXAA 2AQFA 4C3IJ 3KP7A 4OWRB 2KIFA 2ZC2A 4FX4A 2XUBA 1WWXA 2CW0F 2VJJA 1MBEA 3PFYA 5CKTA 3HM5A 3OYDA 3ABMH 4E7IA 4LG0A 1X19A 4BH9A 3OYCA 3K9TA 1ON1A 3J7YJ 3TKYA 1UCRA 3V8LA 3KLNA 1VQLI 4QTRA 2D1HA 2K9QA 3IWFA 3S3NA 1LFUP 2OTJI 1S7EA 1ZREA 3SDBA 3OYJA 3TW7A 2ZB9A 1TLHB 4RDUA 1U9OA 2MSYA 2VXZA 3DEUA 5CYVA 1XX5A 2ZO4A 5IP7J 5E1WA 1YS7A 2MH9A 1GXQA 1Z67A 4GYIA 1IV6A 2CV2A 1S7AA 1MJAA 2XIGA 4ZTJA 2J5OA 4MQ9F 2IA2A 2FMYA 1O3SA 2YSRA 1T08B 4BDZA 5FB2A 5IT3A 4D1QA 1J0RA 3K4CA 1AWCA 1WGXA 2ZJPF 2JTVA 3NRVA 4ASNA 2ZJ2A 3JCUC 3K70C 3LNQA 2G7HA 4HYEA 3LQRA 3TDZC 4A3EJ 1FT9A 5EG0B 4XM3A 1R1TA 3IUOA 4PGHA 4CCKA 1U8BA 5A2QK 2K5CA 1MMDA 3D0SA 4G8XA 2VBWA 1R58A 3VPRA 1K83J 2JRTA 3J7AO 3HOXJ 4MEXF 2L0KA 4EJVA 3AG1H 1B1BA 3NWSA 4CZCA 2X9DA 2BEOA 2XGXA 2EZHA 3BTCA 1Z21A 1R5GA 4H4KC 3L7WA 2VJIA 3AL0C 4HRIA 2QKLB 1X3WB 3U1KA 4BXUA 2FNPA 3E6MA 4NC6A 4GFBA 2VONA 4DYRA 3VYRB 4IHVA 2KQRA 2M7BA 3FISA 2ME0A 3BZ6A 2M34A 1B8IB 4L9VA 4QIWN 3GTMJ 2L9VA 1QU3A 5LGNA 3FXOA 1SD6A 2JPBA 3KX2A 3S3MA 2DT7B 1FTTA 2FUG2 4RAZA 5BPDA 3J81Z 4LK0F 4KIFA 1KGSA 1WCMJ 2OU2A 4CCOA 2BYVE 2VT2A 1RC9A 4RM2A 1Q1VA 3SEZA 2DI3A 1ZGJA 3QOEA 1ETVA 5FLMJ 4IL6C 2DJIA 4FT8A 3H5AA 3J7AY 2YR2A 4HEA2 2WAEA 3MZ8A 4A69C 4RB3C 3ASOH 1GVJA 2W00A 2XAJA 2Y0SA 1V5FA 3KYDB 1S3JA 3RKXA 4YIRX 6PAXA 3G1MA 1T39A 3LMMA 1MBJA 3PNYA 2VODA 1B4AA 2M30A 3B6CA 1R9TJ 1Z7LA 2HVRA 1R36A 2JA5J 3LAJA 1XGSA 2DN0A 3WGIA 2E60A 4EM2A 1IN6A 3MZHA 3K4NA 2IBDA 3IH2A 5L3FA 2DCEA 4I09A 1Y0UA 2M3AA 4DQ2A 5C3EJ 1UB9A 5IY5H 2RQPA 4RB2C 3S2WA 4HNUA 1R1VA 3G6EI 3H3ZA 2A61A 3ZQ7A 2M2EA 4UVBA 5EDNA 4JYKA 2L4AA 3HOYJ 2KFDA 1HQCA 3GTJJ 2UUZA 1VQNI 1PP7U 2M4GA 2DT6A 1JT0A 1FX7A 2CYYA 2QENA 3BTLA 4P1WA 2XPUA 4MLOA 3J7ZI 2KL4A 2P5KA 4OAYA 5F27A 5K5QA 3HBLA 4U88A 3ONQA 1FP1D 2Y2ZA 3M4OJ 4C2TA 2Y0MA 4RAFA 2F48A 2PJRB 1PYVA 2R4GA 3CP8A 2XASA 3CJRB 1PUFB 3A01B 5CPRB 4UB6C 4D5CA 1MD0A 3H9QA 2E1NA 2MH2A 4M3EA 1SMYF 1WJ5A 2P5VA 3DPLC 2ETHA 2QQ9A 5LHGA 3CMAI 3ZRGA 3KFWX 3GZ5A 3QYBA 4WXCA 2M9HA 3ZMTA 1DU0A 1B72A 3EYYA 2RKHA 3RQIA 2LYCA 5D4RA 5EG0A 2IXSA 4XICA 1Y6IA 1TL8A 3V4GA 4OMYA 2OF7A 1MKMA 2JWTA 3SZPA 3GX4X 1HCRA 4HX7A 3FK7A 5FLVA 3AL0B 5K7FA 3T5XA 3HG9A 1S29A 2Z5UA 4WXHA 4A6EA 1B9NA 4QPOA 1QZZA 3W2VA 3BOQA 3C2HA 3LSPA 3BC8A 1GVDA 2UV1A 5F0HA 1U5TC 1Z3XA 5DS9A 2BBYA 3EYIA 1GUUA 3ZP5A 4I01A 2IP2A 5HDNA 2EV5A 2CU7A 4A6DA 4AU7A 3VWBA 3SFZA 4AYBA 2EZIA 4G7HF 2EZKA 2N8GA 5FJ8J 3F23A 1SVLA 2ZFUA 1YOVB 1R49A 3MKWB 2OPTA 3O3KA 4M3GA 5D5UB 4RAGA 1JKQC 2HQAA 1BR1A 1BN5A 2O5RA 3IL2A 2P7CB 1OISA 1EH6A 1FIAA 1KU9A 3OSFA 3A0HC 3CCLI 4AD9A 2XHKA 2UXNA 3REOA 3DXJF 3HUGB 1USSA 3EQLF 3PSFA 2OA4A 4XN3A 4EQQA 3ZOBA 2XRNA 2NVQJ 2LDUA 2NYXA 3C7JA 2VN2A 1X1AA 4CSWA 1KZHA 4EGYA 4M9XA 1Y1VJ 2FNAA 1PJRA 1UAAA 5HODA 2OV7A 2FOKA 5E17F 1LUJB 3MEXA 1QPMA 3C3WA 2KJCA 1ZARA 1HC8A 3PIOF 4MQVA 3EETA 2WTEA 3K2AA 3TP3A 2W24A 4KMUX 4KMFA 2BHZA 4CCMA 3ZMVA 1WRJA 3HL2A 4XLPF 3BG7A 4GO1A 4MEYF 1QZYA 4C9YA 2R93J 4GXOA 2DU9A 4ITVA 2Y48A 3ABUA 3WU0A 2RC4A 4IHYA 2FEZA 5IT9K 2VJ5A 2O9LA 2P7VB 2W7NA 2GWRA 3HHHA 2ELKA 1T8IA 2ID6A 3O6BB 2V4JC 5KCMA 2BY2A 4HLXA 1SD7A 3A0BC 4DW6A 3K1NA 1ACIA 2TRTA 3FHNA 2LBFA 1YI2I 2AXTC 2DK5A 2CQNA 4II3A 3GTPJ 3L1PA 3PQKA 1HW5A 3P7NA 2MLKA 3OIPA 3WGGA 3FK6A 2FSWA 1T2KA 4A12A 5D6FA 1USTA 3ZN0A 3G4SI 1LB2A 1FOXA 2NVUB 1ZRCA 2HVQA 1FMWA 2ISYA 3D1NI 2DODA 1MSEC 4ZDPA 1FNNA 4ZYAA 2MGQA 2D45A 1FOKA 1NTCA 2D5VA 3HKZA 2QA4I 1VQ4I 1U78A 2E2HJ 2OBPA 3M7GA 3ERED 1ETYA 2LSOA 4QPQA 5KVRA 2LFBA 3GWZA 4JQFA 4N9IA 3FMRA 1PUFA 2VKVA 4HBLA 4NC8A 2RGVA 3CC2I 2E1CA 1SFUA 4LJZF 4RAYA 1D8KA 5J6XA 1O57A 5E20A 2X1EA 2IVMA 2J5PA 4F92B 1FLIA 4YEJA 2R3SA 1XD7A 4UVCA 2I5UA 4XR6A 2LR8A 1Y8QB 2QSFX 3K70D 3ZPLA 4XSXF 3L2CA 3E97A 1I27A 1RZ4A 3OS0A 2R7DA 3GW2A 2PN6A 4L0ZB 2HZTA 2HKXA 4IF4A 5DEQA 2L54A 3MQ0A 3BJOA 5BNGA 2WY7Q 2AXLA 5HS9A 1YJNI 4B1RA 3BJAA 3CDIA 5J1UA 3ABKH 1NG6A 2X51A 1FPQA 4LGWA 4UV9A 3IRRA 3GO5A 2RN7A 3IKTA 4MTDA 4HSTA 4XLHA 4JOMA 2DXIA 4OIPF 1JKRC 1D1CA 3HXLA 1TP4A 1ETWA 4LB5A 5CVRA 3PFIA 2DQLA 2E71A 1VI0A 3DU6A 3VB2A 1U6GA 3K10A 3S1NJ 5J8FA 1HDDC 2TCTA 1WSUA 1CF7B 1A35A 3L2WA 1Y1WJ 2LOOA 3I4NJ 3LSTA 3ASNH 5LD2C 2WAQN 1J7KA 4WXDA 4H0EA 3E6BA 1ZYRF 1ZELA 3BG6A 2WBMA 2ZKZA 3JRFA 5A2QZ 3AG4H 2CFOA 1P4XA 1LKXA 1QO0D 1WVRA 2W4SA 4XKVA 3V8JA 5C4JJ 2ISZA 2GXGA 1NK3P 2Z16A 3E5QA 3QWLA 2M4KA 3CCUI 2HPMA 1XSDA 3JRHA 3K4MA 3OYHA 4X6AJ 2XAQA 1ZG1A 3BPXA 2X48A 1VQKI 2HZDA 3PO3J 3D5SC 1LPQA 4BJ5C 3JRCA 4CUGA 1JHHA 1HLVA 5EF6A 2XF6A 2O8XA 5TISC 5JVTA 2CJJA 3FKJA 2F4IA 1SVOA 3BT9A 4OOIA 4Q5SF 4BY1J 3QQAA 3RTRA 3S3OA 1X3ZB 1ZGAA 1XSVA 3LA7A 3ZQHA 3DLLF 5M5XJ 1I3AA 4G94A 5AIQA 3JRGA 1Z3YA 1DGWY 3MWMA 5B3SH 1K6OA 1MMSA 5J4YA 4RA2A 5M5WJ 3F72A 2LREA 3M8EA 1A36A 2GM4A 2HXOA 3LL7A 2MG4A 1S5LC 2EV0A 2MYSA 5DM7F 3QPTA 1K78A 2JZYA 4AIJA 3E6DA 2RVCA 2GQQA 2XPWA 3HTUA 1FSEA 5TRDA 5F1JA 1FP2A 4LG0B 4GCVA 4QLCU 1QHHD 3BR6A 1D5YA 3SQNA 3S2HJ 5GTIC 5M3MJ 3DEWA 1VQMI 4ZYGA 2V1NA 1HKTA 4Y7NJ 4KNYA 3WHBA 5CVVA 5DCFA 4C2MJ 3CCSI 1BC7C 3E1SA 3HSRA 5IP9J 4Z6YA 3SHFA 2M0MA 