2EIKB

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2eikB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2eikB02
4BWUA 2XV0A 2I7SA 3FU7B 4GYBA 4Q89A 2EILB 1AAJA 3N2JA 3X1BA 3PAZA 4DP8X 3TASA 2TSBA 5I6NA 1NPJA 3T6ZA 1WA2X 1ASPA 3NJGA 3DIVA 3AG1B 4HCFA 3EH5B 1R1CA 3TU6A 4DP5X 1W8EA 3QJQB 1SFHA 1NZRA 3AZUA 4MFHA 2CUAA 3ABKB 1WS7A 2R7EA 1RZQA 4E9YA 4YVUA 2BZ7A 1MZZA 1WA0X 2XUWA 2XX0A 2J57A 1KBWA 3ERXA 1SJMA 3FT0A 4G7SB 2WSDA 4GY4A 2JXMA 4AZUA 1HAUA 2QDWA 2J5WA 1L9SA 2QPEB 3PCYA 4EF3A 2TSAA 4A66A 4QLWA 1QLEB 5D4IA 3FQ2A 2ZXWB 2CJ3A 3FU8A 2P80A 4W9ZA 1AS8A 2PP9A 2AVFA 2FQEA 5B3SB 1KBVA 2YAOA 1KYAA 4HCIA 1PAZA 3U25A 2AZAA 4HCGA 1AZUA 1TEGA 4KO7A 4HHWA 2GIMA 1TU2A 1J9SA 1HAWA 4HZ1A 5I6PA 3ZIYA 4AI7A 2JFCA 3S3CB 3NSFA 1XMEB 1V55B 3HB3B 2X88A 3X1GA 1AOZA 1IC0A 1ET7A 3QJRB 2VN3A 2GSMB 2BHFA 4KNSA 2YAEA 3OM3B 3X1NA 4HALA 1KDJA 1AR1B 2GC4C 5D4HA 3AG2B 3FU7A 4YSCA 4JHVA 3DTUB 4KNTA 3FU9A 2YAPA 3NJMA 1ZPUA 2CCWA 3AY2A 2BP8B 5LDUA 2DY2A 2PCYA 3CVCA 4DPBX 3JTBA 1L9QA 1BYOA 2I7OA 3WKQA 1KGYE 3PPSA 3H4FA 1JZJA 3ASOB 1NIDA 2LLNA 3MBWB 4G71B 2ZONA 1E65A 5I6MA 1W6LA 2OCCB 1J5CA 3T71A 3ABGA 3WKPA 1M9WA 3N55A 2PP8A 2J56A 5I5JA 2PPEA 2IDSA 1F56A 1XB3A 2YXWA 5FC9A 3ZX1A 1GS7A 1KCWA 2VW7A 1PLAA 4A68A 1FA4A 2EINB 2FT7A 2YAHA 1A4CA 1OCRB 1JVLA 4YSPA 4DP7X 1QNIA 1A3ZA 3S8FB 2B3IA 4A2HA 2J55A 1EHKB 1GW0A 1AG6A 1GY2A 3T6XA 5B7MA 1M57B 5B1AB 3H56A 1SNRA 3GYRA 4KO5A 7PAZA 2FQDA 2BO0A 4UF7C 4P5RA 5AFAA 1A4AA 1JZFA 1PNDA 2FWLB 2PCFA 3QJVB 2VSMB 6PAZA 2PPDA 1AZBA 2HX8A 1ETJA 1NINA 3CG8A 3NT0A 4DP0X 3IE9A 1WA1X 5I6OA 1FWXA 1IBYA 1BQ5A 2RACA 3UACA 4E9TA 5I6KA 4M4RB 2HRHA 4BDVB 4YSDA 5PCYA 5TK2A 1J9RA 3WIAA 4G7QB 2Q5BA 1CYWA 2HZHA 1EZLA 3NYKA 5I6LA 3UGEA 3D12B 1FFTB 2Q9OA 1L9PA 2DYRB 5AZUA 1GY1A 4UAHA 4E9QA 2P80D 1AZNA 4HAKA 3NSDA 2BP8A 3OQRA 2WO2B 1A8ZA 3MX0B 3AW5A 1ET8A 1JXGA 2AZUA 1PLBA 4KNUA 3ZDWA 2UXVA 3OD3A 4GP4B 3NJLA 2VW6A 2HX9A 4F2EA 1BEXA 3QJTB 3EH3B 5PAZA 1URIA 2W8CA 4BWWA 1GS8A 1PCSA 3IBOA 4YSTA 4P5SA 3FSWA 1AS6A 4E9WA 2GB2A 2BP0B 2GC7C 1MG2C 3T6VA 4AKOA 2H3XC 4YSOA 3RYMA 6PCYA 1ZIBA 1OCCB 5I26A 2OJ1A 3NJKA 1ADWA 2PLTA 4E9XA 1PF3A 4KOCA 1ET5A 3QJUB 3NP4A 3NSCA 3L45A 2YQBA 5B1JC 1AZRA 1NDTA 1OCZB 1QHQA 2IAAC 1JZIA 4A2EA 4K9JA 1A65A 1V54B 3OMIB 2XU9A 1OF0A 2BWIA 1E5ZA 2HRGA 1NWOA 3GXUB 1ID2A 2VMJA 4BWTA 3C75A 1MZYA 1CC3A 3G5WA 1L9OA 4FA7B 1N68A 2PP7A 4G72B 2H5UA 4W1TA 4KO9A 4BXVA 1X9UA 5B7FA 1N70A 3ASNB 2FJSA 2B08A 3FPXA 1RZPA 1KCBA 1PNCA 3SBPA 1JZGA 3EF4A 3AG3B 4A2DA 1J9QA 4YSAA 2E86A 1ZV2A 3NJHA 4PCYA 4BDVA 3GDCA 3FPYA 1MG3C 3NP3A 4JHUA 1TEFA 1RKRA 1NICA 2XV2A 2ZWNA 1BYPA 2QT6A 1JXFA 1L9TA 1T5KA 2EIJB 1OE3A 2EIMB 4M3HA 1J5DA 4CSPA 1NWPA 3NJNA 1SF3A 2GHZA 1AQ8A 4BXSV 2VM3A 3QPKA 4WTQA 2DYSB 4HHGA 2IWEA 2PPCA 5F7AA 2YXVA 4A2GA 2I85A 3QQXA 9PCYA 1VLXA 2GBAA 1NTDA 1JZEA 4QKTA 5B1JA 5ANHA 3WG7B 2BW4A 1SDDB 3EHBB 4DP1X 1JERA 1TKWA 1L9RA 4DP9X 2FNWA 3X1FA 4YSUA 1BQRA 2GI0A 2BP0A 3V9EA 4ENZA 3PXLA 4ZK8A 4A2FA 1PMYA 1NIAA 1A4BA 4N8UA 5I5IA 4DP2X 4GP8B 3TBCA 2CALA 2IDUA 1ASOA 3ZBMA 3IEAA 3DKHA 5B1KA 3S3DB 3QJSB 1J9TA 1W6WA 3NJFA 2YAMA 2IDFA 1NIFA 1BXAA 5TK4A 1JZHA 2PPAA 2XXFA 2OV0A 2VSKB 2BZCA 2IDTA 3KW8A 3PAVA 1OV8A 5I28A 4A67A 2QPDB 1GSKA 8PAZA 3ABMB 4RH4A 1IKOP 1JXDA 2Y1AA 4N4YB 3V9CA 5A7EA 3X2QB 1HFUA 2AFNA 3FQ1A 1CURA 3BQVA 4GP5B 3IN0A 1PY0A 2MRYA 3PAUA 3KW7A 3H4HA 2VM4A 2XX1A 4FAAB 4WKXA 1CYXA 1MDAA 2HX7A 4CSZA 4YSRA 5I5MA 3CVBA 4E9VA 1SFDA 2DWSA 5B7EA 3T9WA 1ILSA 4G7RB 5F7BA 2XV3A 1CUOA 3UAAA 2WO3B 2FTAA 5IY5B 2XVBA 4YVNA 4G70B 1AS7A 3UADA 4E9SA 1WAEA 2YEVB 2ZOOA 4GXFA 4NB7A 5E9NA 1OE2A 4AKPA 5B1BB 4NERA 1XB8A 1IUZA 3X1EA 3NJIA 1GYCA 1OE1A 3S3BB 1SHXA 3TA4D 2MTAA 1I53A 1WS8A 1ZDSA 2XLLA 1B3IA 1SDDA 1OCOB 1BAWA 2XWZA 4JKNA 3WI9A 1PLCA 4Q8BA 3BVDB 2FT8A 2XXGA 3CDZA 3CZUB 2Y69B 2FT6A 3NJJA 3AG4B 2YARA 5AKRA 2IH8A 3SBQA 2UX7A 2IDQA 1OOWA 3FSVA 3SBRA 1V10A 2YAQA 2YAFA 4BK5C 2IWKA 4E9RA 2BWDA 3CVDA 3UABA 1E67A 4KO6A 4DPAX 2X87A 3FYEB 2UX6A 4F2FA 1AANA 4YSQA 1DYZA 2A3TA 4HIPA 1DZ0A 2DV6A 3S8GB 3HEIB 1M56B 3WNIA 4YSSA 1GR7A 1AACA 3FQYA 5D4JA 1GS6X 2FQGA 1PZCA 2EIKB 2PPFA 2HXAA 2IH9A 3FSZA 1JVOA 1ZIAA 1X9RA 4UANA 1PZBA 3OMAB 4X4KA 3ABLB 2UXTA 2BW5A 1ZDQA 2UXGA 3UAEA 1PZAA 2H47C 3T6WA 2R7EB 4L0PB 2CAKA 3FSAA 3PLYA 1NPNA 1YLBB 2FQFA 2VW4A 1BQKA 2JKWA 5EHFA 4YL4A 1KDIA 1AG0A 2XYBA 1KV7A 1NIEA 1E5YA 3FYIB 1SF5A 4DP6X 4F7KA 1UATA 3IN2A 1SHWA 1BXUA 2NRDA 3CDZB 4AKQA 1BXVA 2AANA 3OMNB 4KOBA 3WNJA 4DPCX 1IBZA 1NIBA 1XB6A 4YSEA 7PCYA 3SQRA 4DP4X 1AZCA 2IWFA 2QDVA 1ASQA 4AX3A 3EH4B 1ILUA 2UXFA 2DWTA 4NAJA 1AIZA 3JT2A 4PAZA 2N0MA 3FS9A 1E30A 1RCYA 2CBPA 1JOIA 2HLEB 3TBBA 4TXVB 3NSYA 2W88A
chains in the Genus database with same CATH superfamily
