2EIKB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eikB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eikB02
3TU6A 1WS8A 3V9EA 1TEGA 2WSDA 5I5MA 4AZUA 2XX1A 3EHBB 2IDTA 5F7AA 1BEXA 1HAUA 3TA4D 1E65A 4Q89A 1OE2A 1RZPA 3T6WA 1AIZA 2JKWA 3NT0A 1A4AA 1YLBB 3NJHA 4PAZA 2AZUA 4YSCA 3CVCA 1PF3A 3FU9A 3QJVB 2PPCA 3EH3B 3UABA 1AZUA 2DWSA 3EH4B 1BQ5A 1OV8A 1N70A 4MFHA 1KCBA 4A2EA 4YSDA 4YSOA 1AZNA 3FPYA 9PCYA 2PPEA 2BW5A 4F2FA 1M57B 1JZHA 1OE1A 4HALA 3BVDB 2E86A 1JOIA 2GBAA 3CVBA 3KW7A 5FC9A 3OM3B 2VSMB 4M4RB 1AOZA 1GS6X 4GP8B 2BWIA 2AVFA 4KNTA 3IE9A 3T71A 4GP5B 3FYIB 1A65A 1JXFA 2YAOA 1JVOA 3NYKA 3T6ZA 2WO3B 1ZIAA 4DP4X 4KOCA 5E9NA 1BXVA 1UATA 3QJRB 1XMEB 2PPAA 1ASQA 3CDZB 4WKXA 3GXUB 5I6OA 4Q8BA 1I53A 3DKHA 6PCYA 1JZJA 2B08A 4KOBA 2BZCA 4KO5A 4BXVA 3OMIB 2XWZA 2H3XC 2BW4A 2Q5BA 2GI0A 4CSPA 1CYXA 5F7BA 4N4YB 1W8EA 4P5SA 2CJ3A 1FFTB 2J57A 5B1JC 1OCOB 2FQFA 1CURA 1ZPUA 3ERXA 1NIDA 1HFUA 1DYZA 4G72B 2FWLB 1CYWA 3PCYA 2UXVA 2RACA 4KO6A 1L9PA 3FQYA 1V54B 1A4BA 2QPEB 1NIFA 2HRHA 1BYPA 3FS9A 4YSTA 4QKTA 4UF7C 4FAAB 1T5KA 2IDSA 4DP0X 3NJFA 2PP8A 1JXGA 1MZZA 5LDUA 2HRGA 1CC3A 2OJ1A 3NSCA 4BDVB 4YVNA 3CZUB 7PAZA 3ZDWA 2DYRB 3NSFA 7PCYA 4KNSA 3FU8A 3PXLA 3OMNB 1PY0A 3FU7B 3H4HA 3WI9A 2DY2A 4A2HA 1JZEA 3FSVA 1KBVA 1ZV2A 2H47C 3SQRA 4A68A 2CALA 4BDVA 2PPDA 2MRYA 1NDTA 1NIBA 1NIAA 3OMAB 2QPDB 4YL4A 1X9RA 4ZK8A 4HCFA 3FSZA 1SNRA 3X1FA 1KBWA 2YAPA 2Y69B 1AZRA 5B7MA 1OE3A 5TK2A 8PAZA 3PAZA 1SJMA 1E5ZA 2BP0A 4YVUA 1J5CA 4GP4B 2J56A 3ABLB 1WA2X 3UGEA 1GY2A 3CVDA 2P80D 2VW4A 2BO0A 4KO7A 1L9QA 5TK4A 2BP8A 1PLAA 1ILSA 4RH4A 1URIA 2IDUA 2X88A 4NERA 3WNJA 2XV0A 1AS7A 3PAVA 1J5DA 2VSKB 4DP8X 3X1GA 3QQXA 4E9WA 1TU2A 3EF4A 1AG0A 2OV0A 2DV6A 4YSQA 3DIVA 3QPKA 4YSSA 1AAJA 1QNIA 3S8FB 5B1BB 1AG6A 4YSPA 1MG3C 3WNIA 1AS6A 1FWXA 1WA1X 5B1AB 2MTAA 3H4FA 1JERA 1BQKA 1JZIA 4G70B 4P5RA 2FJSA 2WO2B 3IN0A 3AG4B 1NWPA 1A3ZA 1PZAA 1PNCA 3WKQA 4N8UA 2ZOOA 1M9WA 2PPFA 2I85A 2XV3A 2UX6A 4HCGA 1QLEB 1V55B 1PNDA 1AACA 4EF3A 3CDZA 1KGYE 3NSYA 2Q9OA 3NJLA 4HCIA 4A2DA 2P80A 1JXDA 2UX7A 2BP8B 3IEAA 2XUWA 3PPSA 1CUOA 1PLCA 2W88A 5B1JA 3TBBA 2AANA 1NWOA 1XB8A 4BWTA 1VLXA 4A66A 1EHKB 2EILB 2I7OA 3GDCA 1AZBA 1TEFA 2R7EA 1GY1A 2VW6A 3N55A 2FQGA 3X1EA 4ENZA 2XLLA 3AZUA 1PMYA 1NIEA 3EH5B 1GS8A 2XU9A 2YEVB 2FT8A 2VMJA 5I28A 1JZFA 1FA4A 1NTDA 4E9XA 2HX7A 3T9WA 2J55A 5IY5B 4NB7A 3SBRA 1SDDB 1ADWA 3FU7A 4E9RA 1BXAA 1N68A 4GXFA 3TASA 4YSUA 5B7FA 4BXSV 2QDWA 2TSBA 1IBZA 1AS8A 1BYOA 2W8CA 3NSDA 4BWUA 4F7KA 3D12B 2HXAA 4E9YA 3NJMA 2YXVA 2YXWA 1IC0A 4GYBA 3PAUA 1OOWA 1WAEA 1E30A 1EZLA 1L9TA 3AG2B 1PCSA 3FQ1A 2AFNA 3WIAA 2B3IA 2DWTA 2XVBA 2EIKB 1A4CA 1W6WA 5I6PA 2XYBA 1BAWA 3FT0A 1NPNA 3U25A 3ABMB 3WG7B 4HHGA 4A67A 3UAAA 2GIMA 5D4JA 4E9SA 1L9OA 2HX8A 1MG2C 4DP6X 3ASOB 2YAFA 4UAHA 1NINA 4W9ZA 2EIJB 1BXUA 1KDJA 2JFCA 1X9UA 2PCYA 3ZBMA 2FNWA 4F2EA 1WS7A 2DYSB 1NICA 3C75A 2J5WA 4DPAX 1ILUA 1ET5A 1JVLA 1SFDA 2A3TA 1AZCA 1J9QA 4AKOA 3L45A 1GR7A 3FSWA 3UACA 1NPJA 3ASNB 4YSRA 1A8ZA 1WA0X 4DP7X 2XX0A 3ABGA 1KDIA 3FQ2A 2BZ7A 2EINB 1XB6A 1ZDQA 1ASPA 3AW5A 3FYEB 5I6MA 4E9VA 6PAZA 2OCCB 4A2FA 1ETJA 1GSKA 5D4IA 2HLEB 2VN3A 4HHWA 2UXFA 1ID2A 2FQEA 2PP9A 3NJGA 1AQ8A 2CCWA 2IH9A 4JHUA 3V9CA 2ZONA 4G71B 4K9JA 4PCYA 2FT7A 1R1CA 3ABKB 1JZGA 2BWDA 2GB2A 2YAMA 3SBQA 2GC7C 1SHWA 2YAHA 3NJIA 4G7QB 1KCWA 3NP4A 1DZ0A 2VW7A 2XXGA 1OF0A 1MZYA 1ZDSA 2R7EB 3NJJA 3HB3B 3QJQB 1SF3A 3MBWB 4YSEA 2FQDA 1OCRB 5ANHA 1GW0A 3OQRA 3G5WA 4G7SB 4AI7A 2UXTA 3AY2A 2IH8A 2YAEA 2XXFA 3S3DB 3X1BA 2HZHA 4L0PB 1V10A 4NAJA 2I7SA 2VM4A 3IN2A 1HAWA 4DP5X 4BWWA 5PAZA 2GSMB 1E5YA 2IDQA 1RZQA 3IBOA 1AANA 4X4KA 2YAQA 4DPBX 4BK5C 1ZIBA 2HX9A 1BQRA 1RCYA 2LLNA 2XV2A 3CG8A 1IBYA 2EIMB 1XB3A 1KV7A 4DP1X 4DPCX 1SF5A 2IWEA 2GHZA 1ET7A 3QJTB 2FT6A 5AZUA 2CBPA 4JHVA 1W6LA 3S3CB 4AX3A 2QDVA 1GS7A 3QJSB 4M3HA 1J9TA 1F56A 1SHXA 3HEIB 3FSAA 4AKPA 5D4HA 2Y1AA 5EHFA 1B3IA 3SBPA 3S3BB 1PZBA 3H56A 2FTAA 1GYCA 1RKRA 1E67A 5A7EA 1KYAA 4E9QA 4W1TA 3UAEA 1SDDA 2PCFA 2ZWNA 3JT2A 2N0MA 1TKWA 2BP0B 5B7EA 4QLWA 3JTBA 5PCYA 5AFAA 4UANA 3RYMA 2AZAA 5I6KA 1PLBA 1IKOP 2NRDA 3PLYA 2IAAC 1ASOA 3AG3B 2X87A 2H5UA 4WTQA 5I5IA 4G7RB 5I6LA 5B1KA 5B3SB 2ZXWB 1ET8A 2PLTA 1L9SA 5I5JA 4A2GA 3NP3A 2YARA 5I6NA 1OCZB 3T6XA 1PAZA 2CUAA 3ZIYA 1PZCA 1OCCB 4KNUA 3WKPA 3FPXA 5I26A 3X1NA 4AKQA 3TBCA 2VM3A 5AKRA 4DP9X 1J9RA 2JXMA 3AG1B 1IUZA 4FA7B 3QJUB 2QT6A 2UXGA 4GY4A 4JKNA 3NJKA 1L9RA 1NZRA 4HIPA 1QHQA 2YQBA 3MX0B 2CAKA 4TXVB 3BQVA 2TSAA 3UADA 3X2QB 3OD3A 1MDAA 3NJNA 1AR1B 4HAKA 4DP2X 3ZX1A 3KW8A 2IWKA 2BHFA 2PP7A 4KO9A 2IWFA 3DTUB 4CSZA 3GYRA 1SFHA 1M56B 1J9SA 3N2JA 4YSAA 4HZ1A 3S8GB 2IDFA 4E9TA 2GC4C 3T6VA
chains in the Genus database with same CATH superfamily