5LGUA 4LLGF 2FXAA 1FMVA 2DA5A 2IW5A 3F6OA 4XLFA 5B1AH 2EFQA 5B5EC 4BDYA 2ZFWA 3H0GJ 3M8FA 4CYDA 5GAEJ 2OTLI 3I0TA 4ESBA 4PFOA 3JRAA 1LNWA 3L09A 4BBRJ 3A02A 3FXLA 3CCEI 4L0YB 4B09A 2IA1A 3GFJA 2V1XA 5ICGA 3FF5A 3FMQA 4E7JA 2EB7A 3HZJA 3QPLA 2NOGA 2QVOA 3CLQA 3OOPA 2LY1A 2DDBA 4LD5A 4N9HA 3BG5A 3JTGA 2M45A 4RB0A 4S0HB 2E2JJ 3MMYB 1W7PD 2L7KA 1YHQI 5GAGJ 1DDNA 2PI0A 2XC7A 2CMPA 3GMEA 4BE0A 5D5XB 3KZYA 1P4WA 2WV1A 4PJMA 2VUMJ 2CUJA 2DFEA 1V5GA 4PCQA 4D7MA 4P96A 2E1MC 2FA5A 3Q9VA 4HF1A 2B63J 2CG4A 3FKIJ 1L0OC 1VF9A 1YYVA 3ECOA 3SXYA 3M8JA 2VLAA 4HF2A 2D2WA 2M0CA 1O7FA 4V2GA 2MD0A 2MLGA 3PQJA 4ESFA 1WJAA 3T0YA 3U2RA 1MMAA 4FETA 2ZCWA 5JLXA 1MNDA 1F9NA 5HDGA 1KU2A 5IOYA 3M9AA 3S1QJ 3CF2A 1RPWA 5CVUA 3GLXA 5ED4A 2BHYA 3G1OA 1OCOH 3CC4I 1SAXA 4Y52J 3CZ6A 1D3YA 1O4XA 2QKMB 3DLAA 1D1BA 4FISA 1OYWA 3L9FA 2FMLA 4AVZA 2CUEA 5E8IA 4PJLA 4X1EA 2EV6A 3Q0VA 3MCZA 5L3CA 1E3HA 3S15J 5EGOA 1HF0A 3I58A 4XK4A 3BR3A 4XIDA 1K4TA 4XRSA 3R0JA 2F5DA 2VKHA 2F6CA 4D5FA 4O3MA 3QRFF 4U87A 2JVHA 2PX9A 2H8WA 1GXPA 4DYQA 4HX4A 2YX7A 5E8GA 4OINF 3L2QA 2E1OA 3TOBA 2B7EA 5AONA 4LLLA 3OY9A 2E5ZA 5BOXA 2GXBA 4C3HJ 3DQVC 3HSFA 2L9RA 3FM3A 2V26A 2JPCA 5LEJA 1MSFC 1R5HA 2CRGA 1WQ2A 1MBFA 4F52A 1IXRC 1QZEA 4YRVA 4KISA 3SJMA 5E3NA 4FCYA 1XDUA 2YUSA 1IN5A 5JR3A 3IH3A 2JUGA 2Y31A 2KZGA 4KJZA 4DZJA 2WWYA 4ENMA 1XCBA 3CD6I 4EJUA 2HYJA 2DFHA 1DPRA 3BWGA 1W4MA 3DKWA 1RETA 3GZNB 4HF0A 1G4DA 5LBQA 1NG7A 3FIWA 2LP0A 4G6QA 2CFXA 2M5WA 5AIPA 3ZMDA 3GTQJ 2JN6A 3DU5A 3PO2J 5IT9Z 2RV8A 3VDXA 2B0LA 1AHDP 3A2KA 5CQEA 2O0YA 1MBGA 3AG2H 4BXFA 1H8AC 4KIBA 2QUFA 2K4BA 3TBIA 5IPAA 3V7SA 2R5ZB 2Z2SB 4OMZA 1QRYA 2DJNA 2QGUA 3HOSA 4V2FA 4G6TB 1S6LA 2XVCA 4ZTFA 3G1LA 4EATA 1IN7A 2P6TA 3FZVA 5J8CA 1I5ZA 1MJBA 4ANJA 5HOOA 5HLTA 2EFPA 5LHIA 1EKEA 3B02A 5LRSA 1B72B 5FRMA 2HQRA 3PNVA 3CF5F 3FHZA 1IRZA 4U0WA 3H36A 2KT0A 1SD5A 1OCZH 2V7FA 4ENNA 1HW1A 2EILH 1XPXA 2QQ8A 3ZQLA 1Z6TA 2P4WA 4S04A 3SZGA 2VQHA 3DTIA 1Y56A 2LNBA 2MC4A 2E1MB 3VYUB 1QGPA 4AC0A 4N4NB 3F8FA 4IQJA 1XN7A 2DK8A 2H6CA 4E7ZA 1XTAA 3HPHA 2HTSA 3W2WA 2X6WA 2LKPA 2ID3A 3CMYA 5IYBJ 2GIVA 3N05A 2GOXB 2DOEA 3SFIA 1FOWA 3JRBA 1JKOC 2Y9ZA 3S16J 1WHUA 1HA8A 4DZPA 1LEAA 1JTYA 3BCBA 2R7XA 3CLOA 4LIUA 5FKOA 4DBQA 1FOYA 2ECBA 4HA8A 5DV5A 5F08A 4C30A 2LD5A 2ZNYA 1TZLA 2E35A 2RNJA 4A3BJ 1S7OA 2X6OA 1P6RA 3BTIA 1APLC 2LRDA 1R5ID 3ELKA 3MVPA 2F5CA 1G3WA 3H5RA 1XGOA 4JK1X 4CA0A 3BY6A 4UY8I 2VPLA 3EUKL 1YITI 1ZQ3P 5KAIC 3R60A 1WJDA 1UHWA 1KQ9A 1R22A 2IAIA 2E36A 3UNGC 2IRFG 4KN4X 2B9SA 1REPC 4A93J 1FYLA 3S32A 3ZR8X 3OYKA 2Z3YA 1TWHJ 4CCLA 1UHSA 1CGPA 2WY8Q 3VSLA 4YG2F 1Z05A 2KMUA 4NB5A 2HFHA 4XRSG 4B3AA 5BQTA 1TQPA 2A6EF 2V6CA 2G9WA 2EIKH 4KT6A 3VSKA 5IOZA 2RAEA 4IHTA 1SC7A 1B6AA 3CCMI 1BJZA 1ZR2A 3KLOA 3OYLA 2DMNA 2HYGD 5GPAA 2ICWG 3LSIA 1IC8A 2K40A 4LG3A 4A3KJ 1DP7P 2DAOA 3AKZA 1F5TA 4IHSA 2LBFB 3FWEA 4FASD 1RR7A 5K5OA 4RS8A 4FHTA 4HNVA 4UV8A 2XDVA 3CO6C 2XGEA 3CJNA 3DKYA 2DA1A 2KZVA 1PVEA 2K27A 3OYGA 2K4JA 1I1GA 1ZRFA 5FRNA 2LG4A 2CQXA 3CQZJ 1E17A 1YS6A 2IEKA 4BU2A 2CH0A 1YW8A 4OIOF 2GZWA 3J80K 5TGTA 1W5CC 3LA3A 3H3UA 2PMZN 1XG1A 4E6KG 1BC8C 4A3IJ 1I1SA 1BR4A 4AWXB 4DOZA 1QPIA 3O8HA 1HOMA 1ZN2A 2NNNA 4RGXA 2R5ZA 1T0FA 1YQAA 3S2DJ 1OR7A 3I3LA 1W0TA 4AUXA 1J2XA 3I53A 1IGNA 2FF4A 2XGDA 2KDOA 4CO8A 1RR8C 4Q48A 4RGSA 3HB9A 3QYFA 2XKPA 2CW8A 1DUXC 2E5NA 3B73A 2DA6A 5LHHA 3HOZJ 4F91B 1XMXA 3KYLA 1BOBA 2P5LC 1Y0NA 3KYCB 3DTEA 1BJAA 1YJWI 5EYRA 3F0CA 3HRSA 2KKOA 2EIMH 2XKOA 5K7HA 4KDPA 1TWCJ 4ZYHA 1P4AA 1YO5C 3CCQI 1ODDA 4CHUA 3LOCA 3T8TA 1W1WE 2Z99A 3M1EA 1K4SA 2DDAA 1X1BA 1GT0C 2HDDA 4AIHA 2QBYB 4XOPA 1ORKA 3DCFA 1XDSA 2DOFA 5F64A 4Z2YA 1MMGA 2EFOA 5GTHC 2HDCA 3QP5A 1RKWA 1BIAA 1XGNA 2VB6A 1T38A 3IC7A 1V4RA 1W5SA 2X1DA 4GRIA 5L3GA 1MH3A 2LKXA 4DGWB 3FX3A 2JVGA 2JRMA 3E5XA 5HLHA 3VYTB 4G9YA 3L2VA 3VOEA 5B1BH 5JFRA 1GV5A 4OIQF 2W84A 3HGGA 2EWNA 2JUCA 2WV0A 1YG2A 1Y8RB 3K4BA 1CQTA 2IJLA 2L9SA 2FRHA 2WB1A 2YS9A 3P9KA 2KJBA 2EA2A 3F8CA 3RCOA 1KQ8A 4UUVA 4R8HA 3C2GA 4HW0A 4BQOA 1YJ9I 3TO7A 5L3EA 5E3LA 3HDDA 3S1RJ 2HNHA 3H5NA 3L2RA 1G2HA 2QF7A 4RB1A 1KYWA 2MBFA 1WH5A 1TWGJ 2DQRA 3K1PA 1WPKA 4I98B 5LLQA 3U1DA 2WAFA 3RJPA 4CCJA 4J00A 2F2EA 4KT5C 3HHGA 4RLQA 4LB6B 2OZ6A 2NVTJ 5TJJA 4I0BA 2M8EA 4BJTA 4BBSJ 3I64A 1OPCA 1FTZA 4I02A 2LF7A 1LVKA 2HOTA 2OD5A 3P9IA 2DMPA 2KRCA 3HEFA 4UB8C 1RIOH 1FY7A 1JUPA 2BZTA 2XSDC 5JI6A 2IGOA 2VBYA 4FE7A 4HQMA 3DFGA 3OOUA 2AHQA 1OFCX 2BXYA 2Q1ZB 4L5IA 2ADUA 3BCAA 1YIJI 1EA3A 4BQQA 1RRJA 1X2MA 5ILSA 1YIOA 2NS7A 2PBIA 3KEYA 5FKNA 3CCJI 1XCVA 4E7KA 2GA1A 1MH4A 4CH7A 2EK5A 2GOMA 2BE5F 1K78B 1HKSA 2P8TA 4UNOA 4FQGA 3S93A 4IZZA 4IHWA 1K61A 4BAYA 2R0QC 4N0BA 4PK4A 4IOCF 3EUAA 2A3SA 3NAUA 1GLNA 1WJEA 3G71I 1KYZA 2K9NA 2NNYA 4BE2A 3GZ6A 2OAZA 4NHJA 4BNCA 3JRDA 4G6DA 4XLNF 4PJ0C 3A03A 4NQWB 1D1AA 2D1VA 3V7RA 1WJFA 1YRNA 3L00A 3QP6A 5L3DA 1S8NA 2NVYJ 5CLSA 3CUQA 3GTKJ 4PDKA 2STWA 4HLYA 2QCOA 1ETKA 1BI2A 1B9MA 4LK1F 2JJ7A 1OYYA 3K1MA 2A68F 1S9HA 2CWEA 4XMYA 2ESNA 2NS0A 5C4XJ 1OCCH 2BW3A 3AG3H 1F4KA 2X6YA 2R7UA 1SVMA 4EMSA 3E3VA 3S8PA 3I56I 1EV7A 3DF8A 2JT1A 1N75A 3GTGJ 2QBYA 3LSHA 3QOPA 1UJ8A 5E3MA 1VQ7I 3VYSB 1RNLA 3W6KB 3C1DA 4BJ6C 1HBXG 5F04A 2E19A 1UHMA 2KIMA 3PM1A 4L5JA 2OCCH 4OU0A 2HVSA 2F5VA 2RDPA 2OJED 4BXXJ 2KIUA 4KITB 4I76A 1EJ9A 3PUBA 4M72A 1RUOA 4MFDA 1BI1A 1IXCA 2QQBA 1IXSB 4NUBA 2K9MA 4M3FA 4M6YA 5DD4A 2W85A 2BXZA 3R0AA 1LJ9A 1XC5A 1FEXA 5B66C 1LDDA 3OYMA 1LDJA 3WU2C 2XAHA 1ZKGA 2MA3A 1GHCA 5KNLA 1U8RA 4V19K 3R6SA 1VQ6I 4PSXA 3W3CA 2UWMA 1MZBA 3IAS2 4MIMA 5DYMA 4GDFA 4LFUA 3DBLB 1A6IA 4B43A 5FD5A 4FE4A 3D5LA 5DCMA 5D5WB 2QSGX 4NBQA 2ME6A 1WJBA 4DJAA 4XLAA 2CS3A 1SANA 2QYOA 1ZTRA 2KLOA 2CGPA 2K7LA 4B44A 2DMQA 3OWTA
