2EIKE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eikE00
3ABKE 1OCOE 1V54E 2EINE 3ABME 3ASNE 2ZXWE 3AG4E 3AG2E 2EIKE 5B3SE 2EIJE 1OCRE 2DYSE 3ASOE 2Y69E 2EIME 5IY5E 3AG3E 5B1AE 1OCCE 1V55E 2EILE 1OCZE 2OCCE 5B1BE 2DYRE 3ABLE 3AG1E 3X2QE 3WG7E
chains in the Genus database with same CATH superfamily
3G2WA 3RRNB 4WNGA 5B3SE 5BV1A 1Z3YA 3I4GA 4HI8A 4J0UA 4F3VA 5DIZA 2RFMA 2Y3AA 5LP0A 4JA7A 4AOFA 3QWVA 5A7DB 3E37A 4HOSA 3AU5A 4TRQA 5CMYA 3DSUA 4CRWA 1E8XA 4BERA 5FINA 3UT4A 4A1SA 2FBNA 2OEWA 1LF8A 5FQ6A 3RRUA 5B1BE 2DYRE 4ABNA 1EDUA 3CHQA 3B7SA 3BQOA 2IOSA 3L54A 2WM9A 2P2CP 3L6AA 1L5JA 4RVBA 3CVYA 1S63A 2ZISA 2X3MA 2DWZA 2LUHA 1VDYA 3R9MA 1OXJA 4GYYA 4FHJA 1EPUA 4N3BA 3VLFA 2AXUA 3NZUA 3G2VA 2RFAA 2XGOA 5BUZA 2OEVA 3MZLB 2LO6A 4L9PA 1U3CA 4NACA 3LJNA 1O1TA 4UQZA 5CEDB 5CERB 3S2AA 3PS6A 1QZ2A 4OYSA 1JCQA 2GRLA 3CVLA 4CCAA 4UI9K 4V3IA 3HVEA 5BW8C 3TL5A 1E7VA 2ZU6B 2DBAA 3G2UA 3SI5A 2IFUA 3T8MA 4MBGA 2XEEA 1PC2A 4U63A 3FUJA 4TXRA 3SO8A 2XCBA 4GAAA 3ZYKA 2CHWA 3LJ3A 4MLPA 4C9BB 3L13A 4AY6A 4G11A 4CT4A 2HYZA 3LY8A 3MV2B 4APFA 3W9FA 2A5EA 1HS6A 4EECA 1AP7A 1XGWA 3DSSA 4PH4B 1JPLA 4GYOA 3LY9A 4YVOA 2CHXA 3FUDA 1LTXA 2WPVA 5AYWD 3E34A 2F8XK 3P1UA 3LY7A 4CDMA 1BPOA 4KBQA 1IXVA 3Q73A 2NC9A 1O1SA 5HI7A 3TJPA 1UJJA 3LVRE 2R59A 2WB2A 5EX0A 4GMJA 3Q79A 2IJGX 3I4RB 4I43A 4DX2A 4ATZD 4BTBA 3D9OA 4GMRA 4LNBA 4N2SA 1BI8B 1KZPA 3JXIA 2RG8A 3DXKG 3GZ2A 3IHYA 1YMPA 2A4ZA 1DC2A 3OTNA 3CKCA 4CEMA 3EHNA 5LCWC 3DSTA 4BFRA 2PQRA 4RG6A 5EKQD 4JEHA 4DI3A 3FTVA 2WXNA 4LNGA 1D8EA 1ELKA 3G2SA 4WNEA 5AQ9A 4DUIA 5JA4D 2Y69E 4ANVA 3LKUA 3HDXA 3AG3E 1HF8A 1JWFA 2GRMA 3HG0D 4B89A 3PE3A 3RU0A 3UMVA 4HBDA 4GZDA 2KZTA 2XPYA 3SBSA 4I1OB 