2EIKB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eikB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eikB02
4N8UA 2BZCA 2CCWA 4G7QB 1KV7A 2PCYA 5AKRA 1BQKA 3WIAA 3X1FA 1VLXA 1WAEA 3WNJA 1BEXA 4DP2X 4G71B 4AKPA 4KO5A 1SNRA 2PPEA 4YSTA 1A8ZA 1L9QA 4QKTA 1X9UA 1AZCA 1AZNA 1KDIA 1BXUA 1OE2A 1A4AA 2GI0A 1QHQA 1JOIA 2FT7A 1J9TA 2JFCA 4GYBA 4UANA 3X1NA 3IN2A 1V55B 3SBPA 1NIAA 3MX0B 4YSCA 5B7EA 2VW4A 2X88A 2YAFA 2XXFA 4A68A 2IDFA 4E9WA 3AY2A 3WKQA 3H4FA 2XV0A 4YSSA 4NB7A 4Q89A 2H5UA 4AKQA 4E9RA 2DWTA 2DY2A 1AG0A 1NPJA 2UX6A 1WS7A 5D4HA 4BXSV 1MDAA 3AG4B 2YQBA 4YSQA 3NJGA 1GW0A 4JHVA 4PAZA 2XUWA 1TU2A 1ZV2A 1PY0A 3ZX1A 2GC4C 2PCFA 3S8GB 1TEGA 3PCYA 4Q8BA 6PAZA 3C75A 3MBWB 1EZLA 2PPAA 4KOCA 4MFHA 1SFDA 2CUAA 1OCZB 1KCWA 3S3CB 1A4BA 3ABLB 2YXVA 3EH3B 4G72B 4DP0X 3NSYA 3OQRA 1PLAA 1SFHA 2YAMA 1GS8A 2CALA 4BWWA 1NIDA 1PMYA 3BQVA 1ET8A 1TKWA 4EF3A 3GYRA 2ZWNA 1T5KA 1CUOA 2J5WA 2XWZA 2YAPA 1AACA 2BHFA 1OE1A 4GP4B 2YAOA 4UF7C 3QJUB 3NJNA 5ANHA 4DPCX 3FU8A 4HZ1A 4DP7X 3DTUB 2PPDA 1WS8A 1BXVA 2XXGA 3GDCA 3DIVA 2R7EB 1URIA 3N2JA 2FQGA 1HAUA 2XU9A 3FSZA 3EH4B 4HHWA 1OCOB 5B1BB 4A67A 1B3IA 3FQYA 3IN0A 4KNUA 3FYEB 3NSFA 1WA0X 4A2DA 4A2EA 4KO7A 1WA1X 3H4HA 1OOWA 2ZOOA 2YAHA 2B08A 3N55A 3HB3B 1CYWA 3AW5A 4HCFA 3KW8A 1X9RA 2YARA 3PAZA 3FU9A 1L9OA 1JZJA 3OM3B 3ABKB 4CSZA 2XX1A 2MRYA 1E30A 1AZBA 2P80A 3EH5B 4GP8B 4WTQA 1KYAA 2XV3A 3IEAA 1AR1B 4M3HA 2QPDB 1WA2X 4JKNA 1SF3A 9PCYA 5LDUA 1J5CA 2BP0B 4AX3A 4F2FA 1SF5A 3T6ZA 2BP0A 3FYIB 1MG2C 4KNSA 4ZK8A 1AANA 4HCIA 3QQXA 1NIBA 2W88A 1DYZA 4YVUA 1IKOP 1BXAA 4KOBA 2BW5A 2XYBA 1QLEB 5TK4A 1NICA 4A2HA 4PCYA 3NJFA 1FFTB 1CURA 1HFUA 2FWLB 5B7FA 5I6PA 2OV0A 1PZAA 4E9YA 2PP8A 3TA4D 2UXVA 3UADA 1ET7A 1RKRA 3HEIB 4AI7A 1FWXA 4QLWA 2FT6A 5D4IA 1V10A 2EINB 3D12B 1BAWA 3UAAA 3TBCA 4AZUA 3KW7A 2UXFA 4AKOA 2TSBA 3ABGA 5AZUA 1TEFA 2I7SA 2XLLA 2GHZA 1HAWA 4BDVB 4DP5X 1OCCB 3FU7A 1KBVA 3NJJA 3FU7B 3JT2A 2FQFA 5B1JC 3NSDA 2YAEA 1GS6X 1RZQA 2IWFA 4YSOA 1RZPA 2IAAC 3SQRA 3AG3B 1L9TA 2HXAA 4G7SB 3ZDWA 1V54B 1DZ0A 2EIMB 2ZONA 1GY2A 2HX9A 4KO9A 2DV6A 3QJQB 1PLBA 1I53A 5I6KA 4BWTA 4A66A 3FSVA 1PZCA 7PCYA 3ASNB 1PAZA 2HX7A 5I6NA 1ZDQA 1GYCA 1UATA 4W1TA 4DP9X 2IDUA 1N70A 1AS7A 2QDVA 1J9RA 1OV8A 3IE9A 3NSCA 1ET5A 1JZIA 2JKWA 2CBPA 2PP9A 3AG1B 1IC0A 7PAZA 3FPXA 2FTAA 1NPNA 4CSPA 1GR7A 3ERXA 3ZIYA 3UAEA 3S3DB 1KDJA 1L9SA 2QPEB 3X1GA 2DYSB 1PZBA 2LLNA 2QT6A 3TASA 1JZGA 2FJSA 2QDWA 2CAKA 4K9JA 3OMAB 3NJMA 3S3BB 2BWIA 3PLYA 5B7MA 3V9EA 1AZRA 3T6VA 3AG2B 4E9TA 1A65A 1ZIBA 2P80D 2VW6A 2Q5BA 2IDTA 1J9QA 3PXLA 3SBQA 5F7BA 2GSMB 2UXGA 1XB8A 1BYPA 1F56A 4A2FA 1PNDA 1L9RA 2YXWA 1L9PA 2VSMB 3FS9A 1NWPA 2PPFA 3X1BA 1ETJA 4BK5C 1CC3A 4G7RB 2AANA 3WG7B 1AS8A 2DWSA 2IH9A 4YL4A 5B1JA 1JZFA 4WKXA 5E9NA 2FT8A 3PAVA 5EHFA 4E9QA 3QPKA 1ILUA 4KNTA 1JVOA 2WO2B 3WKPA 5FC9A 1XB3A 2JXMA 5D4JA 2W8CA 2YEVB 1SDDA 4HCGA 3CVDA 3QJTB 3S8FB 1JXGA 3ASOB 2AVFA 2E86A 4DPBX 2TSAA 3CDZA 3CDZB 5F7AA 4YSPA 1AIZA 2GC7C 1JXFA 2VN3A 2VW7A 3NJHA 3T6XA 2WO3B 2AZUA 1AAJA 2PLTA 2IDQA 4E9SA 1BQ5A 4UAHA 4YVNA 4DP4X 2A3TA 4RH4A 4BXVA 1BQRA 3PAUA 1OCRB 1E5ZA 2HZHA 1JZEA 2FQEA 2RACA 3FQ2A 1ILSA 1AS6A 2BZ7A 1IUZA 2AZAA 5B1AB 1ASPA 3NJKA 4BWUA 4FA7B 1OF0A 4DP6X 2H47C 5PAZA 3OMNB 3GXUB 3SBRA 2OJ1A 2XVBA 3QJSB 1ADWA 2R7EA 3WI9A 3X1EA 2IDSA 2Q9OA 1XMEB 1BYOA 2EIJB 1NIEA 2BP8A 2HLEB 2BP8B 1ASQA 2BO0A 2AFNA 1PF3A 1JZHA 1NWOA 1M56B 3AZUA 3QJVB 3ABMB 5B3SB 2HRHA 1SJMA 4DPAX 1KBWA 4M4RB 3NT0A 2VM3A 3UABA 4A2GA 1XB6A 1JVLA 4W9ZA 2FNWA 4E9XA 5I6MA 5IY5B 1GY1A 4GP5B 1NDTA 8PAZA 2NRDA 4TXVB 5I6OA 4NAJA 3UACA 1PCSA 3CVCA 3FQ1A 4HAKA 1FA4A 3WNIA 3JTBA 3QJRB 1NIFA 3DKHA 1J9SA 2IH8A 2VM4A 2YAQA 2UXTA 5I5JA 5B1KA 1KGYE 2I7OA 2PP7A 1R1CA 1E5YA 4HIPA 2GB2A 1NTDA 1MG3C 1E65A 1GS7A 1SHWA 1AZUA 4X4KA 2UX7A 1RCYA 3T71A 3V9CA 1EHKB 1N68A 3IBOA 3EF4A 1PLCA 3NJIA 5I5IA 1AG6A 1JERA 3CZUB 3OD3A 5I28A 1A3ZA 4YSEA 3CG8A 2Y1AA 1KCBA 1A4CA 3TBBA 1W6WA 2PPCA 3OMIB 3CVBA 3U25A 3NP4A 5PCYA 1IBYA 4YSRA 1JXDA 3L45A 1IBZA 5AFAA 2CJ3A 2HX8A 2BWDA 5A7EA 3NP3A 2IWKA 1YLBB 1W6LA 4YSDA 1M9WA 2GIMA 4P5SA 4DP8X 5I26A 2MTAA 3FSAA 2GBAA 2BW4A 1PNCA 1QNIA 1AQ8A 2X87A 1NINA 2EILB 1J5DA 5I6LA 1M57B 1CYXA 1W8EA 5TK2A 4ENZA 3G5WA 4P5RA 3FSWA 2J56A 4F2EA 2H3XC 4HHGA 3PPSA 3FPYA 2OCCB 2XV2A 4L0PB 4FAAB 4GXFA 1SDDB 3NJLA 3EHBB 4E9VA 4F7KA 4N4YB 2EIKB 4NERA 4BDVA 3UGEA 2WSDA 4YSUA 2Y69B 4GY4A 1ASOA 2HRGA 2N0MA 1GSKA 3T6WA 1NZRA 4G70B 1MZYA 3FT0A 1ZIAA 2FQDA 2VSKB 3BVDB 3ZBMA 2XX0A 3TU6A 2DYRB 1ZDSA 5I5MA 1AOZA 2I85A 4YSAA 3NYKA 3T9WA 1E67A 1ZPUA 2J55A 4JHUA 3X2QB 1SHXA 1MZZA 3H56A 2B3IA 1OE3A 6PCYA 4DP1X 2IWEA 2ZXWB 2J57A 4KO6A 1ID2A 4HALA 3RYMA 2VMJA
chains in the Genus database with same CATH superfamily