chains in the Genus database with same CATH topology
5IY5H 2EILH 3X2QH 1OCRH 3AG2H 3ASOH 2DYSH 3AG4H 2OCCH 2Y69H 2EIMH 1V54H 3AG1H 3WG7H 2DYRH 1OCCH 2EIJH 3AG3H 5B1BH 2ZXWH 5B3SH 3ABLH 1OCOH 2EINH 2EIKH 3ABKH 1V55H 5B1AH 3ASNH 1OCZH 3ABMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 H;  2EIL H;  3X2Q H;  1OCR H;  3AG2 H;  3ASO H;  2DYS H;  3AG4 H;  2OCC H;  2Y69 H;  2EIM H;  1V54 H;  3AG1 H;  3WG7 H;  2DYR H;  1OCC H;  2EIJ H;  3AG3 H;  5B1B H;  2ZXW H;  5B3S H;  3ABL H;  1OCO H;  2EIN H;  2EIK H;  3ABK H;  1V55 H;  5B1A H;  3ASN H;  1OCZ H;  3ABM H; 
#chains in the Genus database with same CATH topology
 1IUY A;  1X1P A;  3RKY A;  4P9F A;  1IN4 A;  2FBK A;  3QU3 A;  5EGO B;  2JA6 J;  1FYM A;  2K85 A;  4A5M A;  3BPV A;  2XRO A;  3WTZ A;  4ETS A;  3OL3 A;  2Y0S N;  2H1K A;  1OCP A;  3OIO A;  4RGU A;  2XB0 X;  2QM3 A;  2BOL A;  2VKE A;  1Z0X A;  3RYR A;  4ZYD A;  1VFC A;  2XF7 A;  4ZJZ A;  2ZXJ A;  2X6X A;  5IP6 A;  2HR3 A;  4IO9 F;  1R4N B;  2Z9O A;  2HOE A;  5CQG A;  4IX7 A;  1M1E B;  1E0E A;  1H0M A;  4YFK F;  3CCR I;  3WE3 A;  2IS2 A;  2K3F A;  1IG7 A;  4ZDL A;  1G3T A;  1ZHF A;  2KIS A;  3ULQ B;  4A2U A;  2E34 A;  5H2F C;  3UR3 C;  3KET A;  4A3C J;  3IP4 B;  3HOT A;  4W97 A;  1W36 C;  2KP6 A;  3TED A;  2BY0 A;  5BS6 A;  1QQI A;  4I7H A;  1VQ5 I;  5FLX K;  1LDK B;  1UEL B;  2XSJ C;  1IZ1 A;  2ZXW H;  2R7Q A;  1IRG A;  2LY2 A;  2NXN B;  2VXD A;  4NQW A;  3JR9 A;  3QU6 A;  1D5V A;  1ON2 A;  4PGG A;  5FRO A;  2X85 A;  3JSO A;  3QYE A;  2DLL A;  2HS5 A;  2K86 A;  2UXX A;  1UFM A;  3RDI A;  2ZJR F;  2L7M P;  2F5F A;  3F8N A;  4YFN F;  3VFZ A;  1TT0 A;  1WKM A;  1TWF J;  3CDL A;  2DPU A;  4EJW A;  4PSW A;  1QVT A;  5J1Y A;  1T6S A;  5M5Y J;  1LVA A;  1WI9 A;  4RM3 A;  2GA2 A;  4M3B A;  1MNE A;  2A6H F;  3E5U A;  2R7T A;  1T0F C;  5K1Y A;  3MAJ A;  3BRO A;  1OR7 C;  3I59 B;  3K2Z A;  1LQ1 A;  5DDG A;  4KFC A;  1AOY A;  3ECH A;  3E0J B;  2NS8 A;  1EH8 A;  3J80 Z;  3LFK A;  3FXK A;  1WFX A;  1TQM A;  5EJC A;  2VQG A;  2EFN A;  4BGD A;  4XOR A;  3TDU C;  1N25 A;  3CCV I;  3FBN B;  1MBK A;  4JX6 A;  3TP0 A;  1ZH5 A;  1DGR M;  1VZ0 A;  1FWZ A;  3DBH B;  3MFK A;  3WTY C;  2PLY A;  3JW4 A;  3RPU D;  5LFA A;  4ZH4 F;  2XPV A;  3RIR A;  2EZL A;  4K2E A;  3O2P E;  1MNM C;  1BIB A;  3ZQG A;  5ICE A;  5FKM A;  4AYB N;  1AKH A;  5IYC J;  1K6Y A;  5J4V A;  3CMM A;  1IAW A;  4ZZD A;  2V1U A;  3BTJ A;  2R7Z J;  2K9L A;  4LIV A;  1Z6R A;  3BR5 A;  1FYK A;  1V3F A;  3BR2 A;  4WK8 F;  3HOV J;  1YE9 A;  1TBX A;  1VND A;  3U9G A;  1WI3 A;  4F7Z A;  3RZD J;  4CCN A;  4XOT A;  4UXN A;  4BE1 A;  3KIO A;  1P92 A;  4M71 A;  1RKT A;  2LY9 A;  3DTK A;  4UUS A;  3RQ4 A;  4CYC B;  4J01 A;  4LLN A;  1MDM A;  5JVG F;  3ZMU A;  1I50 J;  4XBF A;  4CDG A;  5HNH A;  1YTY A;  2QEX I;  3GFI A;  1TW2 A;  5FKL A;  3GCM A;  5ICF A;  3KP4 A;  3JRI A;  3KP2 A;  1T56 A;  5CVI A;  3S1M J;  4EGZ A;  2ELH A;  2FBI A;  1ZR4 A;  2E2I J;  1L3L A;  3T8R A;  1SEU A;  2ZBK A;  2DYS H;  2COB A;  1I6X A;  4KYW A;  2H27 A;  2G0E A;  2VBX A;  2X1C A;  2LTP A;  3DBR B;  3W2A A;  2DTR A;  3HPG A;  4XLE A;  3QOD A;  2EH3 A;  3K4L A;  1Q1H A;  4A5N A;  1PP8 F;  2CUZ A;  2R7F A;  4IVN A;  1ETO A;  3W6J B;  4AVP A;  3PIP F;  4RBO A;  4A3F J;  2R7V A;  3KP6 A;  4L5E A;  3OS1 A;  3OYA A;  5CVJ A;  1YW7 A;  2HPI A;  4A0Y A;  1PUE E;  4C2U A;  2PEX A;  4KA4 A;  4HX8 A;  2WC2 A;  2BY1 A;  3HRT A;  4Y15 A;  3ZQI A;  2KRF A;  1XMA A;  1P7I A;  4M6X A;  3A1Y A;  2ESH A;  2L2O A;  4IOA F;  1S72 I;  2QQA A;  2V9K A;  3RKQ A;  2DA3 A;  2OUM A;  2VC1 A;  2XV4 S;  4HSR A;  1JUM A;  1U9N A;  1Z9C A;  4A0X A;  1TNS A;  4U7D A;  2L9N A;  3HKZ N;  2DFI A;  1JKP C;  3CUO A;  2Y9Y A;  3V42 A;  1FSH A;  1ITY A;  2A6T A;  4I0A A;  3ZMS A;  1FIP A;  2FJ1 A;  3E7L A;  2ZME B;  5FFZ A;  2O03 A;  3SZT A;  3Q9S A;  3F22 A;  4AM3 A;  3I55 I;  1IDZ A;  3ROU A;  1ULY A;  1STZ A;  3OV8 A;  3WG7 H;  1GDT A;  3A4C A;  2R7S A;  3BQZ A;  2AS5 F;  3F8M A;  3FXQ A;  2DFF A;  2ZXI A;  3ZQF A;  2CSO A;  1JGS A;  4B48 A;  1C0W A;  2YPR A;  3CC7 I;  2UZK A;  3WG9 A;  1E2X A;  1F43 A;  4L9N A;  3OR2 C;  4HNT A;  1BR2 A;  3I59 A;  4I2O A;  2BY3 A;  4XLC A;  2K9S A;  4HDV A;  1P7J A;  2HQ5 A;  3QAH A;  5EEG A;  2EFW A;  2IGK A;  5F0C A;  3ML6 A;  3MN2 A;  1HXD A;  1MMN A;  3Q5F A;  3F8B