2PO6C 3OZKA 2M2DA 3U83A 5HYQB 1AQKL 1QKZL 1E6JL 1DJZA 3FN9A 2GBOA 1OGAB 1MKFA 3SDDD 5D7KD 4PRNA 4HZLA 2UZPA 3VXRB 2UUCO 2P44B 4I0CC 4PUBH 1YIJV 4UB0L 5TE6H 1AY1H 3UTQA 4ASUG 3FO9A 3KBHE 3CFCL 4G9FB 1XNQB 1AB3A 2P5WB 3PN1A 4W9DC 5HHOA 2AQRA 3EXLA 4HCFA 4I3RH 3IFOB 3C6SB 5DTFB 1O6SA 3KS0H 2ZXDA 4XHJD 4CC4A 5EBLA 5LA6B 2WKOA 1SFHA 2BVQB 3AZUA 3VXMA 5C0CA 4MRBA 1A6UH 3HG5A 4CGUB 1V8HA 4EO5A 4AY0A 1CS6A 4DQAA 1Y76A 4X20B 3MUJA 2XX0A 4JFFD 1KBWA 2EYTB 1FG2A 2WJ7A 1NLDH 3I6GA 4GY4A 1I5XA 4L3EE 3T2OA 2QGCA 3CXHF 2J5WA 1MVYA 2NX5D 5ETUB 2IBBA 1PZDA 2WCGA 2Z65C 1HVXA 4TF4A 4ZAKC 4WWNA 3LX9A 1RM1C 3APFA 3DPDA 4R4FL 3ABKC 2XAFA 2GPZA 4UTCA 4H40A 4KI5C 1MCPH 4PW9A 4N5UA 4FC3E 3V6OC 4Z23A 1XX9C 1U2YA 5BXFB 2FE0A 3GZKA 4PREA 4QF1B 5F7EH 3LKRA 1X7QB 1Q38A 1QFWI 4LIQH 4XBPA 1YVWA 2F18A 2LVCA 3MNZA 4IIJB 1WE5A 4G43A 3C60B 4I18B 2MOGA 3AREB 1D2DA 3EYSL 3ULSB 3VU1A 5KYXB 4BIZA 1K9TA 3EGSB 5DI8B 3MRKA 5FPRA 3SB3A 3U9UA 5JLZA 4Z77B 5IHHA 1FLTX 1AP5A 1QVOA 2YOAA 1Q9WB 2J2ZB 3RYIA 5EO1B 2CD0A 4FFVD 4V33A 1Y07A 2A4EA 4JFWA 4RAUA 3VFPA 4Z3TA 5JNYB 3LXUX 1OSEA 3MRMB 1NBMG 1DK1A 1VPOL 1CFVH 4J4PD 4B95C 3IDJA 3EFDL 1Q94A 1I9RH 1HZHL 4IYIA 3QFJE 4JO1L 4NNPH 4OLUL 5JDSB 4U1NB 3DTUB 1XNRO 1M2OA 1N0LB 3BAJA 2Q4PA 2ZWSA 3K6FA 2ETWA 1AH1A 1I3UA 1CGTA 3PGCB 4M4RA 3TV8A 5CGBA 4MKMA 4OFVA 2KKWA 1BEYL 2DY2A 1AQKH 1E6JH 3T2NL 3WY3A 4Z7VA 2KT6A 4Z9KB 3TFBA 1VKXB 1OZ0A 5EUOE 2OYMA 3G6DL 3UO8B 1CFNB 1R3KB 3N9GL 4UB0H 1NM4A 5C08B 4QNPF 3ZKQD 2D0HA 5AW9B 3S3WA 2OCCB 3CFCH 3O8XC 4AT6A 4GX2A 2CHXA 4B7KA 4Y4FD 4BIOA 3UEQA 4TTDD 3WKPA 2IANB 3QNZA 3OG6B 5IQLA 1H6TA 1XGTB 2IDSA 1K5NB 2OMVA 3U36B 4KPHL 4OAWA 4YHYC 4G83A 3IXAA 3VXRE 3MV8D 3U0TA 1TJIL 4L8SC 5C86A 1A4CA 1FXKC 4Y4HD 5FO2A 5FWRA 1FVEB 1JVLA 4ELDA 2X4QA 3F12B 3EF7A 1HNZB 2P5WE 3QWQB 2CO7A 4C4KT 1M7DB 3H9VA 1EHKB 2WVSA 1GY2A 1XD0A 2ERJB 1OPGL 2XFXA 3CZKA 5I8KH 3WN5A 1EZJA 5ID1A 3H56A 3RJQB 3ZX6A 3QUZC 2C9QA 3PNWB 2V9RA 4OFYD 4UQIM 5DK0A 1EHLL 4B9IA 4TL5A 5DCCA 1TDQA 4WSJA 3BWSA 4R4FH 5HGDB 1MHPL 3NIFF 3WFDL 1JZFA 4EI5B 1OD7A 1U8CB 5FYJD 4B3TO 1I7ZA 2FWLB 2X5PA 3E22A 5EIQA 3OUFA 4JREC 1GM7A 1MCWW 1HHHB 4OZFH 5LP6C 1E9PB 3EYSH 5CJOL 3LKPA 1QZNA 4DNLA 3GXTA 3MXVH 3MV01 4NXNO 3VFSB 4YGVA 1GJIA 4NM8L 5KAQG 1U8LA 4EUPG 3ZZLA 3VE0B 5E94A 4MX7A 3VYPA 2BIPA 4PSPA 2EEAA 1EJOL 1SQFA 5H6QA 5F6HI 5I6LA 5I71B 5CR8A 3BX7C 5IE9A 2GTSA 1VPOH 5DO2C 5FYKE 4AM0A 2RMNA 2D7OA 1FNSL 2P80D 3EFDH 4GAAA 4P9HC 2UXCO 1HZHH 1QQDA 4JO1H 3M45A 4G8EA 4KJYA 3VO0A 4OLUH 2XZZA 3QG6A 3NQIA 2GBUA 1X59A 4TN9A 3BFRA 2ATKA 5C0DA 2UYLB 2WYIA 3CDFA 3GS4A 1I5YA 1BEYH 2HX9A 2LAGB 3LZPA 2Z93B 3M88A 3RTQA 3T2NH 3CCMV 2C9VA 4HOWA 4U6VL 3LY6A 3ZMRA 2Y4TA 5F3BA 1IEBB 1MVFA 3N9GH 2X4PB 4P5SA 1BZOA 4Q20A 4P8QA 1GGCL 2MPVA 1AS6A 4FLYA 4P2QB 5L8KB 1A1OB 2XY1A 5KVFL 1KELL 3H1KH 1MFEL 1S9XB 4WWKA 1ADQL 4AI8A 1DVFB 1MOEA 1JDDA 2DQIL 2X10A 3JQOB 4H4NA 5JW3L 3C5ZD 1UD4A 1HL8A 2EDWA 2Q2EB 5J56B 2Y6TE 5B1JC 4LHUD 2A6IB 3LJ3A 3BRGC 2NTSP 3GGWA 4KPHH 4XOBA 5D1ZD 1T5EA 4JI7B 2WKOF 2IAAC 4JB9L 5C08E 4XMTA 1HEJC 1TJIH 3BPLC 3L3IA 4U05A 3BABA 3NOIA 2HRGA 4AW4A 5LMNO 4PFEA 1XGRB 3C75A 3SODB 3ZHVA 4G5AA 2AQPA 2R29L 5I73B 3UM7A 1OPGH 1NANI 4IKNA 4YDVA 3TWCL 3QORC 4WRLA 4H44B 2GTZB 2WIIB 3QULA 2YWZA 3G5YA 4N0FA 4XI5C 1EHLH 1MHPH 1E4KA 4NOBA 1ZX3A 3WFDH 3H54A 5DD1L 3KPLA 3BVUA 5GGVL 2VN7A 2GK2A 2ZKWA 4G8FA 2NW3A 4EIZC 5FECA 4FE9A 4J7ZA 4ZW8A 1QD0A 1UACL 4M1CC 3LDCA 3KJ4B 5CJOH 5EU5B 4NRZB 4RZCB 4OZIA 5AVVB 4MAUL 1DQKA 1VQKV 5BMFL 2F58L 3GHEL 4NM8H 4XHQA 1YAZA 2OAAA 4IBSA 5HVHC 3IWVA 3ZLQC 2H8PB 4GFXA 3B2VL 2EEFA 3DJ9A 1EJOH 1Z0NA 2G5UA 1MVUA 3FBQA 5F44A 5I1LA 5J1SC 2IV9A 2IWEA 1ETZB 1FNSH 2ZF8A 3ZO9A 4M1GL 4NAMA 2WPGA 4MAYA 1QNZL 1KOAA 3QQXA 1ZLWH 1N8OE 1RD6A 3GZOA 3NA9L 5IMOA 3D3IA 4XN9A 2Q7HA 5E2WL 1QYGL 1QCEA 2XWXA 4LSSL 4DP1X 3MDJA 4RFEA 2OI9B 4XDJA 1RHFA 2BTQB 4YSUA 4TUJB 2VDKL 5EU3A 3VJ6B 4ZPVA 1TFHA 2VLRB 4U6VH 2XBDA 4KKBC 4PYGA 2NY6D 5I5IA 4GP8B 5MENB 1GGCH 1FRGL 3C6LD 1ASOA 4U49A 3RNKA 5J89A 4F9LA 1KELH 5KVFH 1JK8B 4WFFE 1YC7A 2ZCLL 1MFEH 4WI3A 2WA4A 5T1KD 1ADQH 2DQIH 5JW3H 3F7YB 2L6LA 1J88A 1E79G 1U8OA 5E6IB 1QI3A 4U7OA 5B4MD 2IDFA 3C8DA 1TVDA 3KPMA 4AENB 4UTBL 1BFTA 5TE4H 3TO4A 4JB9H 3E1F1 3GSWB 5IWLC 2IDTA 1U93A 3LNEA 3G08A 2WLIB 3OAYH 3QT2A 4BH8A 3ARBD 1TO4A 2R29H 3ECVA 1DEEA 5H37H 2C5DC 3KCPA 3V9CA 5A7EA 5DJZA 5DJYA 3TWCH 1YNTB 1R3JB 1SVBA 5AEAA 3W2DL 2Q7EA 1FBIL 1YF2A 5HY9B 1KLFA 3MLXL 5DD1H 5GGVH 2QEXV 2Y72A 5DUPL 3MRRA 4CVUA 1EQWA 2APSA 3CVBA 3LRHA 4C56B 3FOMA 2OMZB 1XSOA 3GMNA 2IJHA 3CCLV 2XWCA 1UACH 2HPTA 2VOTA 2JKNA 5DLML 5EIIG 2WINA 2BSED 5BMFH 2F58H 3GHEH 1B2WL 1ORSB 1WAEA 2YEVB 3SEPA 1OE2A 3B8YA 2OKMA 5B1BB 5B38A 3B2VH 4FG6D 1HSBB 1KC8W 3Q9PA 5D1QA 3S3BB 4EXPX 1EX0A 2J5LC 1OGTB 2IOIA 3EO0B 3DSFL 4X6CB 4M1GH 1RZJL 2X9YA 2YXFA 1UT1A 1QNZH 2ZAGA 5AW3B 1GAFH 2WZ5A 3QIBB 4EDXA 2RQ6A 3NA9H 1H6UA 1KACB 5E2WH 1QYGH 1XCXA 2Y69B 2DQMA 2ZOLA 4LSSH 5HI4D 2UX7A 1TVBB 2UVFA 5IEHA 4B9GA 4X6FB 1UGNA 1MNUL 5DZPA 4MNQB 2VDKH 5AAMC 5BS0B 1EVUA 1SMDA 5C6WH 4R2GD 2COQA 2RALA 2VCOA 2ZXQA 5H37A 2V3EA 1FRGH 2QR0A 4U1LB 5CFAA 4YSQA 2PTVA 4BQ8A 2Z34A 3HKEA 4WNQB 2ZCLH 4HD5A 3S5ZA 5E5MB 3ARGD 4PJGF 4QO1A 4NHUB 5LGJA 2DV6A 1D9KD 1ZT7A 4HWEL 1O9WA 3Q43A 2VLRE 1PD0A 4UTBH 3MNVA 1PZCA 1WUNT 3DVNA 2KG7B 3Q1SL 