2OR7A 3DX6A 4FM2A 4IKIA 2FBOJ 5K39B 2XA8H 1SN2A 3EHBB 5F7AA 1HAUA 4N0CD 2Z3YA 3H42L 4PIBA 4BQBA 3T6WA 2B5IC 1NLDH 1A4AA 4YJ2B 2Q7NA 4QIWF 3KJ4C 2NSXA 4HUUA 4E5XA 3MHZA 2XWTA 4M7ZC 5IEKB 5LYJA 2X1QA 1ZLDA 3D25A 2DWSA 4MA3B 3EDJA 2DJ4A 4FLRA 1VB9A 4X4XA 4X5WA 2BVQA 3TXQA 1OCRC 2ZUXA 3C5JA 5IJDC 4Z7UE 2UXXA 2OR9H 3L3DA 2ZM6O 3IXTB 2X5PA 1GM7A 3DX8A 3EJZC 1A7PH 4TUUA 5FUOL 1JVMA 3PABA 4XR8C 1BMFG 5EULV 2GUYA 3EJPA 4NWUH 5FHBL 4WSGA 3OR7B 4OLXL 4ANKA 1JF6A 2HFGL 1HWWA 5ESVB 2R1XB 4WW2F 4HG4K 3OPZH 4EN3D 3GNML 3AROA 1N0XH 4U7MA 2O5YH 2HHHO 5CBFA 4GP5B 3RU8H 2VDPL 4OKVA 4GSRA 1P1ZA 2CTRA 2R1XA 4TYUA 3UOAB 3QQ9D 3ZL2A 3ZN6A 3SJVA 4X0KB 1S9XB 1MCNA 1HKLL 1S7SB 2WGNB 1M57C 3M17B 4ZFZA 1CICB 3CQFA 3HVNA 3M6DA 5AQ0A 2KERA 1ETA1 2DQJH 2NW3B 3APNA 3PP3H 4JFPB 1OOAA 5C09D 4QRFA 3OSVA 3OKMA 4X1KA 2V2WA 3BIKA 5GS0H 3ULVE 1DQDL 2IGTA 4LOFA 3OGIB 1ORQB 1I8KA 1VJSA 4MA7L 4PS4L 4GYCB 4IRZA 5DD6A 2VLJE 1MJ8H 5GJTL 3V0WH 5EC2C 2WKOF 4O2BB 4LVOC 1J8HB 1KGJA 2IG2H 3S35X 2O61A 2Z8RA 1CGTA 1J7VR 2DPKA 5EV7A 4ZG1A 3VFNB 1OSEA 4KY1H 4IGBB 1F2XK 1NH6A 1GGBL 1ZPUA 4LLWA 4WHTA 5FW6A 4FZ1A 4F7CB 2HYMA 3FAVA 4O2BA 1T5EA 4FRWA 5CBEA 3TBTA 5GW7A 1MHPL 5EIQA 2EILC 3MV9B 4GRMB 3T8XB 4IL6Z 3GUTB 3VRLE 1SEQL 1ZVSA 3FS9A 5FYJD 3TCLA 2L7EA 4DKEH 4GIPD 2EAEA 2NZ9D 4LSTH 1YAZA 1GOGA 2J8HA 3IJHA 3BY6A 1G1XB 2EINC 4NNXA 3UBXG 2X70A 1FBIH 3MV7D 2NR5A 1YYLH 1YI2V 2HT3C 1F41A 2F5BL 2BCKB 2OJ1A 4P5TC 4NQCB 4X9IA 4XMKL 1IL1A 4NN5C 5I18H 3M17A 4FLZA 3G9AB 1RZKC 5F2FA 3SJVB 3FRUB 4G8GB 4L8BB 3RVWD 1U8LB 3BSGA 4LARL 2NYYC 4P48A 4K23H 1TVDA 4YL4A 1ITBB 3HG0A 5AB1A 1KZQA 5EIIB 2A6DB 3F8UB 4S11A 3CFMA 1R75A 1L7TL 2D7QA 3P0GB 4IBSA 4TF4A 4IIJB 5TK2A 5CEXA 3CVHA 1SESA 3MOQA 4K8XA 3N2GB 2OZNA 2NY6D 4Z3HA 4L29A 4LRIA 4MS2A 1N2RA 2X9YA 3G6JA 3BAYA 1BZOA 2H1PH 4MXVF 3N1MC 1Q82W 2Q86A 5CZXC 4OX9B 3TETA 2ZCLL 1OM9A 4J42A 3H0TA 5IP4A 3WLWC 3UPAA 1E2ZA 3OR7C 3G6EV 1DEDA 1KIUA 2G60L 3K04A 3PXJA 4V1DA 2H7WA 3MNMA 3BP4B 1T0OA 4PRNA 2ZPKH 4W70A 2D3LA 2IAND 2R9HD 3L4VA 4IW4C 3AU1A 4LCIL 2W95A 1HXYA 3VGHA 2B1HH 5IDJA 1J5IA 2E7HA 5GS1C 2ZCEA 4MQ7A 4ONFH 1ZWIB 4QJ5B 5JIPA 3RX8A 3B6SB 3P4MB 2C3VB 4K07A 1ZXQA 4X6DF 3MROA 5FUCC 4DESA 2EBOA 1SY6L 2IPUK 4I7ZB 1B0GB 4HUMB 2CHDA 4JE4B 1S9KC 4FN0A 5JXAL 1BX2B 4Z8FL 1OGAB 2XXCB 5E4OA 1IARB 4HIHA 4Q9QH 3CCHB 1FV1B 1F00I 4JFWA 4WI0B 2UU9O 3BP6A 4PREB 4KKBC 3MRNA 2Z8WC 2QQKL 5CA0B 1UYWH 4HJTA 2YEZB 2MWCA 2VDMB 5LCVA 1CR9H 2QMKA 5T3ZD 3DC6A 3AY4C 5L6YL 1JFHA 4XAWH 4DV6O 2OSXA 3K6IA 5B1JA 4PJCA 4J8RB 4M7JH 3TNNB 1NWOA 3DX4A 2EILB 1K4CA 1VZGA 4AY0A 2Y48A 3UBHA 3B9KC 1RMFH 4J2XA 3WLBB 5LUMA 1JGEB 4OD3L 5T5NF 2YS8A 1SERA 4PJCB 2ZNWA 1NIEA 4WF9V 3P30A 2OK0L 4GIOA 3GIZL 5F1IA 4MHHI 4B3MB 3D48R 3HB3C 3KPSA 1RJZB 4YIQB 2HX7A 4AWJC 4F8LA 4N85A 3R06A 1T66C 3DC5A 5K1NA 1BZ8A 1IQDA 3RWFA 1XTMA 3U7WL 1KIPB 1U96A 4XPTL 1DDHA 4H37A 3KEHA 1B6QA 2B9ZA 3EJCA 5AALA 3B83A 2CR3A 4K3DH 5T1MA 2DQ6A 3TO4A 5LGHL 2AJZB 3KPNB 2W8CA 4F7KA 2H0JA 2LFGA 2F95B 2E6JA 3A24A 4YGVA 5F6IC 4B9YA 3QEQE 4M61B 1Q72H 4XPBL 4XWOD 1DL7L 3OPUA 4HUXA 2Y5QA 3NGBB 2JKRM 2RMNA 4LSQH 2OXHA 2VDLB 3CMGA 1DBML 5LNDA 5T3ZE 1MF2L 1H8LA 3JARA 1T4WA 1W6WA 2YHGA 1JF1B 4WV1C 4MW3A 3W5MA 1QP1A 1NH2D 3QXAB 3DXAD 1UM4L 4B7EA 2Z92A 4TNWK 5HVHB 1ED3B 3D0VA 3R18A 2A2QT 2EX3A 2IGFH 4OFIA 4CS4A 1QRND 2C7UA 2DQIH 2YAFA 1WUZA 3AITA 1KDJA 1NL0H 2JB6A 4PI2A 1U95A 4PJHA 3RTQB 1IXBA 1OTSD 3B8YA 4NQED 2QA4V 2C9XA 3CCUV 5F3HB 3QCVL 3MTRA 1OO2A 4N2GA 2VAAA 1BBDH 3O8XC 3RWJA 1IM3A 1CLCA 1JYXA 2NW2B 1DVFA 4KX9A 1SFDA 3QW9A 4O4IB 3KHOA 1NTKH 1LE5B 2CR6A 4XP6H 2VDNL 1R3KC 3QUXA 4X7DC 5DZAA 2QDOA 4PA4A 1KN2L 1BFTA 2OX5A 2X4UB 1SXBA 2A9BA 5FGBA 1WA0X 2FUQA 1IURA 3ZDZB 4LNRB 1M7DA 3C5SB 4BD4A 3FT4A 3JXAA 5I1EL 5ESAA 3EOTH 4WWOA 1A1OB 3V6ZB 1NAMB 1XB6A 1HNGA 4W9LC 2PMZA 4E0RA 1CLOH 2G0KA 2VXUL 2ITEA 2K9UA 4YZWA 4A2FA 4EKJA 4M43L 2HR3A 3LNIA 5HHMB 3IJHB 5E94A 3A23A 3DV4B 5JQIB 1ZTXL 4TQDA 2P47B 2Q10A 3E8VA 1DJHA 3K1KC 5FHBH 1AXTH 1Q6HA 3FQRB 2YAMA 3TBTB 5CBEB 2WANA 3QUZC 4MJJA 4KXCA 2ZYSA 1KBKA 1PVHA 4JKPH 4M7KH 1T83A 1ZOXA 5G5DB 5TFSH 3U2SA 3PNWB 5HHNA 1AFVL 1EGJH 1G8MA 4FQCH 4A7SA 2WUCL 2LW3A 1DK1A 4Z3IA 2YI8A 4LSPL 1KLGB 2BS9A 3CTTA 3GHEH 5L3BA 4JTAB 2BIHA 3O4OB 4OQTA 5ENWB 3SKUD 3HS0C 3WFEH 4DGVL 3HUJA 43CAB 2P52A 1YNKL 1N3NA 1QI3A 1IC5H 4JW3A 2AAAA 4HC1H 2BOBC 1E6JL 1AMXA 3SPVB 3CLWA 2JJ1G 4MASA 2VM4A 1PPIA 3IETA 4LLDB 1HAWA 1KJMA 2AK1H 1S3KL 4ZFZB 3QXUA 2GSMB 1PZDA 2FJUB 5FWRA 4Q6GA 2LABA 4FFVD 5DJ2A 4L3FA 3UT5B 1Y18B 4DETA 4L3ED 5CJ8A 2E9JA 2ED9A 2BSDA 5C0IB 2O6FA 3WJMB 2ARWA 2C1PA 2ZJSL 2IPKA 3ZE0B 2EIMB 4FQJL 2NUPA 3U4KA 4HJEA 3N27A 3QFJD 1NCCL 3QG7L 3D9AL 1X44A 2EIKC 2R51A 4EMZA 4IS6B 3BSZL 1V3JA 5DYOA 2XASA 1YMHB 1YZBA 5B5EZ 3VI3E 2OR9L 4G9FD 2WTRB 3T8VA 2PYJA 3ET9F 3QG6A 2X7LA 4G8EB 3FU5A 1HIML 3C5JB 5E5UB 2WWWA 3T8MA 5B8CB 4PBDA 4Y2DA 1RVFL 3O11B 3KYKH 1MMMA 4JFEE 7TAAA 3VX1A 1KTDA 4IMLA 2Y2YA 1ROWA 1WT5A 1O6TA 2BCMA 4ZMPA 2UY7A 1BJMA 1U21A 2WWNA 3QTCA 4XNQB 3MYJB 1U8JB 2LU5A 2YD2A 1FSKC 4PJXB 2XN9A 2BWQA 4CH6A 1GGUA 1HWGB 2I07B 1MELA 4DGIL 4JKKA 4I0PA 5KAQF 4J41A 2EIZA 1DQLL 2ZUSA 4MDIA 5IFHL 4JS7A 1WIOA 3K9AA 4X6CF 5IW6A 3MO1A 5IR1B 2EKJA 4P9HC 1F6AB 3VMNA 1F1DA 3RBZA 4MQXC 3VI4E 3HRZA 3SJVD 3FKSG 2H5UA 1OPGL 5CN3A 1S2EA 2BHUA 4TSBL 3QYMA 3IAGC 1U8CA 