1IBGH 1VENA 4N8UA 4TOYL 4JO2H 3QIUA 4DUVA 5AOIA 1RZ8A 2IO5A 5CA0B 4PTTB 4P9PA 3RVWD 5HHVH 5FO8A 1DBML 2D7QA 4J3OH 1U33A 2X6BA 4G71B 5E94B 1XGTB 3LZQA 3V4PH 4AKPA 1XCQB 4ZHQA 3UZVA 2VLKA 1KN4H 4UV7H 3RPIA 2EH7L 3SOTA 1J8HB 2DLIA 3MOAL 1IGFL 1FNGA 2XXCB 2ZUYA 1K9MW 1A4AA 3MHHC 5F9WC 3TEUA 3U11A 4ZSOA 5E23A 3D3VD 2DLFH 4LESA 4U6YA 3SDCA 1YJWV 3IS0X 1FFPA 2V9QA 4NUMA 4ONFL 2OWOA 1R1BA 2AAAA 2HYMA 1NDMB 5CS7A 3WFBL 2YKLH 1SVCP 4CNIA 1L6XA 2VDQB 5LA6B 4JZJB 4ZQKB 4HWBH 5FO9B 3IJHB 1ANUA 1HHGA 4NRXA 3WXWL 4AYEC 1JTOA 1GN4A 4XMTA 5ITBL 2XV0A 3EG9A 2HT3D 4BSVB 3X14B 3ME0A 4J12A 4XPBH 4ODTL 3CC4V 1JUFB 3FH8A 4Z7NF 3DV4A 3STZB 4NC1C 4CADB 1JTTA 2EC9T 4CMHC 5IQMA 4JI4B 1QKZL 4TNVF 3RFZB 2DQIH 3MRGA 2G0KA 5DRZB 2C9AA 3HZ3A 5FDYA 5I0DA 2XACC 2GY7B 3X2QC 5D5QA 2WKOA 1Y67A 1CFVL 3CMOL 1BBJB 2WLIA 2YGQA 3GMRA 2G75B 3IETA 3GDBA 2YIAA 2L7EA 5DVNA 1AMYA 3V79C 1MABG 1MF2L 2KMWA 2N74A 2M26A 4YDJA 1R5VA 3WJLA 1J48A 1BVLA 4XDLA 1KCWA 3BVOA 1RZKH 4L3EA 2H6UA 2R69H 4L3EB 5IOKA 1X6LA 1JHLL 1UM5H 4FHJA 4G72B 4JHZA 4R83A 4LQFH 4XBGA 3WJJC 4F9PC 5E24E 4XMLL 3V4PL 3J81N 2AK4D 2R56L 1AD0B 3C60A 1DVFB 4RDBA 3MTXA 2VL4A 3NGBC 4HJTA 3GMOA 5HHOE 4K73A 3QCUL 2KLRA 4KJYA 4X0NA 2E59A 2ZWKA 2DJ4A 1KIPA 2UY6A 4OTXL 4LNRB 1LO3L 4ATWA 3JWOH 1Z3RA 2ED7A 1DVFD 3U0WL 2NY5H 5GRVL 2ICES 5EF1A 4PDMA 3U10A 4GP4B 1AVMA 4LF8B 3LIZH 4D7TA 2YA1A 5IB4A 2BVOB 1S7TA 4MWFB 3GPEA 4FTDA 5ECJE 2XXGA 2IQAB 2X5PA 5C0CB 4HW6A 1FAIL 3CUPA 4M48L 2X2YA 3VFGL 4QPJA 3VYOA 2V2WB 4JG0L 4F33A 3C90A 1GM9A 4YDNA 3PQYB 4TUOB 3PQYA 5EU6A 3T6QC 1XH0A 4DGVH 1SEQH 1YEKH 4KNUA 3NSFA 3UP1A 1CZ8L 4Z7NB 4CBPA 3EDFA 4A2EA 1H3PL 4FKKA 2Y6SD 1UXSA 1MIEH 3KXFB 1THZA 2ED6A 4APQC 2P49B 5I15H 4X7TA 1AJPA 2CR6A 3LKOA 3GSRB 4WCEV 3VI3B 1MH5B 2VSCA 2ZOLA 2WINB 4PLKD 5I0ZA 2RMKB 3EYQC 5ITFA 3TCUA 4GBXC 3OM3B 2QVKA 3ECQA 2YSSB 2O5NA 3Q2LA 1KU9A 5JWPA 4ZUSB 4CA4A 1NR1A 2EULA 1T66D 1V7NH 3PABA 1FI8C 4GP8B 2XV3A 3LRSB 4P2QD 1F4MA 5EO1A 5BO1L 5CBEA 3WJJA 1MLBA 2JKLA 5IJVA 3DOIA 2X6AA 2JELH 3DVNA 1BX2A 2BIQA 5C0AB 5C0AE 4ZW6A 1YXBA 3L6FB 4B9YA 3NSXA 3PL6A 3AU1B 1KCLA 4ABVA 1XGYL 5CN2A 3BVNB 5E79Z 3KDMB 4NO0B 4X1IB 2Z31C 3FOLA 3NPSC 5FYJD 5JOEA 3UH8A 2AC0A 4DWHA 4P30A 1G7HA 4R4ND 2Q0AA 1W72H 5J12C 3K6IA 4A39A 4LOFA 2R4SL 3Q1SH 3INUL 3P2DA 3DMMA 4JVUA 4DERA 1TMQA 3ULVL 2LGNA 2QWRB 2HB0A 1Z5HA 3VRJB 4NKIH 1A14L 5AENA 3H9HA 4U2YA 3HEIB 2VZSA 1T5EA 4K23L 2WAMA 3ULVD 3AMLA 4UTBA 1MJ8H 4J4PC 1IAIH 4HUWB 4PV8A 1S7UA 3JD2A 2R0WH 3MRKB 4XP1L 4XVJL 3T2NH 1S7UB 2V5TA 3BJLA 3MRKA 1AR2A 2DH3A 2K6YA 2GVYA 4JQVA 2AQ1A 3KJ4C 3DUHA 1IXMA 5E6ID 1X5KA 3BUYA 4GUPA 4KK6D 2A6JA 4OGYL 4UM8A 3RWEB 4UNVA 2A6JB 3U9UA 2RA1A 3OAAG 3QP3A 2YD3A 3P4OB 4OCNC 1KJVB 4P3DA 1KSRA 4TSFG 5TFSH 1OB1A 4XB7A 3GBLA 3K1KC 1I9RH 1JPFB 3S3SA 2QPFA 1E1QG 3RGBA 3VXUA 1A1OA 3SODB 4O02H 3GWOA 4FJCC 3FFDB 2JCCE 7PCYA 1QBMH 3DV6B 3U79A 4L3AA 3VYNA 1P5UC 2H0JA 3EBAA 3ILEA 4HXAL 4OFKA 4Z0XA 1L0LH 2QR4A 2R1WA 4LHUB 1N3NA 5HYFA 5J6HA 3LVEA 3U2SB 1U8NA 2PUQT 1N6VA 4X6CF 4BUQA 1BIIB 3CMOH 5F7WC 4AM0A 1M7IA 3JZYA 4OLYH 1MCEA 1KCRL 3UTSB 1AHWB 4OKVB 3O45A 5I8KL 5KOVC 4OD1H 4AH2A 1NCIA 2J8UF 3FUHA 4XE0A 3AG1B 2I60L 3HC0A 4ODUB 2X4RA 5GS3A 5F44A 5LBSH 1UCBH 4P2QA 2XAJA 5DR5L 1HDJA 4GQ9L 2E75B 5AVWB 1FL6B 4YC2B 2CKBB 4JZ2A 1Y6MR 4GQZA 1FV1A 2ZCLH 3UAEA 1AGFB 1GOHA 4NDMB 4MJID 3S8WA 2BTQB 3CSBA 3DURB 1MNNA 1QSEA 2NUTA 2VQTA 2ERJB 4X83A 3BRFA 4DR6B 4GAFB 1GZQA 4YXKH 1V27A 4QIWF 4AW7A 3RDTC 3DOHA 3MLUL 1PD1A 2BWIA 2GV9A 5T1LB 5T3ZL 2PCFB 4UQAA 3ORJA 3BT2L 4OY9A 3VFUA 4GLXA 3EAKA 4ZXBC 2UZIH 4FXLA 4LEBA 4W4LA 2GT9B 4WEBH 3HRZA 4PV1B 5FCSH 3UTQA 3C9NB 2E74B 5EPMA 3AG7A 2C1PA 1ZLSH 5DZAA 1BYPA 1QLFA 3QQ9D 1U30A 3D0LB 1LP9F 4JM2A 1NQBA 2VAJA 3J07A 1CGWA 1CFQB 4YL4A 3DSQA 1F6AB 4OCSH 5B1JA 1TQCC 1KULA 4WKXA 3MRGB 5DRZA 3P40A 4RZCA 3T0AA 4G1EB 4J8QA 3BAIA 3DX0A 3QXTA 1HWGB 2WLLB 4OZGF 4RZCB 3V7MA 1XGUB 4GRMA 1F02I 2E75C 4P9OA 5CFHA 2DKUA 3FO9B 4M6ML 1B6UA 2DD8L 4F2MB 3AVEA 3RWGA 1YI2V 4O4LB 4N2MA 4UI2A 3BFWA 3C5SA 5IVZB 1H3TA 3TTSA 2OA9A 1U8CA 3JWNG 1SQQH 5E2VL 3AJ7A 4OLXH 2QM7A 4FNRA 2Q6WB 3ZE1F 1MSWD 1DE4A 2GC7C 1H6UA 3JZ7A 1FZOA 4UVAA 1OAXL 3EW3B 3MNVA 1DL7L 3S0PA 1KXQE 2W59A 4MRBA 1FORL 2F53D 4N86A 3V7AE 3KYNA 1RLWA 3N1PC 3ZE1E 1JZEA 4JI7B 2RAMA 3GSWA 1J10A 5IBTH 1P4BH 3EJTA 3FTWA 2YD4A 1A4JB 2EC9U 3MRCA 2HLFD 1P6AB 2WPDG 2DI7A 2VDRH 4P5MA 4TMPA 3ZTEA 3LMJH 1V54C 1WFMA 5F72S 3UTTB 4I55A 3BISA 3IBEA 5GS0L 4KUMA 4TTDC 4APXB 2X0UA 2IBBA 5HYJE 5CA1B 5DJ0B 2IBZH 2UVFA 1K2DA 1M4UA 3ARXA 1CP9A 5CMAB 3T2OA 1FFNA 3QFJA 4ALAL 5KW9H 4RSYA 1ZJBA 1FFNB 4UQIM 1AGBA 3BQUC 3GZOA 3IDIA 1P4UA 4O4IA 2Z1PA 3R4DA 1M2VB 4LVHC 3UO1L 4JFUA 3ESVF 1M56B 2QEJA 4H20H 1RK1B 5ERWA 1MEXH 3ABMB 1ACCA 2HRHA 3U7WL 1EXUA 4JFED 2DDQL 3QEGH 4WV1A 4DR4B 5EU5A 1JRHL 2DLHA 3TZVC 4Y5YB 4E42B 4Y4FA 4OI8A 1FNEB 3UMNA 5E0QA 3ZRWA 5FGCB 2BNRD 2A5UA 4U7MA 1A6ZB 3V6FA 4KI1A 4JF3A 5DUBA 1KUMA 3RGVB 1SMOA 3ZL1A 1ND0A 3MDSA 2EYRA 5BXFB 5EA0L 2UXBB 2EYRB 5BXFA 2GAZA 1OTTC 2NY5L 1DLFH 3GUTB 4RLDA 1MHCA 5I5JA 1QBLL 4BJLA 1UACL 4U1HB 4KKZA 2R2BA 4EI5B 2F5AH 4LOUD 3RNQB 5C09B 3ZN1A 4H13B 2J4WH 4JI8B 2XKUA 3GHEH 3MV8A 4DK1A 1X7QA 4UDTA 2VM9A 5IEKB 5HDLA 4MD0B 1ZLSL 3T1HO 4UIKL 4O4HA 2W0KA 5H9CA 1I94O 3HNTL 3TJEH 2HH0H 3VWKA 3GS4A 2EEBA 1XT5A 1BZ7A 1OZTG 2VXSL 2FB4H 