A;  2PMU A;  3I71 A;  3COA C;  3HIF A;  4BKX A;  3D5R C;  2QLZ A;  2A05 A;  1SAU A;  1FBS A;  1V5E A;  3CUQ C;  3RYP A;  2M87 A;  1R71 A;  2HDW A;  4XKC A;  1J75 A;  3S14 J;  3CP2 A;  1A04 A;  1I3Q J;  2L7F P;  4EM1 A;  1T95 A;  3ABT A;  3GVA A;  4ABZ A;  2PJP A;  3DKX A;  2QSH X;  1WH7 A;  2VQC A;  2FU4 A;  2X0L A;  4O6J A;  5J47 A;  4I99 C;  2MW8 A;  3SYT A;  3TW6 A;  2LK2 A;  4G7O F;  4JP0 A;  2LLK A;  4CYC A;  4HDU A;  4ESJ A;  4ENJ A;  1O3Q A;  1JXS A;  3BG3 A;  3EUH A;  1DPU A;  3BP8 A;  2LH9 A;  2ACJ A;  4GYG A;  3O8G A;  1QVU A;  2NAZ A;  4Q4Z F;  2WAQ A;  2XB5 A;  3B6A A;  1G6N A;  1MIJ A;  5D4S A;  4PUS A;  1R00 A;  4ENK A;  5L3B A;  3FXM A;  5E79 C;  1H9G A;  3SEQ A;  1QBJ A;  3S17 J;  4EVI A;  5EEA A;  3ZMZ A;  2V6E A;  1BA5 A;  3OYB A;  2FE3 A;  3BZC A;  2HEO A;  3R4K A;  2W1O A;  1ZG5 A;  3JAM K;  1ETQ A;  1IDY A;  2Z33 A;  4D0P A;  1P9Q C;  1G3Y A;  1BOA A;  1FJL A;  2HTJ A;  2VC0 A;  2H1L A;  2IS6 A;  3ZQQ A;  2DBB A;  2ZJQ F;  1SFE A;  3HYI A;  4HV6 A;  1YX3 A;  3HOU J;  2CV0 A;  3H3V K;  2HGC A;  4PJN A;  1W36 D;  2L4M A;  1ONV A;  2L3D A;  3CJT B;  5FFX A;  1Z77 A;  3K7A J;  5F6F A;  1N77 A;  5F1R A;  1YFH A;  3WHC A;  4IRG A;  1IJW C;  1VQ8 I;  2LF8 A;  3EDP A;  5DM6 F;  1Z91 A;  2HU9 A;  3FXR A;  2R92 J;  3KE2 A;  3G2B A;  4BY7 J;  4A3J J;  3OL4 A;  2DPD A;  3KEO A;  5JHU A;  4UVA A;  5C44 J;  3I54 A;  3G73 A;  3TQN A;  4CXF A;  2WAD A;  2ZME A;  4MFE A;  3NWT A;  2W82 A;  4MTE A;  4Y33 A;  4WX9 A;  4R1H A;  2HXI A;  1X58 A;  1I39 A;  5D5V B;  2EA4 A;  4TV7 A;  1AU7 A;  2MFZ A;  2P6S A;  1HST A;  4L18 B;  2FBH A;  4F55 A;  3ZN1 A;  1W5T A;  1JJ8 C;  4ZZL A;  3KPH A;  2F5E A;  2DOA A;  4X0G A;  3ZCO A;  1J9I A;  3BZK A;  5HLG A;  1X4O A;  2I8D A;  1EH7 A;  3HJE A;  2IA0 A;  1LFB A;  1ETX A;  1G8X A;  1YRN B;  3OMY A;  1SFX A;  1O7L A;  3I4P A;  3K4J A;  2R7W A;  3CUQ B;  2VJ4 A;  4R79 A;  4HG2 A;  2H94 A;  5DTD A;  2LC2 A;  2KDZ A;  4XL9 A;  1UG2 A;  3KEQ A;  4B47 A;  4E70 A;  2EQR A;  9ANT A;  2FOW A;  2RRE A;  3AAF A;  4E7S A;  5K5R A;  3N4M A;  2BW3 B;  3GYH X;  4OAZ A;  1MW7 A;  5HNF A;  5FLX Z;  4U0Y A;  5ILU A;  3F21 A;  5J40 A;  1UZC A;  3EPZ A;  1SD4 A;  1K7A A;  3GLL A;  1IUF A;  2JSC A;  3OIQ A;  4IEJ A;  3ZXS A;  2BVL A;  4DNC A;  4F93 B;  1BW5 A;  4L9T A;  1ZG3 A;  4AID A;  1IRX A;  2ZNZ A;  4HAM A;  3CME I;  4OIR F;  4A3D J;  4LOC A;  1ENH A;  4CIC A;  3HTS B;  4CGZ A;  2CO5 A;  5ERI A;  1XS9 A;  1U3E M;  4PZJ A;  2Q8K A;  1ZLK A;  2FQ3 A;  4ZYE A;  3DPU A;  3GFM A;  3H9G A;  3ISP A;  3ZGK A;  2LMD A;  2YU9 J;  5HVQ C;  2Y30 A;  4EJO A;  2VPR A;  2XAU A;  2ZSH B;  2IS1 A;  3RKW A;  2EBI A;  3GTL J;  4WCG A;  5FD6 A;  4U7B A;  1IF1 A;  1KU3 A;  2YX4 A;  4M3D A;  4XRM A;  4A0Z A;  5GPC A;  2C6Y A;  2LVS A;  3JRE A;  1E3P A;  3HRM A;  1Z1D A;  3LFU A;  1B8I A;  1I6H J;  5LRR A;  2HOS A;  2Y75 A;  4LIT A;  2VQL A;  3PNT A;  4B8X A;  4IXA A;  3ESW B;  2M1B A;  4DYC A;  4BQA A;  1X1C A;  3K6G A;  3LSJ A;  3KCC A;  5FKK A;  1TWA J;  3MKY B;  4QWQ A;  2VOP A;  4BYY A;  5HLI A;  5DCM B;  5EZH A;  3MZY A;  1POG A;  3QPS A;  5HDK A;  4BEH B;  2QWW A;  5J3L A;  1KON A;  4YEL A;  4HPQ A;  1A31 A;  2RNG A;  2AQE A;  4PJJ A;  5CJ9 A;  5LEK A;  3TO9 A;  2PFB A;  5JHF A;  1JUS A;  1BI3 A;  1R23 A;  5HS8 A;  1TTY A;  2EPF A;  3DV8 A;  2AO9 A;  2JK3 A;  3IHU A;  1T98 A;  5BPI A;  4MHG A;  4XNF A;  4WWC A;  3W6V A;  3OR1 C;  2A5Y B;  2STT A;  1BL0 A;  1A6Q A;  1JTX A;  3WE2 A;  1OKR A;  2EIJ H;  3LSM A;  3OYE A;  4EM0 B;  4G12 A;  1U2W A;  2BV6 A;  4FX0 A;  2NOJ B;  5LGT A;  2EIN H;  4BHB A;  2O7O A;  2VIX A;  4KN7 X;  3IWZ A;  1Z7U A;  4YII A;  2HOA A;  5J1R A;  1T33 A;  3KP3 A;  2V1D A;  4Y13 A;  1HDP A;  4P55 A;  1JJ6 C;  3WTT C;  2W57 A;  3WGH A;  2KRH A;  1KA8 A;  4XSZ F;  1OCR H;  1NH3 A;  2IPQ X;  1SMT A;  1H9T A;  1ZGW A;  3TOA A;  4W1U A;  1ZAO A;  1IRF A;  3NAR A;  2PQ8 A;  3GXO A;  1G59 A;  3P5J A;  2LKS A;  4AIK A;  3AFH A;  3CDH A;  2JA8 J;  3CCY A;  3GFL A;  3H1C A;  1JI8 A;  2ZSI B;  3ABL H;  2CUF A;  1R6R A;  3K0L A;  1O3T A;  1K79 A;  2JA7 J;  4CZZ A;  4MNU A;  2XAF A;  4NC7 A;  2HI3 A;  1BW6 A;  3BLY A;  1MJ9 A;  3C2B A;  3VEP A;  1ZLJ A;  4A3G J;  4IQ4 A;  2PJR A;  3X2Q H;  1VQO I;  2JA2 A;  4ZC3 A;  3TGN A;  3A01 A;  2BGC A;  2Y69 H;  1VTN C;  1FBU A;  4M74 A;  1VQP I;  1QNT A;  4O5V A;  3GEZ A;  4MO7 A;  1F36 A;  4KUM A;  3Q0U A;  3OYF A;  3ERM A;  5KHD A;  1YLF A;  1IV8 A;  1FC3 A;  3BDD A;  5E3O A;  2CQ7 A;  2R7O A;  1UG0 A;  4JBA A;  1V55 H;  5DD8 A;  2IGN A;  4RLF A;  3M07 A;  2P0W A;  1D0X A;  2VI6 A;  4J19 A;  3BR1 A;  2Q2E B;  3JSP A;  1U5T B;  4P9U A;  3Q0W A;  5D8K B;  2XF5 A;  2HKO A;  1SFK A;  1WZ2 A;  4BL0 B;  2ZXH A;  4NDL A;  4RMN A;  1JT6 A;  2O6G E;  1N78 A;  3GBG A;  4U0V A;  3DP7 A;  3J81 K;  2A5W A;  3NQO A;  1RI7 A;  1W7P B;  2OZU A;  2VE8 A;  4UHT A;  1D8J A;  4XN0 A;  3MD2 A;  2Q0O A;  3I9V 2;  2TDX A;  1FZP B;  4XRF A;  3WTU C;  2KPM A;  