4U7SA 1OAQL 4GX1A 5LBGA 4A2GA 4B5EA 5I6NA 2LGQA 5BQDA 4GJTB 3SGJC 1MY7A 4EOWL 2GW5A 4ZIBA 2R1WB 2MEJB 3O6FC 4OLZL 1FNEB 4GRLA 5D71L 5KWYC 4LP5A 4WCYH 4LF3A 4Y2DD 3M88A 2JXMA 3GRWA 4KITB 3LB6C 3OFNG 1HH9A 4PV9B 1BREA 4OCWH 4OLEA 1BQ0A 1OAKH 1JMZA 3FUIA 4YPGB 1JGUL 4H1LB 2C1OA 2P7TB 4HKJB 2KQXA 2FL4A 5I9QB 5JPNC 3EW3B 1TT6A 3B2PA 4W9DC 2XETA 4FYTA 3C60C 5D93B 3PDDA 5FLVA 1MHEA 1ZVHA 4NUGH 4ACTA 3GZPA 1FPTL 5L2KB 2GCYA 3E3QC 4Z3FA 4M1GH 2DLGA 3GSOA 1DJZA 3PL6C 5BRZA 2BOCA 4FA6A 4YSAA 3Q2LA 2PYEE 1AVAA 3AADB 2AJVL 2GC4C 3W39B 5GS2D 4PP1C 2NYYD 3X3FL 4PJIF 4NQEA 1UM5H 4ANWA 1UXMA 4Q20A 3RJDA 3WTYA 4BFOA 1INDL 2EEDA 3V9FA 2MTPA 5AB0A 4UM9B 4YHYC 2JKWA 4LF7O 1A6UH 1G0YR 4X1IA 2ZP0T 1GK9A 5I30L 3IKCA 4ODUB 4MMXA 4BIZA 5BRPA 3SGKA 1PF3A 1LP9F 4OGQB 5EOCJ 4BQ6A 2XWBA 1DQTA 1NT2B 3ZZSA 1KB5H 4PJ5B 3OHXB 1RMFL 1WFNA 4KWUA 4M8UA 5IK3B 3CPLB 4AVHA 1ETZA 3C6LC 4UUJC 2GUZA 1K8IA 4HJUA 3Q6FA 4JRYA 4LPVA 4OCRH 3HMXA 4NN6C 4FJ6A 3F05A 4F2FA 4BH8B 1PLGH 4CADB 1BYNA 5HHOD 5K1VA 1VEMA 2SODB 3BVDB 3VQ1C 2NQ3A 2XBDA 2XKSA 2ICWI 4OV5A 3CZNA 2KDYA 4XNYL 1HINH 3L13A 3U1SH 1TQBC 3TTSA 5IBUB 4Y5VA 4TRPL 5C92A 3DVNB 5AW2B 4IBYA 3MBWA 5LCVL 4GP8B 3BAXA 5F7FA 4WAFA 3CHPA 5C93A 1P84K 4H0LC 4PSPA 2ZOLB 3ZR5A 3NYKA 1I7RB 2DW4A 1SMDA 3LQAC 5C7ZA 4CS3A 2ZAIA 3LEXB 4DR5B 2BNRD 5JXAH 4Z8FH 4H13B 1G5GA 1XMEB 4GKZA 1TTFA 4GAAA 5LHHA 3FB7A 3ABZA 4FFTA 2CO2A 4DFIA 5LNEA 1SRDA 5LMNO 3NTCH 3S3JA 4DR6B 3MROB 5HDRA 3TA3D 4I1PA 4QPEA 4NNPL 1TIUA 1LP9B 1S9YB 1UGNA 3HJ0A 3JWNH 4MJ4A 4WW2B 4X6CB 3RILA 5JOEA 5EU6B 1FC2D 4PRIE 4DN4L 3C9NA 1I94O 1E9PB 2WYZA 4ZW8A 4LVHC 1CYXA 2DM2A 1BMZA 1UKSA 4F7TB 5KSVA 1K8DB 1A6TB 3HN8A 3LKSB 1E40A 1XXFC 1NCDH 4JBSA 4GIAA 3ZHDA 1JZ7A 2G38A 2VZ1A 3ZHSA 2EXWD 2MPVA 1L9PA 2VH5H 4AYBA 3AK2A 2LR4A 3DX3A 3LKQA 4JI7B 4NO0A 4EE2A 4PSRA 5D1QA 4J27A 2IDSA 3E1ZA 4WHYG 4ELKA 1TUPA 1ONQB 5EBGA 3N2GA 2F54A 2NTSP 1MZZA 3AXIA 3RJOA 5F1KC 2L6LA 3AUWB 3AQXA 4XO5A 3JZYA 2WZ6A 3SKJL 1HXMA 3ZDWA 3MBEB 5L3CA 2P8LA 4IS6A 3DDGA 1EAPB 3X12A 4B08A 3VQYA 3JV4A 4JJ5A 3UDWC 2QZQA 3NFNA 4ZYKB 1GTNA 1JL8A 2Z1KA 1KU9A 3EO1A 5BQ7B 5KVGH 2X4OB 2M26A 4B3SB 3ULVD 1Y67A 5CCJA 2XWJB 3PGCB 5LDSA 3C8HA 1UOLA 4HMEA 4N1HB 3N1QC 3LXAA 3I6GB 4RGNE 4LFBO 4KX7A 1TZAA 2F2HA 1F58H 2X38A 2YQ2A 3B9KD 2VRAA 3GMNA 3T0EB 2QGNA 1TA8A 4MJIB 4OCSL 2JKJA 4JPKL 3K5OA 4AHCA 1CTNA 3A67H 4M02A 2VC2B 4MKTA 4HWEH 4AZ8A 3BVVA 1U8KA 4M1CC 1GY2A 2XFGB 5E70A 3ZYJA 4PA9A 4EI0A 3ATAA 3R4DA 4QTIL 2BP8A 3S6CA 3MV9A 5DD3L 3WE6A 5LGNA 5T5FA 1KECA 3DHPA 2A73A 2XV0A 1NKGA 3FU0A 5F1SA 5I6XC 3PFQA 4XT1C 3U0TB 3VXRD 2Q9LA 3BVOA 3RFZA 3T1WA 2EIEA 3MV7E 5MEND 2WK2A 1VESA 3APDA 2XPGB 3EF4A 2NY5H 2SEBA 5K9QI 3U0ZA 2G5RA 5IHUL 5AW3B 4CBCA 4UTAL 4OIIH 1W72B 1L0XA 3K8MA 4LVNB 4PP2A 4UYPA 4N0CC 1R73A 3PNRB 4BUQA 4EXKA 5IYDO 3W7WA 4XN5A 1EA9C 1A5FL 3GWJA 2V2WB 1QWUA 4YEFA 1LILA 4BM7A 1QWNA 4UMGA 1E9OA 2H2SD 1CFQB 2BSTB 4HWUA 4KVNH 1F1AA 2CGOA 2BSSA 1IC7H 2NYKA 4Z95L 3FB7C 4HP5A 4QXVA 4ELDA 1OANA 3OMZA 2JGUA 1WDAA 1T6WA 4I3SH 4I13B 5L88H 2KC0A 4M5SA 3FT4B 2A7WA 1IAIM 1MH5B 2JJWA 4JANA 3D52A 5E24E 2UX6A 4R8WH 1I1CA 3JTSA 5DHYA 3NIGB 5ALCL 3CDZA 5FOBA 1NUDA 5D1XA 3B2VL 3K3QA 2EICA 3EO1B 4NQUA 1HHJB 4A2DA 2AK4E 4PEEA 4TLUA 3ZHKA 1AJ7H 4BJLA 3UYPB 3CX5F 3SE8H 1JPTL 1HZKA 1KUMA 1O7DE 2W88A 2H45A 5EO1A 4F8TA 2XHBA 1CICC 3AUVA 3ARPA 3MRQB 1H8HG 4O2CA 5DMJB 1OXYA 3HC3L 5IJ9B 2BX5A 4C55A 4FQIH 3VMPA 3VXQB 2JJTA 3IXTA 1FLTX 3AACA 4M8QB 1AFVH 1EGJL 4ZUTA 4RAIA 4DW0A 1K7DA 1JQ0A 4JKPL 2ZAHA 1NLBL 2OSLA 1G0DA 2COVD 2I9LA 2WYTA 5I28A 3VFWB 5KJ4A 5TPWH 4C56A 4ELMB 1LO4H 2WQRA 3IBEA 1NBYB 5KANG 2HVJA 1MY5A 2Y0SA 3MBEC 4HAFA 1TJMA 4TMPA 5GXBB 4G9FB 4MSWB 4QJ3B 4E9RA 1RK1B 1T7XA 1P53A 2XQBL 1NAML 4Y1AA 1DF5A 4UCTA 1VQ4V 2BVOA 3GO1L 5J5EA 5GRJH 2AJSL 1Y74B 5EU6A 3HN3A 3MLZH 3HTLX 5F9OH 3NSDA 2YPLA 1T6BX 3QFJE 3REVA 5IEHA 2WM0A 5EZJA 5HHXL 3T5WA 2ED6A 1H2GA 1Q1JH 2CRZA 3OSKA 4YDNA 1SXZA 4FQLL 4GYBA 4WUUD 4LF8B 4X8GA 4JPSA 1HL4A 4HFWB 1TVHA 3BDXA 4L9LA 4P4KC 5DHXB 3ZRWA 3KPRE 3VACA 5GIRA 3U2IA 3EDDA 1TMQA 2DWTA 1FZMA 2XVBA 1ZS2A 1NGZA 4GSQA 5KTEL 1J87A 1X5LA 4K8RL 1KF9B 3FXIC 2KB1A 3WKML 3CC5B 3S5YA 2XBTA 3CFEB 4EO5A 3ASOB 4DR3B 1LMIA 5BJTA 2YEVA 5B66Z 1N32B 2E75B 4B9CA 3F3HA 4D9RD 4ODHL 3GMQB 4OUOA 3JZ7A 3OAUH 1QLEL 4ATWA 3P3RA 3RVUD 1QUPA 3DHUA 1DLFL 4IU2B 1SLWA 3IMSA 2BS8A 4WNJA 2YXHA 2FUTA 2JIXD 2OL3H 2XWRA 3QDMD 5CSZA 4BFGA 1TLMA 5DYFA 5A16B 4DPAX 3KDMB 4QY8B 2ZOKA 5F70A 1FZKB 1AZCA 3FTVA 4K35A 1UM5L 2G30A 4HSAC 4XP4H 1ITCA 1YPZE 4QRPA 4PJ8B 5LG6A 1F45A 3FSWA 5CA0A 1HW7A 5E8DL 3ZUCA 4P9OA 3AB0B 4R7DA 4XP1H 5IM7A 4DYLA 1IBLB 4Z1PA 4N2KA 4JQIL 1E8ZA 3WD5H 2Q0AA 4UTCA 4X8JB 5DJCB 1E4HA 5IJVB 1RZKL 2DS4A 3KPRA 3CSPA 1TVHB 2G2PA 3VWKC 5D7SL 5HBBA 1KJ3L 4BW9A 5JOFB 4D0CB 4M93C 3L95A 1T7ZA 1QBML 5FUZL 4LPCA 3RY5A 3O2DA 3ZHRA 4G7QB 5LB1A 4QAMB 1JZ4A 1MUJB 4AMWA 1E28A 1LUVA 4N8CL 3EO0B 5IT9N 2VXVL 3HC4H 4FTDA 3U9PL 3L4YA 5D7LB 1FH5H 2NCEA 4PJFE 5HYJE 2AJ3B 2EYSA 2R7EB 3NJJA 5AB9A 1YPZF 3H85A 2ZDIC 