2WTOA 5C07E 2F18A 3M8AA 5D1ZB 4OD3L 4K23H 1P7KB 4LAQH 1GAFH 3QG7H 1TYRA 2IQ9L 2Y7SA 5EZIL 2ZKYA 3L4VA 5FM8A 4NKIL 3I6KB 4FCAA 5GGTL 5C7ZA 4XZ4A 4FJ6A 3PWLB 2NY1D 4KY2A 3IXTA 5B4MD 1EZJA 2V17L 1OARH 3HZKA 3KYOB 4IGBB 1DLHA 3CIQA 5IVXB 3AK3A 5HI5D 3V5KA 4UV8A 1G1KA 4YX2L 3ZQWA 1XAKA 1EBAA 3DO7A 1DJZA 2YPLD 2O5XL 1ZAUA 3JAKA 5JPNA 1MCCA 2AMGA 3S5LG 2MCPH 4QRRB 3BCCH 2JELL 3UCSC 4PDRA 2NY6B 4G8EB 2B16A 1LJMA 4I18B 4N3UA 2NNAB 3DK0A 3VTMA 2FR4B 3GTVA 2L7JA 4H88H 4B7IA 2X9YA 3B34A 3QZBA 4FRWA 2UZYB 2Q2LA 5F9OH 3E6HA 5KAIZ 2WYHA 3HE6B 3LRHA 4YDKL 4ZW3A 2XTLA 3BPLC 4XBEL 4Z0XB 5HDBF 1G6RA 2DMKA 1BS3A 3ZW3A 4PLJC 3OTOO 4WIQA 3VD1A 1HS6A 1UGNA 3VQVA 3DIDA 1MY5A 4UV7L 3VYPA 1A6AA 5EOCJ 5C0IB 3KPMB 2YS8A 1MFAH 2FO4A 2IXQB 1WHOA 4PJGB 5LCVL 4UBDD 4ZDHA 4JKPL 2VJ8A 5DQDH 3BAJA 3HC3L 3OXRA 4F8TA 1NFDE 3TBSB 3SDAC 2QVFB 2BOCC 1OSPL 3MLYL 1J8RA 1ZIAA 4G8IA 2BY1A 4FQ2L 2LQRA 4JREB 4K3DL 2EXSA 3D9AH 1MCHA 3QCVL 5F1OB 5IQ9B 2RD0A 4JR9H 1H2LA 1I7UB 4R6ZA 2B2XH 4HKXA 3WIHA 3D36C 1QRNA 2G2RA 3UOAB 4NHUA 1A9VA 2V4DA 2GY5A 2ZD0A 4Z7VE 3RVYA 6PCYA 3HHMA 4XOCA 3UTQB 1FYTD 3W7WA 1MRDL 1G9NC 3NA9H 4WENB 2JIZG 3H1LH 5D5PA 5EC1C 1G5GA 3PV6B 2WLZA 3O0LA 4TSBL 2CE4A 4N2CA 3CSGA 2CLZB 4O02A 4B50A 3SDXB 1KV7A 1GGTA 4LWSA 2CK0L 5KHIA 2R2CA 2WLMA 1F6AA 4FG0A 3O2VL 5TQ0H 2X40A 3L2MA 4WI8A 5HDBB 1DJGA 3NPZB 5HDBE 5AKTA 3SZ6A 1ROWA 3IAPA 3S5ZA 5JIMA 4H2AA 1VFBA 3BD4A 5DK0B 2ORBL 1J0IA 1KEMH 2IBZX 5DEGA 1ZLUH 5BQ7A 2X6UA 5JXEC 1BXUA 4Y5XA 4UT6A 1T1WA 2IF7A 5F8QC 3U7YL 3RUGA 4KHTL 4KZDL 4B3EA 4AQEA 5KHGA 4X65B 3AXIA 4RAUA 2VW4A 3S36L 4FFBB 4HF5H 4UTBH 4I87A 4FLXA 2DM3A 2XBZA 2ZJSH 2WB1A 4A68A 2IDFA 2YI9A 4ESKA 2GTAA 2E3CA 3QE5A 3UYPB 3H1JH 1GVIA 4HFUH 4XXWC 4Q89A 1QD0A 1RPOA 2X4QB 5DJ8B 4XMKH 2DQTH 4OZ4B 3AG4B 2NNXA 4AIXA 4DKFL 4NUQA 1Y7VA 4WK4B 4N8PA 4YO0B 4AIZA 3N0AA 4JHVA 1HNFA 3QUXB 2G9HB 1UA3A 2EVIA 5JH7A 1P6WA 4ORGB 4K7PL 3LKSA 3S8GB 1BQHA 2BY2A 4L05A 4FQHA 5DFVC 4YJ3A 1JD9A 4LB8A 5IMOA 1J11A 5HDQL 1NBZB 1IBBA 5DVOA 4KOCA 1A6WH 6TAAA 2CUAA 1OCZB 4YEEA 1U8PA 5C0BB 2HLFC 2VZOA 2AXGA 4HS3A 4JO2L 5GGSB 2YXVA 2DWDC 1DVQA 2F53A 3ETSA 4Z7AA 3H3BC 3LHAA 2ATKA 2XCMC 5JDSA 1UD2A 1PMYA 1JGDB 3R66A 3WLBB 3CHPA 2QMJA 2VERA 3N04A 1MFCH 3QRGL 4LRNL 1N0JA 4FP8H 3S48A 2L7QA 2JS3A 4H0IA 4K8ZA 1RUQL 2EECA 2XWZA 3NAAL 5T33H 4AOFA 5C0RL 1ZS8A 4JFFB 2O6DA 3LN9A 4UF7C 1EMTL 2RB8A 1D5IL 3QR2A 1T7YA 2I9TA 1W0JG 1RPQA 5ID1B 3K6SB 1C5CL 1CXKA 3K6SA 12E8L 4PQXA 2DRUA 3TT3H 5AAPA 4LPTA 1CTOA 4ODXA 1JPXA 5E6YA 1VQNV 3LXAA 3MYZA 4A67A 4GO6B 5KSVB 4PJFA 4Z3HA 2NY6C 4GIOA 3WS3B 2BOLA 2C1OB 4Z78A 3OE7G 4O4HB 1IBKO 3DRTB 2BVUA 4HG4K 3BO8B 5FK9A 1UM4L 1XZ0A 3HAEH 3VXRE 2ZWYA 2HTKD 3EIFA 4EOWL 2O5ZH 3IDJA 4I2XB 2QTSA 1F6FB 4IS6A 4AEFA 3STZA 4IRSA 3QQDB 4Y16A 1PJ9A 2HN7A 1THCA 5TH2A 4QJ5B 2ZZUT 2VXSH 5E1QA 3TBYA 1Q81W 2CTWA 2ICWI 4H8UA 3WJMB 5KS9A 5KBNC 2AHYA 4YR6A 2QM4A 1LE9A 1JVKA 1E30A 1R24B 4KPHL 4MTMA 1NCWL 5D93B 5LUMA 2DLEA 3TBTB 1YEJL 1N4XH 5DFAA 2F8OA 2FX8H 1MWAL 2EE6A 2ZQKA 1YJDH 3HI5H 4U49A 3C8KA 3RYCA 3KWUA 3FW6A 3MRJA 4GKZB 4XCEB 4GKKO 1R3HB 1HKFA 4BFEA 4JQIH 4RA3A 2XWJA 5J3HC 1A0QH 2UZYA 2OMTA 1XMOB 3SE3A 3FCUB 3ZHLA 1FFTB 1HFUA 2WKOF 3LN5B 5I6PA 5SX4H 4JX0A 5C3LD 2A1WH 3HN5A 3LNIA 1JYXA 4Z3EA 3TN0A 4MZIA 4QTHB 1EFXB 3EFFB 3KR3H 4M62H 5JQ6H 1XH3B 3FCTA 5JZ7D 1S5HB 2B5IB 5DZJA 3QDGD 4LSPL 5SV4A 3TBCA 1DBJL 4LDEB 5C0CA 2SEBA 4R7NA 4NYLB 2EJRA 1R6NA 4RIRA 3U7YH 2ADPA 5I1IL 1X5XA 2UYLB 3T1YO 3HPLA 5B1JC 4JPVH 4OQTH 2W9DH 3GSVB 2VQUA 5I8EB 2IWFA 3IGAA 1RZGA 4JFHD 4ZOLB 3QC5X 4MQTB 1I53A 4JI6B 1V3KA 4ZNEA 1G43A 2BSTB 1LEIB 3FSVA 1T7ZA 4EFBA 2YPVL 4OCMC 4LGSB 4BZ2L 5KVEH 3MJ7B 4X88A 1PAZA 3O6KH 4GAGH 4QXTB 3O9OA 1Z9SB 2B77A 4W1TA 3E22A 2X2UA 1ZHBA 4D2NA 4O4LA 3E22B 1ZHBB 2QSQA 4B5ZA 1AS7A 1BPVA 4H26B 1YEEL 2CO7B 2V4LA 2XZAH 3UXFA 3TVMA 4MVZA 7CGTA 1S3KL 4JRXB 1Q94B 1WCQA 2BHUA 1YEIH 1OXYA 2PP9A 3NFNA 3GI9H 3JYBA 2EO1A 3C2SA 5HGGS 1OP9A 3VB8A 2AXTZ 2M7WA 3ES6B 3N44F 1WF5A 3VDCA 3WSQL 1JIBA 1T6WA 4AQ8C 1T04B 4K71B 4BFNA 1FL6A 5EC1B 4QXVA 1TTGA 2R9IA 3C3SA 1CD1B 2ZSWA 4H7VA 4MASA 5CZVL 3HPJA 3LDDA 1MXGA 2DS4A 2NX5D 3F7YC 4MAYD 3O4LB 1F3DJ 1KYOJ 1T21A 3NJMA 2V9TA 4HYOA 4YK4B 3HPLC 2ZUTA 3BPNB 3V9EA 2EXTA 3CWBH 3AG2B 3MUY1 4DKTA 2YQ2A 2YEZA 4FXGC 2AJVH 1K7DA 2M1KA 15C8H 3CQPA 3TWCH 1HIML 2AQPA 2IDTA 1KJ2L 4PY7A 5GGTA 3EYFB 5FECA 4Y5VA 4JY5H 4TUKH 4B7EA 4AJ0A 4PM1A 2ZIMA 3S35H 1EHAA 4U33A 5F9WB 1JHKH 1ACYL 4JO3H 4IT5A 2EDWA 3ULUD 4MVOA 1J1OL 1UD6A 2PPFA 3CHOA 1ETJA 2W0PA 4MMYA 2LGWA 1WJZA 4PI0A 1ADQA 2MH4A 3BHBA 2FT8A 4X6CE 1H6FA 1UXLA 1IQWH 5LCVA 2P9RA 4P5TA 4X9GA 4Q9CA 1ILUA 4N0YL 1A0QL 1ZEAL 3QXVA 4MCZB 5HI4C 2P44B 3DX7B 4N1CA 3ZYJA 2CDFA 3IMUA 1CI3M 2Z8RA 5KBDA 5BRPA 4NPKA 4RAIA 1JXGA 3WEXA 3D33A 2AVFA 4OFYD 5FCUH 2TSAA 1RXLA 3IDNB 4LEXH 3O9WD 4JO5A 1ZT7B 4WFGE 4QXUH 1DVUA 2DQJH 4TVUA 1A3LL 2Q86A 1KCRH 3T6XA 2PR4L 4YE4H 4YAQA 2ICEA 2AABL 2IDQA 1G1XB 2ICEB 4QPEA 1NH6A 5DZVA 2OMVB 4C47A 4RGOL 2DEWX 3L3OA 4G6MH 1SXCA 1V7ML 3IJEA 4U0QB 3SQOH 3AEIA 