2EIKB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eikB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eikB02
2BWIA 2IH8A 2Q9OA 4UF7C 3T71A 1ET5A 5I6KA 2EIJB 3KW7A 4WTQA 1J9RA 1OE1A 1BXUA 2XXFA 5B1AB 1L9QA 4AKQA 4N8UA 1AQ8A 4UAHA 4NERA 1BXVA 5B1JA 3ZX1A 3NT0A 3T6XA 1PZBA 2BZ7A 4A68A 1GW0A 3OM3B 1ADWA 4M4RB 1RKRA 4BK5C 1AACA 1NIBA 1PNDA 1M9WA 4AKOA 1NIFA 3NJNA 1WS8A 3ABLB 3NSCA 1L9OA 1WS7A 1OCCB 1ID2A 3NJMA 4E9QA 3H4FA 2PP8A 4QLWA 1JZIA 2R7EB 3AY2A 3UGEA 4KO7A 3WIAA 2HXAA 3BVDB 1JZHA 4YSPA 1NIDA 1GYCA 1XB3A 2GI0A 3QQXA 2UXVA 3FYIB 2VN3A 4AX3A 1WA0X 4PAZA 3FQ1A 2J5WA 4G7SB 2VW6A 5LDUA 4BWTA 8PAZA 2BP8B 4GYBA 3DIVA 2QPDB 5D4HA 2X88A 2GSMB 2VW7A 2QPEB 1A8ZA 3N55A 3PXLA 4GY4A 2FQFA 4DP7X 4NAJA 1OE2A 1MZZA 2DV6A 3IE9A 3DKHA 1IKOP 5I28A 1NIAA 1UATA 2I7SA 2RACA 1WA1X 4BWUA 3FQ2A 3NJJA 7PAZA 3NP4A 1R1CA 2XYBA 3QJSB 3ASOB 5I5IA 1PAZA 2GBAA 4E9SA 3FU9A 4BDVA 4A2HA 1SJMA 3C75A 2OV0A 1TKWA 2DWSA 3U25A 1KCBA 2P80A 2YAQA 1IBZA 4YVNA 1AAJA 1KDIA 3UADA 4YSCA 1KDJA 3S8GB 1ZDQA 1GS6X 1I53A 2BW4A 4JHUA 2FT7A 2XV3A 4F7KA 1OV8A 2DYSB 4P5RA 1KBWA 1AS8A 1XMEB 1JZFA 1N70A 1TEFA 2AZUA 2CBPA 3FSAA 3AG2B 2WO2B 3NJFA 3OD3A 4DPCX 5B1KA 2CAKA 4TXVB 1ZV2A 1NWOA 1JOIA 3X2QB 1V10A 1PLCA 2PCYA 5TK2A 4UANA 5I6OA 1AZRA 3WKPA 1L9RA 4E9YA 3D12B 4YSTA 1NPNA 3TASA 1GR7A 2Y69B 2ZONA 3QJRB 2AFNA 1VLXA 4DP4X 1T5KA 1FFTB 1L9SA 1JXFA 1PZCA 5B3SB 3RYMA 3CDZA 1CYWA 2ZXWB 1L9TA 6PAZA 1FA4A 3ABKB 2VSMB 4Q89A 1JERA 4KO5A 2PP9A 1A65A 1AOZA 2HRGA 3X1EA 2PLTA 3FS9A 4YSEA 4M3HA 2BW5A 1FWXA 2NRDA 4P5SA 4A2EA 3GYRA 2CJ3A 5I5MA 1A4AA 3ABGA 2H47C 2Y1AA 4FA7B 1NICA 4BDVB 5I6MA 2BZCA 1RCYA 2E86A 2OJ1A 4A2DA 3AG1B 2FQEA 4CSPA 2J55A 4QKTA 4KNSA 3L45A 2XWZA 3QPKA 1BYOA 1AG0A 1NDTA 3HEIB 5D4JA 4JHVA 1AANA 3PAUA 4KOCA 1OCRB 1SF3A 4DP9X 5B7EA 3MX0B 4E9WA 3S3CB 2WO3B 4G7RB 1E65A 3FU7B 1JXGA 4X4KA 1F56A 3WI9A 3X1BA 2ZWNA 1ET8A 2IWKA 1IUZA 4RH4A 3X1NA 3HB3B 2VW4A 1JXDA 3CG8A 1A3ZA 1PZAA 2IDTA 1GS8A 3V9CA 1SDDA 5EHFA 2A3TA 4MFHA 3SBQA 3OMAB 2AVFA 2FT8A 4YSAA 4DP6X 2XU9A 2GC4C 2YAEA 4E9XA 3CDZB 2BO0A 1V55B 1XB6A 3PPSA 2H3XC 4KNTA 2AZAA 2XLLA 5PAZA 1SFHA 2PPEA 1YLBB 5AZUA 1JVLA 2FQGA 2MRYA 3G5WA 4N4YB 1EHKB 1ILUA 5F7AA 1PF3A 4KO9A 1BQKA 1E67A 1A4CA 2AANA 3GDCA 3TA4D 2B3IA 2HRHA 2LLNA 2XX1A 3JTBA 1SF5A 1A4BA 2JFCA 4BXSV 2XV0A 2BP0A 1ZIBA 1AG6A 1BEXA 3NYKA 4E9TA 4W1TA 3IN2A 7PCYA 3NJKA 5FC9A 3S3BB 1OOWA 1N68A 2YAOA 1B3IA 1J9QA 4YSRA 3V9EA 1ZIAA 2YXWA 6PCYA 3EHBB 1E5YA 1QHQA 4DP2X 4KOBA 2EIKB 1OCOB 3UACA 2J57A 3T9WA 1IBYA 4YSOA 1KV7A 4WKXA 3QJQB 3FSWA 9PCYA 2TSAA 1J9TA 2CCWA 1SDDB 2FNWA 2HX7A 1KYAA 1L9PA 4W9ZA 1W6LA 2BWDA 4E9VA 3PAVA 2WSDA 5B7MA 2YAHA 5PCYA 2YEVB 2DYRB 3EF4A 3KW8A 2GHZA 1EZLA 1BQ5A 3S3DB 1DZ0A 1PY0A 3NSYA 2EILB 2YAFA 4HCFA 3T6ZA 3T6WA 1XB8A 4HCGA 1QNIA 1HAWA 1ETJA 2HZHA 1J9SA 3WKQA 1PLBA 1W8EA 3FYEB 1PMYA 2JKWA 3EH4B 2MTAA 3CVCA 4KO6A 4PCYA 1TEGA 4AZUA 1AZBA 4F2FA 3OMNB 1ILSA 2BP0B 3CVBA 1MG3C 1OF0A 2XVBA 5B7FA 2PP7A 5I5JA 3OQRA 1NIEA 5I6LA 4L0PB 2OCCB 2I85A 5AFAA 4AI7A 4GP8B 2UX7A 3SBRA 1OCZB 2YXVA 2BP8A 2W8CA 2W88A 4YSDA 4EF3A 1GY2A 1SNRA 2HX9A 2J56A 4FAAB 1BAWA 1CC3A 3PLYA 2P80D 1MDAA 2XUWA 1KGYE 5A7EA 1AZNA 2FQDA 4HHGA 5AKRA 1ASPA 2QT6A 4HCIA 3TBCA 2H5UA 2YARA 4ZK8A 3TBBA 4DP8X 2DWTA 2QDWA 2GB2A 2X87A 4AKPA 2PPDA 2GIMA 2N0MA 2BHFA 3OMIB 4G71B 5I6NA 2B08A 4ENZA 1NPJA 3AZUA 2VMJA 1NTDA 3T6VA 4BXVA 2IWEA 4A2GA 3QJUB 1BQRA 5I6PA 4E9RA 1NWPA 1WAEA 1JZGA 2PPFA 3X1GA 1J5CA 2UXFA 5D4IA 3AG3B 3CZUB 3FU8A 4KNUA 3IEAA 2UXGA 1AZCA 3SQRA 3EH5B 3EH3B 1KBVA 1URIA 1ZPUA 3UAEA 4A66A 1NINA 5IY5B 4YVUA 3NSFA 1CYXA 2PPCA 2IDQA 3S8FB 1ASOA 3NJLA 4GP5B 1CURA 2FTAA 5ANHA 1PCSA 3FSZA 3AG4B 3ABMB 1RZQA 1AS7A 2EINB 2QDVA 1GSKA 2XXGA 1IC0A 3ZDWA 2YAMA 2IWFA 2IDSA 3FSVA 1AZUA 1E5ZA 4NB7A 4DPBX 5B1BB 2GC7C 4HIPA 1OE3A 3ZBMA 1SHXA 1X9RA 1MG2C 1GS7A 3H4HA 1WA2X 1AS6A 3ASNB 1DYZA 1MZYA 4F2EA 3UABA 2FT6A 1SHWA 1AIZA 2CUAA 1GY1A 4BWWA 1TU2A 2YQBA 3GXUB 4HAKA 1BXAA 1PLAA 1W6WA 2HX8A 2IH9A 2JXMA 3FQYA 5I26A 3TU6A 4A67A 4G7QB 1CUOA 2I7OA 4DP0X 1M56B 3DTUB 4HZ1A 2HLEB 1JZJA 2PPAA 3QJVB 1KCWA 3ERXA 1JVOA 2EIMB 3MBWB 2UXTA 2VM4A 2IDUA 1BYPA 1J5DA 3FPYA 4G72B 3WG7B 3AW5A 3FPXA 3NP3A 2FJSA 3FT0A 2VSKB 5TK4A 3PAZA 4Q8BA 3FU7A 3WNIA 4YSQA 5F7BA 1NZRA 2Q5BA 4K9JA 3NSDA 4DPAX 4YSUA 1HFUA 2XX0A 2PCFA 2YAPA 4YL4A 1SFDA 1RZPA 1V54B 2R7EA 3CVDA 1AR1B 4G70B 5E9NA 3ZIYA 4JKNA 2UX6A 1JZEA 4HALA 1ET7A 3PCYA 2ZOOA 3X1FA 1ZDSA 4HHWA 2CALA 4A2FA 3IN0A 3IBOA 4YSSA 2IAAC 2VM3A 1X9UA 3QJTB 3SBPA 3JT2A 4CSZA 3H56A 1QLEB 2TSBA 2IDFA 2DY2A 2FWLB 3NJIA 3N2JA 1ASQA 3NJHA 3NJGA 2XV2A 3BQVA 1HAUA 1M57B 4GP4B 3UAAA 3WNJA 4GXFA 4DP1X 1PNCA 4DP5X 1E30A 5B1JC
chains in the Genus database with same CATH superfamily