2AF2A 5AAWC 1OP3H 4P23B 5I0YA 5DJZB 3CP1A 4PJDB 2YC1A 2VQFO 4NEHB 4X9YA 3AM8A 2YUZA 3RA7H 3QDGD 5FGRA 3JD3A 2AZ2A 5IB1B 2W6IG 1MWAB 1D9KD 4IOFD 3L4XA 2N04A 1N12A 4U6HA 4N2MA 2QSCH 5BMFL 4DKEL 3G5XB 5DK2B 4Y4KA 1RZQA 4KQ3L 1OHHG 1Q5OA 1P6WA 2X9XA 5BXFA 3TNMB 3FT3A 1ZIBA 4O2FA 4X6FB 4G6AD 1IFHH 1XWVA 4NN7B 5ICZA 1KELL 4F3FB 3BAAA 4LR3A 3QFDA 1PJWA 3FRUA 1NCBH 4G8GA 4YJZL 1R3LA 2CTQA 5CD3B 5I2IB 2BINA 1IAKA 3C60B 3FC8A 3HMWL 2QM8A 4K8RD 4YDJA 3KCPA 5D93C 5AKTA 3UIYA 4LKCB 4EQ2A 2XJLA 2N0KA 1OAQH 1U8HB 3QXTA 1GZQB 3LPFA 3IDGA 1FNLA 3CE1A 4XNZB 5FYKH 4O2AA 5MEPA 1G94A 4GXUM 1QFPA 2V4DA 1BEYL 1I9EA 3HA0A 1FD9A 4BKSC 4L0ZA 1F56A 2BNRE 5C86A 5ACLA 2VXQA 5AAMC 1MNNA 2A38A 4TL5A 3U79A 3PJSB 3CZEA 2K7PA 1CK0H 2X89D 2NY6C 1JNJA 1WLHA 3FO1B 5KVEE 5IUCA 4JRYD 1SQVH 3V4VB 4JFYB 2O1AA 3NCEB 3P3PA 1FIGL 1KYAA 1EERB 2A99A 4A7UA 3HPJB 2J1YA 4L5FH 1PNMA 1SDDA 1J8HA 1E79G 1QQDA 4XHJC 1SQFA 3NK4A 5C0IA 3BP5A 1TKWA 4U1MA 4LGRB 4X9FA 4UUJB 1BM3H 2VLJA 2QQQA 3WY1A 3ZKND 3UT5A 1NGPL 2ARHA 2DOSA 1HNWO 1G4RA 1Y18A 3RYMA 4MNQB 3D6GA 4H7VA 4LOUD 1VFUA 5KSUA 5I6KA 1U93B 2GVYA 1FJGO 2CDGB 4NQDA 2BSCA 2JSFA 4BGDA 3A4AA 2YGVA 3DJ9A 1QBAA 3F6JA 5I5IA 1EEZB 5B3SB 4RWHA 1GRWA 4M1DL 4KDTC 4TQ8A 4QRPE 4QR7A 4L1BA 5CCHE 3RGVD 2A9NH 3DVIA 2X6AA 3EO9L 1ZKAA 3GXPA 3UJIH 3VNZA 1DLBA 4K5MA 3TYFA 3UBFA 5AEAA 4N9GA 5JQ6H 4LZKA 5HI5D 1JWMB 1JCKA 2FYVA 3UG3A 2R8SL 2CK2A 2WY3B 5E1QA 1Q90A 2OULB 2WLZA 5L7XH 1QBLH 2LU4A 3EFDH 3REWA 3NJKA 3PNWA 2QLYA 4ZOLB 4B0MB 3QRGL 1FNFA 1V3LA 5FYLL 4LHUG 5AW8B 5JHLL 3NJNA 1JGLL 1GL4B 3H54A 3OXSB 4L4VD 1AVMA 1DVUA 3F7YB 4UIKH 4HG4J 4MTFA 3O8XB 4XMTA 4DV5B 1GKFA 3L3JB 5EZIH 3IFPB 2XV6B 3VFSA 5KVDH 2BSED 2ADFH 4DR1B 1WTGT 1KKDA 1Q9OA 2CMRL 2YRBA 4UCSA 4R3SB 2I5YH 1P7GA 4W9IC 3MRHA 2NZ1A 5A2QN 1EN6A 4HW6A 3GGWB 4WO4B 4ADJA 1K3IA 3TU6A 3VFOA 3BRDA 4KKLD 3WS3A 2FNBA 3TO4D 3V6ZA 3VH8B 2X7RB 3WIIH 3IDXL 1YCIA 2CRMA 3LZLA 1MLBA 4KKCD 2JMRA 1RZPA 1VDGA 4PRDA 2PWDA 1K33A 2WBJA 2VSDA 4XDLA 1DP0A 12E8L 3DK0A 2YD6A 4LHUA 5FYKU 4QRPD 3TNMA 3DTDA 4S1DD 4X7TB 4Z7OE 1NJ9A 3MYZA 4ZDHA 1I1YA 2A74A 4AQYB 2ZCKH 3AJ7A 4L8SA 3V6FB 1S7VA 3RPBA 2N7AA 4DOHE 1NGWA 3K4AA 9PCYA 2BW5A 3AG1C 1PKQE 5IB1A 5CCKL 3Q7JA 2JIZG 1HL9A 4HSQA 4UI2A 3KW7A 5E4AA 3OM3B 3MOAL 5G4NA 4TOIA 1EZVX 4NN7C 1I85A 4EFBA 2PUQT 2YIBD 3DX9A 3LSOB 5GISL 4HS8H 5TGBB 2JQMA 2FZ3A 4YDLB 1QOKA 2ZICA 2C7UB 4LFCB 3LSSA 4R7LA 5J0BA 4JY6B 2BTQA 1HHIA 2Y7SA 4F7EB 5HYQA 2XWXA 4X4YA 5HHQA 3RY6C 1BVKA 2PTTA 1JF1A 4TUOA 4DP4X 5DJXB 4Z7NF 2EDHA 3EYOB 3CFJA 5LGTA 3E35A 2PPAA 3AMKA 3VGEA 4PD4J 4KTEH 2W94A 3HKDB 3US9A 2YXYA 1MFAH 4OM1H 2YD5A 3MNZB 3O6LL 1H19A 1XH3A 2DEXX 4L8CB 1B3JA 5CHNB 4QT5B 3STLA 4FGMA 4MMXB 1Z0MA 3ARDA 2ICEC 2JJSA 3GFUA 3L54A 4ZHQA 3EGDB 5K9QG 4WFEA 3KL3A 3CRCA 1T1YB 5BR8B 2OPCA 4B96A 4APXB 1KXVC 3WKMH 5C1MB 2W0FA 1WE5A 4FPPA 3GTVA 2YSUB 3MV8D 3JALA 2DDQH 4AEHH 1BZQK 1CURA 3DPBA 1NIDA 1EPFA 4KUZH 5DRWA 4PJ5D 3UZQA 5KVGL 4S2SA 1LO0H 1N8ZB 2BZDA 2PTMA 3OAUL 1K5QA 2GCYB 5D7HA 5IJKA 2VLKA 1U8OB 1QU7A 5C0NC 4G8FA 4HBCL 3WY2A 1BPLB 3HAEA 3RB7A 3FN0H 2QPUA 3CFDA 3UEZA 2GFBA 3C3SA 3P9WB 2LFEA 4LVNC 1WIUA 3MXVL 3QCTL 4N6RA 7PAZA 4N0YL 1JUFA 4RX4D 2DICA 3LEXA 4HA1A 5DJYA 5EU3B 2JLPA 2WCGA 3PXLA 3L9YA 4YLCA 4F8PA 3K7UA 4HZAA 4YBLB 3ZXAC 4RMWA 1ORSA 1JZEA 1XR8A 1F3JA 2GQHA 1FYTB 1GMGA 5IB3B 1DEEA 5ID1A 5HGHB 1ACXA 3HLAA 3L1OL 2Q2EB 5KBPA 3GB7A 1GZPB 4UT7L 4F1ZA 4UQ3B 5JHDD 4MMZB 1Q1JL 2GK0B 5FGBC 2BVYA 1IZKA 4HFUL 1ADQA 4IOIB 5LGKA 2YAPA 5CFAA 1RSFA 3PAZA 3IMRA 5JHDE 4AL8L 1E5ZA 4PJCF 2IH3A 4DR4O 3WHXB 3WSQL 3I55V 5H6RA 3ZTDC 2OTJV 4KRPB 4PJ5A 3KYOB 4B6ZA 2XAJA 4KO7A 1AQMA 4D9QE 5TK4A 1ILSA 2NXZD 2IMNA 4YXHL 1FFNA 3C60D 4KAQL 3UMTA 1HXYB 4OZ4A 4Q9RL 1WAPA 3CUPA 3L9EA 4BFJA 4D8OA 1P4BH 4LFHG 5KSAC 4JFFD 1FRGL 2WUBL 3FCBA 5DQDH 5D1QE 2H4EA 2IOIA 1TZIB 5FYKE 3DMMA 1G1OA 2HEPA 3KLLA 4GB9A 5IJBC 2J1WA 1MCPL 2R56H 2B1OA 1JSYA 3C8KB 1G9MH 1F11B 3F7LA 3Q06A 5IJKC 3CGTA 4BWAA 3OKKB 4JZJC 1VQMV 3O11A 4PHZA 4MNGB 2BOCB 3RYFA 3QUMH 2ZKOA 1AS6A 3SE8L 4P3DB 3VFPA 3S36H 1WA1X 2VIRA 3LPOA 4J3OG 3QIBB 2EO7A 1U8PB 3GSNL 3OT7A 2JK5C 1B0RB 2V5RA 2HLAB 5IWLC 3FUDA 2QKSA 4KHPB 4LLUA 3D39D 2LP7A 1JNHB 1L9MA 1SM3H 5K1PA 2TRYA 5EK0A 4P99A 4NWTH 1PNCA 3WTVA 2UXBO 1ZAUA 4JQIH 1M9WA 1YNLL 2WXJA 2EH8H 2CSPA 3BXNA 4WFFD 3QUYC 3BN3B 3QZBA 5HHXH 1NZ6A 4PCKA 1NM4A 1KCRH 1SA0B 4PYGA 3BRFA 4IHOA 3S3PA 1NMAL 3NGBC 4M5ZL 2BY0A 1QSEB 1KC5H 3OLDA 3DVGA 5GRXG 1SETA 1CD1B 5C09E 1MFEL 1N34B 1J1XL 1ROPA 2AEIT 4GRWE 4YBQD 4QF1B 1DQLH 2COQA 3IU3B 3US1A 3JAKA 1U8CB 4AM0A 3H9SD 5ALBL 1E9OB 1M42A 2I7OA 4TLSA 3AT9A 5F9OL 1AQHA 3O3AB 4GUQA 1D5NA 2DTSA 3M1BB 4Y88A 1BFOB 4O5LH 1S7QB 3C5ZA 5GGSA 3VFTB 5CF3A 1PMYA 3KCWA 3RVUC 1DBBL 3H9SE 5E6ID 5A2IH 3MO1B 5IR1A 2FT8A 4F15B 4K55A 4FF9A 5AVVB 1TZ8A 4E5XG 2J71A 2X12A 3WMQA 4JNXA 1G7JA 5LXGH 3BCDA 3OKYA 3D69A 4K8ZA 1BFSA 5LQBH 3TJEL 1CI5A 2EYTA 3LDCA 2JB5L 4LEEA 4P5TB 4I3RH 4N3TA 1RU9H 3LNGA 4YFEA 4N5ED 4OJFH 1IM3D 2I9TB 4OJDH 2QTSA 4JPWH 3LS5H 4BYHA 3L5IA 1MXGA 