3Q15A 5ARGA 3T5XA 3BG1B 2AXZA 3TWWA 2EIKE 4NQ0A 3Q75A 2BEDA 4YDYA 3ULQA 4Q94A 3IHVA 3HIZA 5HQ8A 3GYZA 1E8WA 2EILE 3LXUX 3E4BA 3ZW3A 3TWRA 2B0OE 2P9NG 3UM3A 2IEJA 1YCSB 3CQCB 1H2TC 1X5BA 3HHMA 3FTUA 1BI7B 1MHQA 3JUIA 2PM7A 2P9LG 1Y6IA 1JUQA 5AQ7A 2H6IA 3UINC 2KCVA 2HR2A 4BT9A 5HRYA 3J5PA 1HG2A 2XS8A 4I6GA 3SBTB 3HYMB 3PZ1A 3WXXA 3V2XA 3Q7FA 3O48A 4U96D 2WXRA 4WWNA 1MX2A 4BSZB 3B7RL 4H7YA 4GZ3A 4AVXA 4BX8A 3ASDA 3DSVA 1HG5A 3ZFWA 2E0IA 3KSLA 4KZCA 2YQ8A 1WG0A 4NRHB 2OV8A 3FH8A 4WNFA 3MGBA 1TN7A 2LSUA 2X6HA 4I1AA 3UQ3A 4KT6B 3QK0A 3L08A 4WWPA 3Q78A 4XKBA 5E76A 4UWFA 1KZOA 4KYOB 3CQGB 1JCRA 1BU9A 3FTXA 4FULA 4F6RD 3PH0C 4GCNA 2ONDA 4N5QA 2YHCA 4BY6A 4U8YD 4U8HA 3ZYLA 3SNXA 4ACKA 3QB2A 1WAO1 2MRIA 3HVEB 3EDTB 3D9NA 4JXTA 4OVUA 2IONA 4HLEA 2FO7A 2A5UA 4L23A 3MV3B 3X2QE 4CT0A 2WXHA 4LG6A 1N4PA 2IU1A 3GZSA 4JHKA 4ME2A 4URKA 2L9BA 4HXIA 1EF1C 3FUIA 5ANLA 4DX7D 1TR4A 4HRLA 5DBKA 4TUUA 1U3DA 4RSYA 3ONKA 3ESLA 5CBNA 2XRYA 4JEUA 5G04J 3ZHEB 5AIJA 3UPVA 2V8SE 3FH7A 2V5QC 1K1BA 4HOTA 4DJAA 3PZDA 1QYMA 4ANXA 5KJKA 4GZCA 2XGMA 3AJIA 4GTTA 4N3AA 4YVQC 2KC7A 2WXOA 3D9IA 4FA6A 1RZ4A 2UY1A 3CR3A 3FU5A 3EU9A 4EQFA 1HH8A 4A55A 5AQBA 4HFGA 2LAIA 3FTYA 3CVUA 3UT7A 5T8IA 3KEZA 2ETAA 4GU5A 2AWIA 5KCMA 3CVWA 2MHKA 2WXKA 4CDNA 4JW1A 1OWOA 2XGSA 3EUVA 3ZYQA 1OCRE 3UKUG 5B1AE 5LFAA 2X38A 2XCCA 3EJNA 2XHEA 4HOQA 3PUJA 2XZDG 3T8KA 1B89A 4I2WA 4IN3B 4J8DA 2OVFA 5ITZF 4UQXA 1FVHA 3FTWA 2VSNA 3CHPA 1UJKA 3Q47B 3NBNB 2WMOA 2UWJG 2BKGA 2KZTB 3L22A 3FDHA 3CLJA 3SHFA 4BX9A 3CK9A 4LRZA 4KZ0A 1KT0A 2WXIA 3PZ3A 4F1SA 5CRVA 3R7RA 5FZSA 3B7UX 3CVXA 4TUMA 1IQUA 3SQVA 3UM1A 3OXGA 4MS6A 3PREA 3ZEFA 4FLBA 3NB2A 4OAVB 2VGXA 2F0YA 2AVPA 2VQ2A 3B13A 