3VMPA 5MENE 2ARJB 4GW1B 5T3XD 4L1BA 3UAFA 4QRRB 4C57C 5FLXN 3WUWB 3QR1A 2CHZA 1BCCH 3DVFA 4F7CB 4KRPC 5C07D 4H0HB 1FZJA 4Z7WF 2VZVA 1NPNA 2ESVD 3LEXB 3W2DH 3JALA 4IS6B 1YN7B 2EXYD 1FBIH 1UH4A 1K2DB 5AKSA 3VQYA 2WN3A 3MLXH 4EPSA 1YI2V 4XXDA 1P6AB 3BN3B 5DUPH 1XIWA 1UATA 5HP5A 5JORA 4WW2A 3UZEA 4U1MB 2YA2A 1SHWA 1UFUA 4P4KA 5DJAB 3S88L 2N7AA 4GUCA 3CDZB 4AQ1B 4MJHA 1AI6A 4X7TA 4JFUA 4UUJC 2JGUA 2V5RA 1FNGB 3L3HB 1FF5A 2JB6B 1JN6A 2ZT9B 1B2WH 3N91A 4PJBA 1AZCA 2O5YL 4NQCB 3SQRA 1UT2A 3V10A 4GKKB 2YSUB 1R5IB 2NNXA 3I75A 3NESA 1TR7A 2QTEA 4F93B 4C56E 4ZDHB 4DV2B 3TTYA 2YSSB 4JL2A 4ZBMA 1Q9LA 2WXLA 4ZW6A 4A2MA 2LJ2A 1KTLA 1Y6NR 4LPXA 5I76B 2UZIL 1FYTB 5CGYC 4IOIB 2PXYC 3DJSA 3DSFH 3RL1A 1RJYA 1JR9A 1RZJH 1YEGL 2IADB 1N36O 3AY4C 4Y2DC 4IKIA 5T8IA 4M5YL 1ZD6A 2JVUA 5CCKL 4XCNB 5D7LA 3EJZC 1F51A 2XHBA 4UTBA 4LCUC 3PWPE 4D9RE 3NSYA 2WTRB 3EGDB 2Z35B 3CFBB 3CMOL 3L9YA 1XEDA 2FYYA 1JZDC 32C2A 3AACA 5G4OA 4BSWB 1MNUH 4KK6C 4E42B 4CKVX 3LNMB 1S7SB 4XXCC 3WTUA 2R23B 3ARXA 4K7PY 4X6CE 5GS1C 3VFNB 1XWVA 1L4IA 3FT4B 5F3HB 4A37A 1NPJA 4IRZH 1QLRA 3V52L 1U8PB 2H6UA 4EI5C 3F7RA 4TRPL 5IJVA 5L2JB 4JI3O 2AEOA 5LYJA 3U1PA 4IEFB 2BNRD 3TU6A 1FO0L 4HWEH 3OE7G 1N8RW 3ZUCA 4OF8A 4JAVA 4NB5A 4Z1MG 2JIXA 3Q1SH 4PB9H 2AK4B 4N85A 4A55A 3D36C 4KDTA 2PCPB 5AZEL 4F9PC 2BVOB 3BQUD 2C34A 2LTQB 2BZ7A 2R72A 2CK2A 2WD0A 3ULUD 1CFTB 1UZ6F 4YHHO 3KS0J 4G7SB 4JYCA 3HR5A 3BMVA 1KZYA 2FUTA 3V6BR 1HWYA 2YGVA 5B1NA 3MBWA 4LKCB 4FI7A 3HC4L 4DV3O 1P9MA 3CMAV 4XPAL 4HG4J 1NPUA 5CMAB 5D4IA 1VADB 1TCRB 2E4TA 1MIML 4QRRE 5CJXA 4I9XA 1Y7VA 1BD2A 1QSVA 4XRCA 1ZAGA 2AVFA 4BFKA 2NY4D 1I1AB 1H19A 3W5MA 3RGVC 3QNEA 3KBPA 1BAGA 4CVXB 2PCXA 2RB8A 4FLSA 1P5UA 2BS71 2JK5A 1JGDA 3FTZA 3U25A 3HKBB 1J1OH 1IGML 1RSFA 3NJVA 3T0AA 2AZAA 43CAB 1TEGA 4KO7A 1CBJA 3VG0L 4IBLT 3B40A 5AVWB 3CH8A 4R4BB 4YHKL 5JW4R 2JFCA 2YGPA 3QJHA 2L4OA 2QLVB 2A9NL 1ZCRA 2AHZA 2ILLA 3U46A 3W57A 3RKDC 2O5YH 1H6FA 2AJYL 1YEHL 3KYMA 1J12A 2VE6A 1HYRC 1SESA 2IJKA 2A0LC 4PS8A 1DJWA 3RJOA 4NO3B 4FLOA 2UZIH 1RUQL 1P4UA 4QPEA 1D5MA 5JW4N 3MRFB 1G0DA 4BQ6A 3CHXA 1N2RA 4WKZA 1YEGH 1L0YA 4M9OA 4X7CC 1JPFA 4M5YH 4PGCA 5CCKH 1VFMA 2OTUA 4YMPA 2R1YA 3HB3C 3MRCB 4NQCE 1A6TA 4HS6B 3AY2A 4HKXB 5K69A 5A16A 1BMFG 4L8CA 4Y9CA 4OGYL 3CMOH 3JTBA 4IGBD 1VQPV 2ZOUA 5C71A 3M17A 3KPOA 1FYTE 1PG7X 2JXMB 3JV6A 3H4FA 3P9MB 2CK0L 5E2JA 4QRTA 5IOKA 5L2KD 1QP1A 4H44C 4P5TB 3ZTDC 4E68A 2WLHA 4XP5L 3V52H 3TK1A 1F42A 4CH5A 4NN5B 1KCUL 2YN5A 4TRPH 5DHYA 5LGYA 1XZ0A 3L7FB 3CIQA 4JR9L 2UZYA 5I5JA 3VMNA 1FO0H 1GO3F 3T3MF 3B9KA 1HS6A 1ZHNB 4LCWA 3L5JA 5ICZA 1WFJA 5K39A 5ICXB 4A7GA 1TYJA 2P06A 4PA9A 5AZEH 3SPIA 2VUOA 4NO5A 1IBBA 5EUKB 4E5XA 4RQQB 4N3TA 3L4VA 3T6XA 5IYBO 3X12A 5GPRA 3QDMA 3HC4H 1FFXA 4XPAH 1NCUA 2FQDA 3P4OB 4EIGB 4F2MA 2F66C 1MIMH 4FG2A 5DRNB 1R4XA 4PW4A 5IW6B 4PI2A 4J8RB 2HEPA 1HCZA 2A6KB 3PE9A 1P49A 2DBJA 4DP0X 2Y3AA 3CG8A 3BUBA 4Z7OB 4HPHA 4UQBA 1X5HA 2Y5EA 2HHHB 4WW2F 1BQHG 1E4XI 5IBLD 1IGMH 5IFHL 5ISZD 4KHTH 3VG0H 1PFOA 2VLLB 3DROB 4BDVB 3QNFA 1M1SA 4YHKH 1BZ7A 4MJIA 2QPUA 1NEZB 3OW2U 2A9BA 4ABMA 2A9NH 3MRLA 1U3JA 2GJZA 3D85B 4JI0B 1ZLZA 2L7UA 4PHZA 4JK0D 1IXMA 3BLPX 2AJYH 4YDMA 4XNZC 1YEHH 4EDWL 2CKBB 5B1OA 4AE0A 2ZR3A 1LDPL 3P0VL 2UY7A 1MCEA 2VO8A 5BUPA 5KEZA 1FL3B 1BFSA 4LF8B 3VD0A 1RUQH 1FFPA 2X2HA 3OV6A 4U31A 2LLGA 2N3JA 3VD7A 2FWUA 3CFQA 5GGSB 1N3NA 3HKFA 3UJIH 2BVPA 3IKKA 1MHEA 4GP4B 3FQUA 2PW2B 4PJ8B 2LV4A 3QZPA 1J8HB 4APQA 5F3FA 1F6AA 2OMYA 4N6RB 5A6LA 5E9DB 1M6OB 1N6UA 5T1LB 2CK0H 3EXAA 3EOYG 1G7LA 5EF1A 3RPIA 4TSCL 2NUPA 4M3KB 1BIIB 1PW3A 4WHYG 3DUSB 2YIAA 4XCYA 1NMCC 2WOYA 3NR7A 4XP5H 2XWTB 1RZIA 1KCUH 4NFBA 4YR6A 4BFBD 5I26A 5I0ZA 3L74H 1ADWA 4JR9H 3EOAB 1Y66A 4H7VA 1ZPLA 3S37X 2YI8A 3VGAC 3QO8A 4X99B 2A4ZA 4JMXA 2OQJB 1GJUA 1TQWA 2EYRA 3JWOL 5SWQB 3BUPA 1RP8A 2ZE6A 2WW8A 4WZ9A 4MXVF 4W4OA 4UAOB 1SN5A 3HKZA 1I8KB 3VBBA 1ID2A 4XP1L 5EFIA 4AUYA 1AKJA 2I07A 4FGMA 3VTTA 1LEGA 1U92B 4DR7B 3EJYD 3NCJL 1C7TA 2AJZA 2R2HB 4JO5A 3CZFB 4HIIA 5E99L 4CILA 2ZNJA 2FJFB 2Q20A 1TO5A 1OCZC 2X38A 3SJVD 3VG9C 2P22C 3ARSA 3EF4A 1V54C 5IHZB 3B2PA 4LL4A 5D5PA 4MCYB 4XN5A 4PCYA 4XPHL 4WEMB 3REWB 2AVGA 1P4IL 1HNZO 3EAKA 4LHUG 5LO7A 3C90A 5A2BA 2UUDH 4PP2B 1BJ8A 1QBAA 1E27A 4OD2A 5C2BL 5EC1B 5EOCL 3SDCD 3FAVA 5IFHH 1ZK9A 1WAAF 4YPGB 1OO2A 4WV1B 5GGTL 2X4OB 1G1OA 4JZNB 1ZS2A 4ZFFB 2FIRT 2XVKA 4HBQA 1IBKB 1JMXA 2HLAB 2YWYA 2NY5C 3QEUA 5CGTA 2NX5E 3DC0A 2VLME 1QR1B 2NZ9D 4IMLA 4Z7OE 5I0DA 5C0FA 4EDWH 1GHFH 4XNQB 3FF8A 1HOEA 3P0VH 1LDPH 4ADGA 1GKEA 5J7CC 4NC1E 2PPCA 1BJMA 5E8PA 1DZBA 4F6RB 4JQVC 5DJ2A 1K8AW 2XXMB 3FCTA 1UA6L 4J7RA 1NTDA 3ES6B 3APMA 3W0WD 1QSFD 5D7HA 1G6UA 3AS2A 2Q9LA 1DDTA 4G3YL 4NBYB 4KUCD 1BMZA 3OKNB 3CXDL 3S9DB 3CN4A 2DYSC 4HZ3A 3WE1A 4O2CA 1U8NB 4TSCH 2Q87A 3V95A 1IM3A 2ARWA 3U7YL 2WQUA 3E3QE 2XAHA 1KY7A 1QX1A 3GJEB 2ZCEA 2JF1A 5ESAB 4F7PA 1NEUA 4PVBA 4G8GD 3S3DB 3BHBB 1J8HE 1UXSA 1YITV 1W6WA 4AL8L 1G7HA 1PX4A 4N23A 1BXAA 3JWOH 2M26A 1Q6IA 1LL1A 1B2YA 3FB5A 2ENJA 4CS2A 4PJIA 3E86A 