3MAWA 1KCKA 5AG8A 5F6IB 3O65A 5IE9A 5GS1A 2Y36H 3O2DH 3TZVD 3H7LA 1A9EB 3F01A 3ILEA 4QYAA 1SZXA 2OMWA 4DZBA 3MRIB 1QZ1A 5T3ZH 2GIYA 2IJKA 1U3YA 3QG6B 4G8EA 4Q0XL 5EEUA 4OF7A 3ILPA 5BV7B 3VWKA 1T22A 4EI6B 3NCFB 3UC0L 1LE9B 4UT9H 3MA9L 5F8QC 3P9LB 5E08H 3GMOB 4IBLT 5CN0A 5K1JA 3ZTEA 1P1ZB 3FTGA 4G6KH 4HUNB 4XMVA 3NSJA 4Z6AT 3UAAA 3LKPA 5FM4A 3CRAA 3BPLC 3BEHA 1L9OA 3H3PL 3A2FA 1F3DJ 5A2LH 4JI2O 1EJOH 4XPFL 2HVKB 2PETA 4NXSA 1TYJA 3AG3C 1QRNB 2I32A 3OR7A 2PCPA 3BPOC 5FKPA 3RWJB 3W9DA 3W81A 3OZLA 3FF7A 5E23A 5F3BA 5E5LA 3G04B 3JYBA 3NPSB 4QYOA 1HWHB 4KTDH 1B2WH 4RFNB 4XB7A 3NN8A 4GKSB 1R0AH 2WV3A 1SF9A 2R23B 1WB8A 5LXTA 4XO9A 3MRCA 2PTUA 2OIGA 1S7TB 3NA9L 4I2XE 1LK2A 5SWSD 1KTBA 2J3SA 4PRHB 4AGLA 1UCBH 1BPVA 3E9TA 1IGMH 1AD9A 1SXNA 1XDCA 4QGTA 4XHJD 2XQYA 5HYJA 3T2NL 1TKWB 4U1MB 2UZYB 1YEKH 2VRQA 3ZHUA 3BPCB 1RZIB 2NCMA 1I7ZA 1URFA 4URTB 3ABGA 5LCVH 3IJ8A 4UQBA 2WXQA 2QE7G 3DECA 4TLTA 2ZWLT 4Y9CA 4WFED 2WIMA 2MPAL 5K39A 3V4VA 5T1DH 4JFXB 1HOCB 3KPMB 1F4XL 2OCCB 3M8AA 4X6CA 1ETJA 2Y7QB 3FQTB 1JZ6A 4H8UA 1QR4A 2HT3D 4P5TD 5BOPA 2FDBP 3SZ6A 1H3XA 2HFEA 5JW4R 4L8CA 3B2MA 4U7NA 3E6FB 1T1ZA 5AVWB 3U4BL 1GHFH 1AYOA 5EA0H 4TSAL 3FCTA 1YNTA 3QE5A 4MT8A 4MNHB 5DD1L 1J1OH 4XWOC 4CC6A 2GC7C 2WNKA 4U6XA 5I5RA 5DGRA 4YDJB 1I4FA 1LEKB 2BNUA 4WK2B 5FPIA 1N26A 1YJ9V 1M2VB 3CN1A 3K74B 1P69B 1DQJA 5IFAL 2X53A 4XVJL 1P4RA 3H9VA 1AO7D 1T21A 1LE5A 2CMRH 1KENH 4N87A 4HK0A 4WFAV 2ADFL 3HMWH 1AI1H 1JCHA 3FB5B 3OWEA 3WLBA 1DVFB 5GRVL 3WTSA 2W59A 2IPTL 3WFDH 3X1BA 4UCFA 3C87A 3QDAA 3T3PB 5F3HA 2R1YB 4LRNL 4OCRL 3GEFA 2CLVB 3QDJD 4XBFA 1BEYH 5DR5L 1WPCA 2WZPA 3BFOA 4G42A 3WJLA 2HX9A 1NGPH 3UIZA 1C5CL 1GPOH 3IDMB 4FFZH 3ULSA 1IEBA 4BFEA 1PY9A 3SDAD 5IHLB 4RFEB 3KAAA 2UXNA 2KYIA 2WVSA 3HG1A 2MH4A 2Z31C 2O5XH 4NXKA 1PX3A 2CGZA 4RDBA 4PJGA 3QNZA 3VG9C 5FV1L 2XOKG 2GTQA 2WXFA 1HX0A 1W6LA 2WXLA 1K34A 4GKJB 3VA6A 3VYNA 4GNKB 3RGHA 1GM8A 3U0WH 4GX5A 3LH2L 3DJZA 4LCUA 4LCUB 1KD1W 1J9TA 5DDHA 2A4CA 4Y5XC 2PXYA 2VWJA 3ML9A 5IWAB 4RA0C 3RVYA 3OR6C 2K78A 3KPNA 4F33A 1DUZB 4P46B 2UY6B 5TE6H 1CXKA 2W9DH 1RKRA 25C8L 4ODTH 5A7EA 4OZHF 1A9VA 3KPRD 5IMLB 4MRBA 3Q13A 2E7CA 3D50A 2R2EB 4NZTL 3RWCA 1QX1A 4KTEL 1SDAB 7CGTA 4GEJA 4UVAA 1MREL 1OHQA 3UYRL 2AJXL 3LNNA 4HIEB 2IQ9L 2WB1A 3GMPA 1VF5B 1H9DA 2IAAC 3TWYA 2CZNA 1Z5YD 4TPRL 4GUNA 4ORGA 4Y9EA 4R5VA 4TULH 1RPOA 4P4RA 5CEZH 1DJXA 1WFTA 2APTA 3MLRL 3NK3A 3O6FB 2Y4TA 5TF1L 4KNUA 1P4BL 3GSWA 3BWSA 3HC0A 1UC6A 4TKWA 4HHAA 2IC2A 3TBVA 4KK6D 5IQNA 1T1WB 3C5ZD 5AKRA 3G9VA 1YEWA 3EYFB 4N0RA 5I15L 1SJHA 3V7AE 4DSYA 3QJUB 4LDLB 3E8BA 4E41B 2EXTA 1QHQA 5HPMA 2IDCA 2CAKA 4TXVB 5FX3A 1RULH 1RZFL 1AR1B 4XXDA 5L3FA 1FIEA 4ZS6D 2P4VA 2RHEA 4IKJA 4YQXH 3TCLB 1SRYA 3DOSA 5B8CA 1IXMA 3F7KA 3OC8A 4H0LB 2WXKA 1SFHA 3VFGH 3O41B 5EF3A 1RUAH 3T65A 3B6SA 3P4MA 4OFKA 3P69A 2EDKA 2V7QG 1BIIA 3BW9A 1WZMA 1QFWM 3I02A 3L1OH 4N2HA 2Q2LA 3BKYH 4GH7B 1N18A 1C7SA 5J12C 4DR7O 4Z7IA 2H26A 3KE0A 2WA3A 3MV7A 4Y1AB 2EO1A 2YPLD 3SKMB 3V0EA 3EJSA 3QO7A 3HKCB 2XT9A 1MNUH 3BLBA 5HGDB 1ZLWH 3TJHC 4PW4A 3L3KB 1VA9A 4UM9D 1NKDA 5AW5B 5DD6B 3UO1H 5EIBC 5LN4A 5IHUH 2PR4H 2L7JA 4B7LA 3ZDYE 1FYHB 1D6VH 2BERA 4QCIB 3Q9QA 4N90D 4ZXBC 3DROB 5KMGB 1FYTD 2A6KA 4EI5C 4JDTH 4MFHA 2E7DA 1OGSA 3CC1A 5M7QA 4JFPA 3VD1A 1FJ1A 1TYEB 3IPFA 2IH3C 5F7UA 4JKWA 3MUHL 4GAYB 3OKDB 2D9CA 1C5DB 3QIUD 2ZG2A 3QIUB 4ORZC 1JOIA 4NAQA 1LYQA 1EUUA 5FC9A 1HR0B 2VDLH 1DF4A 4FXKC 3RYIB 5AB2A 2H3NB 4FNLH 4M4RB 3D85B 4FLUA 3QBTB 2GEEA 2VR4A 4JI3O 3D33A 1K3EA 3JTTB 5DJDB 3OGOE 4GT1A 1K6QL 1FS0G 5B3SC 1SDYA 2XQYG 3EADA 3QISA 4JHAL 4B95C 2HKFH 2EDTA 2FLRT 1OSZA 3BRGC 1DQKA 5ACZB 1KTKE 2UUBB 5DC2A 5FNVA 1JZ8A 2DLTA 4HS6B 1KULA 5K9KA 3N43F 3B40A 2BFVL 3MJ9A 4K8RC 4M7LL 1VF5C 1KLUA 3QZMA 5I0DA 5HGAA 5E94B 2B08A 4AYFA 3J7HA 4ODSL 4HEPA 3QYNA 1B0IA 3G08B 1W9XA 3MJWA 3V5KA 1A3LL 5ABAA 3ZKMD 3LQAH 3THMH 3DURA 4PGCB 1TTBA 2W60A 4UDTB 3ETBJ 1QEWB 1WV7T 5DRNB 2AHZA 4P5SA 5AW0B 3WEOA 4FZ8L 3QJFA 4K71C 5DI8B 5C0BB 3APOA 3L1GA 4BQ9A 3JSNA 3ERXA 5KYYB 2XNAB 4N2OA 4RZCA 4WU5B 4G1EA 3MVSA 4FQXC 2Q87A 2J5LB 3RX7A 3VTTA 1JGDA 3MNVA 4FQ1L 3OAYK 3O3AA 3SPCA 1CL7L 3GD1C 5EOQL 3ARYA 5KUMA 3L3OB 4LLQA 2WLNA 5DK0B 5I73B 3DBXA 2CKBH 2QSTA 2WN3A 3QI9B 1MCSA 3U9WA 5JPNA 1OIOA 4Z0XA 3F00A 3FQWA 2HJLA 4H25B 3I75B 3H4HA 4A68A 4Z23A 1G9HA 4JQVC 1AI5A 3T4AB 3BFWA 2N7SA 1H15B 4MB5A 4F57L 4QAWA 1IBGL 3ZK0A 1NC2D 3F58H 5CKAA 5FM5O 3JV4B 3QUYD 1NCGA 2XN1A 3IFNH 2Y4SA 1Z5WA 3H9ZA 5MEQB 1QD0A 4M6ML 1DCEA 5B7MA 4Z7NE 1G9ML 4JI5B 2CDYA 3DX8B 3RNQA 3DJTA 4HXBH 2Q8AL 5DVOA 1VPOH 4XCNA 1RFYA 3ABLB 1WA2X 2DQMA 4NHCH 4NZRL 1M1KW 1EM1A 3S36L 1OGTB 4YGVB 3F12A 3CE2A 1TQUA 1TQTA 1A2YB 3LKQB 4KI5F 4PLJC 4Y4HD 1YEDA 3ASOC 5ITZA 4Y5YB 1M7IB 3TA3C 4X8XA 3WFBH 4NQQA 3X1GA 3QZOA 2ROXA 3TS8A 4E9WA 3FKUS 4FFYA 1TU2A 1KNOB 3O3BA 1G1YA 1XGQB 5CD5C 2DMCA 2QADB 3DRTB 3RU8L 5AZ2H 3C9NB 1PFCA 4YSQA 3DXRB 4DV2B 1R0AL 32C2B 1ZV9A 4JI5O 4BZ2L 2Z7ZA 4ZX5A 2KT6A 3PWUB 4F7MB 3Q2WA 4M6OL 5LBSL 1Y4MA 2CBOA 4WU7B 1VGEL 4XNXH 1RI8A 