5BMZ A;  3PL8 A;  4IRH A;  3CO7 C;  2RQQ A;  1X2N A;  2VBZ A;  2GBY A;  2L01 A;  4D9J A;  1AKH B;  3GF2 A;  2R5Y B;  1UMQ A;  3RSN A;  3N97 A;  2W48 A;  3LA2 A;  1BM9 A;  2I10 A;  3PUF A;  3WTS C;  2JMW A;  1TC3 C;  1LFP A;  4NNJ A;  3E6C C;  3HUG A;  2Z1D A;  2OC6 A;  2E7W A;  4ON0 A;  1KU7 A;  2EJR A;  1OLT A;  1OJL A;  2VT3 A;  4BUP A;  3IAM 2;  3P9C A;  4N4O B;  3BQY A;  3LAP A;  4UUS B;  2MAB A;  3LSR A;  4M6V A;  4Y17 A;  2OQG A;  3FDY A;  1PDN C;  4YIF A;  1MDM B;  2L7Z A;  1H89 C;  3F6V A;  2GLO A;  3SDG A;  2MD5 A;  3GUD A;  1XSX A;  3I4M J;  5D8L B;  4UUT A;  4XKW A;  4E4H A;  3JTH A;  5JLW A;  2VL8 A;  4BEH A;  3WU1 B;  2W25 A;  5HS7 A;  1G3S A;  3MKL A;  2A69 F;  3M3Y J;  1R4M B;  2NRA C;  1EF4 A;  2DMU A;  3HOW J;  4RGR A;  1YX5 A;  2HYF A;  1BBY A;  1HW2 A;  3I5U A;  2CQQ A;  3EUH C;  2HWV A;  4PFP A;  4QSH A;  4IRI A;  5F0F A;  1TNT A;  5H6R A;  2H6B A;  4HQE A;  1XMK A;  3FM5 A;  1DU6 A;  3ZQC A;  1J5Y A;  4FTH A;  3KP5 A;  2M8G X;  2XRL A;  4BS9 A;  1JE8 A;  2E7X A;  3GTO J;  3LWF A;  1AA7 A;  2GIZ A;  5M3F J;  1X1D A;  1U0J A;  2PG4 A;  3G3Z A;  4XQF A;  2VAS A;  2DA2 A;  4A3M J;  2PMH A;  5DUI A;  2P81 A;  1KQ0 A;  5ICC A;  2JQ7 A;  5H6Q A;  3QPH A;  3V8K A;  2ELJ A;  5ILV A;  2L5Q A;  4B3X A;  2K3P A;  5E18 F;  1YW9 A;  4E7H A;  5EZG A;  5E1X A;  3T1B A;  2COM A;  1NK2 P;  5FGM A;  4IPA A;  2YU3 A;  3FMS A;  4IKF A;  3R61 A;  4EV0 A;  1XGM A;  4JX4 A;  2M7A A;  1LE8 B;  1P2F A;  4M73 A;  5GAD J;  3C18 A;  4G7Z F;  2DA7 A;  3CTA A;  3K69 A;  3IV5 A;  3FXJ A;  3BG9 A;  3IRQ A;  3PSI A;  3JAM Z;  2PMZ A;  4MGR A;  1H88 C;  3H92 A;  4DBR A;  2IS4 A;  3F3X A;  2FX0 A;  2X4H A;  2GAU A;  3OSG A;  1BI0 A;  1IO2 A;  4Y4R A;  3TO6 A;  3MKZ A;  1GV2 A;  3OYN A;  2XGC A;  3RPQ A;  4BHP A;  1B59 A;  1ERD A;  2O8K A;  3L2U A;  3DEE A;  1WJC A;  2ZME C;  2CQK A;  3H9J A;  3WTW C;  3VOD A;  4S05 A;  2WA0 A;  1TQI A;  5IYD J;  3PJR A;  2O3F A;  2OCE A;  2Q2E A;  1U5T A;  3WTV C;  1OQY A;  3LQQ A;  4Q47 A;  1IW7 F;  1OMI A;  4C3J J;  1NHA A;  3Q3S A;  2CW7 A;  3LSG A;  2O61 A;  3BR0 A;  2G7U A;  5E1Z B;  4II2 A;  1VQ9 I;  5FO5 A;  3V7C A;  3HSE A;  3U21 A;  4KIG A;  5GAH J;  2R7R A;  3RI4 A;  2VE9 A;  2QZ8 A;  4XON A;  2V79 A;  2IGM A;  4D7N A;  4EJT A;  3RZO J;  1W7P A;  4LMY A;  2DMT A;  2DTZ A;  4EEF G;  4YFX F;  5KAF C;  2V9P A;  2NVX J;  3OS2 A;  1QA6 A;  3OYI A;  4F3Q A;  3RPU A;  1Y39 A;  1FBQ A;  1J09 A;  3HRU A;  5D6E A;  3TL4 X;  5KK1 A;  3LSK A;  4IJA A;  1X4P A;  2DA4 A;  2R5Y A;  2F4M B;  3TMO A;  3F9K A;  4BHC A;  3UKG A;  4BQN A;  5K7Z A;  4WF2 A;  4JX5 A;  1A5J A;  1TT5 B;  3H0D A;  4E7L A;  2A07 F;  1TW3 A;  1R1U A;  1O3R A;  1J59 A;  1HKQ A;  2H8R A;  1V54 H;  1LEB A;  4ZDO A;  1HSJ A;  4HV5 A;  1CF7 A;  4M9Z A;  1ZRD A;  2XAG A;  5GP9 A;  1XB4 A;  4L9J A;  4BAC A;  1F1Z A;  3IH4 A;  1X3U A;  4XKB A;  1MGT A;  1ZK8 A;  2HQN A;  3HC7 A;  5DUK A;  2WB1 N;  2OQR A;  5H20 A;  2DT5 A;  3M1C A;  3NEU A;  2BVM A;  1SFO J;  1QHG A;  1JGG A;  2KHM A;  1OYI A;  2H09 A;  3IKV A;  2FQ4 A;  2FD5 A;  1DQU A;  2DO7 A;  2JSP A;  4DIQ A;  3HGY A;  4P5O A;  4KIC A;  4IHX A;  5EEH A;  2VOO A;  3CJQ B;  1D0Z A;  4Y3O A;  1MBH A;  2VKD A;  3H35 A;  3WTX C;  3DWL E;  1JHF A;  1RUN A;  2KIQ A;  4GGG A;  2MC3 A;  3FXU A;  1OCT C;  1RES A;  3WOD F;  4I6Z A;  4B4C A;  1IN8 A;  2L02 A;  3KZI C;  3FBI B;  4HZF A;  1W0U A;  1DP3 A;  2CV1 A;  3DPT A;  3CES A;  3BJ6 A;  2K02 A;  4A3L J;  2DYR H;  2ECC A;  4HOB A;  3K4K A;  2F4O B;  1E3O C;  2IT0 A;  2V9V A;  1R7J A;  3KZZ A;  4M9S A;  1LE8 A;  2DW4 A;  1D0Y A;  2GXA A;  2AQF A;  4C3I J;  3KP7 A;  4OWR B;  2KIF A;  2ZC2 A;  4FX4 A;  2XUB A;  1WWX A;  2CW0 F;  2VJJ A;  1MBE A;  3PFY A;  5CKT A;  3HM5 A;  3OYD A;  3ABM H;  4E7I A;  4LG0 A;  1X19 A;  4BH9 A;  3OYC A;  3K9T A;  1ON1 A;  3J7Y J;  3TKY A;  1UCR A;  3V8L A;  3KLN A;  1VQL I;  4QTR A;  2D1H A;  2K9Q A;  3IWF A;  3S3N A;  1LFU P;  2OTJ I;  1S7E A;  1ZRE A;  3SDB A;  3OYJ A;  3TW7 A;  2ZB9 A;  1TLH B;  4RDU A;  1U9O A;  2MSY A;  2VXZ A;  3DEU A;  5CYV A;  1XX5 A;  2ZO4 A;  5IP7 J;  5E1W A;  1YS7 A;  2MH9 A;  1GXQ A;  1Z67 A;  4GYI A;  1IV6 A;  2CV2 A;  1S7A A;  1MJA A;  2XIG A;  4ZTJ A;  2J5O A;  4MQ9 F;  2IA2 A;  2FMY A;  1O3S A;  2YSR A;  1T08 B;  4BDZ A;  5FB2 A;  5IT3 A;  4D1Q A;  1J0R A;  3K4C A;  1AWC A;  1WGX A;  2ZJP F;  2JTV A;  3NRV A;  4ASN A;  2ZJ2 A;  3JCU C;  3K70 C;  3LNQ A;  2G7H A;  4HYE A;  3LQR A;  3TDZ C;  4A3E J;  1FT9 A;  5EG0 B;  4XM3 A;  1R1T A;  3IUO A;  4PGH A;  4CCK A;  1U8B A;  5A2Q K;  2K5C A;  1MMD A;  3D0S A;  4G8X A;  2VBW A;  1R58 A;  3VPR A;  1K83 J;  2JRT A;  3J7A O;  3HOX J;  4MEX F;  2L0K A;  4EJV A;  3AG1 H;  1B1B A;  3NWS A;  4CZC A;  2X9D A;  2BEO A;  2XGX A;  2EZH A;  3BTC A;  1Z21 A;  1R5G A;  4H4K C;  3L7W A;  2VJI A;  3AL0 C;  4HRI A;  2QKL B;  1X3W B;  3U1K A;  4BXU A;  2FNP A;  3E6M A;  4NC6 A;  4GFB A;  2VON A;  4DYR A;  3VYR B;  4IHV A;  2KQR A;  2M7B A;  