4MNGB 2BNRE 4Q20A 4IQHA 1IB5A 4EOWH 2LU3A 5DD0H 4AV4A 4LXFA 1NM4A 1IAOA 2AJZB 3FFCE 1Z0MA 2AXGA 3AAZB 4EVNA 2DLFL 4HU2A 2EDXA 4M02A 4PJAF 4U1NB 4J4PD 3I6KA 4O2BA 4JI6O 3G5XB 3ZHFA 3GSOA 4W4NA 4ELKB 1FL5B 3WNNA 4JM4L 4M5YL 5GRWA 4EUPB 2EULA 3P2DA 4AYID 4WK4B 5I1LA 4CC0A 5F1NB 3AG2C 3BKMH 4M4RB 1EEYB 2VXUH 4AKOA 3GMRB 1Q81W 1NC2A 1NGXA 3ZKXC 3H4FA 4FQQA 3O2DL 1YMMD 4Q97A 3S96A 3ZKNC 4QLWA 3RFRA 1A3RH 5IYCO 1M7DA 2VDNL 4JG9A 5C70A 4I7ZC 3ARUA 2GW5A 3SE4A 2JIZG 5DRZA 5FYKD 4H8VA 3UJJL 4ZFGL 1DSYA 2EDMA 1J5EO 4JASA 1PX4A 3NJXA 1T3FA 2ARJA 4FLVA 4O58H 3TO4C 2UUDK 3DO7B 2OMTA 4OV6F 3UJTH 2L8AA 1GKEA 3THOA 3D3VA 3C5ZC 4RX4A 5D96B 4H8QA 1XCQB 1TTFA 2VW7A 4JFDA 2JH2A 2ZOLA 2AXHA 3PXLA 4NHUA 4NYKA 3K8KA 3N40P 4NT6A 4WEBH 4F2MB 3SDCB 4A7TA 5MEPB 4TLKA 1N26A 4L37A 3WNLA 2KL6A 1YQVL 2J4WH 1WLHA 1DBML 2DQFB 4XBGA 2DMXA 2XOTA 4H26B 3QXWA 1F4HA 4OCSL 5DC0A 5EO9B 5ENWA 4BQ8A 2GJ6A 4RWUA 3D8MA 3QUHA 1QFUH 3S36H 4PA4A 4MQ7A 5F3FA 3F62A 4E9SA 1F97A 4AK1A 2ED9A 3JV6A 3SE3A 4XB3A 3MLYH 2FECL 2QLYA 2BNRD 4NWUL 5T33L 1IMHC 3CYOA 1W0VA 2XVLA 4X4ZA 1AI1L 1JNHA 3BD3A 3FFCD 2E4FA 3OUSA 4YVNA 4E68A 4ADGA 4F15C 4Z7NF 1SQQH 4G80B 2JLPA 3KBFA 2WGXA 1MFCH 3V4PH 1YJWV 5EYPA 4KMLB 4WJ5B 4XCNA 3OX8A 3MFFA 1QLEL 2OPCA 4I13B 3IGFA 2B5IC 2GSGB 3K2UL 2GHWB 3HB3C 5ADPL 4P9HH 1UC6A 3BRCA 1X59A 2A9HA 3LDEA 5TE4H 2X4SB 1EJ8A 1CQKA 1QBML 2X6AA 1ZV2A 2QADB 4FI6A 4RIRB 5T5FA 4S0HA 1JX9A 3MZTA 2I9TB 4Y2DD 4AT6A 4H5SB 1P5UA 2BP5M 4MAYD 1O6SB 1IM9B 1ZLZA 1VQKV 2R8SH 4FQCL 3W5MA 2VAJA 1X5ZA 4JI3B 3DOIA 3MRFA 3QJRB 5IDJA 4AE0A 3SKNB 5LHDA 5D1XE 4EB6B 5DJ6B 1E4HA 1R5VB 2YR3A 2BY0A 4XN2A 4LFAB 5IESH 1M6OA 3Q1SH 4PR5B 3UAJC 2XPYA 1CICB 3D8CA 2X6CA 2FGWL 2VZSA 4G59C 4X4XB 4GOSA 2W65B 4IYIA 3X1EA 5HHQA 4JTCB 2CR0A 4XOBA 3VFRA 1TETH 2PWGA 2O6EA 5I66B 1B4LA 4MGXA 4WU7A 5AAPA 1EQWA 4MA7L 2RR3A 3D87B 1CR9H 4HIXH 1SLUA 3DBXB 4JDVB 4BRVA 4JMXA 4ODXA 5AKVA 4P5TD 4ZFFA 4J27A 2FQEA 4QRBA 4L29A 4LSRL 5IK3A 2YPKA 3GMPB 2DBJA 3PQYB 2BTOA 1NOLA 5BRPA 1XBRA 2O61B 3WEAA 4AMKH 3HEIB 5GJTH 3CHRA 4OF8A 4EPSA 2UVEA 5CB4B 3ILPB 1KULA 4IT5A 1RJYB 2DJMA 4ZMVA 3MRIA 2B1OA 1KELH 4CA4A 1KJ2A 4OX9B 3NPSC 3G6BA 1FI8C 4PBVC 4YDKH 3AT8A 3HG2A 3FKUS 4JW3A 3S3CB 4ZO7A 5TGBA 3ARGC 1MCPL 2NX5E 4QUOA 4XMXA 4PJCA 5I74C 1A7QL 2NY3D 3HPLB 4WW2F 3D3QA 4X9FA 4D9QE 3NCWA 4LF6O 1UD4A 1EHLL 4H20L 2XWCA 4QO1B 3L7FB 1R3LC 4YO0B 2DYRC 5HI4C 1LK2B 1DK1A 4HKJA 4IKLA 4UCVA 4JO4L 4LFCO 1NCAL 3OMAB 4ONGL 3SBQA 4KXRA 3R0NA 3T1YO 3HUJF 4LVNB 4F20A 4LP8A 1A6PA 5KTEH 4UQ3B 1LEKA 2OMXA 1XF4B 2HKFH 4RFOL 2WP3O 4MS6A 2Q76B 3CN1A 5KN5B 4YHNB 2CM5A 4QKXB 5HD8D 1MWAB 4GIPD 5D7LD 1S5HC 1QU7A 2IQAB 1WGVA 2I9LB 4ZYKA 2GFBB 4AIZA 4X1IA 3MUZ1 5F7NC 2BDNH 4HK0B 2E5EA 3UT5B 2P06A 4J2XA 4N4YB 2CGYA 1PCXA 5T1JA 1MXDA 3K80A 4M7LH 2AI0L 2Z31C 4GSUA 4ODVL 4BAYA 1XZ0B 3FTSA 5CP7B 4JPVH 1TJHL 4XN8A 5KANG 4ADIA 2QEJA 4JANB 1TJXA 3KYAA 4LOUC 4QDGA 4U6TA 2Q7EA 1RP9A 1KYFA 1SN0A 3MA9H 3L75H 25C8L 5DO8A 5E8NB 4FXGC 1VZHA 3LKNB 2Y23A 3SQOH 5M95B 3O6FA 1GMIA 4LH6A 2C7UA 4FMTA 3LIZA 5HDQH 4CMHB 2DAVA 3L73H 2DKMA 2DWDA 1QHQA 1NOFA 2ICWA 2WBXA 3MNVA 4P9OA 4GSDL 4W6WB 3RBSA 1JN6B 4IIJB 5ITFA 3VD1A 5HJ3B 5T3ZL 4JBSA 4NKGB 3AJ7A 4IIZA 4D0BA 4F7MB 1JNJA 3TJEH 2TSAA 2V7QG 3I9IA 3EJZC 4NXMB 4KP4A 2YLKA 1K5NB 5D1ZA 4IRSA 3TIDA 1AGEA 2CJUL 5EOQL 2PF6A 1ZXKA 3A0HZ 1S7UB 2XIDA 2YAHA 3PXHA 1GGUA 2BPBA 4GEJA 4DV4O 1WC7B 2JI3A 4W9JC 1KCRH 1OSZA 3QJOA 2CK0H 3F6LA 3PP3K 4EI5A 3QORB 3PL6D 2WYIA 5LMUB 1TQBB 3BCDA 2YZ1A 4XC3H 4GLRH 3NFPA 5FO7B 4PJEB 4UTCA 4AZ8A 4BKLA 3RI5K 5LGNA 4PJIE 4RGNE 2UZXB 4B0MM 4ZXBA 1KIUB 2DQDH 5I75C 1RIVL 5EPMB 4XPBL 3IVKB 4WY7L 4DTGH 2ZX6A 4M7JH 2WMPA 3I02A 5FAAA 3HCVB 1K8DB 1EH9A 3LRGA 2P24A 3BWAB 2XAHA 4KKQA 4WTWA 2WQ8A 4YY3O 4XPHH 1G7QB 1ND0A 3LQMA 5DRWA 5DT1L 4WI0B 5E4EC 4AQ8C 3FQUA 2A3QA 3B40A 2C7FA 4XP4L 3GSVA 3OHMB 4DHLA 3NK3A 4NPKA 5ACMA 2CA4A 4OLUL 1VQMV 1Q8MA 5ANME 4U31A 3ZSSA 1WZ1L 4M3JA 4X80H 5JUEH 1E27A 4HLZH 2AAVA 3BPOC 4PLJD 3WFEL 3M99B 4ZIBA 1Q1JH 2WWMC 1HEHC 1RIHL 2QHRH 1HR0O 1Q0XH 2WZAA 5AOMA 5AW0B 4FAAB 3ULVL 4Z7WA 1RU9L 2VRZA 2E8ZA 1BOYA 1EN6A 3WFBL 1AHWC 1AJ7H 1NTKH 1ZV9A 4GRMB 3TBCA 1T2QH 2YARA 1ZK5A 2JF1A 3TEUA 3KGTA 2N04A 1L8DA 4PGEB 1UD3A 1WFJA 3JUZA 1UB5B 4OLEA 5SWSD 4CGUB 1GGCL 4IEFB 4G82A 1SY6H 2AKRB 2ZKHH 1JYXA 1KTDB 1R46A 4FEIA 5IFAL 5ITBH 4QRPD 3NTCL 2HUHA 3T6VA 1UD8A 5IFJB 4FNRA 1G7LA 1A7NL 5K33A 3TGXA 1OSEA 4O02L 1Y74B 4QIWF 2RQ8A 3IKCB 4G8GE 2JGDB 1RHHB 3BZEB 1DBKL 1NWPA 2YK1H 3HKCA 1AXIB 1GYWA 2H1PL 3LKRB 4JDZA 1SQFA 1BHAA 1R0AL 1H5BA 4XVTH 5DVNA 3WXVL 1J5CA 4L3FA 1N10A 2LAAA 4N0CC 5KVEE 1I8KA 1SOKA 3VACA 3UP1A 1FSKC 1V8HA 4BCYA 4RGND 4M5TA 5K9KA 2DDQH 5GGSY 4LPVA 1JMZA 1CLOL 1K4CA 3GSXA 5JW4R 5GSVB 1M71B 5F88B 1DVTA 4IYKA 5MEQB 5I16A 1WEJH 4XODA 1BFTA 1Y76B 3PS6A 3S8FB 3NJLA 4MMXA 2WLLA 1A6WL 3KVDD 4G6ML 4KJYA 5JIQA 1CDJA 4AGMA 5CGYD 4XNQA 4FQIH 3C3SA 3WIHH 4ENEC 4ZSOB 1GSKA 2YXMA 3EOBA 4HZLB 1E79G 5F7FA 1RD6A 2IBBA 5F93C 4RWYH 3ULUF 3NG5A 2AJVL 3FUFA 4HIPA 4OZIE 2X2HA 3GM0A 1SHSA 3D2UB 2H1XA 1E7VA 1CK0H 1KG0B 2NY2C 2FJGA 2E3VA 4ZX4A 1Q90D 1SBSL 2DJVA 4X98A 4S1DC 5IVZA 2BVPA 5SX4I 1C7SA 4TUYB 1NSNH 5HI3D 4MNQE 3AXLB 4EDXA 3TCLA 4Y5YC 2VMCA 2PN5A 4FFWC 1I1CA 3IDJA 3QRGL 4N0YH 4A67A 5KS9F 4LCIH 1ZE3C 5CP3H 1QI4A 3ZRCC 4XNDA 4GKLA 4PBWD 1M56B 