3QS3A 4QWWD 2Z93A 1SJEA 1VKXA 4DF9A 3QPXL 2KT6A 3LPGA 2B9BA 1B4LA 2WXMA 4JAUA 2CZNA 1KB5B 3AG3C 3D50A 3BP7B 4WUUA 3FQNB 4XNUH 4OZFB 4XC1L 1SEBB 4PLOB 2AAVA 2NTSP 3P4MA 2PYEE 2PYEB 4OCYL 1MKFA 4D8PA 5J8OA 4U6YB 2MFNA 2ZYHA 2R7EA 4NI6A 1J7VR 3SDCB 3WI9A 1N5YH 5E95B 1HCVA 2J8UA 4FK5C 1OPGL 2FO8A 4IOIA 4U4BA 4V1DA 2CH7A 5ABDE 2GT9A 4XGZA 3EYVA 4M61A 4FPPA 2Q67A 1Y76A 3ZDYB 3JAKB 5JPNB 2Z9TA 5EU3B 1C08A 2R0WL 4YY3B 4XVJH 2QKAA 1KBKA 1S9VA 5MEOA 3ABKC 3BVNA 3KDMA 4NO0A 5L4IA 2BRRH 1A8JH 1IC5L 1AP2A 4OVUA 4HS8L 3THMH 2FNWA 1E9QB 3L5HA 3UEZA 3EYQD 3QQDA 2QADC 4Y16B 5E2TH 2MEJB 3GSNB 3ARWA 1AR1D 3D05A 3F5WC 3QZWG 4TUYB 2PI5A 1PG7X 4GOSA 4M7KL 4TUYA 3CLEH 4OIBA 2X3CA 4UIMB 4NPJA 3IVKA 1FA4A 3T1HB 2PKDA 4YR6B 4H1LG 4JNXA 2NXYC 5FX3A 5HHPB 5F7KC 2WP3O 3TP4A 4B41A 3DOSB 1NBVH 4H20L 2H32B 1DUZA 5B1KA 2VAAA 3U4BL 5GS1B 4O2BA 1UXMA 1H2NA 3LEVL 3F6JA 1BMFG 1CE1H 4NRZA 2X4NA 3ZX6A 3GSXA 4KJQC 2CRMA 2ZUQC 4H25A 4ONOA 5GZNA 4MMXC 3FN0L 1GS7A 3KYMB 1O75A 1S7XA 3HKBB 1ZXKA 3IJ9A 2UX7A 4X4KA 4YZWA 1BLNA 1XR9B 5I1JH 4YPGB 2R8SH 5D7IB 5DHYA 3FO1B 4H5SB 35C8H 4G9DA 4PJ5D 3N42B 1P4BL 4FFZH 5D1ZA 4GIPD 4JZOA 4PJCB 4X50A 1W6WA 3O6FC 4ZQTA 2Q8VA 4XAKD 2BVOA 3L4TA 4DV3O 3CVBA 1HVXA 4Z0BL 4OZIB 5LYJA 5LWYL 4AJVA 2KG7A 3DDFA 1AI5A 2JE8A 3TBVB 4AGPA 1MJJB 2VQ1A 2X09A 1KELL 2X12A 4LCUC 3QDHA 1EAJA 4CJ0A 4P04A 4YSDA 4ZPVA 4ZMPA 4ELMB 1YF2A 4CBZA 2G4EA 4LSUH 4O02B 4OPAA 4JFDB 4MSWB 4Q4IA 3SDXA 3TJPA 5C70A 5KYXB 2DJUA 1EAPB 2W6JG 1QNIA 3VJ6A 3N85L 1N0XH 3QA3B 4XCNB 5AVRB 1J5DA 3FF8A 5J89A 1T0MA 3WFHA 3ZEDA 3L1GA 4PRPD 4B3TB 4BFBD 1A6ZA 5LBVA 2UXCB 2QM8A 1IJ9A 4QTFA 4KNQA 5ACZA 3TCXA 5FGCE 3H3KA 2LQTA 5LG6A 8FABA 2XWCA 3MJGX 4ZOBA 4PGEB 1CXFA 3FPYA 3W5NA 5CZXC 2YKKA 3S7GA 4GXFA 4JFOB 3NJLA 1QCEA 3L75H 5DZPA 4EDWL 1IAMA 2FL5A 5IT2L 3K4AA 4PJEF 4XPAH 4JGMA 4QRPA 3UGEA 1PJWA 1X4XA 2ZWSA 3S3JA 4I50B 4NWTL 4UT7L 4ZDHB 1ASOA 1MWOA 3AQXA 1YRKA 3BWUF 1EUTA 4OZGA 2WNWA 2X4UA 5GISH 2L6LA 3T6WA 2E46A 1QUPA 4DH2A 2Z0AA 2AZ0A 3ZDZB 3KDPB 3G6JB 3CHQA 2CTPA 3RL1B 2BRRL 4C7UA 5D5MA 3PYCA 2AV1B 4TSCL 1GTNA 3C3TA 3R65A 4HETA 5HVWA 1YHPA 5F9JA 1IM9D 2I07A 4PJ5B 2YRBA 3EJZD 3GLAA 3K8MA 4ZMTA 1F4HA 1K8DA 4DHLA 4XODA 3A23A 4JO8A 4LCIH 4JYBA 3PN1A 2A6DA 2EKSB 2E9IA 5LCVH 2YRLA 3VGAB 3PGFL 3VWJC 5EFIA 2YD7A 1JGLL 3F6IA 1MCLA 3GFUA 4HD9A 5DEDA 1NUFA 1U41A 2ITFA 5JZ7C 1IVLA 1V3LA 2HJFA 4P2OB 5DJZA 3UZQB 4HJ0D 1F90H 4AEHL 3ARFD 3CC2V 1G6RL 5IHUH 2K7PA 4BUHA 2MKWA 4HX1B 3BH9A 4RRPG 5F3HB 1JK9B 1FHNA 3FONB 4P23A 3D5OF 3LZNA 3P1VA 3QUKA 3MNMA 4P46D 3IDGB 4PJBB 4HAFA 1T22A 4ECNA 1QRNE 1DQTA 1XQ8A 4HEME 4M9OA 1JNHB 3HS0B 2X6CA 5E5LA 4I18C 4YSTA 1FF5A 3RBGA 2XPGB 4KUZL 2KQMA 2WPGA 5DRXA 3OR6B 4JRYA 4OF0A 1A4KB 4A6YH 1R5WA 5LP6B 3HS8A 4HCRL 3I9IA 3QO5A 3BDYH 4XC3L 1FBIH 2K6WA 3AY4C 5CCJA 3MXVH 4XNYL 1AQDA 2NQDA 3OHMB 1VHPA 4HKJA 1ADQL 3G08A 2OZ4L 3IDIB 2X4RB 2XWRA 1PG7L 2B9AA 3SKNA 4XT1C 1KIQA 2B3RA 2P8LA 2H5UA 3OSKA 1A14H 1U8QB 2G3MA 2IQ9H 2Q0OC 3GLZA 4LHUD 3UJJH 2KS0A 2YQBA 4BXSV 1QSEB 3K08A 1W0VB 1T1ZA 2VDNL 3RKPA 5LMNO 5T3XL 4G5AA 3NJGA 4DJMA 5SWZE 4H44B 4WFHA 4HG4J 3HTLX 2X70B 1TU2B 3ZX1A 3B43A 2PCFA 2Y4UA 4FM2A 1HIMH 3CFQA 4Q8BA 4L9LB 4DGYL 2XBTA 5CEZD 4KUZH 1VB9A 5T3XE 1XGRB 3AUWB 3KVDD 2AXGB 2A6IB 1KPUB 5FDWB 1C12A 1RUML 3MODL 5ALCL 3NCFB 2WKLA 2CDGB 1DQQB 4IBYA 5I1GH 2JI1A 1WC7B 3CPWU 2FO1A 1E28B 2D4FA 2EYSB 4M43L 3DJSA 4X6CB 3RNKA 3TZVA 4UOW1 4WHYG 4HYTB 5DEGB 4WV1C 4YDIL 3WELA 3C5SB 1YECL 4PRNA 4KP4A 2C4FU 2ADGB 1YEFH 1URIA 5DS2A 2BNUA 5HI4D 3L7EB 2NT0A 2FQGA 4HV8B 1MHEB 4D3CH 4YHLL 4UCRA 4NR1A 5SWQA 5A43C 1JFFA 4ZAKC 2FHBA 4N2AA 3RTQA 1EH9A 3CN3A 3L4CA 1S4IA 3MRIA 2B08A 5D7IA 2EDQA 2FVNA 5IV2A 4EEEA 1BVZA 4N90D 4RMVA 5KYUB 4P4KC 3OGCA 4KV5E 3RT3C 3APOA 1JE6A 2ZWLT 4NQTA 4PRHE 5JIKA 2E27H 2EZ0D 4KTGA 3VD3A 5L3GA 4HPYL 5B38G 3KLKA 3FU9A 4HIQA 4JAMB 4OJFH 4XP5H 4B9KC 2WXHA 1CFSB 3C5JB 5JOFB 1CD9B 2MRYA 2IADA 4X64B 4N6RB 3UPRA 2X1OA 3MQIA 2QBWA 3GXNA 5AALA 1KYAA 4YDJB 4KHPO 2ZINA 2UUDK 3MOQA 3U6RB 4ZPVB 5C0AA 2Z65C 5C0BA 4DZ8A 2I24N 4B3MB 3M7OA 4KRNA 1JVMA 5A16A 1HNWB 4HS6A 2OP4H 1SS3A 2DTSA 1AANA 3CS5A 4WWNA 3FB8A 3R8BB 3UO8B 4FM0A 1PL3A 2H6PB 1J5OH 4LLWA 1IX2A 3O3EA 1YY9C 1JGDA 2H3NB 3PWNA 1OW0C 1J5EB 3QIUD 4KTDL 1P4IH 3ZRCC 2AJYH 5DC2A 1Q38A 2IV9A 5TK4A 4Z7QE 3OKKB 4WTZA 4I4WB 4WBNA 1BBDH 1OCWH 2AEWA 3OC8A 1LDPH 1NOAA 3BZEA 2IMNA 2NW2B 5ESAA 4E9YA 4ZD3H 3WTWA 4RQQA 3MPCA 2DQUH 3WB1A 1FWXA 3SJVA 3MA9H 5JIPA 2VJXA 1EFXA 1NTMH 2XN9A 3C87A 4LE8A 4Y7MA 3BRCA 2V8LA 2BSKA 1AZVA 3BEVB 1I3RB 1TF4A 3QEUB 2IANA 2ZXCA 5IQ7H 4HWNA 2XQYA 3TJHC 3ZMUA 1ZANH 2ZX6A 2LOEA 5DZOA 5EZYB 1K6QL 1DF5A 1OAYH 1FNFA 1G4MA 3MLXH 1IC4H 3FU7A 3CC1A 1VIBA 3FU7B 5D7IF 4XN7A 3RDTA 2RFXA 3NSDA 3VBBA 2AJUH 4MYWB 4D8OA 4OUUA 1MW3A 4OAWA 4Z7OE 2RHEA 4PRAB 3RX5A 2HLDG 4FLTA 1RPKA 4NZFA 1C5DA 4Z8FL 4B3SB 4HWZA 4PW9A 4QOKA 5T5FH 5CBAA 4FULA 1IILE 5DK0A 2AI0L 4MCYB 5BY1A 3CSXA 2C7UA 2IDUA 4P59L 2YRPA 2GJZA 4GW5B 1H6EA 3WTYA 1X5IA 4XDJA 2PETA 3WHXA 3QWOB 4DIXA 5A2AA 3Q8AA 2BC4B 