3FIS A;  2ME0 A;  3BZ6 A;  2M34 A;  1B8I B;  4L9V A;  4QIW N;  3GTM J;  2L9V A;  1QU3 A;  5LGN A;  3FXO A;  1SD6 A;  2JPB A;  3KX2 A;  3S3M A;  2DT7 B;  1FTT A;  2FUG 2;  4RAZ A;  5BPD A;  3J81 Z;  4LK0 F;  4KIF A;  1KGS A;  1WCM J;  2OU2 A;  4CCO A;  2BYV E;  2VT2 A;  1RC9 A;  4RM2 A;  1Q1V A;  3SEZ A;  2DI3 A;  1ZGJ A;  3QOE A;  1ETV A;  5FLM J;  4IL6 C;  2DJI A;  4FT8 A;  3H5A A;  3J7A Y;  2YR2 A;  4HEA 2;  2WAE A;  3MZ8 A;  4A69 C;  4RB3 C;  3ASO H;  1GVJ A;  2W00 A;  2XAJ A;  2Y0S A;  1V5F A;  3KYD B;  1S3J A;  3RKX A;  4YIR X;  6PAX A;  3G1M A;  1T39 A;  3LMM A;  1MBJ A;  3PNY A;  2VOD A;  1B4A A;  2M30 A;  3B6C A;  1R9T J;  1Z7L A;  2HVR A;  1R36 A;  2JA5 J;  3LAJ A;  1XGS A;  2DN0 A;  3WGI A;  2E60 A;  4EM2 A;  1IN6 A;  3MZH A;  3K4N A;  2IBD A;  3IH2 A;  5L3F A;  2DCE A;  4I09 A;  1Y0U A;  2M3A A;  4DQ2 A;  5C3E J;  1UB9 A;  5IY5 H;  2RQP A;  4RB2 C;  3S2W A;  4HNU A;  1R1V A;  3G6E I;  3H3Z A;  2A61 A;  3ZQ7 A;  2M2E A;  4UVB A;  5EDN A;  4JYK A;  2L4A A;  3HOY J;  2KFD A;  1HQC A;  3GTJ J;  2UUZ A;  1VQN I;  1PP7 U;  2M4G A;  2DT6 A;  1JT0 A;  1FX7 A;  2CYY A;  2QEN A;  3BTL A;  4P1W A;  2XPU A;  4MLO A;  3J7Z I;  2KL4 A;  2P5K A;  4OAY A;  5F27 A;  5K5Q A;  3HBL A;  4U88 A;  3ONQ A;  1FP1 D;  2Y2Z A;  3M4O J;  4C2T A;  2Y0M A;  4RAF A;  2F48 A;  2PJR B;  1PYV A;  2R4G A;  3CP8 A;  2XAS A;  3CJR B;  1PUF B;  3A01 B;  5CPR B;  4UB6 C;  4D5C A;  1MD0 A;  3H9Q A;  2E1N A;  2MH2 A;  4M3E A;  1SMY F;  1WJ5 A;  2P5V A;  3DPL C;  2ETH A;  2QQ9 A;  5LHG A;  3CMA I;  3ZRG A;  3KFW X;  3GZ5 A;  3QYB A;  4WXC A;  2M9H A;  3ZMT A;  1DU0 A;  1B72 A;  3EYY A;  2RKH A;  3RQI A;  2LYC A;  5D4R A;  5EG0 A;  2IXS A;  4XIC A;  1Y6I A;  1TL8 A;  3V4G A;  4OMY A;  2OF7 A;  1MKM A;  2JWT A;  3SZP A;  3GX4 X;  1HCR A;  4HX7 A;  3FK7 A;  5FLV A;  3AL0 B;  5K7F A;  3T5X A;  3HG9 A;  1S29 A;  2Z5U A;  4WXH A;  4A6E A;  1B9N A;  4QPO A;  1QZZ A;  3W2V A;  3BOQ A;  3C2H A;  3LSP A;  3BC8 A;  1GVD A;  2UV1 A;  5F0H A;  1U5T C;  1Z3X A;  5DS9 A;  2BBY A;  3EYI A;  1GUU A;  3ZP5 A;  4I01 A;  2IP2 A;  5HDN A;  2EV5 A;  2CU7 A;  4A6D A;  4AU7 A;  3VWB A;  3SFZ A;  4AYB A;  2EZI A;  4G7H F;  2EZK A;  2N8G A;  5FJ8 J;  3F23 A;  1SVL A;  2ZFU A;  1YOV B;  1R49 A;  3MKW B;  2OPT A;  3O3K A;  4M3G A;  5D5U B;  4RAG A;  1JKQ C;  2HQA A;  1BR1 A;  1BN5 A;  2O5R A;  3IL2 A;  2P7C B;  1OIS A;  1EH6 A;  1FIA A;  1KU9 A;  3OSF A;  3A0H C;  3CCL I;  4AD9 A;  2XHK A;  2UXN A;  3REO A;  3DXJ F;  3HUG B;  1USS A;  3EQL F;  3PSF A;  2OA4 A;  4XN3 A;  4EQQ A;  3ZOB A;  2XRN A;  2NVQ J;  2LDU A;  2NYX A;  3C7J A;  2VN2 A;  1X1A A;  4CSW A;  1KZH A;  4EGY A;  4M9X A;  1Y1V J;  2FNA A;  1PJR A;  1UAA A;  5HOD A;  2OV7 A;  2FOK A;  5E17 F;  1LUJ B;  3MEX A;  1QPM A;  3C3W A;  2KJC A;  1ZAR A;  1HC8 A;  3PIO F;  4MQV A;  3EET A;  2WTE A;  3K2A A;  3TP3 A;  2W24 A;  4KMU X;  4KMF A;  2BHZ A;  4CCM A;  3ZMV A;  1WRJ A;  3HL2 A;  4XLP F;  3BG7 A;  4GO1 A;  4MEY F;  1QZY A;  4C9Y A;  2R93 J;  4GXO A;  2DU9 A;  4ITV A;  2Y48 A;  3ABU A;  3WU0 A;  2RC4 A;  4IHY A;  2FEZ A;  5IT9 K;  2VJ5 A;  2O9L A;  2P7V B;  2W7N A;  2GWR A;  3HHH A;  2ELK A;  1T8I A;  2ID6 A;  3O6B B;  2V4J C;  5KCM A;  2BY2 A;  4HLX A;  1SD7 A;  3A0B C;  4DW6 A;  3K1N A;  1ACI A;  2TRT A;  3FHN A;  2LBF A;  1YI2 I;  2AXT C;  2DK5 A;  2CQN A;  4II3 A;  3GTP J;  3L1P A;  3PQK A;  1HW5 A;  3P7N A;  2MLK A;  3OIP A;  3WGG A;  3FK6 A;  2FSW A;  1T2K A;  4A12 A;  5D6F A;  1UST A;  3ZN0 A;  3G4S I;  1LB2 A;  1FOX A;  2NVU B;  1ZRC A;  2HVQ A;  1FMW A;  2ISY A;  3D1N I;  2DOD A;  1MSE C;  4ZDP A;  1FNN A;  4ZYA A;  2MGQ A;  2D45 A;  1FOK A;  1NTC A;  2D5V A;  3HKZ A;  2QA4 I;  1VQ4 I;  1U78 A;  2E2H J;  2OBP A;  3M7G A;  3ERE D;  1ETY A;  2LSO A;  4QPQ A;  5KVR A;  2LFB A;  3GWZ A;  4JQF A;  4N9I A;  3FMR A;  1PUF A;  2VKV A;  4HBL A;  4NC8 A;  2RGV A;  3CC2 I;  2E1C A;  1SFU A;  4LJZ F;  4RAY A;  1D8K A;  5J6X A;  1O57 A;  5E20 A;  2X1E A;  2IVM A;  2J5P A;  4F92 B;  1FLI A;  4YEJ A;  2R3S A;  1XD7 A;  4UVC A;  2I5U A;  4XR6 A;  2LR8 A;  1Y8Q B;  2QSF X;  3K70 D;  3ZPL A;  4XSX F;  3L2C A;  3E97 A;  1I27 A;  1RZ4 A;  3OS0 A;  2R7D A;  3GW2 A;  2PN6 A;  4L0Z B;  2HZT A;  2HKX A;  4IF4 A;  5DEQ A;  2L54 A;  3MQ0 A;  3BJO A;  5BNG A;  2WY7 Q;  2AXL A;  5HS9 A;  1YJN I;  4B1R A;  3BJA A;  3CDI A;  5J1U A;  3ABK H;  1NG6 A;  2X51 A;  1FPQ A;  4LGW A;  4UV9 A;  3IRR A;  3GO5 A;  2RN7 A;  3IKT A;  4MTD A;  4HST A;  4XLH A;  4JOM A;  2DXI A;  4OIP F;  1JKR C;  1D1C A;  3HXL A;  1TP4 A;  1ETW A;  4LB5 A;  5CVR A;  3PFI A;  2DQL A;  2E71 A;  1VI0 A;  3DU6 A;  3VB2 A;  1U6G A;  3K10 A;  3S1N J;  5J8F A;  1HDD C;  2TCT A;  1WSU A;  1CF7 B;  1A35 A;  3L2W A;  1Y1W J;  2LOO A;  3I4N J;  3LST A;  3ASN H;  5LD2 C;  2WAQ N;  1J7K A;  4WXD A;  4H0E A;  3E6B A;  1ZYR F;  1ZEL A;  3BG6 A;  2WBM A;  2ZKZ A;  3JRF A;  5A2Q Z;  3AG4 H;  2CFO A;  1P4X A;  1LKX A;  1QO0 D;  1WVR A;  2W4S A;  4XKV A;  3V8J