5HXMA 2BFVH 1KU9A 4AQEA 5IVXA 1A3QA 1O7VA 2VE6B 2YA0A 2XN2A 4LF7B 3V55A 5ECGA 4NXKA 3G6JB 4IL6Z 2IJJA 2DQ6A 3SCMB 2J5LC 3MAWA 3QR0A 1L7IL 1A7PL 4O5LH 1U6AH 2H0EA 5DZLA 2J1XA 3QQ9D 4GINA 5T3XE 4LE8A 2WQRA 3T0AA 5BZDA 5JHMA 3WTXA 3O6LL 5T1LD 3ZDXE 5GGRB 2VZTA 1GSMA 4Y7OC 1PKQE 1E9PA 4BFOA 2RHEA 2EICA 4YHOL 1NUNB 5KX5A 1PYWA 4R0LB 3SDYL 2B9BA 3D18A 2G4EA 5EH1A 1ITCA 1PFOA 3M8AA 3O45B 5BUGA 5KAFZ 2EDFA 4UT9L 4U6XB 2CUIA 2ADIB 1HOEA 2YFOA 5DMIL 3WNOA 2UX6A 4FKHA 4Y19A 1WN7A 2F54A 1PEWA 3SDAB 4AEIL 3GJFA 1KZQA 3CJJA 4HBCH 3SDLA 3ARFC 4L8SC 1XCTB 3OR7B 4HHWA 5DZNA 1D2PA 4FRWA 3IN0A 2DTMH 4NC0B 2VXQH 4UMGA 1VFBB 3D4YA 4CSZA 3ZIAG 4HNAA 1DVFA 1R1BA 3EGDB 5D1QE 4E41E 2DY2A 1GN3A 3BWSA 1ZANL 3LEVL 3GTTA 1XQ8A 5AVTB 2ED7A 3NJHA 2XV2A 4L8DB 5AB2A 5E6RB 4HBQA 1MNUH 3ZR6A 4G5ZH 4MNQD 3OSKA 3WLBA 1HCYA 2M83A 2Q9OA 3MLSL 1HEJC 3T71A 2F8VA 1INDH 3J07A 1DF4A 4JI6B 2BSTA 1NCHA 3DURB 1SEBA 1RAMA 5FOJA 4G8EB 3SO3C 1MWAH 1ONQB 5B1JA 5IMLB 3AQYA 2IXQB 2ENSA 3D07A 4NNPH 5IW6A 1QCEA 4IRZH 3O3DA 2IH3B 3P4OA 3U83A 1W16A 2CRIA 3ASWA 3U9UB 4ABMA 5T1MB 1QZNA 1GW0A 1PQZA 4LEOB 2QWNB 1TZIA 3EJQA 4DKFL 3K72B 4GUOA 3QIWD 4ATWA 3X2QC 4LF9O 1WS8A 3NSCA 1TSHA 4I3RL 3VSQA 2OT5A 1E4XH 1CXIA 1J5EB 1D9KB 3K6DA 1D6VL 4KO7A 4RO2A 4HOXA 1CI3M 1UA7A 3NGBB 3VYNA 4BK5A 2FHBA 3TXAA 4N90E 2HRPH 4G2KA 1AJNA 2HPOA 1IEAA 2X3AA 1YVWA 4BD4A 4MVZA 5J2UA 1G7MA 2FATL 2YGNA 3GM8A 4JDEB 4JFEE 3PNWA 4WNJA 4UYPA 4IBUA 3WFHA 3NCYS 5B3SC 5BOPA 1JJOA 1IAMA 3A8TA 2JV6A 3QWRD 5KVGH 5L2JA 4FHJA 3QULA 2CGNA 1BGXH 1SQMA 3H0TB 2Q0OC 1UH3A 5KAQG 3N55A 1N33O 3VFWA 4YHYC 2E3CA 3CFKB 1TQWA 3ZDZF 4J8QA 2BNQB 5LYJB 4ZAKD 5DECA 2WWWA 3PNRB 3DKHA 3K58A 4JPKH 1PP9H 2Q7NA 1Q94A 2B0SH 5K39B 3WJJA 3CFIC 5CCKL 1KGCE 2RACA 5HHPA 1LEIA 4BWUA 1KIRA 1UH4A 5EUKA 5IROC 4XN5A 1MSDA 2YC1B 5DCCA 2B16A 4QWWD 1W91A 1AHWB 2DLHA 4MTFA 4PRHB 3VRIA 4CADB 2GJZA 1PX3A 5IQ9A 5I19L 2IVFC 2ZOKB 4HS8H 2EXWC 4YX2H 4AYFA 5EOTB 4WW2A 1NH2B 2ZG2A 4MNGE 3V52L 2OCHA 2MTPA 3L3OA 2FVNA 1FLTX 3COOA 4OZFB 4JJ5B 4ZTEA 1HCVA 4JPRA 1WFMA 3K6FA 4OJFH 1X5FA 5D2LF 2CLRB 5DQ9B 3LN5A 4MMYA 1W0WB 2IQ9H 4PG2C 2CIIB 5J1AA 3HUJA 2AK4E 1GO3F 4MW8A 2F53B 4MZ2A 3QQ3B 4GRWB 2DYSB 3QIUB 5J6HA 1ZHKB 2C1OA 2XWTB 4KUZH 1NCNA 4N8CL 5B1CA 1ZAGA 4WUUE 3MREB 4WWKA 2FEDD 2XQYK 5LDSA 3UG3A 2JJ2G 1CDYA 2GYSA 1XGPA 5IHUL 3LQAC 3CH1B 5I1DA 1R3KC 5C9KA 4UILH 1TQSA 4Y4FB 3U2IA 1R4XA 3OTFA 5H35B 3CZKA 3UH8A 2VUYA 4W4KA 4N2AA 3OKMA 5DJXB 2AV7B 1YYCA 2CO6B 3MUJA 2A73A 2L7EA 3K81A 4MA1C 4Q74A 2MFNA 4U2YA 5A2CA 1ZVSB 4BSVA 1IGIH 3VD2A 4JN1L 4JY5L 1DBBL 4DEUA 2YKLH 1H15A 1FFTB 5FDWB 5FK9B 2JVUA 1FNGA 3EYSL 3F04A 5BS0D 3CDZA 2V9UA 3BZFA 1I8AA 1SN5A 2ODIA 3N27A 1JFFA 1AC6A 2EDEA 2WTPA 4WWOA 5ABZA 1A65A 1DJIA 2WNWA 3L5WB 4ZS7H 3QUYD 3W39A 4K8ZA 3LJ3A 3FS9A 2BHYA 4MYPA 2OSLB 1DGSA 1E9OA 5FYJE 2HT2D 1XEUA 5C3TA 5AOJA 3OPUA 1C08A 3UM7A 4KHTH 4PJ8A 2CJ3A 5I5MA 3L95A 4AEHL 3F12B 2BFGA 4H8UA 1OD7A 3MKGA 1KGCD 4YXKH 3D4GA 1FZMA 5MP6L 3GSRA 4JCMA 2HUEA 3V5HB 2WTOA 4J7ZA 3D4CA 3MOBH 4FKEA 3VE0B 3QPKA 1EBPA 2EH8H 3E6HA 3L3DB 5E2VL 5JHLL 1CDHA 4JRXB 3BWZA 1XFPA 1Y6MR 4MTMA 4PRIB 3TURA 1FZKA 2VR8A 4DXWA 1P9MC 1JWMB 2NR6C 2VLLA 4RRPM 5GGVL 2MMXA 2Q7YB 3VFGL 3Q8AA 3P2TA 5BCAA 1NBVL 2QDOA 3QAZC 4NKOA 4OW6A 1VCAA 4QRUA 1MWOA 3ML0A 3IMUA 3U0TB 1HXMB 4Y5XA 1HK6A 4IRJD 2GAZA 3D0LB 2EEXA 5CD5D 2X4QA 1HH6A 3GF8A 5CA1A 4LFCB 4PJFF 4OD1L 2VLKE 1IEHA 2ILMA 1FZOB 3T1YB 2PYEE 1F42A 3NDZE 2YA1A 1A1MB 1B04A 1FNHA 3QG7L 3WSQH 2FT8A 4X1KA 3AACA 5TF1L 5ISZA 4LWSA 1T04A 4DVBB 1RUPL 1S9WB 3IK2A 4IBTA 5A2AA 5LGYA 1IRAY 3AQZA 1G6RH 1MJ7L 2AABL 5EC1B 2R0LL 5AYUH 3KDMA 5HYQB 4YK4C 2R9IA 4XBPB 5DQDL 2Y07H 5LBSA 3UBXI 5E1QA 4M1DH 1MI5B 2H3XC 1T2JA 2IBZH 4XHJC 1H3PL 3RA7L 3CPWU 2KERA 2EABA 3WOVA 1F58H 1WZLA 3MLWL 4R9HA 3VXOA 1NMAH 5LBQA 3S0PA 4HWEL 5DURB 4OF5A 4OVUA 4KO9A 3LMJL 5A7BA 4N2DA 3LRLA 5FYJD 4BQ9A 3JBG7 3CXHK 2ZOWA 3SDCD 5D2NE 4K55A 1U8NB 3MXVL 2Z4QA 4O2EA 4DKTA 3MAQA 3PIQA 5IGXL 4HISA 1CB4A 1MMMA 3EJSA 4OJAA 1TTCA 1VGEL 2ENPA 5DWUL 3BFRA 2ZKYA 2E4TA 3DSQA 2OIGA 5F89B 1JJUA 3T3MF 3QDGB 3ETTA 4ZUWB 2JJ1G 1BZ9A 4G11A 3DX6B 1GRJA 1MIML 2WBJC 1GL4B 3KYKL 4K71B 1FPTH 1U3JA 1G7JA 2JKNA 2QQNL 2IJIA 3KAAA 4OPAA 4WFAV 4PY7A 3UTQA 2DQCH 2XZAL 2G60H 3B09A 3MRCB 4WV1C 4NZTH 3P4NB 2GT9B 2FDBP 4ODHL 3WO3B 2PO6D 4F5CE 4LLAA 4MS8C 3NDYE 5EO1A 5LCVL 4XDKA 4TUJA 3PJSB 1JNLL 3FU3A 4X8XA 4XP6H 1KC8W 1VADA 3DUUA 4DV4B 5MENB 3MCLL 2VLKD 2X4PA 2Y6TE 4JE0A 5J57B 1KXVC 2PTUA 1FKAO 5EZYA 2YEVB 2B1HL 3D36C 2PYED 4JZNB 3FH8A 3OLEA 4CC4C 3E83A 4FIPC 3K5MA 4WW1A 4MHHI 3L48A 4MCYA 3I84A 3N1GC 1G9MH 4NCDA 4G6AC 4ODBD 4J6RH 1R75A 1WTLA 3TA3B 3MRDB 4XP5H 1IM9D 2WLZA 1C1EH 3BUYB 1YY9C 3JVGA 5J6GB 1I1AA 3SKOB 1BW8A 4HC1L 1HKLL 1JTPA 3NEXA 1JUFB 3MACH 4YY3B 3MBEA 4LLVB 5ICYA 1KWGA 4MD5B 3RVWD 1FCGA 2UWEF 3FYEB 4MMZA 5DDHA 1FFXA 3U7WL 5EU6A 1ES0B 5K9QG 2WZ5A 5EIIB 1J1OH 4AQ1C 1NGQH 2EINC 4URTB 3SOBL 1SXSA 1IV8A 2WLMA 3KM1A 3LOWA 1XIWA 4ISVA 1WBXB 4N5EC 1FRGL 3WDHA 2G2PA 5B1BC 4YXLL 3DYPA 