2HJKB 1ZKAA 3LVTA 3TVMB 3L70H 2I60H 2X10A 3O6FA 2NY3B 5D1ZC 3N27A 4L3EE 3VFRA 3ZK0A 5M7QA 1R4XA 2BSSA 1BZQK 5IB5A 1VFUA 2C9PA 1JR9A 3KPSD 4G8EA 2NR6A 1LUVA 2ROXA 4JKMA 4MAYC 4LOEA 1F4AA 1SQ2N 1KEGH 3QRFM 5E1AC 4X6DF 3FHEA 3B2VL 4WJG3 5DQJB 1QHPA 4DV5O 1VARA 4YHPB 3UTTE 1AI7A 2E7LA 5DLLA 2EVJA 5J1SC 1JZGA 4J7JA 3DA0A 2QLVB 3PL6D 1P5VA 3BFRA 4APQA 1XIWA 1OPGH 4PJEA 4ZT1A 1XBDA 3ALXA 4PEEA 4DN3H 3FDWA 1DP0A 3RIAK 3OMZA 3G7TA 3CMGA 1K34A 1H2SB 2WWMD 1BCIA 3UG5A 2X4PB 4BFIA 4KITB 5DJYB 1GC1H 1JPTL 2LLLA 3RWCA 5CA3A 1TQCB 1D9KC 1KBBA 3L1OL 4YUEL 3PWPD 4O4JA 2F15A 2W80C 3K81A 5FYLH 4QHPA 1L9PA 3FS9A 3PGDB 5DEFB 2HA1A 4KTYA 5JW5A 3S37H 2BX5A 1LO0H 3QJHA 3TOPA 1TJMA 3BE1H 2OI9B 5IMMB 2J1WA 3Q8BA 4HFUL 4LCUA 4YFLF 5L2JB 2A9BA 1XOUA 3QPKA 1XCQA 1RUKH 3WKPA 3B7SA 1VF6C 3EXAA 1G7LA 4LF4O 9CGTA 1S3KH 1M7DB 2HT2D 5C09E 2PWHA 1MQKH 3OKLB 2Q3ZA 3ZRFC 4UV9A 5D96B 2K3HA 5F7AA 3FB5A 3UC0H 4NO5B 1P4IL 1RZJC 1CGUA 2ATPA 2NY7L 4P3CL 1HINH 2AZUA 3WV0A 1VQMV 4A7QA 2D7TH 3MODH 3QUGA 1GC1L 1JPTH 2EC8A 4TNWK 4ZFOL 3T1CA 1JCVA 2CKBA 5LHIA 3LNGA 5IEHA 2YPKA 1SA0B 1HL8A 1S5IL 1VFAA 3GB7A 3N43F 5C3IA 1AO7D 1MI5B 2CWRA 2QPSA 2NZIA 2R0LL 2WQVA 3NCCB 2DWEB 4R3SB 1K3ZA 3KPNB 1S5JA 4AIEA 3KPNA 3VFMB 3N2KA 1KB5H 3VSUA 4GKKB 3NTCH 4P0DA 4PB9L 2BNRB 5BVPL 3BQUD 3HFML 3F85A 2DWXA 1T80A 5DJDA 1HU8A 2JF1A 3AZUA 5MEPB 4JG9A 4XWGL 2H3OA 5D7SH 3D9AL 4Y8AA 4HUUA 2VIRB 3FQWA 4A2GA 1IV8A 3F7RA 5CAYB 2PWGA 4QHKJ 3CFNA 2XWJB 4NO2A 2A06H 5GGRY 3E0GA 1OK0A 5EBLA 1BG1A 3BX7C 3QIWC 1YAIA 3UACA 3VDBA 3HG0A 2V6HA 1QUNA 3KJ6H 4U1MA 2YSSA 2JKIS 2EIBA 4YLCA 3T1YB 5T5FL 4PWHA 4NB5A 4PRPE 2BSRA 2ZCKH 5T1DH 4KZEL 2FH8A 2UXTA 4IDJL 4CVUA 3V4VB 1KGYE 3CFTA 4JI3O 1P4RA 5CB4A 2K78A 4MB3A 4DR7B 1XTMA 4NRZB 4PWJA 5JPMC 3K72A 2X89A 1HNXO 3CCHB 2F53B 3WB0A 1N7ML 4HMDA 3NIDB 3WNMA 1FYTA 5G5DA 2JKXA 3MV9D 1WBZB 1F4WH 1UPGA 1LNUA 1QFWL 4OI9A 1A1MA 3CZUB 1ITBB 1A1MB 5I28A 5IF0A 1OF2B 3HAEB 3WUZA 2ZCLL 1AHWC 4GMSL 4W9GC 4YNYA 1N5AA 4AWJC 4HSCX 4EN3A 1UB5B 3MZTA 4WW1B 1RH8A 1OAKL 4ZD3L 3RVWC 4CN6A 1XF3A 12E8H 3LAFA 1G5AA 4RVBA 2QSCL 1CFBA 4XNBA 3P0GB 1R73A 4APXA 3D06A 2E6JA 4X5XA 1OSEA 3B2UD 4FYSA 4MJHA 4AUUA 2VLRE 2XZQL 2R2HB 4S1SL 3MRHB 2XZQH 3GM0A 1SOKA 3UYRH 4JYYA 4IM8A 5GHWH 3OPZL 1ZVYA 5MERB 2FB4L 3S5LB 1RUAL 1Q0YH 3SQBB 4GKOA 1IGML 3VJ6B 4XP9H 3FO2B 2E7BA 3QA3A 2EEAA 3NZ8A 1OSZB 1L0QA 3SKMA 3U1PA 2VXUH 1MOEA 4BD4A 5HYJA 3CHSA 3CRMA 3ZHUA 1S5IH 3UC2A 5LGYA 1ODUA 4GW5A 3O8XA 2CA4A 1U8NB 4EI5D 1R3LB 3MBXL 3MX0A 5AVQB 5HHMD 4R2GB 4PV8B 1A6AB 3PDOA 2PYFB 1FNHA 4OD2B 4U1HA 1T0OA 2YFNA 2B4CL 3POHA 5TPWH 4KTEH 2VDLH 1I1AC 5L3CA 4KJPC 1AROP 1QEWA 2OJZH 5IHUL 2AF2A 1HXYA 2XG5B 2QDOA 1KXQA 4L9LC 4UDTB 1PU0A 2OXHA 3PWJA 1K6QH 1OAYL 4ZTPL 3O65A 2Q7YA 3H54A 3P4OA 4OVVA 4F57L 1RUPH 3M8OL 2P8MB 4MMXB 4NQDD 3BVVA 4Y8DC 2UZXA 5DFWH 3AACA 3DC0A 2UZXB 1H5BB 2AJ3B 3CFIC 3RHWF 2DYRB 4FMTA 3KEDA 4J5VA 2PZSA 2PTVA 3V0VA 3IF1B 1R9FA 3E83A 4U6HA 4NO3A 4WU5A 5IQ9A 1WTGT 4WTWA 1Y6NR 2N04A 3H1ZA 1IBLB 4LFHD 4HK3N 4PY8I 3QYNA 2VZTA 3UGUA 3TFKC 4QRTA 5AB1A 1QP1A 3FN3A 4O2EB 5C0FB 1F4YL 4OZHA 3UBXG 4W9DC 3B3BA 3SGIA 3K0DA 2WCPA 3HZKB 3Q5OA 5I2IA 1VGKA 4JPIB 4Y16C 1ITCA 1ZL8B 2CO2A 5GISL 4AH2B 4IRZH 3IGAC 4XP6L 4A5UB 3EFDH 3RLSA 5E2JA 1KWGA 2ICWJ 1NUNB 3MMEA 3QRGH 4RGND 4I1RA 5E6IA 3QJHB 3QK0A 2Q7NA 4HJJH 2VABB 3MJ9A 1LDSA 4LSRH 2VABA 2OYMA 2B59A 1RD6A 2J6EA 4Y0GA 2IH1A 5K93A 4LSRL 2V7QG 4W4NA 4JEGB 4YBHA 5B1CA 1A8ZA 2VDQL 1K8AW 1PQZA 4ZUVA 2QKIA 3OKLA 4UANA 2JKSA 3OR6A 3CLFH 3MJ9L 4Y4HC 4PBVC 1DLFL 2D3VA 1BAGA 3QBTB 3SE3C 3EJCA 4A6YB 3VX1A 5A1AA 1CYGA 3Q5TA 3QDMB 3MNVB 4FA6A 4MVUA 1KIQB 1VPOH 3FN9A 4OJYA 5BJTA 3US0A 1BVNP 3ZT5A 4YSSA 4WGVB 4Q9BA 5SWSB 3RURA 3U0WH 2DWTA 3AWGA 3N6YA 2F19H 2FEJA 4IRJC 3KPOA 5D4HA 1S9KC 1PEZA 3P2BA 4F5CE 4LPUA 2BY3A 3ROOA 1BEYL 4LL1A 4NZRL 3ATBA 5DMKA 1U8MB 3ULUH 1MCFA 3T2PA 1Z9MA 1CF1A 3FTGA 2OFQA 3VI3F 1ECZA 4PVLA 5EZLA 2IPKA 3IDXH 3MRPB 3CXHK 5EEYA 1SQVH 3TK1A 3KLAB 1AGBB 2V3DA 4JDTH 4NZDA 3M88A 5INCB 1XNRO 3G6AA 3AS0A 3E8UL 4KWUA 3Q6FA 4HS6B 1KWKA 5DS8B 3DXAD 1SY6L 4B08A 1GS8A 4OZGE 1TQBB 1S9XB 4BWWA 3PHOB 2EEFA 4FQCL 3PQYD 4CH6A 3VQXA 4AITA 4QT5A 1ZVSB 3MBED 5DQ9A 1AC0A 1KD1W 1G7IB 1VF5B 3W7UA 1FFXB 4S0SD 4R97C 1CU4L 2A9CA 3F7KA 5I76B 5ILTL 5FNVB 3FT9A 2UVEA 3GJEA 5FNVA 2VDPL 3SDYH 5DT1H 1DZBA 4YHNB 1MRDH 5ANHA 4GSRA 3JTTB 3HKDB 3DTUB 5E7BA 4DP7X 2HJFC 5F7MC 3D85D 4LFHG 4LSTL 1OAQL 4FLWA 1N8OE 2OL3B 5IM7B 3STLA 4YMPA 4G8GE 3DIVA 5D1QE 2AKRA 4AQAA 1HDMB 5LXTB 1IL1A 3A67L 1SQGA 4NQVA 5T33L 3CJHA 2OP4L 2Z92A 3EGSB 5DK2A 5KVFH 1UENA 4TUOA 5ANME 4HOWA 4CVZA 2F23A 2B20A 1UD4A 2X9ZA 4GXVL 4WFGD 3GBML 1IGTA 1ZTXE 5IT2H 3D39B 1UTDA 1BZ7B 1KN4L 1PFCA 2NDFA 3INOA 1F13A 3GK8L 1ORQA 2OX5B 3MRBB 3EJPA 4X99B 2FH6A 2YD5A 4IRSB 3P3NA 1XXFC 2BFVH 4R5VA 3SKJL 1OY3B 3VGAC 5F7HA 1A7OL 2CIKB 4EIZC 4F9LC 2IJKA 3NCJH 4ZO9A 1L9OA 1U36A 5IMKA 3M1CA 1JV5A 3ZMSA 5JH7B 4R9HA 2XX1A 5FHAL 5KYYB 1J5EO 1F3RB 3NRPA 3AG1C 4AHCA 3U0PB 3V55A 4PGDB 2X9XA 4QRRD 5GZOC 1H0DA 