A;  5C4J J;  2ISZ A;  2GXG A;  1NK3 P;  2Z16 A;  3E5Q A;  3QWL A;  2M4K A;  3CCU I;  2HPM A;  1XSD A;  3JRH A;  3K4M A;  3OYH A;  4X6A J;  2XAQ A;  1ZG1 A;  3BPX A;  2X48 A;  1VQK I;  2HZD A;  3PO3 J;  3D5S C;  1LPQ A;  4BJ5 C;  3JRC A;  4CUG A;  1JHH A;  1HLV A;  5EF6 A;  2XF6 A;  2O8X A;  5TIS C;  5JVT A;  2CJJ A;  3FKJ A;  2F4I A;  1SVO A;  3BT9 A;  4OOI A;  4Q5S F;  4BY1 J;  3QQA A;  3RTR A;  3S3O A;  1X3Z B;  1ZGA A;  1XSV A;  3LA7 A;  3ZQH A;  3DLL F;  5M5X J;  1I3A A;  4G94 A;  5AIQ A;  3JRG A;  1Z3Y A;  1DGW Y;  3MWM A;  5B3S H;  1K6O A;  1MMS A;  5J4Y A;  4RA2 A;  5M5W J;  3F72 A;  2LRE A;  3M8E A;  1A36 A;  2GM4 A;  2HXO A;  3LL7 A;  2MG4 A;  1S5L C;  2EV0 A;  2MYS A;  5DM7 F;  3QPT A;  1K78 A;  2JZY A;  4AIJ A;  3E6D A;  2RVC A;  2GQQ A;  2XPW A;  3HTU A;  1FSE A;  5TRD A;  5F1J A;  1FP2 A;  4LG0 B;  4GCV A;  4QLC U;  1QHH D;  3BR6 A;  1D5Y A;  3SQN A;  3S2H J;  5GTI C;  5M3M J;  3DEW A;  1VQM I;  4ZYG A;  2V1N A;  1HKT A;  4Y7N J;  4KNY A;  3WHB A;  5CVV A;  5DCF A;  4C2M J;  3CCS I;  1BC7 C;  3E1S A;  3HSR A;  5IP9 J;  4Z6Y A;  3SHF A;  2M0M A;  5LGU A;  4LLG F;  2FXA A;  1FMV A;  2DA5 A;  2IW5 A;  3F6O A;  4XLF A;  5B1A H;  2EFQ A;  5B5E C;  4BDY A;  2ZFW A;  3H0G J;  3M8F A;  4CYD A;  5GAE J;  2OTL I;  3I0T A;  4ESB A;  4PFO A;  3JRA A;  1LNW A;  3L09 A;  4BBR J;  3A02 A;  3FXL A;  3CCE I;  4L0Y B;  4B09 A;  2IA1 A;  3GFJ A;  2V1X A;  5ICG A;  3FF5 A;  3FMQ A;  4E7J A;  2EB7 A;  3HZJ A;  3QPL A;  2NOG A;  2QVO A;  3CLQ A;  3OOP A;  2LY1 A;  2DDB A;  4LD5 A;  4N9H A;  3BG5 A;  3JTG A;  2M45 A;  4RB0 A;  4S0H B;  2E2J J;  3MMY B;  1W7P D;  2L7K A;  1YHQ I;  5GAG J;  1DDN A;  2PI0 A;  2XC7 A;  2CMP A;  3GME A;  4BE0 A;  5D5X B;  3KZY A;  1P4W A;  2WV1 A;  4PJM A;  2VUM J;  2CUJ A;  2DFE A;  1V5G A;  4PCQ A;  4D7M A;  4P96 A;  2E1M C;  2FA5 A;  3Q9V A;  4HF1 A;  2B63 J;  2CG4 A;  3FKI J;  1L0O C;  1VF9 A;  1YYV A;  3ECO A;  3SXY A;  3M8J A;  2VLA A;  4HF2 A;  2D2W A;  2M0C A;  1O7F A;  4V2G A;  2MD0 A;  2MLG A;  3PQJ A;  4ESF A;  1WJA A;  3T0Y A;  3U2R A;  1MMA A;  4FET A;  2ZCW A;  5JLX A;  1MND A;  1F9N A;  5HDG A;  1KU2 A;  5IOY A;  3M9A A;  3S1Q J;  3CF2 A;  1RPW A;  5CVU A;  3GLX A;  5ED4 A;  2BHY A;  3G1O A;  1OCO H;  3CC4 I;  1SAX A;  4Y52 J;  3CZ6 A;  1D3Y A;  1O4X A;  2QKM B;  3DLA A;  1D1B A;  4FIS A;  1OYW A;  3L9F A;  2FML A;  4AVZ A;  2CUE A;  5E8I A;  4PJL A;  4X1E A;  2EV6 A;  3Q0V A;  3MCZ A;  5L3C A;  1E3H A;  3S15 J;  5EGO A;  1HF0 A;  3I58 A;  4XK4 A;  3BR3 A;  4XID A;  1K4T A;  4XRS A;  3R0J A;  2F5D A;  2VKH A;  2F6C A;  4D5F A;  4O3M A;  3QRF F;  4U87 A;  2JVH A;  2PX9 A;  2H8W A;  1GXP A;  4DYQ A;  4HX4 A;  2YX7 A;  5E8G A;  4OIN F;  3L2Q A;  2E1O A;  3TOB A;  2B7E A;  5AON A;  4LLL A;  3OY9 A;  2E5Z A;  5BOX A;  2GXB A;  4C3H J;  3DQV C;  3HSF A;  2L9R A;  3FM3 A;  2V26 A;  2JPC A;  5LEJ A;  1MSF C;  1R5H A;  2CRG A;  1WQ2 A;  1MBF A;  4F52 A;  1IXR C;  1QZE A;  4YRV A;  4KIS A;  3SJM A;  5E3N A;  4FCY A;  1XDU A;  2YUS A;  1IN5 A;  5JR3 A;  3IH3 A;  2JUG A;  2Y31 A;  2KZG A;  4KJZ A;  4DZJ A;  2WWY A;  4ENM A;  1XCB A;  3CD6 I;  4EJU A;  2HYJ A;  2DFH A;  1DPR A;  3BWG A;  1W4M A;  3DKW A;  1RET A;  3GZN B;  4HF0 A;  1G4D A;  5LBQ A;  1NG7 A;  3FIW A;  2LP0 A;  4G6Q A;  2CFX A;  2M5W A;  5AIP A;  3ZMD A;  3GTQ J;  2JN6 A;  3DU5 A;  3PO2 J;  5IT9 Z;  2RV8 A;  3VDX A;  2B0L A;  1AHD P;  3A2K A;  5CQE A;  2O0Y A;  1MBG A;  3AG2 H;  4BXF A;  1H8A C;  4KIB A;  2QUF A;  2K4B A;  3TBI A;  5IPA A;  3V7S A;  2R5Z B;  2Z2S B;  4OMZ A;  1QRY A;  2DJN A;  2QGU A;  3HOS A;  4V2F A;  4G6T B;  1S6L A;  2XVC A;  4ZTF A;  3G1L A;  4EAT A;  1IN7 A;  2P6T A;  3FZV A;  5J8C A;  1I5Z A;  1MJB A;  4ANJ A;  5HOO A;  5HLT A;  2EFP A;  5LHI A;  1EKE A;  3B02 A;  5LRS A;  1B72 B;  5FRM A;  2HQR A;  3PNV A;  3CF5 F;  3FHZ A;  1IRZ A;  4U0W A;  3H36 A;  2KT0 A;  1SD5 A;  1OCZ H;  2V7F A;  4ENN A;  1HW1 A;  2EIL H;  1XPX A;  2QQ8 A;  3ZQL A;  1Z6T A;  2P4W A;  4S04 A;  3SZG A;  2VQH A;  3DTI A;  1Y56 A;  2LNB A;  2MC4 A;  2E1M B;  3VYU B;  1QGP A;  4AC0 A;  4N4N B;  3F8F A;  4IQJ A;  1XN7 A;  2DK8 A;  2H6C A;  4E7Z A;  1XTA A;  3HPH A;  2HTS A;  3W2W A;  2X6W A;  2LKP A;  2ID3 A;  3CMY A;  5IYB J;  2GIV A;  3N05 A;  2GOX B;  2DOE A;  3SFI A;  1FOW A;  3JRB A;  1JKO C;  2Y9Z A;  3S16 J;  1WHU A;  1HA8 A;  4DZP A;  1LEA A;  1JTY A;  3BCB A;  2R7X A;  3CLO A;  4LIU A;  5FKO A;  4DBQ A;  1FOY A;  2ECB A;  4HA8 A;  5DV5 A;  5F08 A;  4C30 A;  2LD5 A;  2ZNY A;  1TZL A;  2E35 A;  2RNJ A;  4A3B J;  1S7O A;  2X6O A;  1P6R A;  3BTI A;  1APL C;  2LRD A;  1R5I D;  3ELK A;  3MVP A;  2F5C A;  1G3W A;  3H5R A;  1XGO A;  4JK1 X;  4CA0 A;  3BY6 A;  4UY8 I;  2VPL A;  3EUK L;  1YIT I;  1ZQ3 P;  5KAI C;  3R60 A;  1WJD A;  1UHW A;  1KQ9 A;  1R22 A;  2IAI A;  2E36 A;  3UNG C;  2IRF G;  4KN4 X;  2B9S A;  1REP C;  4A93 J;  1FYL A;  3S32 A;  3ZR8 X;  3OYK A;  2Z3Y A;  1TWH J;  4CCL A;  1UHS A;  1CGP A;  2WY8 Q;  