1S7SB 2P5WA 1HR0B 5HI5D 5C0CB 3SBRA 3O8XA 4W4OC 1T1XA 2FO1A 5KS9A 4I5SA 1OARL 4JFHE 3EYVB 3QZOA 4KKLD 2DRUA 3SBWA 2PABA 3K74B 2P80D 3N3EA 3RLSA 1KGYE 4POUB 3ZTJH 2Y48A 5KVGE 3K6IA 4TOIA 3JAWA 2VAAA 3FH5A 3PWUB 1TCRA 1BT8A 4YFLI 5AB1A 4HIEA 2Z91B 2VLJA 5HBBA 1NCCH 4OCYH 1ZVYA 5I6XB 1RUAH 2XG4A 1KJMB 2IAMB 3LRMA 3TFKC 3LHPL 4DV7O 1IM3B 2N1KA 1BEYH 4BXVA 1ZGLB 1SVBA 3VFOA 4TTDC 2BSED 1ZA3B 5ALCL 4CC1A 1M7UA 4YAQA 1EANA 2BSRB 3FT3A 4AUYA 4CVXB 4NWTL 1KECA 1TJMA 1WAEA 3O4LA 1PG7X 3PWVA 4WFFA 1AXTH 2O5NA 3EG9B 4FLRA 3LSUA 4X9GA 3S3SA 3T4AB 5HYJE 3MBWA 2HR3A 5D5PA 1CGYA 4U3FH 1IEBB 1RI8A 4KKCD 5GZNA 1NMBL 4HS6A 3UO3A 3ZOAA 5L2KA 3AG3B 4P4RB 5CIPB 1WISA 1PZ5B 3MJ9A 1B88A 5AW5B 1B0GB 4HAMA 3JARA 4PJEE 3VXPB 4ECNA 4OB5L 3JYCA 1WPXA 2EDHA 3S34L 2GUOA 3ZE0B 1TVHA 3DGGA 5AWNL 2CMRH 4JFOB 2GITB 4OZHB 4XPTH 3EKCA 5DF0A 3N2KB 3G5YA 2CDEA 4QT5B 2WIIB 4MXVF 1QVOA 1CURA 4UTAA 4J3SA 5JNYA 4Z7UB 4I18A 4OZFH 2QKIA 3X3FL 1A3LH 2Z93B 2XXGA 5F2FA 1IC0A 5GS2H 2XHNA 2RFXA 3KPQA 2FUQA 5FECA 4HUUA 2D2CC 2J8UF 2UXCO 2Z8VC 3PV7A 5DFVD 1MNNA 5LA6A 4GRWH 4PJ9A 3IGAB 1GHFL 1W15A 1G9NH 3FB7A 3VFVA 4Z7NB 2XG5A 3IMRA 3OF6D 3EOTL 2HSIA 3NJVA 4ZPVB 1FG9C 1OV9A 3GMNB 4XNZB 3NIGB 4PJ5E 1JNNL 4RESB 1MKFA 4J8RA 4RMTA 3GXUB 1R3IL 4N2BA 4DW0A 3HRZC 1BXAA 4KKZA 1RUMH 4HUKB 5JR1H 4KZEH 3ZYJA 3V0GA 4OI7A 1U8OB 4LKCA 4YHLH 4R7LA 4QPJA 1M2VB 4OXSA 5J9PC 4PWEA 3H1KH 3HRPA 3GWKC 1LD9A 3KYNA 1S3KH 1BMFG 3OR6A 4KK6D 5CJQL 1I1RA 1UVQB 3QG5A 3JYBA 4IU3B 4ZMNA 1E28A 3FQNA 5FA4A 3HMXA 4KI5D 3ABLC 3STZC 5JOEA 4Y16C 5HYJD 4LCVA 2E6JA 3QORD 2X28A 5AUMA 3ZKQD 4C55A 1WE5A 5C3IA 1CIUA 3BWUF 1KTCA 4X99A 2Y36H 5B5EZ 5DLLA 2YAPA 4KPHL 2BOLA 1I7FA 3BH8B 1AFVH 4XT1C 3D25A 4HWUA 4I88A 2BJMH 2R7EA 3CVDA 1VGKB 3KXFB 4XWOC 3BE1H 3N43F 5I15L 5ETUA 4XMUA 3LPGA 2L3BA 5AOIA 1SJHB 1JZEA 1K2DB 4G7VH 4I2XB 4NIKB 3ZK0A 4L18A 2RCSL 3FHQA 1IAKA 5LXGH 5IB1A 2N56A 2YPVH 4KVPA 2H8PB 2K1EA 4O4JB 4M6NH 4CVZB 3V4VL 1FNEA 1RULH 4B9FA 1KEMH 4PV1B 3OB0H 5INCB 4DGUA 2IDFA 4N1EA 3RGVA 5FYKL 3QIBB 3ARDC 4KX7A 1FC2D 2Y0IA 1RP8A 4UI2A 3NJGA 5D2LA 3ZDYE 4C7UA 1T7ZA 4HZ3A 4Q2ZA 5C08A 4OD2A 4R7DA 1S5IH 3FFDA 3KPMA 4GP4B 3UAAA 5EWIL 3N41B 1PNCA 3WNJA 3QUMB 4ZD3L 5AL0A 3EBGA 1IC5L 1UENA 4L48A 1RM1B 1AY1H 3B9DA 1UXSB 4FG4A 4P2OA 3EGXB 4UDUA 2AV1A 2EIZA 1BBDL 2OX5A 1NBYB 3IDMA 3MLUH 5KJ4A 2B59B 3ZX1A 3LB6C 1B0RB 2A38A 3ME0A 5LBVA 1WG3A 3HB3D 3RZCA 1QSVA 2GY5A 1H6EA 3Q44A 4LF9B 3MUGB 1B9ZA 3HE7C 4U1IB 1ZT7B 5DEJA 3TBYA 32C2B 3FT2B 2YUWA 4N9GB 3D85A 4NRZA 5HHOA 2P45B 3AS1A 1PIFA 3T04D 1XSKA 2YA2A 4PGJA 2GY7B 2I07B 4UOZA 3KBHE 3NQKA 4FFVD 4RFNB 3BCCH 4JQVA 2Q7GA 3AY2A 3CRRA 5T8IA 4Y4KC 4YEEA 2HXAA 1E4JA 3KKYA 2OS7A 3GJEA 5HDBB 4P2RB 4ZFZA 4IOSA 4LEXL 5ID1B 2O72A 3L2NA 2Y4SA 3C8HA 3VH8A 4BH8A 3DETD 4P06A 1N33B 4MDIA 5D5MF 1YSOA 2V9QA 2ZXWC 5MHSE 4FQLH 1U2CA 3II1A 3UJIH 1HYSC 5M94B 1SBBA 3ATDA 4U7KA 5BV7C 4OQTH 3E8VA 5LAPA 3X11B 5JJNB 3CX2A 3BO8B 3FB6A 3Q8FA 2Z7ZA 1P7KB 2A79B 4QHLA 5I28A 2HN7B 5CZKA 3UTPE 1XTLA 3P30H 5C8JA 3GNML 4KFZC 4UQ9A 4HDIA 2X4NA 3IDNB 4TQPA 3D2UD 3UX9B 5GGSB 4OV5A 5SV4A 1MCEA 4H37A 2APBA 2LW3A 1B90A 2KLSA 3QXTA 2WQXA 1PJWA 3NOIA 1I31A 4N25A 4XWGL 3VFPA 2UVFA 5CBAA 2J7LA 1RZIB 5CLZA 3RGBA 4YH6A 1F18A 3BGMA 3Q6GL 2DWYA 4PJFA 2VQEO 1FVDB 2YEZB 1JIBA 3STLB 3P4LA 4EZJA 4NKIH 3UBGA 2H26A 3MV7E 3VSUA 3VDCA 1NTZH 2JS5A 2J1YA 2WYZA 5DK2B 4POZD 2VQ4A 4AV5A 4JY4A 3FTVA 4DT2A 2ZIMA 5C07A 3MHSC 3KS0H 4Z76A 4N20A 3VWKC 5GZOD 5GONA 1X7QB 3MRLA 4UQIM 3GUTB 5HI4D 1L6XA 1EFXD 1NDMB 1SOXA 5EU7C 3M6DA 4H4NA 4MJIB 3NSJA 2BVTA 3ECBA 5CU9A 3VXME 1S3JA 2WLIA 4PELA 2D3JA 1ZVHA 1PLCA 2OXGB 2TRHA 1AZRA 2WQUA 4GXVL 5HYSA 2VL5B 4BIUA 4UIKL 1PZSA 2VS0A 1MCFA 5FGSA 3RUGF 3CVHL 5HP5A 1OP5K 3ZHQA 2AFNA 4HULB 2CBOA 2XKSA 3THML 4XCEB 4CZZA 3ETDA 1PPIA 3WIIH 2WK2A 1XH0A 3CRMA 1DN0A 3N91A 2YPLE 4WGKA 4K73A 5AVSB 5MHSD 3GWOA 4ONHB 2VH5H 3QNZA 3SDAD 2XA8H 2MNJB 3SE8L 4P5KA 2HVJB 2QMJA 3UTSA 5DJ8B 5HHVL 3TZVA 4TN9A 1N0XH 2BNQE 4A2EA 4LOUD 4BHUA 4DFHA 4WCYH 4F8LA 1TUBA 5I6MA 1LXMA 2H45A 2BZCA 1N7ML 1BBJB 3V6ZB 3SKMA 4LQFL 3BW9A 2VDPL 4N2EA 3CP1A 4WFGE 4XP9L 2OMVB 1U30A 1OLZA 3BHBA 2E75C 3ZE2F 3TESA 1OT4A 4O4YL 5INDA 1AQDB 3HZKA 5CIPH 5CJ5A 1OCRB 3FL7A 5ESQA 2WXKA 3MA7B 4PREB 5CSZA 1PG7W 3N40F 5LNEA 4WO4B 2G38A 4U33A 2HVKC 3LNHA 1I4FB 4DF9A 3ZT5A 4Q4IA 4RMBA 2I26N 1W0KG 1E65A 4DRXA 1EUUA 2FB4H 4YQXH 1K73W 1U4FA 4NUGH 1FJ1A 1D5IH 4J11A 4R2GC 1YEDA 2ZUYA 4QNPE 3BYYA 4P07A 4NSKB 2Q6WA 3TTSA 4LLDB 3IAGC 5I1CH 2WINB 3UFIA 5C09A 3H9ZA 3VXMD 2Y72A 4K23L 1SHMA 3VXUE 4TNFA 3M17B 3CDYA 2NUTA 4D3CL 3V10A 1Z9NA 1FF5A 1ZAUA 4ZOAA 4XNMB 1E5BA 2Y6SC 4XXWA 2JWYA 4Y7MA 1J5HA 2BS71 3M1BA 1XREA 1RMFH 1RJZA 1AROP 1YPZF 2W91A 2YPLD 3BLKA 4WQOA 3RWCA 5LOVA 4C83A 3WD5H 5EORL 3RRQA 1BVZA 2FQGA 4DN4H 4JYCA 4MVBC 2A1WH 1SVCP 43CAA 5EZOH 1UWYA 1X5HA 1O9ZA 2PXYC 1XR9A 4AI8A 4IBSA 4APQA 1JHLH 2XWJB 3T0VA 3CDGB 4Y9GA 2BNQD 2HWZL 2ITCA 4FE9A 4GAGH 1KBHA 2DIAA 1TYJA 1OCZC 1A6AB 3QTCA 2XV0A 3QUKB 5FS5A 5DHVB 5J3HD 4U1LB 4IBWA 2AAAA 