2DQ0A 2YZ8A 1DLHB 1DVTA 4J11A 2VSKB 3B7UX 3GO1L 5KSAB 2YXHA 1JPGB 2V9UA 4WTWA 4A7GF 3PJLA 4XP1H 2ZT9C 4G6AC 1Q9KB 3EOBA 3QC6X 4N4YB 4JS7A 3WTXA 4YY3B 1IAIL 1BWWA 2YUVA 3NCJH 4FEIA 5E99H 2AXFA 2QADC 1URFA 1XSJA 3HTLX 1CURA 5DYFA 2CIKB 4EAEA 4KRNA 1II4E 4JI7O 3H7BB 5HVGB 4B3VA 4X5WA 5LHIA 4NC2B 2GJPA 4P23C 2VYRE 4XPHH 4JI1B 1EJ6A 4W6YB 1A9VA 1P4IH 1GGUA 1E3FA 5GJTL 3MV8E 4X8CA 3OPUA 1U9KA 1BX2A 2QGEA 5C2BH 5HI3C 5EOCH 4ZPTB 4FNSA 4OZGE 3VI4B 3H0TB 5GGTH 3F5TA 2G75A 5C0BD 5J6GA 2ED8A 3VM7A 2Y5TB 2P8MA 4E9SA 3DX4A 2HKOA 1EDQA 2G5RA 2TRYA 4X9HA 3TN0A 5HPOA 3ULVL 2MQCA 4N5EC 1WB8A 4AKPA 5EO0B 1MHHA 3CRMA 4JG0L 4DCQB 5KA5A 2W60A 3OEEG 1MQ8A 2DKUA 1IC4L 5IESL 1D6EB 4A04A 4PRPA 4BKLA 3B8NA 4H5SB 2Y6SC 4ICWA 4UMSA 3RWJB 1PGRB 2PI4A 2IPUK 1UA6H 3OXSB 4PLOB 1NGPH 4M6OH 1C16A 1TQVA 5CILL 4E4EA 4RVBA 1SXNA 4M00A 4FCAA 3L75H 4G3YH 4RAVB 1MUJB 2G3ZA 4OFKA 3RURA 4LNRB 5L3DA 1KYFA 2I5YL 2V9TA 4AZ8B 3CXDH 3U11A 5AAPA 3CN1A 4YEEA 3L4WA 3U2SA 3K58A 3K0WA 2IWKA 3ZZSA 3COOA 1KT2B 2BVEA 1M1XB 4NQEA 1QA9A 4N6QA 2HJFB 2IAMD 1OWWA 2MNUA 2UX6A 3U7YH 4FXKC 1KIQB 2OM5A 5IMLB 5H9CA 1TFPA 2ZG2A 3JAKB 5LLIC 4FFTA 3S8GB 3LEYL 4YN3A 4AL8H 3HEIB 4NTYA 4PY8I 3WNIA 4EMZA 5MERA 1LMKA 2BNUA 4IHOA 4NN6B 3VXUD 3ALPA 1G7PA 3KPNA 4FHJA 3CCHA 4KVCL 4XNMA 1X9RA 3GO1H 5D7SL 3OMAB 1MW2A 5DZVA 5F7DA 2DIBA 1JGVL 4GAYB 4BE5A 1KWKA 1XGPB 2ODIA 2MNWA 1MA1A 4NUQA 5FHBL 1RJCA 5GGTA 4EN3C 1B6QA 2EULA 4OUUA 1IZJA 4ZO6A 2VQEO 5HTSA 5KG9A 4YBLC 3LVTA 1UB5A 3DDFA 1IAIH 4R96A 5BV7L 2G9HB 4Z5RA 4YHNA 3CU1A 2YPLB 4WF7A 1HX0A 3O9WB 2EIKC 1T80A 2C4FU 4XMVA 2CA4A 2OL3A 1KFGA 3LV3B 3OKYA 4FN0A 3SCMB 2H1LM 5DD3L 3FYIB 1NCCL 4G8AC 2CE6A 4S1DC 1WT5C 3HKCB 1AFVL 5GJTH 1I3VA 2CDFB 1AI1L 2F54B 1X5ZA 3P4LA 3PHSA 1YYLL 2G3MA 4BZ1L 5IJCC 5IT2L 4HV8B 3PGDB 1F3JA 3LSOB 1R3LB 4D0BB 5CEYB 1ZWIA 1UPGA 2ARJQ 1ZHBA 3MRBB 3Q8FA 4BK5A 5EC2C 2NCEA 3MYZA 4TLUA 3ULVH 5AG2A 1JD9A 2PW1B 4NN5C 1N33B 5CLYA 3VFUA 4JG0H 1ASQA 2VLKB 3E6HA 3K5OA 4MJ6A 4U1SA 3LS5L 1BREA 3PP3H 4EI6A 1IC4H 1Z5WA 2BSTA 3NABL 4IU2A 3VI4E 5EZOH 3RVTD 4QDGA 4URTB 3G5XA 5BOJA 1BVKA 4PAZA 3QRFM 3LXCA 5DO8A 5F1NB 3CRQA 3BW9A 1B0GA 2HLEB 5CILH 1PP9H 4GT1A 3F83A 4L48A 3V79C 4ICGA 5D7JA 3K72A 4GAJL 2I5YH 2TRHA 3APDA 4UT6L 2J8UB 2FCBA 3TPUA 1H5BB 3CFDB 4TOYL 4F3FA 2L04A 3ZOAA 1KLGB 3HI5L 3UTSA 4JY5L 2K8QA 3OC5A 1FL6B 3MLZL 3NGBC 1T5XA 1A9EA 1F0LA 3T6ZA 4HETA 3BEWB 4LARL 1OJHA 4QIWF 5AOJA 2DEWX 4OSUH 1CFQA 3O4OB 5F0PB 1FAIL 3CNKA 3RVUC 4MASA 4X1KA 1V3MA 3HI1A 3LNGA 2X3BA 3LEYH 4W70A 3AUWB 2QQQA 4TS6A 2FB5A 5JHDA 2CUAA 2DRUA 1AP2A 3N0AA 3GMLA 4KVCH 5C8YB 1KB5A 1MREL 2R2CA 1QSEA 2ICES 2H94A 5D7SH 2K78A 4PJIF 1PM9A 1JGVH 1MZZA 1TUBA 5FHBH 2HVBA 5KVEE 1OT4A 1S7RB 2KERA 2ZP9A 4K8RD 43C9A 1PZ2A 3H3PL 3K9SA 4DW1A 4RRPM 4ZO8A 1P84K 5BXZA 5KAIZ 2AXGB 1IBGL 2R1XA 5ANMA 1TQBB 3VB9A 5BV7H 4OCLC 2CJ3A 1YEIL 4U3FH 4NKOB 5EEWA 3HRZC 3X3FL 3N44F 4QKXB 1NGZA 5E6YA 4PJ9A 1KECA 4MZIA 1OP4A 2FQEA 3BMWA 3R0NA 2NLJC 5KJ7E 3P2BA 5KJRL 5DD3H 3NPSC 1HHJA 1NCCH 3MNWA 1AFVH 4CDHA 2N7SA 5I75C 4B3RB 5C0EA 5F9OL 2HA1A 3SKUD 4MD5A 1YYLH 1AZUA 3A5VA 5IF0B 3VWKB 2YPLE 4BZ1H 1NJIW 3KYNA 4FQQB 4HHWA 3GXDA 2PO6A 3EBGA 2N1TE 1JRHL 5BPPA 2VM9A 3VFWA 5B3NA 1YTFD 1IGFL 3SDLA 3CSFA 1F02I 3QIWC 3V6ZA 2Q7AA 4B3MB 5K1VA 3SKMB 3T4ZA 2QJ1A 4HIHA 1GPOL 3B83A 1U91A 2CMRL 4DERA 2F54E 5JO5B 3QVAA 3LS5H 4D7PA 1T83A 2R39A 3NABH 3LMJL 5JR1L 4FIPC 5T1JA 5F97E 2WB1A 4HUVB 3QUXB 3MLYL 1WCBA 5JIIA 1X6LA 1KBGL 5EF2A 4KZCA 4YSCA 3PIQB 3EO1A 4HAMA 3K4ZA 3L5HA 3S35X 2HKHL 2BP8B 2LU3A 1MW1A 2VLKE 5E08L 2P5EA 4JQXC 1MFCL 4GAJH 4QHPA 4UT6H 3ROLA 4NKGB 1N0JA 3MXWL 4DV2O 4LF9B 5E95B 4F15B 4TOYH 3IGAB 2QZQA 2X2UA 4MTGA 1W16A 3HI5H 4JY5H 3M1BB 1SQBH 1EJ8A 2DYPA 5K5YA 3P54A 3RPBA 2K1MA 4LARH 4X5XA 2QWNB 4ZAKA 1FAIH 3ECWA 3TZVD 3V0AC 3S3XA 2PP8A 3G6JA 4PTTA 2PN5A 1IEHA 1Z6JT 2A83B 3TH4T 2L3BA 3V6OA 1YMHA 1E8ZA 5CIPB 3UYRL 5C0JB 1XL4A 4GSXA 1SBSL 1MREH 4M5ZL 4BZ1A 1WFNA 2FK9A 5CEZL 3F7VB 3S6CA 5CB4B 5IFJB 5BQ7A 3H3PH 4F33B 3IC7A 3PUUA 1IBGH 1IGCL 4B60A 5CCHE 2BOBB 1AJ7L 2HTLC 4QOKA 5GGQL 1YEIH 4Q6IC 1QW9A 3GVMA 4JTAB 1JMZA 3CH1A 4PV9B 3LD8B 5FKPB 3WB1A 4AXWB 4EFEA 2WBJD 4Q9RL 2E9JA 5KJRH 3UP1A 3IE9A 3OAAG 4CVZB 2CIIA 1JWUA 5BQDA 3UACA 3QQ9C 5F9OH 3TTSA 4UDUB 5DWUL 1S3JA 5CBEB 3TEWA 1T3FB 5IB3A 4Q9CA 2K9FB 1MW3A 1IX2A 1JRHH 2C7UA 3OLGA 1IGFH 3E6FB 2X6AA 4CN6A 5EBMB 3DRQB 6TAAA 1GPOH 3KDPB 4MW3A 2H4EA 3T2PA 2CMRH 3WJMB 4QR7A 3NYKA 3UGEA 2WB7A 3O8XA 3LMJH 4PJ5D 1Z9NA 5JR1H 4BM7A 4IIQB 1UQSA 4NPYA 5E5UB 1DUZA 1KBGH 2EZ0C 3AW5A 4F8NA 3LXBA 4QJFB 1PLBA 4O4LB 2HKHH 3CMEV 1VHPA 1G6RL 2FO4B 4L8SA 3VFGL 1FXKA 1HQ4B 5JPNB 1UXWB 3QEGL 1MFCH 1HQRB 1I7UA 2H32B 2QGBA 3E38A 3MXWH 4YE0A 4XO3A 1Y67A 4G1EA 1LNQA 2F43G 3RG1C 3VFVA 4N8VA 1KG0B 1U8JB 4J7KA 2Z31C 5CCJA 4ZUVB 3MBED 3V0EA 3RL2A 3QUZA 2YR3A 4NKMB 1CN4A 4XP9L 1CGWA 3L7EA 1PF3A 2ED7A 4FFWC 1ET5A 4LESA 2FUQA 3FTGA 4P05A 1CT8A 5DF0A 4MMXB 4NUJB 2BIIA 2JLPA 3L3GB 4G5ZL 5HGAA 3UYRH 1DQJB 1SBSH 4ZMAT 4G80A 5J2TB 5LP6A 2X4TA 2KDYA 3A4AA 