1JZDC 2APWA 3FKSG 1R46A 3GUTA 2JLPA 4QYOB 4QRUA 5EEUA 2WQ8A 1RJLB 5LDUA 1G6RH 1KLUA 1RJLA 3FT2A 1SF5A 2HP8A 2HFEB 4IMLB 4NM4H 4PGJA 2BOCA 2VXVH 3RU8H 4I0XA 5D7LD 3SY0B 4G8FA 4W4OA 1AQHA 2OBGA 2YPLB 1DYZA 2VLJE 3KCXA 2H6PA 3F04A 1RJZB 1CE6A 1T5WB 1HE7A 4ONHA 4B0MM 3QUHA 3FU6A 3RTLA 4ENED 4GZRB 1C16B 3LPFA 3LPPA 1T7WA 3JUZA 1IE4A 5CP7A 2YQ3A 1NCCH 3DO3A 3K6DA 2OQJA 2CAZC 5FOBB 1JWSA 4YIOA 5KJRH 2I07B 1MVFA 4OD1L 4R8WH 1JZ2A 1MRCH 2M8XA 4TPRH 4LSVL 5TGBA 4XR8C 2YMXL 1U3NA 4R7NB 5FAAA 5GSVA 3T0ED 5DJYA 3P73A 5DI8A 4AKOA 1U95A 4H25B 3ULUF 3RHWK 1A64A 3RIKA 1DJHA 1A9EB 5E1GA 4PJFB 2EEDA 1WWWX 2QFPA 3ZKSD 4XPAL 4YSOA 1NBQA 1FFOB 5GRVK 3RTQB 3NCMA 4FNTA 4OUUB 3ZVVA 5DTFB 5J1AB 4LXFA 5KSUB 4KO9A 1N64H 4HX1A 4YXHL 2ZOWA 4LSSL 1F00I 5LOVB 3BVXA 3DNKA 1J0YA 2XAGA 4FZ1A 4YFEA 1BIHA 3VXNA 3NRQA 4ZYKB 3OKEA 2VLKB 2XI9A 5FYKE 1ZWIB 2XVKA 5I6NA 4FNLL 1EAQA 2WBKA 3SJVE 4JG0H 5EN2A 3LNMB 1YEHL 2CPUA 4K94H 4K7PH 3JD0A 3TNMB 5DECA 2NY1C 2GFBB 2PYJA 1GJUA 4P2ZA 1JZIA 3BA8A 2J21A 1LQSR 4MJ4A 3MXWL 4AC2A 1FCCA 4PR5B 2Z5UA 5KYXA 5L8KB 4K5PA 3NZSA 3JWOL 1QBBA 2J1YA 2FTAA 2BS71 3B8SA 1UEMA 2V37A 3OT7A 3CC5B 4X5WA 4GRLA 4X5WB 4BQ6A 4LMQI 1NGPH 4IGGA 2XT1B 4HIEA 2ISDA 1Q9KA 3QZNA 3VFPB 4F57H 4XO4A 2JB6B 2AQNA 3ZHFA 2YXHA 43C9B 1B4TA 2H6OA 3NIGF 2F1EA 2D2CC 4CZZA 1IAIM 4LSQH 5CKGA 5AW5B 3QO7A 4E9TA 1BGYH 4PREA 3VFUB 5CEXB 4EUPH 3QUZC 4J3OF 1M9NA 4RBPK 1J9QA 3CXHJ 1CQKA 2WXJA 4BSJA 4HISA 5E9DA 5CCHE 1UM4H 5JHLA 4FZEH 1HXKA 4ZMAT 2ZAHA 5CEZL 1E6JL 5CCGE 5KZCD 5IW1B 3UAJA 2Y6SC 3LDEA 3Q3GB 3CGTA 3FC8A 3C6LA 3TV3L 5GJTL 4X4ZA 3RAJH 4D7BA 4P5TB 3PAVA 3VM5A 4P2CG 1IGJB 4LSPH 3P54A 3BEWB 4N5EC 1MW1A 4N0CC 4MCYA 2JXMA 1FZMB 2C7UB 3FU3A 4FFYA 1IAOA 1SDDA 1OAUL 4PJIB 4RA0C 2YC1B 3MLSL 5EBWA 2ICEC 4KK9D 3SYCA 3ASOB 4JR9L 1Q8MA 3GMPB 4L5FE 4X4MA 3GSQA 1CF8L 3BPOC 4X1KB 4GMTL 1HX0A 1IX9A 4IRJA 2XTAA 5LGHL 2Z8VC 1B9ZA 5C6WH 1AAJA 2XQBL 1COWG 3X17A 4JG1H 2CQVA 4UAHA 2ZX8A 2ZE0A 2VISB 1RMFH 4XAWH 5CO1A 5B4MC 1E5ZA 5BOPA 3BZFA 5D7LA 5DURB 2RACA 3HZMB 3KXFA 1G7JB 5IROC 2CDYA 3IKCB 3TF4A 4OPHA 1AY1H 3STBA 4NSKA 4Q58C 1T0NB 1T0NA 1G84A 1JPEA 1FZKA 1V55C 3SJQC 3JTTA 1L7IL 1SEBA 2NUPB 4M3KB 4AVJA 5DLMH 4XOBA 3X12A 4I9WA 4H8HA 4Z7IA 4L1LA 3OX8B 5AW6B 1MFEH 2XVBA 4BM7A 2XWTA 4C55A 3DXRB 2IH1C 3GBNL 4D9LH 2IDSA 3BMWA 2JKRM 4YVUA 3K74B 1CGXA 5GQBA 1XR8A 4RQFA 4KK8D 1XH1A 4J3UA 1MAKA 4ZBMA 4FYTA 3OC5A 4XPTH 3BW9A 4RGOH 3C5XA 2WCSA 1TZIA 1MVUB 1YJNV 1TCRB 1DQDL 4X4ME 4Y4FC 4ZS6D 5CKAA 1NC2D 2G5RA 3LRMA 1THAA 3INUH 3DUSA 3ULVH 4NQXA 4PJ0Z 3FB6B 3L13A 4HUVB 1N36O 3N5AA 3D3VB 2K70A 2A0LC 3FHQA 1ORQB 3VFWA 1OTUD 4YGAB 1ZS2A 4F7MA 4E36A 1PV0A 1G7HB 2EVFA 1LNQA 3BQUA 3CFBA 5TH2B 5DDHA 1QFPA 1XF5A 1DQKA 3KLSA 4NQCA 4GKNA 1WE5A 3LEYH 3C5ZB 1IM3B 3QIWD 3L17A 2VWKA 2C4XA 2V17H 3KCYA 2HTLD 4XWOD 1MPAH 3ARZA 3TO2A 2ARHA 3UCRA 5C0RH 5TE7H 5HHXH 4ZI7A 2BVPB 4KZ0A 4XRCA 2X4OA 4NXSA 3L08A 3JWDC 4XRCB 4G27B 3EO1A 5ABZA 4B9PA 5I71C 1AI1H 1WGVA 2PTMA 4GS7B 2BOCB 2GB2A 1NTDA 3LNEA 4JHAL 4S0TD 3L3DB 5IBTL 3ZGHA 3F00A 3K6NA 3OB8A 2ZICA 3T3MB 2H9GA 2WOBA 4X8JA 4GG6A 1XHHA 1YMHA 3FBQA 3X3FL 1ZHLB 2KH2B 1E4HA 2RQ8A 3NIDF 1T5WA 1CE6B 5ABAA 1I1AA 5LGJB 1A3ZA 1NGWA 1U8LB 5K59E 1EFRG 2XQ0A 4Z5RA 1BEYH 3IGKA 4E68A 5F1SA 2UUAB 3OAWA 3VRJA 2ZOKB 3CFKA 3G04A 4YNYB 3HW7A 2F19L 1NBMG 2NY4C 2A9DA 3EFFA 3K91A 1TVKB 1J8KA 3VFGH 3K58A 5JHDD 5LYJB 3N2KB 4B7LA 1TLMA 4B3RO 3CUPB 1I9JH 4Z9KB 3WEMA 3L81A 3QG5A 1QLEH 4NBZB 2G60L 1SXNA 2IFGA 2OTPA 4S1RH 5DSCB 4J42A 4OKVA 1DUYB 3H9SD 1QO3A 4XNMB 3F01A 1FGVL 2GIMA 2YC0A 3CVHA 3FT4A 1KELH 3WNNA 2A73A 2XFGB 3BUIA 5AYTA 4NXMB 1DQJB 3Q9QA 3BGMB 2NNAA 5K1XA 4NS0A 1AGFA 2WINA 2AITA 4I0PC 5ITFB 2QE7G 4ZYKA 4ZXBA 4U31A 1SY6A 1B2WL 5EBLB 5ETUA 1J8HA 4KAQH 3VGEA 4EZMA 5ETUB 2F43G 4G7VH 3BSHA 2J56A 2BVYA 3PABB 3KXFD 3L16A 4MGXA 3MUZ1 4PRHD 2VR9A 5JLZB 2J5LB 1G4YB 1OHHG 3DC5A 3I6SA 4LF6B 1AHWA 4FQXC 1FSKB 4GSQA 2ITDB 3QG6A 3IDMA 3GNML 4D6TH 1FNSH 3LN4A 4FABH 4C4UA 3GSXB 5DA0B 1BOGB 4DV4B 3KNBB 3T3ME 4LLQB 1DFBH 4YHIB 2COQA 4P2QB 1VQ6V 1FYTB 1BGXH 1WB8A 2ETWA 3T8VA 1JUFA 1RJYB 4PRBA 1I7ZB 1WT5C 3PDDA 4MHHI 3GT6A 3I9GL 1TFPA 1KCVH 4HWBL 5DZNA 1Q9OB 1AGDB 1RIVH 4JRYE 4P5KB 4UTAA 4XNZC 1SLVA 2W6IG 4NO3B 2R29L 3S3WA 3O3DA 5KVFE 3NYKA 5E5MA 1UQSA 1QR4A 3QDGA 1MZFA 1ID5I 4HJGA 3K5SA 2XQYG 5FGSA 3RWFA 4M8RA 5FYJU 2YN3A 3LNDA 1I1CA 1M53A 2ZE6A 3MFFA 4MZ2A 5EBLC 5IG7A 2ZKXA 1AI4A 3DYOA 5I1HL 3N1QC 5E8DL 1NEZA 3ULVE 1YYLL 3FB5B 5E9DD 1DSFL 1EVUA 2CCWA 3D34A 1CN4A 1RIUH 2QTVA 3E2EA 3HLKA 3LD8B 4WO0A 2C3WA 5AKRA 1Y0LB 4KQ4L 1QFHA 4RSVA 3RRQA 3O6ML 3ZSTA 3QUZD 4OGYH 3JARB 3LSSA 1CB4A 4P4RA 3MRNA 4JQVC 5GJSL 1F41A 4AVIA 4KO5A 3WENA 3BSZA 2PXYB 3H2PA 3MYJB 5DJXA 3ETDA 2P5EA 4L0YA 3DO4A 3VA6A 3H9VA 1SNRA 2PPEA 2X1WL 2XN9D 3IB4A 3NABH 4MJ5A 1NCAH 4F27A 5ISZB 1NT2B 2O26U 3QWOA 1OE2A 3HHSB 4NJ9H 3NG5A 5L2KE 4GMTH 1SXSA 1IGCH 2P5OA 4LPXA 3MX0B 5DD5L 5J56B 4Z95L 1WLHA 3IRPX 1CDBA 3O45B 2DYSC 3DMMC 1HILB 2X4SB 5KHHA 4LP5A 5CGYD 4AENA 3IMRA 4FQXD 5AVYB 1CD0A 3P4MB 