3PHQB 1SETA 3QJZA 5SV3A 3ULVF 1EZVX 3PABA 4WFGD 4PRHD 4B41A 1QX1A 5IMMA 1AKPA 2YAOA 2J88L 2CHXA 1QFWM 2QM7A 4PRIE 4UB8Z 1QABA 1DCEA 3TT3H 1MUJA 2NW3B 1GYAA 1NH2D 4KOBA 3NCEB 2GTAA 5E51A 3F05A 3HN3A 3Q5OA 1XV8A 4MXQD 3LS4L 4JVWA 5I1JL 1ZS8A 3AK3A 3BAEL 5DEGB 1A7RH 2VKWA 5DUPL 5GS2D 2AJYH 3KMDA 4GJTB 2F15A 3CFUA 1L9NA 4XVSH 1KENH 2ZT9B 1YEKL 2HFFB 4MBRA 5JCOC 3TN0C 1KYAA 4NKDB 1CP9A 1E3ZA 1T5WA 2EO7A 1QLRB 2F53D 4ZX6A 4GUNA 3N50A 4QTIL 5F6HI 1HQRB 1K8IB 3APFA 4P23A 2WIMA 1XNRB 3DC5A 3OL2A 4HV8B 5H37H 1DJSA 2WNKA 4HEMA 2C5DC 1FZJB 3E38A 4HWBA 4JQXA 5E8OA 1OIOA 1H2LA 2HJFB 4GS7C 3IXAB 4HJSA 1X7SA 2B8OT 4JKPH 5DRNB 3VXUD 1P1VA 1CG9B 2IADB 1O7SA 1MHHA 2IALB 3TCTA 3CD6V 2PW2B 3FTGA 2EXYD 4OTXL 1Y0LB 1K3ZA 4AVJA 3GSWA 4OAWA 3RY6A 3MLRH 1Q3EA 3X14B 5IEHA 1BX2A 4NP4H 1YEHH 4OZ4B 1L6PA 1ROPA 1MI5E 1MNGA 2J8UA 1MHCA 3KBPA 3QEGH 2K1MA 3QUMH 3H8NA 5EIVA 3HBQA 3U7YL 5HHNA 4UTBL 4AENB 1HE8A 1ILSA 5IYZB 2E5LB 4PRNB 5IB3B 1M53A 5C6TH 3DMMC 1WP7A 2D2OA 1NIEA 2KQNA 3SKJH 5E4OA 2OCCB 3JQOB 4KGLA 4EOWL 5TQ0H 3B6SA 5DD0L 5AW7B 4UXNA 2YLHA 1ZLUH 1NQBA 5GS0C 4L3EE 5HVHC 2OYPA 3ETSA 3ASNC 3UBHA 3AB0B 4UFZA 2BIMA 2HX9A 2WKLA 4QE7A 5BJTA 2EC9U 4FNQA 1S8DA 4E42A 1H2KA 4PRID 5F9WB 4G8FA 4XRCB 4Y4HA 3VXRA 1NEZB 4FFWD 4OKDA 3MO1A 4W81A 1ZL8A 4AM0A 2OMUB 4FCAA 3WN5C 4HD9A 2EVFA 1CGTA 2VXUL 4DV7B 3TBBA 3O2DA 1IBMO 2GB2A 2WC7A 4PBDA 3PWNB 4IBYA 3PV6B 3LZNA 4ODUB 3OMIB 1AYRA 4I4WA 4WI4A 4CMMB 4AGLA 3HA0A 1G87A 3HC3H 2Z92A 3PWJB 4LFHD 1JV5B 5JZ7C 5EEXA 3HHSB 5I73B 4E9RA 2C9AA 4J3OF 2R4SH 4O58L 4RDQG 3BSGA 1HI6B 2VDMB 3DXAB 3VGHA 2FAUA 4A6YL 1I7ZA 3B9KA 4MJ6A 4KNUA 4FMVA 3HNSH 1P1ZA 4NO3A 2UXGA 4WEBL 4B9JA 3VI3A 3NZ8A 1IILE 1D5ZB 2NUPA 2OJEB 2YHGA 3WS3B 4ANXA 2J4WL 1MI5D 4EE2A 4QLRA 4JM2F 1G5GA 3ARFD 4EZMA 4DGYH 2QSCH 3EO9H 1YAZA 4ANVA 4JFFE 3HR5B 5EBLA 4NN7C 3E8UH 5KSBE 3EADA 3SJAC 1V7MH 2UXCB 1QFUL 2K3HA 3IFPB 5L3GA 1ERNA 4LAJH 4PJBF 3S36L 4WO0A 5DURD 2ZUTA 4K15A 2XCMC 4YEFA 1ZY9A 1UD5A 4G2AA 3MLYL 3IJYA 4ETQB 1E5AA 2V5YA 4MQXC 2MSPA 2CPUA 1XSJA 3B3IB 1OTTC 2X4RB 1YTFB 1GS7A 3GI9L 2DWEC 4L3ED 4L9LA 1DDTA 1UOKA 3P3UA 3QDGD 4YBLB 4KROB 4LIQH 3V95A 2LGWA 2K6YA 3VDBA 3ISRA 5KHIA 2G3XA 3HFMH 5EFIB 3TNNB 4X50A 1MFCL 3OW2U 3F7QA 4M93C 1O9GA 2J21A 1QSEB 5D7IA 2EX3A 4P9HL 2EIJC 3VDAA 3RFZA 2ZSWA 2NT0A 5TE4L 2O5ZH 3OQ3B 1A0QH 1GYVA 3HR6A 3US1A 4HUXA 3ZRFC 4WFHA 1LP9A 3WJLC 4YE0A 2DMCA 1IQWL 4PP2B 3VFTA 5K59E 2BZDA 4QXTB 3U82B 4EDWL 3BH9B 5KVGL 5MEND 3GMOB 2PTMA 4KKAC 4EMZA 1NCBH 2V7HB 1V27A 3K3QA 4ZUVB 1GJWA 1ZHLB 4FD0A 4OKVB 4YBQC 3FB8A 5D5MA 3FB5C 5IYDO 4KVCH 5FPOA 2Z0UA 4G5AA 5IESL 3Q1SL 3H9HA 4LLQB 4XI5C 4UCTA 1NFIA 2K9PA 2RB8A 3I6GA 2Q5BA 4Z3GA 4DR3O 2OMBA 2V7NB 3TA3D 4DFIA 4FC3E 3T8VA 1QG3A 1TETL 5J2TB 1ECZA 2VRQA 2F43G 1M05A 5AD0B 1KY7A 1CR9L 3MV8A 4YWGH 4BUGA 4YDLB 2QQQA 4JKNA 2FSEA 4DK3A 1NVPB 5FDYA 2XJKA 4G83A 1WBZA 1DR9A 4WU5A 4AVIA 4JFFD 4JR9H 4Z7UE 5IOPA 3VWJB 4W68A 4AMWA 4Q9QH 4AJVA 3PWPB 4WWPA 4AMKL 4JRYA 5GJTL 5KYXA 4GW1B 2FYUH 1S6NA 3OC8A 5IROD 2YO3A 4FK5C 2CR6A 2FO4B 2DD8H 4POYA 2XY2A 3EDDA 1RPKA 3WN6A 2VJ8A 4NQEB 5C0CD 4TV8A 1KELL 3ABUA 4PA7A 4ZMTA 2QFPA 4YDKL 2LU4A 3TNMA 1ORQB 2EXWD 3KYMB 5H94A 3S3JA 3CBRA 4GXFA 4IK7A 5BZBA 2IH8A 2MCPH 2ZCKH 1A14H 4QY8A 2MQ3A 5F9OL 3C09B 1CDCA 1K9MW 1MHEA 3DX7A 1BV8A 2VJXA 3PUUA 3K5NA 3UTOA 4AG4H 3P2BA 1DUYA 3RTLA 1IZKA 1RZFH 4NGHH 3U30B 5D7JB 1CEZA 4XXDB 4FFZH 1IGCH 3A23A 3R8QA 2HLAB 5EBMA 4LF3A 1UZ6E 2X5PA 2IAMD 2HKFL 4KXAA 1VQPV 1H9VA 3RUGA 1IM3D 1VFAA 2OTWB 5C0EB 5DQJB 5HVWA 2QELA 4AQAA 1NIBA 2VDQB 4M43H 3SE4C 4NO0D 5ID0B 3OLDA 1ID2A 1J05A 1OANA 15C8H 4ZUUB 2P67A 1U92A 3UGEA 4PJDA 2MQGA 4TSCL 2A4CA 4FNTA 2ADQB 5C0BE 4ZX3A 4NHCH 3KPOB 1GYCA 1YMHA 5DHVH 2DICA 3LPFA 5DUJA 3PDDA 1E4XI 1BHBA 4IU2B 2XXMB 1AO7A 3UTZB 1NGYB 3FYIB 4M7LL 4YIQA 2P5PA 5IB4B 3QDME 5B39A 5I71C 3KXFE 3CV5A 4FQXA 4LL4A 4IIQA 4Q6YA 1D5BA 4JPVL 4WTZG 4F8NA 1MCIA 1P69B 3B5HA 3QEQB 4GG6E 1A8ZA 2FWOB 3MA9L 4Q0XH 5E6IA 3GHPA 1EFQA 1YYMH 3SQOL 4N0FB 1WA8B 1SYVB 4I87A 1LUVA 3QGVA 3V7AG 4OF7A 4G42B 3WCYA 1YDPA 2TAAA 5L8KB 4XDLA 2I7SA 4GAJL 4KX9A 3SE3C 4MCNA 1BG1A 3SJVA 3SPCA 3NP4A 4P57B 4JFXB 4UYQA 4DCQA 1G7HA 1GGBH 3TJEL 1SEQH 3BMVA 3GBNH 1TENA 2NR6D 2X7LA 1OP4A 4NTWA 5ICZA 1RZKC 1KB5B 5CAYB 4W70A 2MHAA 1D5MB 4U1JA 1UWFA 2DWSA 4WHTA 4RUEA 3RVUD 3INOA 1IAIH 5DRXA 1YEWA 1MRDH 1KCRL 4Z9KB 3EDKA 4FL4B 5AB0A 3RYIA 1YHPA 1R34A 4JL1A 1UM4H 1HKFA 5BVJA 2RGSA 3RKDC 2BW4A 5BV7L 1D3CA 4RRPG 4HWZA 5BXFB 4BA8A 4BSJA 3K1KC 3LN9A 1G9EA 1E1RG 1P5UC 3S3XA 1F3RB 2CBPA 1U8IA 4MA3A 4AH2B 4QTFA 2UUBO 3OKNB 3CSGA 5ESVA 4XBFA 4NQSB 4DPCX 1DO5A 4L3CB 4LCWB 1BZDA 2PCYA 4M7JL 4L1HA 1YPZA 4URKA 2BIQA 1G1OA 1HH9B 1DVYA 3IDIB 3D12B 4PRPA 4XPHL 3MRMA 4J42A 3C5SB 2OMYA 3QDMD 3QYMA 4I85A 4QYOB 4L8BB 1GTOA 1KNOA 1CXLA 3KXFD 4PGDA 3OBAA 4MZIA 4E0RA 2HMID 5BMFH 1BP3B 2FK9A 2WWKT 3SB3A 4L4TB 5J4MA 4QMEA 1R6KA 2QHRL 1Q0XL 2BRQA 1SUHA 2BW5A 3NRPA 3WFVA 4U49A 2LLLA 1Q9KA 4GKSB 4CN1A 1FG2B 1DCLA 3MYJB 5CILL 5JVDB 4WHYG 2K9UA 4JLRB 4XVOA 3BSHA 