2AI0H 3H4FA 4KNTA 4CVXA 3QZNA 2JB5H 3BIAX 3UPRA 1YEIH 2FCBA 3IWUA 4PJXF 4P5RA 2O6PA 1XSJA 3QQ4A 5FYKL 2B2XL 4P23D 1HP8A 3AG4B 5E95B 1FXKC 3RVWC 3TH2T 1VRSA 3SIKA 1LTXA 4PJGE 2HG5C 3K71A 2YD9A 2YI9A 4QOKB 4HCGA 2IWGA 1TSHA 2HKOA 5C0CB 1DVFD 4MVRA 1CU4L 2IBGA 3RPIA 1PG7L 5LAXB 3J7AU 4QXWA 4JCWA 1DBAH 1Z0NA 4P04A 4WTZA 4U33A 5EUOA 5D2NE 5B1OA 5K9JL 4NUGL 4HYOA 1HNZO 1TETH 4ERSL 1UZ6E 1K4DC 1E8XA 2OTUA 3AAZB 5C2BL 2QWQB 1H6UA 4R7NA 1DJSA 1JV5B 1Q38A 1B0GA 1AE6H 3ESOA 1OL0A 3OXRA 1GY1A 4DO4A 3N55A 2XLLA 5BV7L 4X99A 1MVUA 4HT1H 1CG9A 2PO6B 3KJ4B 5K1XA 3IVKA 4W9EC 3K0GA 5KN5B 3S5ZA 1N8ZA 1S7UB 2OMUA 3I3EA 4FZ0A 4EDWL 2RQEA 3KMDA 4Q14A 1XGQA 1IFHL 2EEAA 4LF5B 2LVCA 5F2VO 2XN9E 3UJJL 1I9RH 4ZFGL 1E3ZA 2JELH 1AQDB 5D70H 4CNIA 4EUPA 4AQ8A 1NU1H 3QA3A 2EE6A 1UZ8B 2WTOA 3PP3K 3QDMA 3LEYH 4DZ8B 3LZOA 1UB5A 2GBOA 2DRUA 3QZWB 3LXUX 3W39A 2QQLL 3L3KA 4QT5A 3STLB 3BPOB 5KW9H 3K4ZA 1GN3A 4M6AA 3GMRA 3HB3D 4L29B 4POUB 1F42A 1RURH 5C0EA 2VZUA 4XB8A 1C5CH 1GPOL 6CGTA 4HVBA 5AOIA 5CS7A 3FB6B 4WQOA 1HS6A 4TM9A 1MCOL 2WWOA 1ML0A 2I5YL 3BFRA 2ZP8A 4PJEF 3RVTC 2OMTB 3NMEA 3QS3A 3L6FA 4R2GC 4K5OA 3ABKC 3ABMB 1KN4H 3F7QA 4HHGA 2KQMA 5I8KH 4QHPA 4ZW5A 3UX9B 5I19L 3Q1SH 1WUNT 1R9FA 4HBNA 2X2UA 5LAPA 2PR9A 4PDMA 4XXDB 4CU8A 2A9DA 5B1NA 1MIML 5HDQH 2BCKA 2FWSA 1U3JA 2QSQA 4NXNB 4CU7A 4LSSH 2I25N 5CGYC 3S34H 3BESR 1S7VB 1UYWL 2AEPH 2JKSA 2XZCL 3BH8A 1Q94A 3IGAA 4ABUA 2BSRA 3MLVL 3WIHA 2VYRE 3ZMVA 2J73A 3HUJE 4QRUA 2G2RB 1UWFA 2QJ1A 2A83A 3PQYE 2JI1A 2PI5A 4P57A 5GSVA 3DUSA 4PGEB 5H37H 1J9CT 4NYLB 1D6EA 2AAVA 4C47A 2EIZB 4MXQC 3QNXB 1FC1A 4O9HH 3D18B 4ONGH 4UB0L 3VXMB 2WINA 3QJFB 5DI8A 2H9GB 4QHLB 1K2DB 4PJAA 3WFDL 2I07A 2G3ZA 4U1HA 3RYHA 2X4SB 2VZVA 5GISH 2EINB 3NIDF 1A6PA 2H0EA 2ARJQ 2B77A 2DL9A 5F7HA 2ZM6B 5MEOA 4NENA 1DVTA 5F9JA 1YEJL 4FLYA 2YSSA 3FTXA 5I66B 5J4MA 2UXFA 3EIFA 2PTVA 1AY1L 1R5VB 1OGAD 2MCAA 2DBJA 4JHUA 4LU5L 2KBGA 4QE9A 3PU7A 4M56A 1NDGB 4RQFA 4NP9A 4KK6C 2P26A 4U1NA 3MPCA 4WBNA 2GTWA 3EH2A 5JW4M 3ABKB 3ABMC 1INEH 4BZYA 3ASWA 1P7BA 4P2RB 4YY3O 1SHWA 3TO2B 1C5BL 3TT1H 1UA6H 4OGAC 1U30A 3HKZA 1IJNA 4P2QD 1MZYA 3Q8AA 5AAMA 5JXEA 4HIXL 3WIFB 2CIIA 3KPTA 3WJMA 4JPKH 3FBKA 4M4RA 3AK3A 1BZEA 2H3NA 4XPAL 1ZTXH 2AQ2A 3ZZQA 4I5BA 4E36A 2XWEA 4HJJH 4PRBB 1YAIA 1BZ9A 4D7SA 3SE6A 3QIBC 3G5WA 1ZWIC 5DVLA 1IC4L 3QWQB 2FMLA 1BLNB 3FOMA 4N2IA 2CBTA 1EDQA 3MGAA 4AUJA 3BLPX 4HF5L 2IADB 4YL9A 2Q7HA 3AXLA 5MENA 2CH7A 5KZCB 5C0ND 1OLZA 4NQDE 4P2AA 4CKVX 1A4KA 2DBLH 5C9KA 1ZLUK 5LN8A 4M00A 1LWRA 1KV3A 4L1DA 3EGXB 4A6YL 5I75B 3NZ8B 4R4FL 1T20B 3MGTB 2XV2A 1SJEA 3MNWB 3GLZA 1E1RG 3AWFA 5D2LF 3QEQD 2XN0A 1EO5A 2XQYK 1BW8A 1XGPA 2IWEA 2OJEA 4JYAB 3A47A 1P5UC 2EXYC 1OCCC 5BVJA 2QBWA 1M1XB 3OV6A 3PHOA 2CLRA 2VMCA 1BBDL 3MN8A 2Q7YA 2P90A 2H32H 3MJ9L 2WMPB 4NRXA 1I1AB 5D72L 1EXUA 4UDUB 4I85A 2WWMD 2XG4A 1HT6A 2QDVA 1CL7H 5EOQH 3BH9A 5EOCL 2GEQA 5IJ0A 2RALA 3ZTJH 4LF4B 2VDLL 4GW1B 1G6RL 3B2UC 5KBKA 5SWZA 3CC4V 5KVEH 2HFEC 1J5HA 1K5NB 2GTZB 4L3CA 3B7YA 1GIGL 1WFOA 4XMUA 4KDVA 1XD0A 4J8QA 3QUZA 3TYGH 2HKFL 3BYYA 1R6TA 4XXCC 1E5AA 1A7RL 4ECNA 3BSZH 2ENJA 3INOA 2BE3A 1N36B 4P5KB 4LLVB 2WYIA 3OB0K 3QIBD 3HE6D 4LBEB 1I8UA 4L5FE 2E27H 4HAMA 3A5VA 1NLDL 2K45A 1I9JL 4R7XA 1A7NH 2OAAA 1IKOP 4H8PA 2EIJC 3X14A 1QSZA 2F08A 2FEEL 3AABA 2ZT9C 2FIKB 1KYDA 3DXAE 2ZQMA 3V52L 1RHHA 2ALWA 3TBYA 5DO2D 1C8PA 4KGLA 4WI7A 3RWHB 3NZ8A 3UTPD 1OCZB 4B3TO 2ZOUA 4K7PH 3I50H 4XNUH 2QGDA 3FPXA 4JDEA 4NQVB 2WIIA 3S96A 1BQLH 3MCLL 1ZS8B 3CCEV 2XTSA 5F8RC 1R46A 3O3EB 3ARSA 2Z92B 1N0XL 4JYCA 2AV1B 1JK9A 2WUCH 2NY7H 3ARRA 2X4NA 1WFUA 4MCZB 3AG2C 2IANB 3VXOB 1DUZA 4M7LT 3T0WA 4YNYB 4FG4A 3ZN1A 4PDVA 1OD9A 5HVFB 3BZ4A 2BHFA 5CLYA 1MFEH 5LP6C 3HZMB 1W59A 2LFRA 3AC0A 5L4JA 1ANUA 3ARBD 5IMKB 1MW3A 4R7CA 1DBKH 3VXUD 3O0RL 1RL1A 1VFBA 4N0FB 1RIUH 4RMQA 5ALBH 4XP5H 4MS8C 3RUGB 1QNZL 4RAVB 1CDYA 1H6TA 3L72H 2NY0C 1MLCB 2XX1A 3VXPB 2IJIA 1QPKA 1GN2A 4DK5A 3H6JA 4FXGA 4HUCA 4OZIA 4W4NA 4GKKB 3QO5A 4UB6Z 4U1SB 3NRPA 4A39A 3TGUH 2ZYRA 4WI6A 2ITDA 4YHZL 4URKA 2DYPB 1FL6B 2PYEA 4AIXA 2PPCA 4HIJA 3UABA 2C5DC 4PCTA 5C2BH 2VRKA 4NGHH 3H1JH 3LX9A 3SPIA 5J89A 5IYZA 2AEOA 3QJOA 4HWBL 2K9FB 5K33A 4R50A 4A2EA 4MQTB 1RZ8A 5CA1B 4JRXB 1SHMA 3D18A 2NYZA 5HVGB 4MVUA 1MCKA 1R3HA 3DXAA 4PD4F 4JFDE 4IU2A 4UU9A 2OZ4L 1U6AL 2XICA 4XB3A 3OAWA 3Q0HA 4X9BA 1TTAA 2RD0A 3SGDH 4H0HB 1PV0A 1RK0B 2BSRB 4PB9H 4ZI7A 3OHMB 3VXSA 3VDAA 4Q6IB 4JRWA 1PP9H 1A6AA 4L1SA 4WHDA 3VRJA 4J80A 5AWNL 4KQ4H 2Y2TA 3KPOB 35C8H 1TUBA 3CXCU 1VACA 1BHBA 4QF1A 5AL8A 4CMHB 2XKUA 5C8JA 5LBSH 5KA6A 5E2WL 1PW3A 3JAMN 1BXVA 2QVMA 3D08A 4HWNA 4YO0B 2JK5A 3RBGA 5IFHH 4BSVA 5HGBA 1WZLA 1FNAA 3MQIA 4UTBH 3QFGA 2PZSA 1F1GA 4KJYB 4L9LB 3OAYH 4TV9A 5HJBA 3NR7A 2CJUH 3FUEA 4IEFA 3ZE2B 3QAQA 4GLXA 1ULVA 2N05A 5D1XC 3G71V 5EZJB 4XOBA 2FSEB 4OBSA 1CP9A 1JJUA 5AYTA 1E3FA 5EORL 1MJ8L 4XOCA 1A1MA 4YHML 2QZ5A 4PY7B 3RX9A 1PG7H 5AD0A 2GY5A 4C54A 1HNXO 4A55A 5I76B 2HMID 2CJ3A 1XGRB 2HH0H 2YRLA 3IJ7A 4P3DA 1XO8A 4G72B 3VXSE 1BGXL 5I8CA 