1MXGA 1G9MC 5CN0A 4GKLA 4H1LG 2JEXA 4HEPG 3H9SA 3KGTA 5CEZH 4AYSA 3UIZA 5LGHL 5M7QA 4ODXB 1ZTXL 4NS0A 4U3JB 5AUMB 2BTOA 5L88L 4JPSA 4N1EA 4NCC2 3LTVA 4L9LC 1IGCH 3KPRB 4N2HA 5JIKA 1AJ7H 5GGQH 3WBDA 1KTKE 3FO2A 3ULVF 5AALA 4LKXA 1JZGA 5HDBF 1QFUL 4Q9RH 1N0NA 2BNRE 3SE4C 4NPJA 4PJ6A 5KYUA 1NC4A 3ZMEA 2XCMC 3IJYB 5GIRB 3UZVA 5F88B 3WY2A 1ZAUA 1H15A 3CCQV 1U8QA 3FONB 5DWUH 4D0DA 4OV5A 5FNVA 2CJUL 3ULUE 3K0GA 3QFDB 1H2MA 1AD9A 4TV8A 1REIA 1IAOB 4CSPA 2ZUVA 4XXWC 5IR1B 3IFXA 4MTOA 1D2OA 3APOA 3CFKB 5L0QC 1HNXO 1AQ8A 1F13A 3B2MA 2NR6D 1ROCA 2W65B 3GXIA 4UMGA 2VM3A 5F9JA 4BZ2A 4RBPH 2BVUA 4MXQD 4X83A 3BVNA 4LHJB 2DQFA 1LO3L 1SXBA 2WTPA 9PCYA 3QJOA 4X8JB 1M42A 3QIUD 3GTTA 5B1JA 1S9YB 4HUXB 4ZW5A 3ECUA 3MV11 4JI0O 5B8CB 1NCGA 5EK0A 5EBWC 1G6RH 4ADJA 2WLNA 4IK7A 1ZLUH 3VFGH 4YXWG 3QEGH 1BM3L 3CJJA 1SQPH 1KCSL 5IKCB 4JKWA 4AMKL 3PXLA 3WFCL 1KIRA 1PMYA 3O2VL 1VAHA 1QR9A 1SUJA 4NLAA 3IAYA 1A22B 2PYJA 2Q5ZA 3CCSV 3QORA 1N59A 3HC0B 4L2YA 2QKSA 4WK0B 3OR7B 5JXAL 1VFBA 4XP9H 1EAPB 2EE9A 4U1JB 3K81A 1I85C 1IAKB 2BCKA 5CSZB 3AS0A 4KI5F 5JJNB 1JZHA 3ZKXB 4G5ZH 4R5TA 2QSAA 1XQ4A 3HHSB 1XSIA 2PPAA 5FYKL 2Z1PA 1GGTA 3PWLA 2CJSA 5FA3A 2X28A 3GUTB 4A67A 3GSUB 5LGHH 2B1OA 5J13B 1MFVA 4RH4A 1S4IA 1ZTXH 3QPQD 1D7DA 5L88H 1HZKA 1KPRA 2ZG1A 2D31A 4QHMA 2UXNA 2I9TB 4ZXBB 5CJ5A 3BP7B 3UG3A 2RAMA 1QFUH 3QTCA 2H26A 1OIOA 2DQUL 2KYIA 5HFMA 1P2CA 1JPST 5IHUL 2WXPA 4LMQE 3TF4A 1ML0A 3KXFB 2EE2A 1JZ2A 2AZ2A 4NBZB 3SDXF 3KPRE 4GRWH 4F7TB 2CJUH 3UCRA 1G6RA 4R5VA 2XPYA 4WFHE 2H6OA 1EN6A 3VXOA 5A7BA 1CE6B 4AIOA 3D33A 2CK3G 3OGCC 5HGBA 3HOGA 4UV8A 3LHPL 5J2UB 2HFFA 1WWCA 4ZIBA 5EH1A 3O4OC 2X1XR 2NY3C 3PWJA 2AI0L 3NJIA 1SHXA 1TZIB 2J44A 3GSQA 4KP4A 3HE6D 4NENA 4WNSA 1WS8A 1BSMA 4PRDA 2WXGA 2K6WA 2GJ6B 3WEMA 1I08A 5BMVB 1LO3H 1YEWA 2I26N 3TBSA 4PRHD 5D96C 3MOBL 4PLJC 1BJ1H 1IBKO 3K71A 3WN6A 3L3DB 3OJ2C 2Z0AA 2NNFA 5INCA 2YARA 3GXNA 5F7HA 1AHKA 1LJMA 2N59A 5IWLA 1JYWA 4XZUA 3NK4A 1BM3H 3K6DA 1KCSH 2ZICA 5FGRA 4ZUSA 3WFCH 2Q0OC 1I75A 4OJEH 3O2VH 3O11B 3BI9X 2A2QT 1PQZB 1E67A 2WV3A 1WFTA 4QTIL 1UJWB 1PYWB 4X1YA 4HH9B 4NZJA 1UASA 2YD0A 3NN8B 5JXAH 3G4SV 4DOHB 1JGLH 2HJLA 1XGQB 4H25A 1FFNA 4JZJC 3QZOA 4X0KB 5BO1L 2FH8A 5IVXF 4JDEB 3L95B 4GX1A 3FQYA 4O4HA 1E28B 3QWOB 5I66B 2YICA 4LLUB 3PWUA 3V4PL 5FYKH 4TVPL 5HYQA 4L29B 1QRNB 1OGAA 1GC1L 3L8QA 5HGBB 5JH7A 1OF2A 5IJ0A 3V0VB 4AYDC 4FQHA 2TAAA 2CLRA 2ZUYA 1H3XA 1GJWA 2O6FA 2BSBA 4EI0A 3HZYB 4G9FA 4QHUA 4M56A 4IOFC 5DR5L 4PJXB 1P7QA 3MREA 5HHVL 3KZ8A 5D9SB 1XZWA 1AG0A 3VVVA 1KV7A 1KXQA 1P1ZB 2DQUH 3Q01A 2Z7ZA 4HSQA 1ONQA 3QEHA 3TJHC 5IHUH 2NUTA 5KSBF 2QVFB 1CLVA 1SLUA 3JV5A 4YY3O 1IM9B 4DPCX 4PI0A 2QGNA 1NIBA 5JW4M 3T04D 5E0QA 5CF3A 5AAMA 4F1ZA 3A6OA 4IRSC 2GW5A 3LHPH 3CD6V 1NBZB 2VJ8A 2H3NB 3JCUZ 1CICB 5DEFA 1T7VA 2AI0H 2F1BA 5L3GA 3KXFE 3KWVA 2ZDIC 4GKZB 2WVVA 2BSKB 4N9GB 2FJGB 2XACC 3E2HC 4HEMA 1BVNT 3SHSA 4HGWA 5T3ZL 3CPUA 3O3AB 2DBLL 3MRPA 2KSDA 3DO7B 3T0WA 4NM4L 3MOBH 5LG1A 1Y18B 3ETGA 1Z5HA 4CU7A 5INDB 2EEBA 2QQLL 1KJ2L 4IIJA 1UCTA 2IC2A 2EUVA 4M1DL 2CRZA 4UBDD 2H41A 2WP3O 3OAUL 1YECL 3TBYA 1SGKA 3MGAA 2VZOA 3LNDA 3WO4B 1IVLA 1DVXA 3QH3B 1WA2X 1Q7YW 5EZJB 3DIVA 1WBYB 3BGFC 5LQBL 5D1ZI 4DETA 3U30B 3S96A 1COWG 5E2TL 4TVUA 5BO1H 1CB4A 5ERWB 2FWOB 2OYLA 1N0LA 2JCCA 1QSFE 3MLTA 2Y24A 1X4YA 2R7EA 3V4PH 4AV0A 5D93C 1JV5B 4ANKA 3VXSD 1GC1H 3C3SA 4DOHE 2CKNA 2G0LA 2OCJA 4UUJA 4MD4B 4PA6A 3KLAA 5AYUL 2P8PA 3PCYA 4JFQB 4DW2L 3QXVA 1UG9A 3AAZB 2ROXA 5MEPA 1YPZA 5JIMA 5BRZB 3QO5A 1FVCA 5AAWC 1NGXB 5DRXB 5DR5H 3VGGA 2IANA 5HHVH 1AS8A 3LRLA 4FULA 4U6HB 3VXNB 1QRNE 5B3SB 1JE6A 2Z4QB 3VQMA 3IMBA 2ATAA 4ANVA 1K5NA 2PXYA 3FHQA 3MCKA 4DV7B 3QQDB 4XMLL 4Y2DA 2GEEA 4JRWA 1ZVHA 3S4SA 2EADA 5JPNC 2EC9T 3MFFA 1F6LL 4M48L 4BCYA 4BFGA 4GG8B 3F12A 4LCUA 4WBNB 3GMMB 1F4MA 1LP9B 4KJPC 2Z0UA 4CDGC 4MA7H 1LUVA 4PJXE 1E4HA 5IBUB 3F6JA 4HUUA 2XTJC 2DQHH 3FO1A 3AXLA 4J28A 2IH3C 3U6XA 5CSGA 4XXCA 2NZ1A 3ZKMD 1RZKL 2OSYA 2HTKC 3VFOB 5GS1A 3GS0A 3KLHD 3CSGA 4J8QA 2BSCA 4OGQC 25C8L 2DMGA 3KLQA 4I1RA 2EDTA 1NCWL 4EI5A 3FTSA 1IIIA 3KPPA 4PHXA 1BVZA 3CRRA 2IH1B 4YK4B 2GC4C 5T3ZH 4NNYA 2DBLH 2NSXA 2W0FC 4NM4H 4NQVA 2ICWA 2XOKG 4GUNA 3P11L 5J4MA 2QQLH 5FHAL 4M29A 4M1DH 3V4PA 3D36A 3TO2B 2BPBA 3LKSA 3QUKB 5DS1A 4F9PA 3M8OL 1XMOB 4OJYA 3QYMA 4EE2A 5JQ6L 1YMMD 1S5HC 1YECH 1S9WA 3OAUH 4U0RB 3WDJA 5CP7A 3MV9D 1DTUA 4NQDB 1FVDB 3AJ7A 4FLUA 4O4IB 1BLIA 1I4FA 2VITA 3RWFB 4LFAO 2LFEA 2EO1A 2KKQA 3I9PA 1FGNL 4PJFF 4E41A 1P7HL 1U33A 3FOLA 4JUTA 1YEKL 5LQBH 2QBWA 3DIDA 3W1ZA 3QXUA 5E2TH 1MCQA 1T7WA 2DWXA 2YJLA 4OIFA 4GXUM 4P57B 2XQYK 1R47A 3RGVA 4PR5B 3QRBA 4B27A 1V3LA 2EINB 1GMEA 2FT7A 5LWYL 1JAEA 3JVFC 2CU9A 2Y7MA 3H2QA 2W0LA 3SGEH 1SEBB 2NXYB 4GRWF 4DK0A 4GSDL 1YJDC 4NT6B 4NUGL 4P46B 1D2PA 1G5GA 3VFTB 2Y0IA 5AYUH 2ZTBA 3C9NB 4DW2H 4I48B 1A5FL 4P2QA 1IMHC 3WB2A 3UJJL 4NYLA 4X4XA 1S9XA 4CSSA 2A0LA 3GXMA 4JFPA 4G9DA 2HH0L 1SXZA 1TQTA 3SJAC 4XMLH 1IBYA 3HLKA 1K4CC 5D2NB 5D7IA 4UNVA 5KOMC 2ALAA 1JDCA 4PPTA 1KJ2A 4FG4A 1TQCC 4NZRL 