1AC6A 4OLEA 4PGZA 1RK1A 1LLAA 3I9GH 1MCQA 4X9HA 4ZTOH 5FLUA 5I0WA 3D39A 1JCKA 3N40P 1KB9K 4AKQA 2XYCA 2V2TA 4I9QA 2K8MA 1KIRA 2QV2A 2XIIA 1VEMA 3FB5C 5F0JB 3RL1A 4JI3B 4NCC2 4DGIL 3SD2A 3H9ZA 1M2OA 3K7UA 1GCYA 3IWUA 3UTTA 3IJSA 3IJSB 1GSMA 4BZ1L 4U1MB 4KDVA 3WY1A 1LD9B 5AZ2H 4GBXA 2J72A 2F7PA 3IFLL 1P2CB 5TDOA 4EDXB 3JV6A 3H53A 4P2OD 4PBDA 1FJ1B 4K8RD 3R0MA 4BA0A 3IU3B 2HH0L 2BTOA 2R1YB 3WKNA 3QEQE 4LCWA 3SDXE 1P84F 3NSYA 15C8L 3TWCL 5FF6A 3VMPA 1EANA 5GJSH 1NFDA 2WWKO 5JXEA 1MHHB 3RZWA 3NA9L 4MCNA 4MD0A 1CFQA 1TNNA 3PHOA 4U1IB 4KVCH 4LBEC 3QXDA 2XNAB 2IG2H 1YEDB 4GKSB 4N1HB 2ZWNA 4X8CA 1YEDA 4GKSA 3VWKD 5HGAB 1RMFL 4XAWL 2B2XL 3MCKA 1JK8A 3MV11 4JFTA 2NOYA 2R9HD 1ES0A 3B2EE 3FO9A 4GT7A 2X7RB 2Q73A 2OQJB 4F2MA 3WFDL 2DQ0A 3NJNA 4MSWC 3LS5L 3IMSA 2R9AA 2PPDA 2KB1A 2OULB 1KLGB 4FI7A 4IHOA 4NC1E 1M56C 4HFWB 2CLVB 1TETL 5SX4I 3T77B 1O7VA 3RY6C 2DKSA 4MT8A 1QG3A 4X9BA 5D6CA 4M5YL 3WY4A 4MDJB 4MMZB 4KKNA 3W0WD 1KG0B 2YFOA 1WFIA 4Y2OB 1NDMA 1TFHA 3FFOA 5AVXB 4XCYA 1RULL 2EIDA 3DIFB 3IN0A 3S6CA 1A6PA 3OXSA 5D7EA 4A2DA 1VP7A 2FNBA 2AEPH 4POYA 3N42F 1M42A 3OBAA 4GBXD 3AU0A 5DHVA 2K0RA 4QRRA 3ZDXB 3VH8B 2XPYA 1G1YA 2JWYA 3G6JE 4NKDA 4PCKA 4HPOH 4UNIA 1BGXL 4X99A 5C0JB 4HCFA 3AK1A 2I32A 5GZOD 1TZGH 5I1DA 3D48R 2ZXWC 2YARA 4D9RE 4FFVC 5GGVH 5DVPA 3LH2H 4FQ1L 3U4KA 4N0FB 4TN9A 3L9BA 5BUPA 3U46B 1WUZA 5HJ3B 5CJ5A 4UINL 4YXLH 1A1NA 4O58L 3W39A 5JXAL 1IKFL 3TBTA 5BRQA 4M4PA 1VADA 4XOAA 5INDA 1D5BB 2PR9A 3BKCL 3LS4H 5I1EH 4DZ8B 2EAEA 5INCA 5E2UL 3US9A 3FYIB 4XP4L 2L0DA 4CVWA 1UT1A 4KI5F 3U4AA 4BCYA 2UUBB 4Z7UA 1YY9D 4FLYA 3HKFA 4RFOH 2CG9X 2VT0A 3BZ5A 3EO0B 2ILLA 2F1MA 1EGJL 1P7BA 2VN7A 3EDKA 3KPRE 3AG2C 1ZLEA 5F0LB 2DLFL 4XBFA 2CNZA 3OGIB 3SY6A 1TVHA 3VVWA 4TQEL 4C56D 4AC4A 3UAAA 4PJDF 3N0PB 3TH3T 3NDYE 3R8QA 2NY2D 5E2WH 1MIMH 4DCQA 2VN4A 2JQMA 4P4KA 4HV8A 3ZQXA 3P4NA 1OT1A 5DQDL 3GEFA 4IQHA 4GT0A 5IQLA 1SOSA 4X5LA 5A6LA 4IOFD 3G6JF 1N5YL 3QNXA 3B40A 4QCIA 4OT1H 4GKLA 5AKSA 2R70A 2WZ6A 2VO5A 4XBMA 4PWGA 5KBLA 2CJUL 3DX6B 1DZ0A 1AGEA 3L7FB 5AL8A 3IC9A 5ALBL 1IFGA 4G1EA 3NCWA 2WLLA 2NNFA 4ZMNA 1QLRB 1YPZF 1GGBH 1JDAA 5T3ZH 1GGCL 2GJZB 4DUXA 4MJ2A 2Q7AA 3FCGA 1LHZA 5C0BE 1BSMA 1MREH 2FDBP 3LRSA 2DYRC 2VDKH 3T1FB 4UB6Z 1F11B 2CBPA 4Z7UF 2DQHH 2LE9A 4OR1A 2JJTC 4ZFGL 1PL4A 2CHXA 4X6EB 3G9AB 2Q6AA 4NKMB 4XPBL 3QNZB 4AMXA 3JCZA 3UO1H 5HYSB 4JB9L 3SQBA 2VB5A 3U0ZA 4CH5A 3ZJAA 2AEOA 5HYSA 3BFOA 4HJUA 4WWKB 4WWOA 5HJBA 3IJYA 3ZO0A 4ZUWB 3HUJA 4OZGB 1N4CA 3B3IB 3S3DB 3BT0A 2Q7GA 3HJEA 1I4FB 3A6OA 4QTIL 5CHNB 3MRCB 5IROA 4Z7WA 3EDEA 1VAHA 2XQYK 3AREB 3CVHL 5DJCB 4ODSH 4UVCA 1S7WA 3ZZ1A 1S5HC 5DD5H 2XWEA 1KTRL 4LAQL 1UH4A 1T21B 3IRZA 3ROLA 3ZTCC 3KM2A 1BHBA 5F6HJ 1N33B 3T65A 1XR8B 2WQAA 4YZFF 5JYMA 3O0RH 5K69A 5JA8B 3PXLA 5FFGA 3R19A 4LNVA 1DL7H 4DNLA 2OCCC 2P7TC 1U8PB 4PJGA 2GSMB 3WL9B 4NQXB 5FV2A 3AQDA 1F56A 5GS2H 5IFJB 2FZ3A 1S5LZ 4Q74A 4XMWA 4RGMB 4P3DB 2ZIDA 1HWHB 1CCZA 1JF1A 1SOQA 1LP9E 3EUUA 1CC3A 1X9LA 3AQZA 2DQUL 3ZO9A 4P2AA 5EIVA 2QWOB 1JHTB 4TQHA 4YHOH 5IJKC 4I4TB 5EHFA 2LABA 1QW8A 1WIOA 1MCOH 3HUJE 4PJBA 3VVVA 4JI1B 5CN3A 3RZCD 1UWFA 1DF4A 4KFMA 5IMLA 3SJVD 25C8L 4I9XA 2R2BB 1E6OL 1OVZA 4LSTH 4YSPA 4Z7VB 3UBXA 3ESMA 1KGWA 2V8MA 4N24A 2DDQH 4GEIA 3MV7D 2D0HA 1YAZA 2OJEA 5KBMA 1BQLH 4E9SA 4X8JB 2NZ1A 3S36H 4MD4A 1OP4A 1TKWB 2QQQA 3X14A 3D0AA 1ILSA 4GAGL 4K3GA 3I50L 2AZAA 2ZQMA 5GGUB 3FXIC 3BUTA 4ANXA 2Z3FA 2YIBA 5B1AB 1GOGA 2TAAA 4X7SH 8CGTA 2ZE8A 2CMRL 4XMPH 2AW9A 1KV3A 5E8NB 5FM5O 4XMPL 5H37G 4HHAB 1NGXB 1E9PB 1OAZH 3EF7A 1YCSA 3B09A 2W9DL 2H0EA 4U1JA 3VXPA 5D4QA 4X4YA 1VGEH 5ADPH 5AOMA 4R97B 2Z7YA 3ZIAG 1LO5B 2KPNA 1F3DH 1F58L 3NSJA 1YNKH 3DVNB 4OCXH 5HTSA 1Y76B 4JFPB 4LP8A 4PJAA 3EFOA 3K0GA 4CN4A 2CO6A 1MG1A 4I9WD 4DGVL 5IYBO 1JWMB 4XNXL 1ACXA 5I6MA 1RM1C 3TXAA 2GEQA 2HUHA 3NH7H 4HKBA 4NJ9L 2P1YA 4PA4A 4EB6B 1QSFA 3JTBA 1M1XB 3QJRB 4IIJA 4JPSA 2ICWA 4QEGA 3ZHNA 1DSWA 3KLAA 1W0KG 5D7JC 1D5BA 5AZEL 2CKBL 2XRAL 1SMDA 2ZUVA 1NSNL 3WNLA 4I0PA 5ICXA 5AZEH 4LNUB 1O9WA 1TGOA 1N68A 4HC1H 3CIAA 1NFIA 2DWDB 4G6FB 1WN7A 1RJYA 1JX9A 3OD3A 1HP8A 3QIBA 4LVHB 2JB5L 4NEHB 1HKLH 4HWEL 1YITV 2I27N 2XA8L 5I76A 5BRZB 3GB7B 2MKLC 4A38A 4YIPA 5D55A 3V0EA 1BM7A 4DR4O 5GIRA 2CTRA 3SQOL 4AJYV 1GOFA 3N43B 2Y7LA 4HJGB 1CLYL 3ARRA 4W4OC 3KPRB 2JH2A 2GKIA 3N41B 3KBEA 3QC6X 3IDYC 2H3KA 4ODXB 4LF3A 2ETNA 1NEZB 5AB9A 2YUWA 2WSKA 3KL0A 5IB3A 3PWVA 1VMGA 3MJWA 3MRLB 2CHDA 4GG8A 3HBGA 1K3EA 4KV5F 1NKRA 2C3VA 4P5SA 4O9HH 2MTAA 2GBAA 5I1EL 3L4YA 4OUOA 2CO1A 3I84A 4NFBA 2B1HL 5FYKU 1OTTD 1DJIA 3VFWB 1XL6A 4Y4FB 1FNEA 1F3JB 4YWGL 3H6JA 4JGSA 5SV3A 3WXVL 3LNNA 3QDAA 3RY6A 2CIKA 1KPVB 2N4IA 2N7AA 4UINH 1B88A 1FVCB 2WXLA 1U8JA 4N5ED 1XEUA 3O11B 4PJ8C 1FYHB 1ORQC 4HC1A 4KK5C 1Z66A 3SD5A 1RURH 2YWZA 2D3OW 2BC4A 1QACA 4NQDE 4KAQL 1W0WB 3KPSB 3IC7A 4JY5L 4TUKL 4WUKH 5HGBA 5JHBA 2OCCB 1I1FA 2P7TB 2XV2A 3RVTD 3FB7B 5B66Z 3OEHG 4YBLB 5ID0B 3RA7L 4XVOA 1C5BL 3Q2VA 3WD5L 43CAB 4ZW5A 1AR5A 4BDVA 3JATA 1WZ1H 4IU2B 3JATB 4IU2A 2Y69B 2N1KA 5E2VH 