5A6MA 2JVDA 3ARWA 4ZKIA 3FQYA 2Q86B 5I23A 1NCIA 2HRHA 5DJ6A 3S97C 4OCWL 1GGCH 3VXSD 4UV8A 2UUBO 4UF7C 2FJGB 4L4TB 2NNRA 3NJFA 1XGUA 4HKBA 5BZWB 3ZKXB 4F2MB 3Q48A 3TBSB 2G75A 2NUTB 5HI3D 2QVFB 1A6UL 1OTSC 2CKBA 3RL1B 1QWHA 3CZUB 4J1UA 4JEGB 1TTCA 1UWGH 7PCYA 2HVKA 4NHCL 5FB8A 2X4RA 1Q6IA 1S7WA 2OXGB 1F4YH 4FQ2L 2EYRB 3KGUA 3ABUA 2E7LC 5F7EL 5IB2A 2PGGA 4OJAA 4H4NA 5H5NA 3P4OB 5DU7A 5DURD 4J2QA 1D7BA 4PTTB 2IOMA 3BCFA 2NPLX 4ZJ9A 4ZUVA 3ARFD 4X7SH 2EVFA 1FJGB 4F6RB 3G7TA 4L4VB 3J80N 2GIXA 2FYUH 4HBQA 4WIQA 3TH3T 3ZMRA 4NZFA 4R7VA 1GZPA 2R0KH 5IFAH 2ZUQC 2BP0A 4AE0A 3P4LA 4O4YL 4MB1A 4D3CL 1VAHA 1LR1A 4UTAA 4U1IA 2V5MA 3VE0B 2QEXV 2R0WH 4DH2A 4YFLF 5KX5A 3RUGF 2DI9A 4FQHA 4KK8D 1KIQA 5C0RL 2H6PB 4RH4A 4NERA 2QFRA 5DEGA 1D7DA 1YEIL 3D2UD 1WP8A 2ENYA 2ZCLH 1DVZA 1PSKL 1SVBA 4KGJA 3CCSV 4DR7B 1J8HE 4LPWA 4EOWH 1I82A 2AQQA 3QORC 3P9MA 2MK3A 1JHLL 4IRJA 3IF1A 3KEDA 4G8FB 2XHNA 1HEZA 5J6SA 3N06B 3QPKA 3BD5A 1FZJA 3P3TA 5J6GA 1A7QH 1AG6A 3MV9E 5F93C 2CE6A 3ZSSA 3ECVA 4HGWA 1B9ZA 3JALB 1P7QA 3BDBA 3GZKA 2FGWH 4B9KC 4JO1L 5DD3H 5IBLD 4KROB 1V54C 3DIDA 3BEVB 4FXLA 1FL3A 4A6YH 1THZA 2WPDG 3GMNB 4JHZA 1S7SA 3WKQA 1P4IL 1ZGLB 1OZTG 4N8UA 2V9QA 4N1EA 1CD1A 1FE8H 4R96A 5C0AA 3ORJA 2VGLM 1NUNB 1UOVA 2HSIA 1JD7A 3APFA 4G8GE 5T1KB 3SJVE 1PNDA 3Q6GH 5DK3A 3H55A 4BFRA 1DSFL 1RP9A 1CI3M 2DJVA 1DJYA 4OF6A 4AIEA 3QHZL 4JDVA 3ZKXC 3FO0H 4BCYA 3DNKA 3EYOA 5DRXA 2RQ6A 1NCTA 2NNXA 3CBJB 5L2JA 4LU5H 4KZDH 3D30A 3SE9L 3VXMA 1PLCA 1TCRB 2PF4E 2FR4B 3MRFB 3ULVC 2ZX5A 2NLJC 1U8QB 3O4LD 1QLFA 4UBDD 1UADC 2EKSB 5DZJA 1IC7L 2ZIDA 2BTQB 2BDNH 4J3UA 4XC3H 3J2PA 3ZT7A 3FH8A 3WMPA 1RIVL 1Z5LA 1ZMYA 1C5BH 2R2BB 1HYRC 1W0JG 4AQAB 3P0YH 2A4EA 5JLZB 1FNSH 5BVPL 1FA4A 4IQHA 3RAJL 2ODIA 1OARL 1FI8C 2WKOA 1P9MA 1ZLVK 1FGNL 1UD8A 3S48A 3SQBA 3SE3A 4DVRL 2CUIA 3CFTA 2KLRA 4NKOB 3E9UA 3M86A 5DZLA 3BHPA 1MFVA 1N68A 3EF7A 4UCRA 4MXQD 1XCQB 4UT6L 3UTSE 2EUZA 4KHXH 4ZODA 2ZD0A 1MRFL 4X98B 4K3DL 1BYOA 1QKZL 3QO8A 1GGYA 2QSVA 3D12B 1XSKA 3LJ3A 2KLTA 4MCYB 5EIVA 4ALAC 4E9YA 3DGEA 2F7QA 1NTMH 1MIMH 3IDYB 3BHBA 1F7YA 3JWOC 1WB7A 1NC4A 2VL4A 4KI1A 1BQSA 2AJUH 3CFCH 3OLIA 2KDGA 4U1GC 2FJHA 4GKZB 4KMTH 2EUVA 1KB3A 3F7VA 2CG9X 1JTPA 5I6PA 1OCOC 2O5ZH 5HVWA 1SYSB 3BUQA 3HE7A 2W9DL 1IT9H 4ZFQA 4XBGB 3WYRA 1AHMA 2CH8A 4D2NA 3O0LA 2ZINA 2BNQA 1FYTA 3MZTA 3VJ6B 3IRZA 1V3MA 2BOBB 3LNDA 1M6OB 5FDWB 2IH1A 2EIJB 1I8AA 5EU3A 5C6WH 4G6FD 2FL5A 2YGQA 4P4KB 5CJXA 5BZXA 2E56A 4AQYO 3V5DB 3V4UH 1JNLH 4RFNC 3OBAA 1BF8A 1QA9A 1LO2H 5HHVL 3O4OC 4S0HA 4JPRA 2JCWA 3UO1L 1ETZB 1E27B 4MVBC 4FK5C 3E1F1 3MOBL 3RYIA 1YUKB 2X44D 4YOKA 4JDZB 2NNAB 4EI5D 3CHQA 1DGSA 1V05A 2X1XR 4TULL 2FVNA 1FPOA 4QWWD 1JPGA 2R9RB 4NKMA 4FADA 4S2SB 1TZHA 5A1AA 3T1FB 2VDNH 2VR6A 2M6YA 3QQDA 3SY0B 4AT6B 1CGWA 2V9TA 3ASNB 5F7DA 1QFHA 4OZIE 3EUDA 1SLUA 1F02I 1U93A 2GJ6D 3IFOB 2Z91B 1RSYA 3V0JA 3R1GH 3FYEB 1S3JA 3FNKA 3D87B 1U58B 3AG7A 4FFYH 5DRZA 1RULL 1RZFH 3IMUA 2J20A 4LAQH 4MLIA 2X4PA 5L2KA 2PY5A 1IAMA 2V5TA 3ETBF 4PJAE 5HFMA 4P2QE 2QV4A 3BAEH 3T3ME 3BI9X 2X0UA 4MJ6A 4RGND 5FYJE 4GW5B 2CIKA 5BCAA 1BQLL 3GS7A 3MCLH 5T33H 4PELA 1RLWA 5AW9B 4TNWF 4YR6A 3ME0B 5EBLA 3JV6A 1F23A 3ZE1E 4M62H 3LZQA 2FYYA 4ZPTA 2V9UA 4KQ4L 5ETUA 4DUVA 35C8L 3K2IA 4QOKD 3OX8A 4AQOA 4BFBD 2F5AL 2VJXA 4U1JA 1FVCB 3VXMD 4R97C 1SF3A 2HN7B 4WW1B 3QI9D 4WWNA 2UXDO 4FLHA 4QUOA 4DR6O 1DVFC 3W7SA 5F21B 3ZMZA 5E2TL 4JZ2A 4K2UH 3SYQA 5CLWA 5D8JH 2VERN 2FWOA 5E9DD 2E6PA 2P42B 5C3LD 3H2WA 1WICA 3C08L 3LXCA 4KRPD 1T1WA 1CEZA 5FKAB 1TVBB 4WRLA 1MN4A 3CHOA 4Y4FD 4BEIA 3O6FA 2LTQC 1S8DA 4N8CH 4JN1L 4ZSOA 2YMXL 4YZFE 4HWZA 4YHYB 3CZGA 4ORGB 4YHZH 3GI8L 4PRPB 4IBQA 1TVBA 4MXWH 3VCLA 3IDNA 2YBGA 2Q5ZA 1EFXA 1I7FA 1F90H 5DFWH 2Y07H 4AGQA 4XVUC 3TC9A 1RP3B 2UXBB 2J8UE 4PIRF 4FYSA 1E4KA 1T4KB 2FD6H 4PWKA 1LJMA 4OM0L 3OB8A 2E5EA 2A74C 2FT6A 4OZGE 1LEIA 6FABH 5EWIH 1KCVL 3VD9A 2A7BA 5F6HJ 2Z1PA 5HHME 5AUMB 1AKPA 2ZE5A 1IEAB 4RGOL 4NO5B 3V6OA 5A2CA 2IM9A 1N34O 3FQNA 1YTFB 1T5WB 1J12A 5BW7C 3QUHA 5J2TB 4AW7A 4ISVB 1YYML 2VLRD 3IT8D 4ZMQA 3PDOA 1N59B 5C08D 1A8JH 4XPHL 3PF2A 3CN3A 3SBPA 2J7LA 5EN3A 2DWEB 2VE6B 3B2XA 4PJBA 4AK1A 1QHTA 1WGVA 3QCUL 5IBTL 1MOEA 5EBWA 5D7SH 1E90A 3WFBL 1NCWH 1TLKA 1XMOB 1HI6B 4EN3A 2DLHA 1UEYA 4TVPD 1MNGA 4QJ4B 4NKIL 1FFRA 4MAYD 4UOQA 4YLBA 4PTUA 2EDFA 2AZAA 5C9JA 2CAZC 5ESQA 5DMIH 5E8EB 4Z7QF 3U9UB 2P4KA 4DV0O 2A6JA 3AG3B 1EFXD 4I2XA 3WUWG 3JSSA 1SQQH 3KWVA 4G7RB 1N33O 1RH8A 2F19H 4WDIB 1VQLV 2CTWA 1T04A 3QNFA 3KPSE 5EN2A 3EBHA 5I1GL 2A06H 5DVNA 1CGSL 1FG9C 1Y7VA 1QR1B 3KCYA 2CUAA 4X6BA 5J6HA 2FWUA 1CE1H 1OAXH 3CX5J 4WWKC 3K6OA 5KTEH 2R1YA 4HC1L 4KV5F 3WXVL 4F8NA 4RAUB 1KFGA 1QFWL 2IFFL 4JFDA 3HFFA 4DUYO 1EAJA 5DQJA 3I3BA 1FG2A 4J23A 5IQOA 4RRPG 5A43C 2X3CA 1PQZA 3BQVA 1A7QL 3EJTA 2FIRT 3QO1B 3T77B 2IOOA 3WNOA 1Q3EA 2J88L 1JDCA 2F5BH 1D7FA 2R0LL 3KJ6L 3QORA 3UTSA 4JFHD 4M6MH 2QWNB 2OYQA 2IBBA 4DUZB 2P4AB 2Y6TE 4AUYA 4LF9O 1YVLA 1LNUA 2DMHA 4R84A 3VXTA 5E08L 2AMUA 5I8EB 1UB6B 5L7XL 4MAYA 4XNMB 1H3TA 2C9AA 3LKOB 