1GGYA 4O2BB 1PX8A 2CGZA 1V3KA 2WQSA 5PCYA 4D2NA 5HPMA 3FX7A 5KS9B 5LNEA 1VGEL 2A74B 1PD6A 3PQYB 4I0KA 3DMMC 2EDEA 3IDYC 4BFIB 1RZKH 4LNUA 4I4WA 1M9NA 3ZRWB 3OR7C 3B2EE 2HZHA 5HHQA 3C5XA 3LN9A 5T5NF 2XTSA 25C8H 2OA9A 2HT2C 1L9PA 5IB1A 1NCWH 2PI5A 1LP9E 1OLZA 4JUSA 1RIVL 2LABA 3FT3B 3QJFB 3OQRA 2H2SC 4C58B 3MX0B 2RTTA 2X1OA 4JGJA 1N18A 3P11H 5CLTA 3TA3D 3ZDWA 2FL5B 3D39B 3MJ9L 2C9XA 3FKSG 4DR4O 4LCYB 4U1IA 1Q81W 3M8OH 5J13C 1QSZA 2Y36L 5JQ6H 4LH6A 3B3IB 4Q9BA 4GRLC 1TCMA 1MW0A 3MUZ1 2OBGA 3DVIA 2ADGA 1NH6A 2GB2A 5SWZA 3W81A 4OZHE 2FGWL 3BP6B 1FGNH 4JFOB 4R97C 1U30A 4OF7A 3SGJC 1D5XA 2BMKA 1YEKH 5DD0L 5FS5A 2B4CL 1NU1H 4OZ4B 1ULVA 1ETA1 4BZ2L 5BUGA 3AK3A 5F9WC 4KTEL 4NQDE 2ETNA 4LF6B 3TVMB 4L4VA 5JOPE 2EEXA 2ZD0A 4OLEA 1FZMA 5FO9B 5K1XA 1G9EA 4B3EA 5E1IA 4GT0A 4XX1G 4FFZL 4YJ2A 5GGUB 3VJ6A 2A6DB 1HH9A 4JZOB 4PM1A 1CC3A 4GSDH 4NUGH 3ZN6A 4POYA 5FO8B 2RIKA 4XC3L 5B7FA 5H94A 1A5FH 2FJSA 4GS7B 4ABUA 5A3ID 1JK8A 4MSWB 1KTJA 3UJJH 3FT2B 3SD2A 5H5NA 3N1MC 3CDGA 1XIWD 3OXRB 4YSAA 2HH0H 4DKFL 1TIUA 1UENA 4P4KD 5ITZA 5IG7B 4LT7A 5F89A 3L9RA 1DDHB 1P7KB 3BYTA 4M8QA 2MKWA 3GSOB 3L4CA 5E51A 4NZRH 1OK8A 5HBBA 1FJ1A 5EEYA 2GVYA 1YHPA 4X7EC 3E80A 1T5KA 4FFBA 3GMPB 1QO3B 1VGEH 1VQMV 1J5DA 1L0LH 1LQSR 1NWPA 1I0HA 2PYEA 4LLMB 2GSIB 4ZI7A 1XGUB 1YNTA 3V7MA 2VWKA 2C1OB 4RRPG 2CGNA 2K8MA 3HE7B 2LQRA 5I2IA 1EFXD 1NDGA 1RUKL 4WTQA 5A2FA 5TDPB 2MCG1 4MJ4A 1JYXA 1A8JH 3K5SA 3V6FA 1RIVH 4HIEA 1T0PB 4I9WA 3KYKL 4WO0A 4WVRA 5KS9E 2Q0ZX 1I9IL 2EIMC 5TJWK 4N2IA 3EHBB 1D5BB 1F1GA 1TKWA 3JCZA 3WL9B 3MJ9H 3KGSA 1N8ZB 3VRIB 2N05A 4ZMVA 1QTSA 1BQRA 2Y36H 2CR0A 2WZPA 5FK9B 3MI6A 2AW2A 1I3RA 3KDMA 2WAMA 1HSBA 5CJQL 5FEBA 2F53A 4ODBD 4P5MB 4ZG1A 1G0XA 1ZVNA 3H6JA 2FGWH 3RZCC 3CJHA 5LXVA 3D39E 1XR8B 1XCTA 3BEVA 5DD0H 3EJRA 2B4CH 3K2MC 2MQ3A 1KD1W 4I4TB 9CGTA 1BBDL 4WJG3 3CCEV 3KKYA 4BCZA 4JI4O 2O30A 4BZ2H 3QIBA 4HIJB 4MLSA 1BAFL 1OAQL 4KTEH 4GBXC 1HCYA 5JA9A 2NNAA 2GI7A 5HSFA 1RSOA 3TP4A 4ES9A 5IJKC 2Y23A 4FFZH 4HUWA 4NO2B 2JKTM 4X6FA 3IGKA 1H2NA 4X4YA 2GHWB 2DICA 1ZT1A 2DWDC 4XC3H 1JJOA 4PJAB 4DR6O 4JGMA 4XCFL 2CAZC 2IU3A 2EABA 4F57L 2WSSG 1ZHLB 3WCYA 4Z7NB 3K5RA 4DR3B 1GM9A 5FW8A 2P28B 3IDXL 4EB6A 2VWJA 3V2AR 1XH3B 2JCWA 3H9HB 3NJXA 4TLKA 5HYSB 4DKFH 1ROPA 2J7LA 2JVDA 2OIEA 3MO1B 4JQVA 1L3WA 4ZNEA 2AMGA 1G7JB 2ARJA 5GZND 5AL8A 4YJ3A 3F7KA 3MJ9A 2PWDA 3AS3A 1E9OA 3HKDB 2E9GA 3L5IA 5HI5C 3OKDB 3A4DA 1F86A 2JS3A 3RB7A 4NB7A 1TTUA 4AVHA 3LEXA 3WV0A 4NERA 3AQXA 1XB8A 4IS6A 1YN7A 4HPYL 4XN8A 3RI5K 3SY0A 3GIVA 4GIOA 5F7NC 5GS2H 1I53A 1RURL 4WO4B 1RUKH 1USQA 2ZUQB 5DXWA 4JO4L 5CINL 1RFDL 1C12B 1CFSA 4PBWD 2Z91A 1M5IA 4QAMB 4A1RA 3KYKH 3A2FA 2H9GA 1PLCA 1T4WA 1CF8L 1I9IH 1EHNA 2VKWA 1PAMA 3LKNB 4R0LB 3BVDB 4AGQA 2IALB 5BZDA 2DJVA 1IVSA 3CDZA 3MLRL 3QUYD 2K9UA 5I74B 3STLC 5TGBA 2K0RA 1S7UB 3UT5B 5JIQA 5JHAA 5KZCB 5D6CA 4I3SL 2BOCB 2GAZA 3EKCA 4O2EB 4EKWA 1D7FA 5BOPA 5CEXB 5HYFA 2FR4A 1EZVY 2DQ6A 1GYUA 5DQ9A 5CJQH 5LMUB 1TSRA 1HDMA 1DQVA 2WOBA 4EKJA 4P48A 3LN4A 3F01A 4PRNB 3FB6C 1HE8A 4HZLB 1DYZA 5GZOC 5ID0A 4FRWA 1DZ0A 5I76A 1HR0B 4IOIA 3FQTB 1Q0YL 3FO9B 3B56A 1ORQB 3B9KD 4WTZA 4NP9A 1BBDH 1ZLDA 2CH7B 2ZG3A 3D2UD 3KPSA 3KAAA 3M8AA 1AACA 4KBPA 4N2EA 3P3YA 1MF2L 3U10A 1BAFH 1OAQH 2IH9A 1JF1B 1RMFH 2NY1D 1LHZA 3HG1D 1PZBA 1O6SB 3WY4A 5AVUB 2ZOTA 3S0PA 1ZV9A 3MHHC 4B7LA 4BSWA 3VXMB 3MLVL 3ZY7A 3TFKD 5C0CB 1QW8A 3D08A 4E42A 2Y1ZA 4W9CC 2LGNA 4U1GB 1XBLA 1Y76B 3FT4A 2NY2D 1QLNA 2VN6A 4XCFH 1AVAA 2MKLC 3I6GB 2FQFA 4F57H 2QVMA 1EWHA 3FN3A 4PRIA 3QCVL 4POZD 5DS8B 2YKKA 3O3DA 4F7KA 3HNTL 3RGHA 2E76C 5JUEL 2AK4A 2WC7A 2EH7H 3HN8A 4N87A 4PJAE 2H3OA 2HB0A 2ZOWA 3DX2A 4MJID 2DE0X 3WS6C 2RBLA 1M4KA 1N67A 4PREB 3SKJL 3DSNA 5H2BA 3LKRB 3BH9A 1XB6A 4KMTL 4XBPB 4YSEA 3MNZB 1IV8A 5HJ3A 1CFBA 1EH9A 4G43B 2G3XA 5J6HA 3WO3B 4OY9A 1LD9B 4B97A 1VADA 3MRKB 3U9UB 4HPYH 2B14A 1D5RA 1YNTF 1QVOB 2UXFA 4OLYL 5DC9B 1RURH 5C0RL 3RYIB 2UUAO 4FXKA 4JO4H 1ZS8A 1RFDH 4NXMO 3P0GB 4A7UA 4RAUB 3VFPB 3JT2A 3RIAK 2P7TC 3Q6GL 3D25A 3B43A 4KRLB 1AC0A 1CF8H 1ETB1 2B15A 2V4LA 4L4TA 2F8VA 3VH8A 1GN4A 3MLRH 1Q94B 5DD6B 4KJWD 3QAZC 3DTXA 4M02A 2Z7UA 1AIFA 3IM1A 3WENA 2ZUUA 4I3SH 4EN3A 4JDTL 3TASA 1M53A 3BCFA 3ZHKA 3E2EA 1L0PA 4Y4KD 2XICA 4Z7VB 2E7BA 1QBLL 3Q44A 4LASL 5F6IC 3QS2A 4KTDL 1EUTA 3O4LB 1BCIA 3WOVA 3DV6A 4GEJA 1Q0YH 4MTMA 2E74B 4TNWK 3K3WA 4W9JC 4AT6B 2YXYA 5EV7A 4X6CF 3QJQB 4MFHA 4UCUA 1MF2H 1PL3A 2OMNA 1WT5A 3K80A 3QNZB 1BV8A 4JI5O 5DVKA 4JRYA 3A6CL 2EDXA 2OMVB 4MW8A 4OAWB 4UCOA 3IXAB 3MLVH 4WDIA 5EU6B 3U2JA 2BP5M 2JXMA 3ZJZA 2ICWJ 4UT9L 3M99B 1L9SA 2IVFC 3CRAA 1MFNA 4EZMA 5IROD 4A66A 5EC2A 5HHOE 1M90W 2CKBH 3K0YA 3PV7A 4MJJA 4N26A 3E9TA 4LOUC 1IFRA 2VMEA 3LPOA 3QCVH 3WN5B 2JEUA 4P9HL 5ID1B 2GTAA 1VF5C 2F23A 1WWBX 4HHAA 3VXME 5C0CE 2OR8A 5DK0B 3AUVA 3JD0A 1KYAA 3T0ED 3HNTH 4U1HA 4OZFG 1MELA 4DK3A 1IBFA 5JHBA 4LB8A 2X41A 5JUEH 3VD9A 2WLKA 3KMDA 4Z3FA 4H13B 4B9FA 4D8PB 1I7ZB 3QRGL 4Y5YC 4F7EA 4PJEA 4HC1L 3RWCA 4KMTH 5I9QC 3O6FD 1MSDA 5E7BA 5I30L 3JZ7A 2VXSL 