4PDXA 1G3NB 2B6CA 4FHKA 3CSTA 1IYGA 3C5RA 3AAAC 1N9AA 3PEUB 4Z68A 1NA0A 4FLHA 1D9SA 1BD8A 2KATA 5G05J 4TXPA 3WG7E 2DZOA 3ZYMA 4CDRA 5BV0A 4OAUC 3ZXPA 1Z3XA 3RAUA 2C2LA 3Q9UC 1HFAA 4RQIA 5FQ4A 4N3CA 1GW6A 2BF0X 5G04C 3QOUA 5ARFA 4L2LA 3TWTA 2BKKB 2FEZA 5JHBA 3AS8A 2IOLA 3G2TA 3NAWA 4HRMB 3CHRA 5JMND 3ZU7B 1S64A 4BEPA 3FU6A 2DVWA 3N71A 4HQDA 4K0RA 4HNAD 3RO3A 1UW4B 2FULA 3JQ0A 2IO3C 4I9CA 3MKQA 1NA3A 4B94A 2IO2C 5D0OD 3QNKA 2XQ0A 3S7DA 2XPZA 5CRUA 2L6BA 3EU5A 3UT8A 4DLOA 2NYJA 3MEKA 5G55A 1MZCA 1LD8A 3ML9A 2CFZA 4G23A 2PM6A 1D8DA 4RLYA 2VJ8A 1HO8A 2IQCA 3ASOE 5ENPD 3DPYA 4GA1A 3RK6A 3FUHA 5KNGA 1HE8A 4JZYA 3LPZA 2PZIA 2WXLA 2C0LA 4HS2A 2P9PG 4A3VA 3ENEA 4GZ5A 5E75A 4HI9A 4EZLA 4WWOA 3TWVA 3TWSA 4G2VA 2OVBA 4BWRA 1N0RA 2FI7A 4BESA 3KSQA 2YINA 3S7FA 3C3OA 2HM8A 2P9IG 2E2EA 4QFVA 4FJZA 3NZSA 5KBAA 2I2OA 3DWLG 2P58C 3NF1A 1TNYA 1MQSA 4I17A 3Q5MA 4EZJA 3CV0A 4EBAA 3FULA 1ELWA 1UG3A 2WXPA 4BT8A 3DSWA 2XZTG 3D9MA 2EIME 4NIKA 5FWQA 3EHRA 3KS2A 2JEKA 3NOCD 3ZXSA 4GA2A 2WMNA 1TYQG 2P9KG 4ZFHA 5KJLA 3PVLA 4JD2G 3DSXA 3ABKE 5ENNA 3QWWA 2AJAA 3AG4E 4OVVA 4CYMD 1H6OA 1K1AA 2XRZA 3V2OA 1ZU2A 3V30A 4I2ZA 3E32A 3Q49B 3QAQA 1PAQA 4ILIA 3ABLE 1IKND 2Y1LE 1S0PA 1NI1A 5KNHD 3AS4A 1SQMA 2GRPB 5EX3A 3W9GA 3FTSA 4F7AA 3IBEA 1N94A 3FEXA 4BTAA 4GTOA 4O1PA 2KBXA 2ETCA 2VSXE 3VLDA 3PNLB 4DRXE 2R05A 5CCMA 1ZB1A 5AAOA 1TNZA 3FU0A 4FADA 3VLEA 1IQRA 3IV0A 2MYOA 3KD7A 4O6FA 4C0MA 3UX4A 1TNOA 5C1DA 5IY5E 3SY2A 1OWPA 1H0AA 1N54A 3PEVB 3CGHA 3EIQC 3JUEA 1XNFA 3C72A 3HXDA 2J4DA 3BG0B 3BEEA 3LDZA 3ISMC 4L7TA 3D9HA 5A23A 1E8ZA 1YYHA 4F1PA 4AP2A 3T5VA 5FZRA 1SA5A 4U04A 2WQ6A 4GMLA 3QJZA 3L16A 2ZIRA 4R7LA 2VGEA 2L6JA 3RKVA 1KT1A 5BNWA 1FCHA 2M63A 