2WBJD 1V3LA 4HPYH 1TKWB 1X5MA 5LHIA 4KUMA 1IJNA 1BVKA 3PXJA 3L45A 1SY6L 2ZKHL 3BVWA 1COBA 2C4FT 5JXAH 3WTYA 5ITBL 2VDMH 1G4YB 2XWBA 3PGDB 1BVLA 5D4JA 4UQ2A 1IFHL 1HNXO 3CZGA 4O02A 4TV9A 1S7WA 2IIJA 1AANA 2H2PC 2NXYB 5IHLB 1YSCA 4NQDE 2J43A 4B7IA 1F3DJ 3RGHA 2YK1L 4MS8D 4U1SA 1Y1DA 4OGZA 4JY6B 4C4KT 4CVUA 4ASUG 4B9YA 2OYQA 2MPAH 2P5EA 4XNUH 4XVTL 4G7RB 4WI7A 3BPNB 3C9NB 3OHXA 3CMOH 5KBPA 3N42B 2DDQL 5SWZB 1JGEA 2PKDA 1NR1A 3Q2WA 4LIQE 4HJ1A 4PDLA 1NCWL 2VKXA 5EOCH 4PUBH 2KSDA 4G6AD 4GBXB 1UGNA 1QUNB 1YY9D 4NRYB 8FABB 4UMSA 3FQRB 2GC4C 2FTKA 1KT2A 2YQGA 4FQIL 1DP0A 4P2RD 3WIHL 2CO2A 4R96B 4Y1SA 5DK0B 2IO5A 4N3UA 4OFIA 2W94A 1NI8A 4CH5A 1SQXH 1X5JA 4KNTA 4BZYA 2XLLA 1KBKA 1NANH 2W0FA 1OEZW 1RXLA 3MGTB 1JGLH 3A6CH 3CLWA 3DOSA 5B3NA 1ADQH 1E2WA 1HHJB 1PF3A 4GX1A 3BD5A 3MOQA 4NQQA 5F7AA 2PYFA 2ITDB 4X6FA 3OZKA 3F7VA 3AWEA 1EAPB 2AANA 2IGFH 3FO9B 2H94A 1QSZA 3O6FC 4KXZH 1VKXB 3VGDA 1IAOB 1ZIBA 3NYKA 1VARA 3EGSB 2DWDC 3FMGH 2CHWA 4Z2WA 2H3OA 5FC9A 2F4VO 4J3TA 1XH3A 3QJFB 3SYQA 4YHPB 3CAFA 5IW1B 4F8PA 4HFUH 2BFVL 1BYNA 3MOAH 1GOGA 3SYPA 4PP1C 4DKDC 2BTQA 2H32A 4Z77B 4X0KB 3LXCA 4KVNL 1MOFA 5EBWA 3W9DA 1O5DT 5D1ZC 4IRSC 1U6AL 4K3EH 5L3CA 1OCOB 3C5JB 1AI4A 2XZCH 3QW9A 4FQQB 4UV7H 4FLOA 5FFOA 5IFHH 3TFKD 3U2SA 5IV2B 2KPNA 1H0DB 2AQ3A 2VDOB 3NQIA 1T21A 5DJYA 1QUPA 5F0PB 4TTDD 1OPGH 4EI5C 4F57H 1AYOA 2WWKO 3HS0B 4WFEA 2C26A 1UADC 4L4VA 4GKNA 5D7SL 4TUUA 5KUKA 2BS8A 4UT9A 3TJHC 1T3FB 2Q3ZA 2WXMA 4MJID 4OCWH 4ZXBC 4QR7A 2WY3B 3IDUA 1GTFA 2GHZA 3H42H 5I1IL 2OR8A 1S78C 1DFBH 1MFEH 3QBTB 4JM2A 4PCKA 2Q86A 5LGHH 1XH1A 4HBCL 4QRFA 3D6GA 4OSUH 1KKCA 4PJBA 3OKOA 1LO4H 1Y67A 2FIKA 3DVGA 4DQAA 5I30H 2VXQL 5LP6C 2D7PA 2BOCB 1J8HE 3GBDA 5JHDE 2Y06H 4FLZA 4K94H 1QPXA 3KGSA 3RP1A 4N2IA 3BPLB 8CGTA 3RYHB 3QFJB 1PZ2A 1VESA 5CGTA 3S8WA 3RIFF 2HTKC 4PSRA 2VLRA 4S1RH 4ZTOH 1L0XA 1ZLVH 4MB4A 5B7FA 1MNUL 4G5ZL 5FB8B 4BELD 3KPRA 5MI0B 5IEKA 5JLZB 4RMWA 4AI7A 1WFTA 1KN4L 2LQRA 1INDL 4GRLA 4JFUA 3WIFA 3TO2B 3CXDH 4RAHA 2NLJA 1NDGB 2FEEL 2VDQH 5EYPB 3CCJV 1LQBC 4X6DF 1X5AA 3MFFB 1RZGA 3KL5A 4IRZL 4FLQA 3KG5A 3R7QA 5HVFB 5JH7A 1FGNH 4I9WE 3GMQA 3EO0A 1FV1B 2NYKA 5KSAA 4WF7A 1PPJH 1KMIZ 4IMKA 3MJ8B 2EE3A 5AW9B 1NS1A 4WO4D 4HF5H 1P5UB 4HKZB 1XD0A 5KJRH 4N8VB 3MRGA 3WO4C 1H5BC 3O9WB 4F1SA 4LR3A 1FXKB 2IWEA 4NQVA 5EK0A 4XCCL 4H13C 3GJFK 3WEOA 2AJUH 1GRWA 2R9HD 4W9HC 4BFRA 4LLYB 1C5BH 1K4CC 1HHKB 3OAYK 4G7YL 1L5GA 1BSIA 1LO0H 3V6FA 2ZCLH 3UCRA 4CSSA 4ZQTA 1G7PB 1BJ1H 2AEOA 1BGXL 5L88L 4EKXA 4JMNA 5AG8A 5HHQB 4N0UE 4MMXC 3QXDA 1PD1A 3LDBB 3PHSA 3PREA 1KBVA 2ATPB 5D9SB 5CWSA 5FKPB 3L6FA 3M1CA 5CZXC 1J8HD 1E2VA 1NC4A 2B0SL 5TQ2H 3VFUA 1KB5H 1SXBA 1UUSA 4EN3A 5ANHA 2WXRA 4L29B 2RCVA 3NFNB 2ENYA 5IK3B 4F37F 3A67L 1MFAH 1MPAL 3P9LA 5DJ2B 3MTRA 3LKSB 2CKBB 2DE0X 4PRAA 1A2YB 4OLVL 2Z3YA 3LRHA 4HS8L 3K2KA 4YX2L 3TO4A 4MTGA 5H4YA 3GXIA 3MDJA 1TQCC 5HHXL 1P4IH 3BUDA 4DK0A 3L3JB 4GMTH 3C5ZA 4OJFL 4MD0A 5EUOF 1Y66A 3V4UL 4MB3A 5J11B 4DZ8B 4D8OA 3H9SB 2IQ9L 1MCJA 3TBVB 1G84A 1U3HB 4FEMA 4MQTB 2CUAA 4P2QE 2H1LM 2BVOA 2GG1A 2SEBB 4RQQA 4DAGH 3HG1A 4GMSH 3QXVA 4KUZL 4LCCA 4I9WD 4E2OA 3WE6A 2HT4D 2DQIH 5B22A 2A99A 1I3UA 2NY6C 2NY1B 4QRTA 3FX7A 4CVWA 1U8JB 3LB6D 1UJ3A 1YA5A 3SDDA 2OYLA 4UILL 1QBLH 2OMWA 3V0HA 2D9QB 1TGOA 4ZO8A 3T6QC 1J11A 1IBKO 3BIAX 3HE7D 3ERXA 5EU7E 3JTSB 1EXGA 1I9IH 2ADGB 2C3VB 1CFTB 3G5VA 3HE6B 4UB0L 1VF7A 4R5XA 4MYWB 4F58L 3VUAA 1SPDA 1U58B 3WG7B 2C9XA 4H8HA 1V7NL 2YKLL 1W8OA 3FPXA 3GPSA 5FPRA 5E2UH 3OWRA 4CN6A 4X1IB 1NKGA 1TOXA 4DR3B 4LVHB 4P2YA 1WCQA 4K7PY 3CFEA 3IMSA 4HU8A 4H40A 5TK4A 3PAZA 3DSFH 4Q8BA 5ITZB 2EEFA 5C0AA 4JFQA 2D7QA 1CFNA 1DDHA 1XGQA 2OMZB 2PCFA 2R1XA 3KEHA 3TH4T 4GG8A 1EDQA 4PWJA 1ACZA 5ABAA 2LTQC 3A6BH 4XHQA 1JF6A 1GCFA 2X3CA 4FX5A 3K6OA 3BP5B 3RWRD 1A1NB 3G7TA 1TA8A 2J6EH 3K4DA 3QEUA 1OL0A 3QCTH 3QI9B 4NQTA 3DECA 4OZGE 4UVCA 3KDPB 2FBJH 4YXKL 3CQQA 4WHCA 3E1F1 1DVFC 2NSQA 4K5NA 3N2GB 1OAXH 3NN8A 4LLMB 4PVNA 5JHLA 2VMFA 4ZO9A 4JO1H 5LNGA 1M1XB 2EH8L 1HNZB 2C7UB 4IW4C 3QJTB 2JMRA 2X2JA 1NJ9B 2NDGA 3F64A 2ICWB 1FH2A 2XQBH 2B15A 3JT2A 3MNVB 4HAFA 4B9IA 3H56A 3LN4A 1O7DC 5K93A 2V3EA 1OF2A 1MEXH 1LGVA 1ZLUK 4JGMA 1JHKH 4CS2A 1WFNA 4MX7B 3DI2B 4UCUA 4HFWA 4DP5X 4F2FA 5B1JC 3ZE1F 4OCLC 1XHZA 3WFZA 3ZZSA 4UF7C 1QSEE 3NA9H 4R8CA 3QUGA 2WNXA 4LGSB 5JIIA 2R1YB 1WCBA 4HH9A 3JTTA 1FFNB 1KPUA 1MREH 1BCIA 1PY9A 1OSZB 3GBEA 3JSSA 3LNIA 2A4EA 4OIBA 3WSQL 3FN0H 1CLZH 1BXVA 4XOEA 3ZHVA 1C5CH 2ESVB 3OC5A 4Z95H 4ELME 1TTBA 3QO5A 1HNYA 4R4NC 1P2CA 1K8AW 3T0EA 1ID5I 3G5ZA 1M4KA 5AYUL 2D3VA 3P9MA 4D94A 1NCDL 3T2PA 1WIPA 4V1DE 4BK5C 1M9WA 1KC5H 4EBQH 3K06A 1JP5A 4QHMA 5FA3B 4AXWB 2PP8A 1DJXA 1XGRB 4M6MH 3IETB 2CD0A 3AS2A 1K4DC 3IFLH 4EFBA 3WIAA 3MNWB 1F58L 3ABZA 5BOJA 5L6YH 2P8PB 1NMAL 4JK0D 3FQUB 5L0QB 3KCPB 2V17H 3CJHB 2GCYA 2G2RB 4Z7QB 4A2LA 1AB3A 4XNBA 2YSSB 3CRAA 3FQTA 3KLHC 4I8DA 1E27B 4GYBA 2QPDB 3WJJC 4ORZC 3SGEH 3T0WA 4PWFA 1RSOA 1FPTL 3EFOA 5I1EH 4YFLF 4EQ3A 1GH6A 2AW9A 3GSUA 2DQCL 2VDOH 4MLSA 3E22B 3ETEA 