3LKPB 1DQQA 1S7QA 5L4FA 4X8GA 1F58L 1V7ML 2CO3A 4YGVB 4YLCA 2AZ0A 3T8MA 2GG1A 1YCIA 1T66C 4OLYH 5IW6A 5C0RH 3L1GA 2BRRL 5E94B 2WLLA 2A6KA 3CUPA 3MRIA 2OMUA 3FF7A 5ACMA 3Q6GH 4LQ1A 4O4YL 4RNRA 3IC9A 5GGRY 3GLAA 4AM0B 2YC1A 1UM4L 4LP8A 1QQDB 1XF3A 2VLLA 2PCYA 3MJ8A 4G8EB 4MCMA 4OFIA 2WO4A 3QG6B 1BQZA 4DEUA 2AJUL 3W11D 2ATKB 5HHPA 5C0DB 1FJGO 3I6KA 5LG6A 4ATTA 4JDTH 3CN2A 1ZMYA 1B9KA 5LHGA 2ADJB 2V9QA 1PKOA 3GBML 5I6MA 3RTQB 5F7YC 1HTYA 4WEUD 4MVMA 1QBLH 4JPVL 4MHHG 2FEDC 4LASH 3S3SA 4KTDH 3EDKA 3Q7JA 4NPKA 5F3BB 1YUKB 3HC3L 3HRZA 3A22A 3WAKA 2NY0B 2HFGL 3S2CA 5E5LA 3BO8B 1Z1WA 5FC9A 4LLYA 4PP1C 3ARFD 2NLJA 3IJ9A 4WWKB 1K4DC 5IV2B 1FNLA 4D9QD 3VU2A 3MAWA 4L87A 1WICA 3A6CH 2MHAA 2IBZH 4G6FD 4TUOA 4NWTL 1J48A 1G9ML 3GGWB 4B0MM 3D3VD 2YDEA 3KBEA 4LSUL 1J0YA 5E9DA 1M6OA 3L3IB 5FYKU 5ITBL 4QJ4B 4UT9H 1WF5A 3WY1A 3QIWA 1M57B 2BDNL 5DZAA 5AD0A 1BFVL 1PG7W 2YFOA 2NW2B 4UQEA 4LGSB 5JIDA 2MMXA 4WUUA 1S77D 3D1MC 2HAZA 4KKLC 4UNIA 4N2LA 1KCVL 3MAQA 3BZ5A 2MCPL 1WCQA 3ZE2B 3QULB 2YIBD 5KUMA 3G5YB 4N0FB 3NT0A 4LIQE 3BUQA 4KX7A 4JM0A 5EA0L 1EEYA 3JARB 1X5IA 4KXDA 4KXBA 3RAJL 3QRGH 1YSOA 2V33A 2NW3B 3BPNC 4HC1H 1Z2GA 2FD6L 3EADA 3DOHA 4ZMQA 1IC5L 4JQXA 5FECB 1KXTA 4NWUL 5E1AB 5IQMA 1PV0A 5I30H 2VXSH 3OR6C 1VA9A 2R2HA 4MD0A 4AMXA 4PGJA 3FFQA 2VAAA 4OZIB 2YUXA 2I32A 1X9QA 1V7MH 4PJHA 3QR0A 3VQWA 3C12A 3WLBA 1J05A 3K4DA 4ODUB 2D7QA 2BRRH 4JCWA 1RPOA 4TLSA 4CGTA 4CC1A 3REWA 2VR9A 2DMXA 1MVUB 5I1LB 4O4YH 5DEGA 1F4HA 4KNUA 5I6XC 1UM4H 4MAYB 4ELMA 1WPCA 4NC0B 1QWHA 1ACYL 2HRPL 3W7UA 2AJUH 5IMOB 2H6PA 2X1WL 2HLAA 4R7VA 4RGND 1I94O 2VKXA 4FQXD 4UT9A 3LIUA 4FI6A 5CBHA 3GBMH 3N3EA 3FBKA 4JO3L 4XNQA 5EU3B 2AMUA 2GC7C 4ZPVB 4G7VL 4JPVH 4WI7A 3JZYA 3T3PB 1OCCB 2EC8A 4Q6IA 2I25N 3HC3H 3BH8A 2MNJB 2PLTA 3Q06A 4ZMTA 1PPJH 1YN6A 5IVOA 2HFGH 3RNKB 4JFDD 1AZRA 1THAA 4MJ5B 3ES6A 4J3OC 4ZFOB 1I7RA 1COBA 3LZNA 4JI6O 1E5ZA 1U8OB 3BUYA 3FQRA 2QSTA 3OKNA 3KPMB 2BFGA 1G9MH 4NWTH 3DYOA 3U0PB 4HC1A 3TO4B 4BQCA 5H37G 4LSUH 3P2DA 5ITBH 5DJDB 1L9OA 4E9LA 1U93B 2BDNH 5JHMA 1JYNA 3G08B 3NMEA 1DQML 1BFVH 1NANH 5DZNA 5C09D 1DEEB 4HBCL 3SBPA 5ESAA 3KCPB 2YXLA 4F92B 1RZ8A 5DJZB 5DJYB 1KCVH 2MCPH 3NJHA 2O6CA 4R0LC 4KKNA 5EA0H 2JWYA 1KLFB 5SX4I 5I74C 1C08A 3RAJH 3QCTL 1H2LA 2V5SA 3GLDA 3ME0A 3ASNC 2JQZA 5EZIL 4M7LT 3TXAA 1EO8L 2FD6H 2VL4A 3FOMB 1A6VL 4NZDA 1IC5H 3TCUA 2M8XA 2FNBA 1EAOA 1BZQK 2WXIA 2AQ3A 2AGJL 4L18A 3FHAA 5HHXL 2AV7A 2WINB 5AZ2L 3TWYA 2Z31A 3SGDH 4QRQA 3GD1C 1ORQC 1E0OB 4JFZL 4P3DA 2BC4A 5B38B 3WFBL 5D1QB 2VDRL 4Z3EA 4Z7OF 3LDEA 4QHKJ 1H9DA 5LN4A 2A7BA 3B1UA 4ODHL 2X0WA 1TPXB 3DX9A 2QKIC 1JERA 3SDDC 3VSTA 1JXJA 2XN0A 3I9IA 4EQ3A 3ZHSA 4OZIE 2QTSA 3EYQD 1ACYH 2DLFL 2HRPH 4EDXB 4R83A 1R17A 3BPZA 1S5LZ 4JASA 2EXTA 2ZOLB 4N22A 4I88A 1NIAA 3UJTL 4AG4L 5IEHB 5HHMB 2F1AA 3W7WA 4ZZKA 4YDKL 4JO3H 4L8DA 4L9LA 3CCVV 4G7VH 1IXBA 1XGZA 1D6EA 3Q13A 4AV5A 1KGJA 3LDDA 1HN1A 3RWJA 1J9TA 2PGGA 2QR0B 4PRAB 5JHDD 4ZQKB 3OXSA 3P32A 4JTCB 4HJTA 3SE4A 1MY5A 3DGCR 4QO1B 5LGJB 2JQMA 3E83A 1YDPA 1ZT7B 2WYZA 1PJWA 3ORJA 4X88A 5I28A 2YD6A 5F1IA 1KN4H 3MNVB 3T3PE 1HU8A 3DVNB 4JRXA 3DXAA 4M7KL 3ULVD 2XIBA 4TSBL 1IKOP 1KT2A 5LXGL 3BT2L 4ZX3A 1MFAL 1RPKA 4ZTPL 4K23L 1DQMH 3KNBA 4XXWA 3BZFA 4NHCL 3OJMB 4JFHE 4HBCH 1FZJB 6FABL 3PAUA 4ZW3A 3AU1A 5IGXL 3FCBA 4LVHC 3QDGD 3JALB 4FAAB 4WKXA 4YZWA 1KTBA 3DK2A 1SFDA 1WAZA 1UZ6E 2DWSA 3JXAA 4NGHL 5SWSB 3FK3A 4JM2D 2PO6D 3QCTH 4XXDB 2AHYA 3PWVA 1IL1B 2QMJA 3BVXA 4GAYA 5EZIH 5JORB 1YXBA 1VEOA 4FFVC 1EO8H 1P84J 4UI2A 4UOW1 5EBWA 1A6VH 3MGTA 4GKNA 4JI8B 1E4JA 1JGEA 3MRGB 4X7TB 5C3IA 4IHJA 5ENWA 5F1KC 5HHXH 3T1HB 4J4PC 1FE8L 4K94C 3VRLF 4BAYA 2MCAA 5AZ2H 1O7SA 3BAIA 3TA4D 1FSKB 2X70A 1VQLV 1JN6B 1HH6A 1NL0L 2C1PB 4HJSA 4PJBB 4PJHF 2E74C 3ZGIA 3LV3A 3BEHA 4N3UA 3I75B 4JFZH 4OCWL 4AUJA 3S34L 3WFBH 1OCOB 1BAWA 1F1DA 3DJRA 3FFDA 1XH2A 2QL1A 5FPOA 3DX8B 5DJ0A 1Q9LB 4JKNA 4Y19D 5DJXA 1I85A 2VDRH 3EJUA 1KTLB 2VQ4A 3PAYA 2CDFA 5AWNL 3SE6A 4D9LL 2IWGA 1JCKA 4ODHH 4V1DD 5ICUA 3RL1B 3AG4B 4P2YA 3FH5A 5K9QG 3OTTA 4CS3A 1J86A 5D7LB 5CEYA 2DLFH 4ELMF 3US0A 3MRBA 5C7ZA 3HVNA 3J80N 1J8SA 3AT0A 4Y4FC 3UJTH 2Q68A 4AG4H 5GXBB 4TTDC 5D1QE 2FYYB 32C2B 3FYEB 4ZAKD 4YDKH 3AG7A 5FOBA 4WJKB 4LLQA 4HIPA 4KVNL 4YDLC 3H1IH 4IRJB 4JKLA 4QGYA 4TTGA 1NKRA 4HU8A 5K33A 3PDOB 1QLRB 2W95A 5CNHA 4HOXA 3MDSA 2XOTA 3ZZ1A 4Y4HC 1U8MA 5F1NA 4L5FL 4H13C 3O65A 3FCSB 4QRBA 3IRCA 5D4JA 5IJVB 2FQGA 5LYJB 4ZO9A 5HHME 3VWJD 2RNBA 3L5WA 3MZGB 1QHTA 2FEJA 3QNYA 2J8UA 1UB6A 2JIXB 3CFDA 3T6WA 1VFUA 2O6EA 4M7KH 2COVD 4AWJC 4TSBH 4N90D 5EZYA 1QTPA 2M7WA 1EXGA 3BT2H 1MFAH 3OGCA 5LCVA 5HHOB 5LXGH 5EOQL 2B1GA 4K23H 4ZTPH 1U95A 1ANUA 3PL6D 4OLVL 4WEBL 4GSQA 4NHCH 2JKWA 3ESMA 6FABH 1XEUA 3T3ME 1IJNA 3ILQC 5IGXH 3ATFA 4JQIL 3LKQA 2AGAA 3HN5A 2KHAA 1C8PA 3H3BC 1SOKA 5K93A 1E2VA 5E2VL 1GM8A 3K57A 3OPZL 1BD2B 4XRCB 4JM4L 4NGHH 3K0DA 4ZSOA 5HYJA 3OGOE 1RFYA 2C26A 3TURA 2A77L 4GPVA 4ZODA 1IBZA 1P5UB 2JK5B 3BPCA 1JGDB 1EAJA 4JJ5A 1VEPA 4XN4A 4DP4X 1KJMB 4GEIA 2ZAIA 4FL4C 5FV1L 