5HYIA 4DR2B 5J3HD 4NNYA 3B3IA 2D9CA 2GYSA 2P8MA 4H44C 4MMXA 5KYWA 5IIEB 2G4GA 1JV2B 2HVKB 5IIEA 2FBJH 1D7FA 3AT0A 4ZO6A 3CAFA 1RY7B 4KTDH 5HI5C 4DR3B 1H2MA 4XBPA 5I5MA 1CR9L 3A47A 3G6DH 5IR1A 1XZWA 4WCYH 4ZJ9A 4H1LB 1QTYT 1ZPUA 3FQUB 2YJLA 4NCDA 4UXNA 2CHWA 4OU3A 4DGWC 1SBBA 2YC1A 4JUSA 5DI8B 2IWEA 3AM8A 5FPRA 3MNWA 4NJAH 3TJHD 3L9DA 4JPIA 1YJDC 1IEHA 2HWZL 2ZKWA 3MOBH 4N85A 3Q43A 1OGAB 4TNFA 2VMJA 4JFDE 4MQ7A 2PTTA 4FADA 5B3JF 1V8HA 4JK0D 4HJJL 4AQ1A 5E2UH 4Z76B 4ALAH 1AKJB 1NM4A 5AAMC 3PFUA 4QRSA 3UO3A 4EFEA 2P5EE 1AR4A 1UJ3C 4JYCA 2BSCA 4I3GA 4LEOA 1LO2L 3OLDA 2AJXH 3VM7A 2X0LA 1LP9B 4ZFZB 5TE7L 1A7NH 4AGQA 1OANA 1NANH 1JNHA 4QKTA 3C60C 5D1QB 1F4YH 2P5WE 4OZFA 2F4VO 3SGDH 2OMWA 4AY0A 1O6VA 4YDLB 2QVIA 3LV3A 1YC7A 5TQ2L 2A77L 1DBAL 3AWFA 4F37F 4KJPD 2KLTA 4QWWC 3DX8B 4IDJH 4P5TC 1E5AA 2YAFA 3JQOB 3SPVA 5D2LF 1SMAA 1IC1A 1AD9A 3DETD 1I82A 4L8SB 4WEMB 5KHKA 3EHBD 1VQPV 1FCGA 3ETQA 1MHPH 4JAAA 2OMVA 2E6QA 3FUIA 4GAJH 5CSZB 4FIPC 4AL8C 5LQBH 3K2UL 3LNFA 4D9QE 1R6KA 1DQDH 2OXHB 3PWJB 3OSVA 4GRLB 4M5YH 4NB7A 3D0LA 4ONFH 4DK0A 5DUML 2DY2A 1AG0A 3DI2B 3RFZA 1SJXA 3EADA 4YDVA 2EDLA 1WP7A 4IKNA 1P7QB 3BQUB 1FC1A 4R3SA 5I1CH 2WK2A 1BZKA 2IJ0C 1HK6A 3IFPA 3BA9A 3G71V 4ZPTB 2OMUA 6PAZA 2EDMA 3KYKL 4G3YH 1P7QD 1RFDH 3LH9A 5EIIA 1EO8H 5CIPB 3C6SA 3U9PH 1GH6A 1WAAE 1YNTB 4GG6F 4HQQL 2C1PB 1IQDB 2GPZA 2HT4C 4TF4A 2QHLA 4YBQC 1RIUL 1XGRA 3QZMA 1II4E 4JHWH 4FERA 2ATPB 1N64L 4DP0X 1KC5L 3UIZA 2FWSA 2HVJA 4JFWA 4ASUG 2MHAB 3BHPA 1YMHB 4ZX5A 2WBJD 3LZRA 1WICA 3CFDA 4Q52A 1I7RA 4X0KB 1XR9A 3BHBB 4FOMA 2VUOA 2UY6B 4M7KH 3JARA 3KJ4B 5GZND 1F4XL 2EO7A 2CLRB 3DDGA 1QUNB 2OCHA 1E7UA 2QGCA 3MREA 4YFLI 1OAUH 3HBQA 3VD4A 2YAOA 5FKAB 2C9XA 1TJIH 3FUFA 5IVZA 2XG4B 1DBBH 4LRIA 4L48A 1EXGA 2VAAB 1T1WB 1KCSL 3T77A 2F5BH 1EJ8A 2ZAGA 3PHQA 3EJSA 1NGQH 1G4RA 1SXZA 2QQKL 4MNQB 4N1EA 4OGXH 2G0LA 4XP4H 5FUZH 5LBSL 3KL5A 1FZOB 3NIDE 2XU9A 2F5BL 3EH4B 4KI5C 4Z3GA 3OKNA 5B1BB 4ANVA 1B3IA 5C08B 4LIQL 4LNUA 2NY2C 2C3HA 3HI6L 3QZOA 5F0PB 3IU4H 3B9VA 1GPOH 1Z1WA 3TO4B 2YXLA 2KYIA 3MV8E 4KO7A 3M7MX 3WFBH 5D7KE 4NO0D 4BIUA 3V4VH 1IFRA 2ALWA 3M6DA 3MGTB 4R7XA 4MS2A 3DVGA 4M6AA 5J12B 1ZSPA 2ARJB 4IMKA 2YD8A 4TYUA 2YGNA 3QHFH 1NMAL 2LHAA 3V4UL 1D5MB 2XTJB 3TVMC 5FPOA 4CSZA 2HVJC 3OX8A 5FW6A 3P3UA 4LAJH 1AZBA 3C2AL 3QUMA 1Z5WA 2VQ1B 4L3FA 5EO1B 2DOSA 5MHSE 1P2CA 2C3GA 3H42H 4ACTA 4DOHE 2AGAA 4JKNA 2C9RA 4UV4L 2WZPD 4JZNB 4HP5A 5E1AB 2R1YA 2MQCA 2XDHA 4YHYC 4NUJA 5C0EA 1N2RA 3VD5A 2ATKB 5E8DH 1BL8A 3T0EE 3F7PC 1WZLA 3ARDD 3NEOA 4G11A 4KI5E 3SKMB 4HLZG 4QO1B 1MWAA 1OP3H 1NZ6A 2J25A 1H9VA 3NCYP 4HEPA 5I0YA 4RGNB 3S97C 3X11B 3DPDA 3KPRD 3A67H 5GTHZ 2G9KA 3FFCD 4N0UE 4P9ML 4PJBF 5TJWK 2GHWB 2W92A 2EDOA 3WXVH 3S88H 3FQTA 1V10A 2QADD 4MA3A 3HZYA 2OMBA 4S1DC 4DW2L 4KBPA 3WN6A 4EQ3A 3WFEH 4XMLH 4OCXL 2BZDA 4JASA 1HNGA 1XGYH 2ITCC 1OD7A 2P46B 2VJ0A 2W38A 3STZC 4X7CC 5BZWB 2BXYA 4DP5X 4KK5D 3K59A 2AXFA 3O81A 1ROCA 3JT2A 3IFNH 4U2ZA 3OL2A 1OB1B 1IM3D 3BO8A 1JGVH 2QLYA 4BZYA 5IJVB 3SPIA 3K06A 2ORBH 4XP6H 5TTRA 3QJQB 1F4WL 5I6KA 2XWBB 4KX7A 4F8NA 5D1XD 3WFZA 5CR8A 4LVEA 1H9DA 3QXWA 4YDMA 4GRWE 3I6LE 1U97A 5JNYA 1MRCL 2AP2A 3D1MC 4TPRL 4D9RD 1Z9LA 4F8QA 1ZDQA 2B1IA 4RMSA 3AB0B 4KFZC 1EAOA 1N70A 4UMSA 4PB0L 5AOLA 2P48B 4NN7B 1EO5A 3SGKA 5BRZD 3JV4A 3U0PA 5C0GB 1NLDL 1OV8A 2CBOA 2HJKA 2HWZH 2YXYA 4N8VA 4XPFL 3UTSA 5I8OL 5L7XL 1H3PH 3A4AA 2LT9A 5KJ4A 4ELMA 1Q8IA 2WUCH 4NM8H 4ANWA 1QO3B 4XNMA 3NCBB 1IKNC 1Q0XH 4FQIH 4GRLC 2X9WA 4RBPH 1J12A 2CJTA 3BE1L 4U0RC 3L2NA 4OCLC 3PS6A 1Q3EA 4Z7UE 3KWTA 4OF5A 3OVUB 3C09B 4UQ9A 1K33A 4NENB 3ZIYA 3BPZA 5KBKA 3WTSA 5FWQA 4MVMA 2DKMA 3CPLA 3V5DB 1MDTA 5HYJD 1PIGA 4L4VB 5DWUH 1A7RH 1WWCA 2E56A 4UWQB 2QT6A 5FLXN 1TJXA 3TBWB 4DO2A 2KKWA 1CICC 2HRLA 4FTVD 4B9CA 1S7WB 2CXKA 3TN0B 3J80N 3D69A 4G7YH 4HKXB 1WZMA 4PJEB 1J0KA 3LKSB 5CZXD 3K04A 5EZJB 4AYBA 1A32A 1W91A 1M05A 2RALA 3DX8A 3BLKA 4BH8B 4DUYO 2P80D 1JL8A 4OFDA 4TOYH 3MLZL 4N2IA 4PTUA 3MACH 1KENL 3FUMA 3X3FH 2GJ6B 5CCKL 4LLQA 4HGKC 5KHJA 4CUCA 3JWDH 4PVBA 4LLVA 2W60B 1ZA6B 2E27L 3OXRB 5AWNH 4BK5C 4N2LA 5KS9E 4CH3A 3CYOA 2AANA 1CFMA 1FIGL 1RZGB 4XPHH 5H35B 3M99B 3QUZA 5HPMA 1YG9A 4GJTB 2HJDA 1AGDA 2R29H 3EBGA 2EBOA 4D7SA 2BK8A 3VU1A 5L2JA 1E8WA 1MCBA 2XIBA 2BIMA 1XMQB 3JXAA 4ZS7H 1BPLB 2YEQA 4K71C 1HI6B 3IAYA 1KJMB 3K80A 4QDGA 3RYFA 1KJMA 4Y19D 2OMXB 4HCGA 3A4DA 1INQB 3CVDA 3DOSA 1FUNA 4O51B 5EOQH 2L8AA 1WAPA 4NQDB 2VN5A 4U1SB 1YNTA 3OR7C 5E4OA 3A0RA 1P4LB 2GSGA 5ANMA 4CVXB 4Q9RL 1ACZA 4WK0B 2IAMD 1FVEB 1BQ5A 3DIFA 1QQCA 4FGMA 5D7HA 3UYPA 3HC4H 3RGHA 4BXVA 4X0KA 3HZMA 4EKXA 1FXKC 5F88B 5SWSA 5EC1A 3MRIB 2XTJC 2OJZL 1X5HA 4KX9A 3QCTH 2P5EB 1S7SA 4MVRA 2WWWA 5TE6H 2XIDA 1RSFA 1FZKB 2YD1A 4R96A 3TBYB 3UCQA 1LTXA 1CXHA 1A47A 5LXVA 4E9LA 4FEMA 3KPRA 1NGXA 5FYLD 1AY1L 2OJ1A 4RZKA 5C8YB 4F33B 3MA9L 2BNRA 3VCLA 1UXWB 2UWEF 3E8GA 3BIBX 3FL7A 2O57A 1UUNA 1TJHL 1TQWA 5K9JL 1VEWA 4DV2B 2E76C 2QQKH 3SKNB 1LEGB 1XCTB 3BFQG 3EJJX 4WFFE 2DQFA 1PD6A 2R27A 4M6NH 1J5HA 1E4WH 3HKCB