2FR4B 2AQSA 3GWJA 2F8OA 5JW3L 4NZTL 3DIDA 4AIOA 4XOAA 1HQ4A 3AG1C 4M6OH 4WW2C 1YITV 3ZO0A 5FNVB 1YTFD 1L3NA 2XYBA 1CTOA 4LRNH 3CWBH 1LL1A 5A2LH 1T83A 4Y1AA 1UZ8A 1IGYA 4XP6L 5AVQB 2CLZB 1S46A 3O3EB 3GTVA 3KEDA 3F2LA 1E43A 1QSED 1QWHA 3BPZA 3HKCB 1KD1W 5H2FZ 2JB6A 3N5AA 2Z6FA 1MRFH 4WWKC 1KPRB 3UADA 1JPXA 4D0DB 4O51A 1G9ML 1XEQA 2UUBB 4J6RL 4ZUTB 3X13A 1KLUA 1IGJA 1GKFA 3A0RA 1F4WH 4HJGA 1JZFA 3FTZA 4XP5L 1C1EL 3KPSA 3ZHKA 5C2BH 3FQXB 5K9KB 1A9EA 4HC1A 3E8FA 5MEOB 5JWPA 1KJ3H 4LNRA 4ZS6C 2X9WA 1SZXA 2HP4A 2QTVA 3L9BA 3MACL 4R90H 4V1DD 3VG0H 1UKQA 4S1SH 4F91B 1C8PA 3S4SB 1T2XA 1TZGL 2HA1A 3KLAA 4I0PA 4JVUA 3UMTA 4NQCB 3DRTA 1E40A 2Y6SD 3VGGA 1HZHH 1Q9LA 4YJ2B 2NDFA 5DO2C 4X65B 3VXNB 2YUAA 3WY4A 3G04A 3FO0H 1DVSA 4ZMPA 5MERA 3WUWB 2OL3B 4NXSA 2XIIA 1L9SA 2GUYA 4BFJA 4CKVX 2CO1A 1JRHL 4PJ8C 2J8HA 4QOKE 2HLFC 1NVPD 1JERA 1YNTF 3F5WA 3FK3A 3KJ4C 4N1CA 3REWB 3SN6N 2ADJB 2HRGA 1HW7A 3CMEV 3CZJA 5KW9H 5L9DH 3VWJD 5E2TH 4JQIH 2P49B 4PVMA 4XXCA 3RE0A 4EDXB 4NRXB 4LF5O 2R2BA 3I3BA 5DLMH 3POHA 2Y1AA 2G3NA 4JPIA 5CHNA 3L3KA 4ZOLB 3PFUA 4NQED 4CL7A 1CLCA 1JPFA 1X9QA 2W60A 1HNXB 4KTDH 4OLXH 1D2OA 1NCCL 2EYSB 1RUAL 1RIUH 2AZ2A 1K9TA 2NY0C 1QLNA 1FHNA 1OGAE 2VTFA 2O6CA 1Z3GH 2HJLA 4Y5XC 3LH2H 1BEYL 2VSCA 2DM7A 2BY3A 1ECYA 2WYTA 2ZAHA 5KSVA 2YMXL 4BIKA 12E8H 3X12B 4FQHA 3U4AA 1P4LA 1XUQA 3TN0D 4MSWA 1BFOB 1LJMA 4L8JA 3GGWB 4OIAA 1Z5LA 3BKYH 5FO8A 2W95A 3BKCH 1JXGA 1J1PH 3X1BA 2ZWNA 4I9QA 1ET8A 2QMKA 4AYSA 5DI8A 4YGVA 1JGVH 2IWKA 4UM9B 1U2HA 3B7YA 4FOMA 3BYTA 3HS9A 4FP8H 3UIYA 1H8NA 2P7TA 5DJAB 7FABH 2CMRL 3I50H 1A66A 2CKBH 3GBLA 2P8LB 4XPTL 5I17B 3HC0A 4LCUA 4Y19B 1CFMA 3C60C 5TE7L 1BLNB 2OR9L 1NCUA 4G27B 2YAEA 1WZMA 1S9VB 2EILC 3CFTA 4E9XA 4C56A 1V55B 3EBIA 2ROYA 1FYJA 1AIFA 2WXLA 2OMNA 5E9DE 3NIFF 5FV2A 4S2SB 3WJMA 3OPZH 1QATA 2H3NA 1DSFL 3RWIA 1IBDA 2CIKB 4QOKD 4JS7A 1X5KA 3AVEA 4CNIB 1G9NL 1KXQE 3DMMD 1R17A 2DJUA 2CO4A 4GAYB 1QEWA 1Z5VA 3HKZA 3WLBB 3GDCA 4PJIF 3CZLA 2F4VB 3PDGA 3UIZA 5GS0D 1FFQA 4NYLB 5T5NF 1RUML 3SDXE 5JR1L 4KZEL 1SEBB 2VN4A 1Q6IA 1DJGA 1BPLB 2ICEB 1T6VN 1GAFH 1PKXA 5IBTH 4YHLL 1BZ8A 2P8MA 3JAKA 5KVDL 1OGAD 1THZA 3BDBA 4ZZKA 1S3KL 3FCTB 3EHBB 1PQZB 4PIRF 1FVCA 1XGYH 1CF1A 2ENJA 3B56A 3RWHA 1T7VA 2DI8A 5DFAA 1H2MA 1F00I 4K7FA 2VDRB 1MELA 3GSQA 4U0RC 1HL5A 3H01A 2YWYA 5FPIA 1ZGLP 3ILQC 1R47A 2HG5B 4BH7B 4IJ3C 2KLTA 3EFDH 4HHAB 4JO5A 4W9ZA 3WFDH 2Y36L 3PAVA 3F7YC 1ZSDA 1AFVL 5CM1A 1OZTG 1R24A 3ZKSD 1MAJA 2BJML 1TJIH 4UT6A 4P4KB 5C2UB 3P73B 1CD8A 3BE1L 3BZ4A 1I1AC 4KHXL 1HCZA 2VN5A 1DLFH 1RFDH 1U4EA 1YEEH 2W81C 1HHGA 3LV3B 4LCWD 4PV9A 3MBEC 2VQ1B 4G7VL 4P46B 3ULUC 1V05A 1X3DA 2F7RA 3GMLA 4RZKA 1FXHA 3CSXA 1ESOA 2K4WA 4MMZC 1MAMH 3K6SB 5LXGL 2R27A 1YMMA 1GZPB 5GS1C 3V5KA 2BH0A 2QJ1A 2YPVL 3V4VA 2BXYA 4JO3H 1ETJA 4DEPB 4KDVA 4DETA 1RULL 3OAZH 1AJPA 1KEML 1XIWC 2FUTA 1N5AB 1WFOA 1KIRB 2JCCB 3BN3B 3EH4B 3H1ZA 2LFSA 1HXYA 2KZKA 3AG4C 3IDXL 4KO6A 1TEGA 4NO2A 1AQHA 4LEBA 5EUOA 2NXZB 1VZGA 4L4TD 4NQUA 2CA3A 3OMNB 5LAXB 1COWG 1MG3C 1OF0A 2HMIC 3TBSB 1S5IL 3C6LA 5EG6C 4MQXD 4XVJL 5GPRA 4DH2A 3L3OB 1UM6H 4XB7A 2IPUK 1JYNA 3GIVB 4L1BA 2OZNA 5B38A 2D7TH 4HP5A 1AY1L 3ZMUA 3VXQA 3T2NL 2ETWA 4A7QA 1JGDB 3D52A 2PTTB 5HGDA 4XO3A 3SJQC 3LN5B 4G6KL 2PCPB 2H9GB 4Q9CA 3TIEB 2YIBD 3BA9A 2EO1A 3DROA 1J88A 3B8NA 1HTYA 2W1NA 1ORSB 1OD9A 5E08H 4HHGA 2KG7A 2BSDA 4E5XG 1PL0A 4F6RB 4X64O 4HGWB 4OFYD 1DEEA 1UWEH 2BIPA 2W59A 3PJNA 1NBZA 3Q5YA 4DOHB 4DP8X 2O57A 2BNRA 2VXTH 2PPDA 4FZEH 4JZOB 4R4BB 4OZIF 1M1KW 4F7EA 2B14A 3B9AA 3EJYC 4B27A 2KS0A 1N0LA 4JDTH 2UY6B 3RL2B 1T5XB 4ZFOB 3ENEA 4KKAD 5GZNC 2GIYA 1E6OL 5BRZB 2FX7L 3LS5H 4LHUB 3L81A 4Z7VA 3RYFB 1C16A 5SWZD 3T0XA 4YBQD 3RAJL 1S4IA 4WK2B 1EHNA 2JKXA 5EU5B 1FNGB 2PPFA 1XTMA 1BQZA 5IQNA 1SOQA 3D3VE 4FQLL 3BRDA 1DEDA 4GBXD 3BDYH 3JCUZ 3CC5B 4JFDE 4B3RO 3H1LH 4OQTL 3MYZA 5F6IB 2JE8A 4MD4B 4Y2DA 1QRNB 3C12A 4GUPB 4MAYA 4I18C 1URIA 3VFNB 4M48H 2BC4B 2Z65C 4M7KH 2NPLX 4UM8A 3L95B 2DH2A 1MCBA 2CHZA 4TKWA 1ASOA 3VI4F 3HKEB 5JXEA 1Y6KR 1DUZB 4RNRB 4AW4A 1HXKA 2GJ6E 3QR2A 4M29A 3NIDB 1DSWA 4PJ9C 3FO1B 2VISA 3IPEA 4AY0A 4U7OA 2O5XL 1G7IB 4DKEH 3L5HA 1J18A 4XC1H 3VGAB 3WHXB 1RZ7H 3CLFH 2J44A 3MGOB 3VH8G 1JZ6A 3GB7A 2Z35B 1N36O 3BAAA 1KB9F 4QRUB 3RDTB 4KTYA 1BFVL 2J8OA 3F83A 3D1MC 4NN6B 3TBWB 4UUJB 2R2EA 1GGTA 4P5TA 3DPBA 5A3IC 2MIZA 1IGFH 3TT1L 4RAIA 1MJJB 4K5MA 2VWJA 4PWKA 1NKDA 2BSKB 4XCFH 2QGBA 2C4XA 2VZ1A 2G9KA 4HKBA 1B2YA 3DX1A 1IBKB 1ZWIA 2GJPA 2MH4A 4JREC 3OR6C 4H25A 4LSVH 3N0AA 4OGXH 3CFDA 3T1HO 3WS6A 2VDLB 5IVNA 3D33A 4MCZB 1I8LA 5TH2B 1A4JB 2OL3H 1ZHBB 3GBML 4IOIA 3UYOD 1JBJA 2ZX8A 4M1CC 2EIMB 2X12A 1WQVT 2Q6AA 3WU2Z 2A9DA 2HKHH 2J2ZA 3LHAA 4JB9H 4NJAH 3VJ6A 4MVRA 4OGAC 3GXFA 4RMRA 3T09A 4JV5O 3TTYA 4TNVK 3V5DA 1PDKB 1H3XA 3WIIL 5C7XH 1ZT1B 4ALAC 1W9XA 6FABH 5JTWA 1JPST 2ZX7A 2H6UA 3OKDB 4MWFA 3EVKA 3D3VD 3ILEA 1RJLA 2A6JA 1AXSA 4JFDD 1U3NA 2R29A 3G9AB 3HLAB 4TRPH 4UV4H 3VG9B 1DQVA 1F1AA 4OUUA 3W7UA 4KJPC 2VOTA 3O41B 1SFDA 1DL7H 1N0XL 2Z4QB 3REVA 1U8QB 4WCYL 