1NTKH 1FE8H 3QJHB 3RWGA 1HK6A 5DHDA 1HCVA 1NL0H 1OSZA 1O7DC 3U46B 3P30A 3R4RA 4NAJA 1AHMA 4OCWH 3K06A 1CQKA 2WQRA 3CHRA 5FF6A 2LU7A 2PKDA 3T1FA 5CIPH 4JZJA 3RA7L 1UJTA 3K08A 4J3XA 3K5LA 5AWNH 3M1CA 4JJOA 4D9LH 4FADA 1D5MB 2Y9RT 2W88A 2DKSA 3CD4A 1TTAA 4OJFL 4DR1B 3FUFA 4Y5VC 4PA3A 2R1YB 4PJBE 4Q89A 3RDTD 3AK1A 3KLLA 1PZ3A 1M57C 1A6TB 4AEHL 1NBQA 4M8RA 5A16B 3X1BA 4L8CB 1E9QA 2O72A 2ZE8A 5K9JL 3H85A 4JJHA 4B50A 3M17B 1I8MA 3C5ZC 5JO5A 3JV6B 3L3JA 2YUAA 4QRTB 2K3TA 1N4CA 5DS2A 4HVBA 4KVNH 1AGDA 5D1ZC 2YLHA 1QAWA 4HUVA 3VTMA 5D7LE 1S7XB 3KVDD 2EE6A 4CZZA 2CO1A 3PIQA 4HKZA 4L5FH 1SUHA 5DHYB 1XZ0B 4LF7B 1T1ZA 3MACH 3QZWG 2J88L 4GFTB 4M7ZC 4R7DA 2UZYB 3H9SD 5DVMA 4V11A 1LM8V 4DTGL 3CQPA 1KUMA 5LMUO 4LCWB 5ICZB 3AG1C 4OIIL 5K39B 4AZUA 5E4EC 2QVTA 4MZ3A 3D0AA 2FX7L 2FYUH 3ZXAC 1RL1A 4J3WA 2JH2A 4NO5B 1Q0EA 5EOQH 2IEPA 1T2QL 2BZDA 2ZXWB 4IRSA 4KMQA 4E5XB 4OLVH 3D30A 4WEBH 3TNMA 5BW7C 1L9NA 3X12B 3DVGB 3I6LE 3QDMB 3P4NA 1FFXB 4NO0D 2NR5A 2ZDIA 4A7SA 4O51A 4JQIH 4BHUI 2C4FT 4HCIA 3S5YA 1E8YA 4YAQA 5E2VH 5C0JA 1GYAA 2F74B 3OPZH 4HJJL 4JM4H 5D72L 1Z0MA 1E4XL 3ILEA 3UBXI 4GIAA 1QLEC 5A6MA 2ZXBA 2GIMA 3FB8B 4NQXA 2H32H 4HZ1A 4GI9A 4BIUA 2A77H 3ILPB 4X66O 3K2IA 4Y16B 3GLZA 4FQJL 5D2LA 1AOZA 3ZIMA 4B9KC 1JBJA 3FCGA 3CDCA 2AJ3B 3O0LA 4JVWA 4OQ1A 5JPMC 2GSMB 1BD2E 3MRLB 1PVHA 4M93C 4YNYA 2GJZB 2E5EA 1Q1JL 1JJUA 4HALA 4FZEL 2IOOA 1QOKA 4AEIH 3HIZA 4FQPA 4OBRA 1C5CL 3MUY1 2Y48A 4DV0B 3PV6B 2UY7B 3RA7H 4JHVA 3WELA 2BIMA 2CNZA 3MJ7A 1FFPB 1U3HD 4UDUA 2Z8RA 2CCWA 4PMEA 3APNA 2XN9D 4JE4B 5CEZD 2B39A 5K9OA 4OJFH 4BEIA 1N3NB 4KVPA 2NY6C 2BVPB 3D8CA 3C6LC 3VGHA 1US6A 3OX8A 5CJ8A 4ZOCA 3E6FA 4AEHH 3ASOB 1OP3H 1BPLB 3FQUB 4HW6A 3WSQL 3QORD 4APQB 5K9JH 1XF5A 2BSRA 1F6AB 2Q0AA 3AXIA 1MWOA 2OMYB 4XN7A 4Z95L 1J5CA 3OKOA 2A9CA 1RLBA 5B4MC 1G7LB 4QRPA 3RPIB 2DAVA 1P4BL 2NXZD 2J56A 2NUPB 1I1FA 4N2CA 5AAWA 4XCYB 4DGIL 4YJZL 3P02A 1RZIB 4JQIA 4MBOA 3WNNA 1FQ9C 4GMSL 4A68A 1DSFL 4OI8A 1MHCA 2J88H 3ARBC 2YEQA 5DSCA 4JFSA 1NGWA 2FO4A 5JPNA 4DTGH 1HQ4A 3I85A 3QISA 2AEWA 3WHXA 1HQRA 2EYRB 2R69L 2H32A 2J55A 4QTFA 3F6LA 2KPWA 2J8UF 4OIIH 4JANA 1AKPA 3DHMA 3I3BA 2FX7H 4UCFA 2IH3A 5EFIB 2V37A 4AGLA 2R9IA 4L3ED 4LEOA 1T2QH 1AKJB 3ATAA 4WI8A 5D70L 3GHBL 2I07B 1LEGB 4ONHB 4X4ZA 5KHGA 3HMXA 3ZSTA 1ACZA 4IJ3B 2L0DA 2AJZB 1Q9OB 4HIIB 1ODAA 4TLTA 3N40F 3VI3A 4LCWE 4Q58C 4I7ZB 1NC2A 5AQ0A 1BQ5A 1F4WL 3P4MA 1UWXK 4HJJH 4JAUA 2W0FA 5D72H 4X0NA 2B5IB 1TJXA 4UZUA 3MOQA 4LCVA 3QDME 2AEQL 4FG6C 4DAGL 3P3NA 1E27B 3BAWA 3DOIA 4OD2B 4FQJH 1NR1A 4U3JA 1S5HA 2HVJB 3JTSA 1EN4A 5AUMA 4F2ME 1NH2D 2VDNL 1G4YB 3S5LG 4K7PL 4P07A 3QEUB 1Q1JH 3FQNA 3NVQA 2C4XA 4IMLB 4FZEH 4KRMB 5C0FB 2V5YA 4Z76A 1XDTT 3VXPA 1HNWO 3MA7A 1C5CH 2DLTA 5HI4C 3UDWC 1EERB 4P23A 5EPMA 1WZMA 1ZLSL 1YJNV 4ZZFA 3IJYA 5F88A 4OF3A 2OZ4L 8FABA 2VQFO 1JNNL 3OEHG 5DJ2B 5F6HJ 4MJIE 3PDDA 3NJLA 3FCTB 2VW6A 5BJTA 4R2GC 5C7XL 2HFTA 4GKSA 1GS8A 4ORZC 5K59E 4YSTA 3CFKA 2J1ZA 3RT3C 1P4LA 3WSQH 1CK0L 3ARGC 4F20A 4P4RA 2JI3A 4TYUA 4UZGA 4Z95H 2W65A 3T6VA 1D9KC 2VLJD 4O2CB 1X3DA 2VC2B 3M46A 3QFJA 1P4BH 3MRDB 1CXKA 1IM3B 4ABVA 4DGIH 2YRZA 4X8JA 1NDTA 4KQ4L 4GMSH 2Q3XA 4F7PB 2OULB 2G4GA 1DSFH 1JZIA 2PWGA 4HWZA 4WK2B 1ZUQA 1UXSB 1OGAD 2V3FA 5DC0A 1K4CA 3ETDA 1G7HB 2YD3A 1X4XA 3OSVA 4OCXL 4P3WA 2R0KL 3GT6A 4ONGL 2XZAL 3RX7A 1I7FA 2R69H 3VXRD 3FB5B 5GGVY 3CC2V 4PJIB 1P0SE 1R34A 5CD5D 3B7RL 2EXYC 4G9FD 1NBYA 4DUYO 3G71V 2P5WD 1M4UA 1N70A 1FSKC 2NQ3A 3DMMA 4U0QB 3EOBB 3IU4L 1KCBA 3GHBH 1W15A 3OR7A 4AK2A 1HXMA 4YFLI 1DBML 1N9PA 3CFEA 5AVXB 1IIKA 1XT5A 3MRJA 2AXFB 1IAKA 4M43H 3QFGA 3LQAC 2E7MA 3AG4C 1F4WH 4X5WB 1OGPA 5JQGB 4LSRL 5C0AA 5CR1A 3GUTA 2JKLA 3W9EB 3GSUA 2AEQH 2WWMD 4DAGH 1FD9A 1BX2B 3OJVC 3KJ6L 2ZQMA 3LRKA 2ZKXA 5SV4A 5AG9A 3Q1EA 1JPEA 1IT9L 2EDKA 3MMEA 4GRLA 1YA5A 2G75B 5J6GB 2GHZA 3GB7C 2VDNH 2X2JA 3BUDA 3G5VA 2P8MB 4IRJC 4MA1C 4BXSV 4H8HA 4K7PH 1ECYA 4Y2LA 3MYJA 5F7AA 3FUIA 1FXHA 3TN0B 4A2GA 4AQZA 1CQYA 3VACA 1MHHB 3SGJA 3NA4A 2W60B 4QEGA 3P73A 3BIKA 1R5VA 2IXQA 1ZLSH 3CZEA 2F7IA 3C60D 4PRPB 5FYKD 3ARED 3S7GA 2OZ4H 2X6BA 1PL4A 2F4VB 5E4IA 1JNNH 2Q6WA 3RVXD 2VZSA 4F7TA 2X40A 3ZZQA 4N0CD 4OT1L 1C16B 2DJ4A 3H2WA 5CUSL 3CS5A 1PPIA 1VFAA 4A2FA 2YRPA 1A4BA 1TLMA 2KMWA 2ZUSA 1CK0H 3QDJB 3CC7V 2DLIA 2K7PA 3U2SB 4NQEB 1QA9B 4F8OA 2BOLA 2Y7OA 2GTWA 1PU0A 2UXXA 5AVYB 3BQUC 4IDJL 4O00A 4KQ4H 5DEDA 5IJ9A 3KG5A 4Z2WA 1ZY9A 2OV0A 3DHUA 2Z92A 4KROB 3BFWA 1X5GA 3WNLA 1MPAL 4OCXH 2R0KH 4B9PA 4ONGH 2XZAH 2G2PA 2BNUB 4IHOB 4R7NA 5MERB 1VQ6V 5ELIA 3SDAB 1FNEA 1G7PB 5C08D 2H2PD 3FTUA 4JY4A 4KY2A 3KZIZ 2D73A 4XH2A 5JMRA 3IB4A 3ML8A 1EJFA 4OF0A 1ACXA 2IAND 2NY4C 3IU4H 3C5JA 4KMLB 5KG9B 5FV2A 5AOIA 1DBMH 1XGQA 1UB5B 1YG9A 4R96B 1CD1B 4PWIA 2B9ZA 2XX1A 4K5OA 1QPXA 1KP3A 4XP6L 1CYXA 3RNQA 1FIEA 1XREA 4PJIE 2OL3B 3EJZD 3H9YA 2B1HL 4J3TA 3W7XA 1CD0A 1PZ5A 4Y1AA 1XF1A 4W9GC 4UB8Z 3R65A 4LSRH 1HILA 4OM1L 4XVJL 4G70B 4RETB 1J0IA 15C8L 4QT5B 3BCDA 3TL5A 3KJ6H 1TGOA 1E3ZA 4H8WC 2DD8L 3SYQA 1IT9H 1F3JB 1DFXA 3UG5A 4EI5D