3VSL A;  4YG2 F;  1Z05 A;  2KMU A;  4NB5 A;  2HFH A;  4XRS G;  4B3A A;  5BQT A;  1TQP A;  2A6E F;  2V6C A;  2G9W A;  2EIK H;  4KT6 A;  3VSK A;  5IOZ A;  2RAE A;  4IHT A;  1SC7 A;  1B6A A;  3CCM I;  1BJZ A;  1ZR2 A;  3KLO A;  3OYL A;  2DMN A;  2HYG D;  5GPA A;  2ICW G;  3LSI A;  1IC8 A;  2K40 A;  4LG3 A;  4A3K J;  1DP7 P;  2DAO A;  3AKZ A;  1F5T A;  4IHS A;  2LBF B;  3FWE A;  4FAS D;  1RR7 A;  5K5O A;  4RS8 A;  4FHT A;  4HNV A;  4UV8 A;  2XDV A;  3CO6 C;  2XGE A;  3CJN A;  3DKY A;  2DA1 A;  2KZV A;  1PVE A;  2K27 A;  3OYG A;  2K4J A;  1I1G A;  1ZRF A;  5FRN A;  2LG4 A;  2CQX A;  3CQZ J;  1E17 A;  1YS6 A;  2IEK A;  4BU2 A;  2CH0 A;  1YW8 A;  4OIO F;  2GZW A;  3J80 K;  5TGT A;  1W5C C;  3LA3 A;  3H3U A;  2PMZ N;  1XG1 A;  4E6K G;  1BC8 C;  4A3I J;  1I1S A;  1BR4 A;  4AWX B;  4DOZ A;  1QPI A;  3O8H A;  1HOM A;  1ZN2 A;  2NNN A;  4RGX A;  2R5Z A;  1T0F A;  1YQA A;  3S2D J;  1OR7 A;  3I3L A;  1W0T A;  4AUX A;  1J2X A;  3I53 A;  1IGN A;  2FF4 A;  2XGD A;  2KDO A;  4CO8 A;  1RR8 C;  4Q48 A;  4RGS A;  3HB9 A;  3QYF A;  2XKP A;  2CW8 A;  1DUX C;  2E5N A;  3B73 A;  2DA6 A;  5LHH A;  3HOZ J;  4F91 B;  1XMX A;  3KYL A;  1BOB A;  2P5L C;  1Y0N A;  3KYC B;  3DTE A;  1BJA A;  1YJW I;  5EYR A;  3F0C A;  3HRS A;  2KKO A;  2EIM H;  2XKO A;  5K7H A;  4KDP A;  1TWC J;  4ZYH A;  1P4A A;  1YO5 C;  3CCQ I;  1ODD A;  4CHU A;  3LOC A;  3T8T A;  1W1W E;  2Z99 A;  3M1E A;  1K4S A;  2DDA A;  1X1B A;  1GT0 C;  2HDD A;  4AIH A;  2QBY B;  4XOP A;  1ORK A;  3DCF A;  1XDS A;  2DOF A;  5F64 A;  4Z2Y A;  1MMG A;  2EFO A;  5GTH C;  2HDC A;  3QP5 A;  1RKW A;  1BIA A;  1XGN A;  2VB6 A;  1T38 A;  3IC7 A;  1V4R A;  1W5S A;  2X1D A;  4GRI A;  5L3G A;  1MH3 A;  2LKX A;  4DGW B;  3FX3 A;  2JVG A;  2JRM A;  3E5X A;  5HLH A;  3VYT B;  4G9Y A;  3L2V A;  3VOE A;  5B1B H;  5JFR A;  1GV5 A;  4OIQ F;  2W84 A;  3HGG A;  2EWN A;  2JUC A;  2WV0 A;  1YG2 A;  1Y8R B;  3K4B A;  1CQT A;  2IJL A;  2L9S A;  2FRH A;  2WB1 A;  2YS9 A;  3P9K A;  2KJB A;  2EA2 A;  3F8C A;  3RCO A;  1KQ8 A;  4UUV A;  4R8H A;  3C2G A;  4HW0 A;  4BQO A;  1YJ9 I;  3TO7 A;  5L3E A;  5E3L A;  3HDD A;  3S1R J;  2HNH A;  3H5N A;  3L2R A;  1G2H A;  2QF7 A;  4RB1 A;  1KYW A;  2MBF A;  1WH5 A;  1TWG J;  2DQR A;  3K1P A;  1WPK A;  4I98 B;  5LLQ A;  3U1D A;  2WAF A;  3RJP A;  4CCJ A;  4J00 A;  2F2E A;  4KT5 C;  3HHG A;  4RLQ A;  4LB6 B;  2OZ6 A;  2NVT J;  5TJJ A;  4I0B A;  2M8E A;  4BJT A;  4BBS J;  3I64 A;  1OPC A;  1FTZ A;  4I02 A;  2LF7 A;  1LVK A;  2HOT A;  2OD5 A;  3P9I A;  2DMP A;  2KRC A;  3HEF A;  4UB8 C;  1RIO H;  1FY7 A;  1JUP A;  2BZT A;  2XSD C;  5JI6 A;  2IGO A;  2VBY A;  4FE7 A;  4HQM A;  3DFG A;  3OOU A;  2AHQ A;  1OFC X;  2BXY A;  2Q1Z B;  4L5I A;  2ADU A;  3BCA A;  1YIJ I;  1EA3 A;  4BQQ A;  1RRJ A;  1X2M A;  5ILS A;  1YIO A;  2NS7 A;  2PBI A;  3KEY A;  5FKN A;  3CCJ I;  1XCV A;  4E7K A;  2GA1 A;  1MH4 A;  4CH7 A;  2EK5 A;  2GOM A;  2BE5 F;  1K78 B;  1HKS A;  2P8T A;  4UNO A;  4FQG A;  3S93 A;  4IZZ A;  4IHW A;  1K61 A;  4BAY A;  2R0Q C;  4N0B A;  4PK4 A;  4IOC F;  3EUA A;  2A3S A;  3NAU A;  1GLN A;  1WJE A;  3G71 I;  1KYZ A;  2K9N A;  2NNY A;  4BE2 A;  3GZ6 A;  2OAZ A;  4NHJ A;  4BNC A;  3JRD A;  4G6D A;  4XLN F;  4PJ0 C;  3A03 A;  4NQW B;  1D1A A;  2D1V A;  3V7R A;  1WJF A;  1YRN A;  3L00 A;  3QP6 A;  5L3D A;  1S8N A;  2NVY J;  5CLS A;  3CUQ A;  3GTK J;  4PDK A;  2STW A;  4HLY A;  2QCO A;  1ETK A;  1BI2 A;  1B9M A;  4LK1 F;  2JJ7 A;  1OYY A;  3K1M A;  2A68 F;  1S9H A;  2CWE A;  4XMY A;  2ESN A;  2NS0 A;  5C4X J;  1OCC H;  2BW3 A;  3AG3 H;  1F4K A;  2X6Y A;  2R7U A;  1SVM A;  4EMS A;  3E3V A;  3S8P A;  3I56 I;  1EV7 A;  3DF8 A;  2JT1 A;  1N75 A;  3GTG J;  2QBY A;  3LSH A;  3QOP A;  1UJ8 A;  5E3M A;  1VQ7 I;  3VYS B;  1RNL A;  3W6K B;  3C1D A;  4BJ6 C;  1HBX G;  5F04 A;  2E19 A;  1UHM A;  2KIM A;  3PM1 A;  4L5J A;  2OCC H;  4OU0 A;  2HVS A;  2F5V A;  2RDP A;  2OJE D;  4BXX J;  2KIU A;  4KIT B;  4I76 A;  1EJ9 A;  3PUB A;  4M72 A;  1RUO A;  4MFD A;  1BI1 A;  1IXC A;  2QQB A;  1IXS B;  4NUB A;  2K9M A;  4M3F A;  4M6Y A;  5DD4 A;  2W85 A;  2BXZ A;  3R0A A;  1LJ9 A;  1XC5 A;  1FEX A;  5B66 C;  1LDD A;  3OYM A;  1LDJ A;  3WU2 C;  2XAH A;  1ZKG A;  2MA3 A;  1GHC A;  5KNL A;  1U8R A;  4V19 K;  3R6S A;  1VQ6 I;  4PSX A;  3W3C A;  2UWM A;  1MZB A;  3IAS 2;  4MIM A;  5DYM A;  4GDF A;  4LFU A;  3DBL B;  1A6I A;  4B43 A;  5FD5 A;  4FE4 A;  3D5L A;  5DCM A;  5D5W B;  2QSG X;  4NBQ A;  2ME6 A;  1WJB A;  4DJA A;  4XLA A;  2CS3 A;  1SAN A;  2QYO A;  1ZTR A;  2KLO A;  2CGP A;  2K7L A;  4B44 A;  2DMQ A;  3OWT A; 
#chains in the Genus database with same CATH homology
 5IY5 H;  2EIL H;  3X2Q H;  1OCR H;  3AG2 H;  3ASO H;  2DYS H;  3AG4 H;  2OCC H;  2Y69 H;  2EIM H;  1V54 H;  3AG1 H;  3WG7 H;  2DYR H;  1OCC H;  2EIJ H;  3AG3 H;  5B1B H;  2ZXW H;  5B3S H;  3ABL H;  1OCO H;  2EIN H;  2EIK H;  3ABK H;  1V55 H;  5B1A H;  3ASN H;  1OCZ H;  3ABM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...