1XXFC 2LU5A 3TV3L 4X6CF 5IB5A 3MV9A 4P59H 5D7LA 1I5YA 2B2XH 1T4KA 4ZMLA 2ALAA 3A4EA 2GJ6D 3FO2A 2QSQA 3U46A 2MNWA 4ZI8A 3VRLE 3O0LA 4C4BA 4Y2NA 5LJYH 1RK1A 4QD2E 2B1AH 1XGUB 4JM0A 5AYTA 1ZLVK 4JKLA 5DTFA 3IFXA 4Z7OB 1UQSB 3NFSH 5I82A 1I3RB 4ZI7A 4G9DA 2YBGA 1S9XB 1CF8H 1YN7B 3EZ8A 1BZQK 3MLTB 2COQA 4P2OC 4JHBA 2FB4L 5CFHA 1VADB 4NUGL 2YD1A 1KGXA 4PJCE 2GHYA 1D5IL 2FD6H 3OGCA 2BWIA 4ZMAT 1JF1A 3QAQA 5C8YA 1ET5A 2Q87A 4DIXA 2E9WA 1QASA 5I1CL 4UAHA 2AEPH 3SGKA 5H5NA 1MF2H 2UYLA 3RWJB 4P3WA 3EJCA 1B0IA 4BM7A 4JQVC 1QQCA 4HEPA 1KTKE 5E7BA 1P9MA 3JWDH 3JWOC 2QWPB 4ICGA 1ADWA 1B6DA 1J0HA 3IWVA 1AACA 3C5XA 4PJ7B 4FFBB 1WAAE 5DUBB 3L71H 1DN2A 4TQFA 1FC1A 2YBRB 1J0JA 1F45A 1QQDB 2DI9A 2IANB 3UL4A 1JPEA 3WD5L 3PJLA 1JXJA 3S37H 1EJ6A 4JE4B 2WCSA 3QXAB 2J25A 4ZHQA 5F3HA 4DN4L 1YNTA 3PHOA 1H8HG 2WHVA 2Y69C 5EZOL 3PL6A 4YE4H 2HCZX 3O2VH 4ISVB 2ODMA 1KBPA 2CDFB 5IG7B 4J1UB 4BQBA 1N6UA 4Z0BH 4GAGL 2F1MA 1UM5H 3JD3A 4PJHB 3O8XB 3ABKC 5GRJH 2UUCO 5HGBA 4HPHA 2X88A 4IKKA 2A77L 4NS0A 2H41A 5KA5A 3CCHB 5IBLC 4LEEA 3KLKA 4ORGA 1F6AA 2UUAO 1AD0B 4FXKA 3L4YA 1KKDA 2XQYA 4IKIA 2VDRH 5CEYB 3H9YA 2XXCB 2VAAB 4NUPA 1SZTA 3S36X 2RJZA 5CU5A 3TT3L 2VABA 4JCLA 2GEQA 1Q4NX 5HJGA 1XX9C 4HIEB 2VLJB 2GTZA 1XF2A 5IJ0A 1XNQB 1T1ZB 4FMFA 3LD8B 3RTQC 1XR8B 1G6VK 4QJ3B 2VITA 2VUKA 1A7RL 2AJYL 2CKNA 4XVSL 3AEIA 3GZKA 4A2HA 3MRRA 2H2PD 3WENA 5HPMA 2CTPA 1U3HD 4ZMZA 1LE9A 1HEZA 1S7XA 5I8CB 1MVUB 1IBZA 2ZR2A 1K5QA 2ZUXA 4OF6A 1KDIA 2NY1D 1CS6A 4X4MA 3V0VA 2X4OA 3BIKB 3BPCA 4Y5VB 3VCLA 1ZDQA 2Q7HA 4Z78B 1DANT 3QPXH 5JYMA 5L2KB 2HRLA 4JKPL 4RFEB 1IAII 5HY9A 4UIMA 3RILA 3JARB 1AGBB 3C8KA 5SWSA 2MOGA 4BJLA 1G4MA 3MLRL 4U6HA 4ZW7A 1RK0A 2O4EA 4QRPA 5DVOA 1LK3H 4WV1A 3D0VA 4NP4L 4H1LA 1VQ5V 4WK0B 2WO2B 5T1DL 5I24A 2VC2B 4PHXA 4Q6IB 2Z8RA 2VRKA 3CPUA 5TD4A 2OSYA 1EX0A 5BRQA 3QUML 4UTBA 3SZKC 1ZHNA 1KEGH 2QKIB 4NC1C 1YCIA 3MLZH 1CBJA 3IJHA 1OP9A 1HIMH 1ZV5A 3ZN0A 2FJHB 2F5BL 2RFXB 1PNMA 1SM3H 3GRWH 4OJEH 5C6TL 4TM9A 2Q1EA 3IFNH 4HUUB 4Z3EA 4Z7QE 1QNZH 5DR5L 3I75A 3TZVC 5TQ0L 3GINA 3RYMA 5KBKA 4TSBH 4B53A 3UBFA 3QI9D 5KVFE 4X5XB 5JO5B 3VFVB 1TFPA 3FB7B 4JF3A 4K5LA 2DQUH 1JWUB 3P4MB 1MG1A 3R1GH 3VXTA 4Z7WE 4DV5O 1NH6A 2JKIS 5D5QA 2X09A 5GTIZ 2H47C 2ZQMA 1NICA 4NO5A 5A2KH 2X70B 1VP7A 3QS2A 4RAVB 3CFCH 3RJDA 1TZHA 3P11H 1KTLA 4JZJB 3T1CA 1B6UA 1NDTA 5CA3A 5I2IA 3KYNB 4MASA 3UAFA 3HC3L 4PJGA 3ZMSA 2P44B 4U3SA 2XKUA 4OBSA 1DQKA 1BIIB 4JAMA 1JCKA 2R4SL 2DLTA 3OKLA 4A6YA 1U8KB 5AUMB 2WLNA 3OAAG 1U8PA 3ALXA 1VPOH 2XC8A 3L13A 3IDYC 4AC2A 1A25A 1NFDA 4G1EB 5CINH 1LM8V 4HOMA 2PWEA 4CDGC 3HNSL 4RH4A 3B2EE 1PZUB 1AHKA 4R3SA 4ZXBD 4WI8A 3HPJB 3SZ6A 3WXWH 3CFMA 1RV6X 5D6CB 1N4XH 5TDPB 1F8TH 4FNLL 2A3TA 5B8CB 4XXWC 4OFQA 3D48R 2ZCHH 3T2LA 2QSCL 4H0IA 2QR4A 3VXSB 2IH1B 3QUZB 5DD3H 3VO0A 1KIQA 3E8UL 3BKJL 3CEIA 1L7TH 1V7ML 1AVMA 5T1LA 2OR7A 4JI5O 3IF1A 4APQC 1AMYA 3D39B 4CU8A 5KHHA 3QUXA 4KMTH 4P2CG 1KXTA 1BLIA 2ZNXA 1USZA 4HIJB 4LBEA 4PJXA 5CXPA 2YXYA 2HTKD 3LY6A 4I1RA 5TE6H 3W0WB 1FP5A 2MRYA 1N8OE 2X41A 3A6OA 1ILUA 1NANI 2UY7A 3IRCA 4OD2B 3HFML 2EE0A 4JFTA 3VMPA 3LNEA 2VDLH 1E67A 4XMPH 3LDCA 4UINH 1FYTB 5EC2A 5G4NA 3FCBA 4V2BA 1FH5H 2WV3A 3ZTDC 4X8GA 1BG9A 2BP0A 2F74B 4E9TA 4LP5A 3GD1C 2O5ZL 4W1TA 1UD2A 2PR4H 2IW5A 2MWCA 2OX5B 5LBSH 4JG0H 4NI3A 1C5DB 5SX5K 1K72A 1TZ8A 1BM7A 2V2XB 3BP7B 5F7YC 1AD9B 5IVXE 3RZCB 3ZL4H 4RGMB 4H8WC 4ZNEA 4R4FH 1KN2H 1SQPH 2XZZA 3V7MA 4K9EC 5IHHA 3IPBA 1HE7A 4LKXB 4NRZB 4UNTA 2WVVB 1NCBL 5EZJB 4P23C 4LOVA 4DGWC 1YIJV 2IMNA 3QJQB 3VRJA 4KVCL 3FQ4A 1VF6A 3FFCB 3FHEA 4JQXC 4D8PA 3GJEB 2YD3A 4OUOA 2ADFH 2XPGB 3ECVA 5E1HB 1OTUC 3TC9A 3MXWL 1ZTXL 2F7PA 3H3PH 2R59A 4U6YA 2CGZA 1A4KA 5EIBC 1IL1B 2OP4L 4PMEA 1QFOA 3RY6C 3BEVB 4MDIB 1QVGU 1ZLWK 3IJ8A 2D03L 4YWGL 2QWQB 2WUCH 3LZLA 3VI4A 5ACZB 2ZNIA 1YO4A 2F54E 2GPZA 4Y19E 2QR0A 4M8UA 2N1TE 3QIWA 4JG1L 1FFRA 4GI8A 1U8LA 2PZSA 3FB6B 1E42A 4HCFA 5IJVB 1XB8A 2R2HB 4JYAB 4ZO6A 4BW9A 5E5MB 1N12A 1P5VB 2N01B 4FFYL 3FONA 4J41A 2DD8L 3OXRB 2BHUA 4IS6B 2NY7H 3FOMB 1WP6A 4KI5F 4NNXB 4PCYA 3ABMC 4AZUA 4PTUB 3T3PB 5HSFA 5I1AA 1JK8B 1MJUL 1GMEA 3G6AA 1FLRH 2WW8A 4YHZH 5BO1H 3NZSA 4GIOA 3TBTB 4WF9V 3AWGA 4PJEF 3BGMB 1LO5B 5I23A 1UOVA 2ZCKL 1UGKA 1A14L 1M7IB 3NR7A 5F7MC 1KB9J 4E36A 5LVEA 3GZQA 4F24A 1JWSB 4Y4HC 3TONA 2Y7MA 2JDIG 1RZFL 3O11A 4LFBO 2QFRA 1IGCL 2GSIA 2WXIA 5C07B 5CD3A 1RPOA 1CC3A 4X64B 2YD9A 5ESAA 1VACA 5GONB 4PWHA 5E6YA 4EJ1C 5C0DB 1BAFL 1CYGA 3QG6A 1R3JB 2CJTA 3RWFA 2NY6D 3O2WH 2QT6A 4APXA 5EN2A 3LZOA 3ZDYF 3GMMB 4M43L 3BWUC 3I9AA 1VMGA 1IDSA 2QDWA 3Q2VA 2FWSA 4FTDA 15C8L 4YDVA 4KQ3H 2CO7B 5ILTL 1QFWL 3AREA 4NHCL 5DHDA 4X1YB 2UZIH 3B2VH 3B9KC 4KQ4H 5DA0B 2CTRA 2BCMA 1QO3A 3BEWB 1BQRA 3K5OA 2NY3B 3EXLA 5F70A 2NTFB 4U6VH 1NGPL 4PGBB 4B3RB 4X8CA 5E8EA 1DN0B 1PFCA 1JZGA 2E74B 1T1WA 1WUNT 4Q4EA 1LE5A 4XPAH 3QNZB 4X6CA 4Y19D 2F54D 5HGHB 2BNUA 4Q0XL 1F11A 1DQLH 1FNFA 3JZ7A 3AU1B 1YYML 2IDCA 3EH5B 3QEHA 1NINA 3TYFA 5H2BB 5F72S 4YVUA 1Q9OB 1XF3B 2N7BA 3DVNB 1DVFD 5D1XB 4O4IA 5F96H 4AYMC