3N0AA 1TEGA 3QRGH 1Q0YH 3OKLA 3KXFA 2ADIB 3D39B 3E6FA 5CEZD 1R3LB 1E65A 3ARXA 4PJXE 1XSOA 2AQPA 4XMPH 1CDBA 2R0KL 5AOJA 1KCSL 2NY4C 2YPLB 2HTKC 5C07B 4KXBA 2DLFH 2EJ7A 1VQ8V 2WXMA 4WK4B 3UTPE 1H2LA 3CVCA 3RL2A 5B38G 1DFXA 4OI7A 3EH3B 3K9SA 2X6MA 3N1PC 5C0GB 3M99B 1M1XA 3U0PA 2OMZB 4JI6B 2ZOWA 1BQ5A 2ADGB 3K59A 5EC1C 3QK0A 4YSDA 5JHDA 4RGMB 1SJEB 3MNWA 1AZNA 2GI7A 4XMLL 4JQXA 2BVPA 3IE4A 3O81A 4IGBC 1MJUH 3WG7C 4A63A 1JXJA 1IC1A 2AABL 1N9PA 5EYPB 3QAZC 2ZWSA 2OMNA 4PBVC 1AP2A 5J3HD 5HYEA 3O8XD 5IT2L 3ZCCA 3S0PA 3O6KL 5E4EB 5EYPA 3GIVA 1BVLA 4UCUA 1JVOA 3FOMB 5BRZD 2CLZB 4HXAH 3BT2H 4B7IA 1DTOA 1OSYA 5TDNA 3QQ3A 5A9GA 3S37L 2ZF8A 4LF8O 4PRBA 3KG2A 1QKZH 5T8IA 3WFZA 4BBWA 3MRBA 3WUWB 4RSYA 4JO1H 2ZXBA 1AXSA 1WFMA 2GJ6A 3RA7L 4TVPL 3CDZB 5FOBB 3VGAB 4FQ2H 3ZZ1A 1FE8L 5I6OA 4YHPA 3GMOA 3PGDA 1KJVB 5C0AB 1NANH 4YHKL 3KXFE 3HR0A 1IGIL 4KO5A 5HHPA 2XZCH 4LVOB 4MZ2A 4GQZA 2XY1A 3OR6A 4PBWD 1HEHC 4XP9H 1OP9A 3FB6C 3B3BA 4IIQA 3OWRA 3TL5A 3KZ8A 3ABLC 2JIXA 5FA3B 3ISYA 4ONGL 3VB8A 5F9JB 5MI0C 2EZ0C 4QMEA 4HMDA 1FAFA 3CN0A 3GHBH 1HSBB 3BUTA 4W6YB 2FECI 5FYJH 4PJ5E 3P2TA 1NFIB 3I56V 4PV8A 2WCPA 3JWOH 1MJ7H 2BJMH 3CXFA 4S1DC 4LWSB 2J6EH 5ELIA 4LC1A 3SDCB 1AGCB 3WJLC 5I30H 1GYWA 4BDVB 3MV11 3CWBH 3H9SA 1T3FB 2H2PD 4G6JH 2CNZA 4KNSA 5K9OA 5KYUB 3CRRA 3TCTA 4XH2A 4X1YB 1XCWA 1HOEA 2BC4A 3HS9A 1U33A 3V10A 4DKDC 2KMWA 1XF5A 3WI9A 4A2HA 4OX9O 1HQ4B 1MCLA 2AQSA 4YE0A 3U7YH 3L1EA 4P2CG 3IWVA 4WDIA 4ZZKA 2HT4C 3S5LG 1MHHB 2DD8L 4YX2L 3D05A 4P2OA 1SY6H 2R69A 4QHUA 4XPBH 4J10A 3VD4A 4QRSB 4G9DA 2LAAA 3TT1L 1MW1A 3K58A 3OJMB 4KRMB 2K8MA 5E0FA 1Q9KA 2K1EA 3NAAL 4LSQL 5B1BC 3ZYOA 2XFXA 1ACYH 1Q9LA 4O4HB 5JHLA 4K0OA 1J5CA 3R0NA 1E3XA 5KYNA 2Q76A 2VISB 3CVDA 4OD2B 2P80D 2ARJB 4ZMTA 3K72B 5FB8B 1L9QA 1CR9L 4PJBE 2C9SA 3ZT5A 1QBZA 2IGFL 3QIWC 5F0LB 4CS2A 4NQSA 3AWEA 5EU6E 1V27A 1E50A 1EIBA 3F7RA 2Y1VA 4L8JA 5TH2B 1M1SA 4GQ9H 3WO4B 4F8QA 2XY2A 4MGXA 5FW7A 5KAIZ 3C2AH 3FRPA 3MCG1 4Z7WF 4K5NA 4NO0B 3WSQH 3II2A 4N86A 1D3CA 5EU4A 4Y19E 2QQNL 3F7YC 1CIUA 2P46B 3QDME 1MG3C 2R29H 2XG5A 1QSVA 4HAGA 1N2RB 3P3SA 1FWXA 4GW4A 3EYVB 1LWJA 3QDGB 3WB2A 4PJ7B 4CMHC 1JERA 4K3JL 4I5SA 4KAQH 5CEXB 3CPWU 2VMEA 1N8OE 1P4UA 1FFNB 1U41A 2UWEA 5IV2A 4LFHD 3VO0A 4JDZA 1E5BA 3KYOA 5B22A 5EF2A 1E27A 2PPFA 1MXDA 2AXGB 4LFAB 3L48A 4HJ0D 5D1XB 2ZE8A 2DQDL 1OWWA 5I75C 2JJTC 2P24A 2KL6A 5JYLA 3CFUA 3C6SA 1E42A 2P80A 2IALA 2HP4A 4PS3A 5B1AC 1Y1DA 5ID0A 1M6UA 3PPSA 3QJHA 5GGVH 2OL3B 4I50B 3J81N 1J0ZA 1OEZW 1R5WB 3LYRA 4IK6A 4IIZA 2DMGA 4LPTA 4PW3A 1QVFU 2WHVA 1EHKB 1LO0L 4MJIE 1WP7A 1M4KA 3B5HA 2NZIA 4X4MA 4QWWC 3NQIA 3KLHD 3WJJC 1JWUA 2J8OA 3FN3A 4ENZA 3MRRB 4FLXA 3GSVB 2CXGA 1GS8A 1IBLO 3L1FA 5DJYB 5EZLB 2VMJA 5GS0L 3O2WL 4GKKO 2XJKA 3NIFE 2JS5A 5E9AA 5CM1A 3ZGHA 5JVDA 3ZMUA 1TO4A 2G0LA 1LD9A 2ICEB 4UU9B 2F5AH 1BOYA 4I89A 4PJAF 1S9VB 3I50L 4ZQKB 1N67A 3GTNA 3BX7C 2PCXA 1IKNA 1W15A 4HEME 5D1ZB 4WZ9A 2Q6WB 1BXAA 1LM8V 4P5MA 4ZXBD 1IZJA 1HL8A 2KKQA 4FL4C 3W7TA 1UENA 1T2QH 2JH2A 1IBZA 5DC0A 3CX2A 1PD3A 3HN5A 1NBMG 3A4DA 4NCDA 4NNYB 1FGVH 3MD0A 3HI1B 1B06A 3EFOA 3DO7B 4WWKA 4V1DE 4FQLH 4NIKB 1TNMA 5D7LD 1HCFX 3JASB 2MQ3A 4C57C 2H94A 3P2DA 4RVBA 1L9TA 1JOYA 1MFAL 4APXA 3R7RA 4Q52A 4OZHE 1PG7W 4RAVA 3SY0A 1UGKA 3QH3A 4KY1L 3ARDB 3R1GL 2XTJC 3S35H 1XILA 1Z9SB 1HQRB 4PY8I 2CUGA 1XH3B 1IGYA 3RGVC 4X66B 1QFWH 2A0LD 1OCZC 3MBXH 3BVWA 3QO0B 2HG5A 1SEQH 4Z7QE 5KUKA 2BIQA 2GIMA 5AZEL 1S77D 4G6FB 4DP6X 3CZFA 2O72A 3PXHA 3GI9L 4HULB 2B20A 4W9ZA 1I1FA 4YPGA 2FO4B 3LIZH 3CH1A 3N9GH 2HFGH 4JI1B 3R7QA 4JPQA 3U30B 2ZXEB 3GIVB 3A3YB 3VQLA 2Y69C 3OJDA 3CRQA 4ONOA 4Z7UA 4XCYB 3SDAB 3S2AA 2HLFC 3DX9B 4PS7A 4HC1A 4WWPA 5TGBA 2WLLB 4DGIH 3UTTA 2XIDA 1G7QA 3FQUA 3HPLB 1Q0YL 3H1ZA 2FX7L 4G5ZL 4ELME 3RWRD 3H3PH 2VNCA 4FP8H 4QDGA 1YG9A 2DQJL 3LHPL 3TA3A 3LKSA 1RHHB 4JJOA 3H3BC 3IJEB 5GRYA 3GNMH 3MNVB 1X4XA 2M7WA 4U3SB 4N2NA 4X5XB 3PREA 5IF0A 4GKNA 4F8OA 1MA1A 1HHHB 2DQHH 5ADPL 4B9GA 5A7BA 3FHQA 5LOVB 1Z3GL 1MCHA 4X64B 2P48B 3FQXA 3RL2B 3U4AA 6PAZA 5KYYA 3LDEA 3V0WL 3VXNA 3WENA 5JQHC 2R83A 4KHTL 1UJWB 5IF0B 3LKNB 5I1GH 1QEWA 1TQVA 4FA8A 1NC2A 2DQ0A 2ENPA 2BS71 1DQML 2Y24A 2Y25A 1DE4B 3KLSA 2PW1B 1VIBA 1HXKA 2EJRA 1KIQB 1D5ZB 2QVIA 4FQHB 2K6ZA 2VDRB 4O51A 2V2TA 4XX1E 4UQEA 4YLQT 4IJTA 2GTZA 5A40E 5E2JA 1I7TB 3NP4A 1QMUA 4JQVA 5H94B 5A6LA 5LNGA 2VW7A 1ZT1A 1LNUB 1QW9A 2QR0B 3D4CA 1JHKL 1F3DH 3BH9B 2R0LH 4RGOH 2LHAA 3QG5A 2QVKA 5LXGL 2DWEC 2J88H 1BS3A 4QXUH 3UTQB 1WP6A 3MBWB 4CJ1A 1KGUA 5J1AB 5ACZA 2DIAA 5CNHA 3N41B 2HH0L 2YJQA 4OM0H 5FO9B 1BM3L 1NGYA 4JI1O 1XZWA 4U6VL 1NQBA 2KKWA 4YDIL 4AILC 1P6AB 1A7PL 5FUOH 1MCIA 3ZEDA 4PV1B 1DO6A 1HDMA 1NANI 2BY3A 3CDCA 1IAIH 3MGTA 4KBPA 3JD4A 2X4RB 4KV5E 1NMCB 2YAQA 1F51A 2YZ8A 2VLKE 2EZOA 3BWAA 1OHZA 1HILB 1URZA 1YPZB 2JEXA 4LEXH 3TVMA 1R24A 4XX5A 2FO1A 2W91A 4LCWA 3UKMA 1VEWA 2CH7B 4OAWA 5F1OB 2QKIA 1NI8A 1U4FA 3LDBB 1WFJA 4KMQA 4EZLA 3S3SA 3SCMD 5H2BB 5IHWA 3SDDA 2R0ZL 3W11D 2QLVB 1TTRA 3CJHB 3ZJAA 3E80A 4NQEE 5ADOH 5IHZB 4ZX3A 5J1SC