4LUNU 3FFLA 4G24A 4K5BA 4FU3A 5ENOD 1K3ZD 2WXQA 3FUEA 3K9IA 4JVSA 3UI2A 5JJ6A 4Y6CA 5KWDA 3TAXA 3CVVA 4M3OA 4YDWA 5KJMA 2BUGA 1HZ4A 1E7UA 3MX3A 1BLXB 1N0QA 4ZHBA 3KEAA 3MKQB 3ASHA 1U2VG 3D3MA 3QDNA 1DCEA 3APCA 3OXLA 3ULYA 4TV3A 3JQ1A 2PQNA 3LEWA 4K5AB 1X81A 3Q4AB 2WXMA 4XI0A 4C48B 3UIPC 4AIFA 4L1BA 2VSOE 1JWGA 4AM9A 5CHEE 1DVPA 4BETA 1ELRA 3CKBA 3D9PA 1N11A 4CZ2D 1LD7A 3JYSA 4JPSA 5EN5D 2EIJE 4G8KA 3UM2A 5BXUA 5FTPA 4ATGA 1OCZE 2KCLA 3ZVVA 5KJNA 4XI9A 4YDOA 2I1JA 2CG3A 2ZGGA 2P9UG 3I5PA 1SVXA 4EPZA 4J7WA 5FQ8A 5AENA 3FUKA 3QARA 5C2YA 3ZPJA 3TG4A 3FP3A 2V5FA 3ESKA 2LXLA 3SFYA 1TEZA 1N4RA 3HXBA 1UN9A 2QYJA 1PY1A 1W3BA 4MKTA 3HXCA 4RG9A 2C0MA 3RIBA 3GW4A 4M7CA 3SFXA 3GZ1A 3EHMA 5ENSD 3C3RA 1EYHA 3OAWA 3HRAA 2R02A 1TN8A 3MCXA 5HS0A 4DX1A 3SGHA 4HVBA 1OUVA 1A5EA 3E30A 2I1KA 2BTDA 2NSZA 2X6KA 4E85A 4JC8A 2AXVA 4AJWA 4IYPA 3TGOA 4ANWA 4PS8A 2L0IA 1QBQA 2CFUA 3U66A 1SZ9A 3DBSA 1WDYA 5JJTA 2J9QA 1Z5SC 3TXMA 5AARA 1UOHA 1A17A 4IULA 3C3QA 5D0QD 4AEZC 1H6PA 3FH5A 3CEQA 5JJ7A 1MJ0A 3O4ZA 3HXFA 1O1RA 2DYSE 1FT2A 2R03A 2R5SA 1H2UA 2GGFA 3P2BA 4Q69A 4J8YA 2VGYA 5AJDA 4FC8A 3OXFA 2OOEA 4G25A 4GTMA 2J08A 3PZ2A 4KXKB 4GPMA 4LERA 3L82A 4JHJA 4LEUA 4O60A 1HX8A 4EHMA 2H6FA 2GRNB 3ZRHA 3QKYA 2YHEA 5FZQA 3LVQE 3Q7AA 3ASFA 2VTBB 4HB5A 4QQIA 2HO1A 3D9KA 5BXOA 3V31A 2WXGA 1Y8MA 2QYUA 4GTSA 2XPIA 1RW2A 3AS5A 3FUMA 1S70B 2R2LA 5D66A 3FU3A 4HRNA 3F6QA 3ZNGA 5A6CA 3CK7A 5JHAA 3DXMG 3ASNE 1NFIE 2V0PA 5LOZA 4KVMA 1OWMA 1V55E 1NZNA 2QC9A 3T9KA 5FT9A 3LCAA 2I6HA 4GTVA 4DPRA 3EHQA 3AG2E 2WVIA 2H6HA 1SA4A 3DEOA 4LSZE 3S7BA 4F53A 4D10C 4J8EA 1Q2ZA 5ANRA 2X6FA 3FUNA 1O5MA 1TJFA 5AN8A 3ZIMA 5T3RA 2GW1A 5M72A 1SZAA 4WNDA 3PZ4A 4U0UA 2ILRA 4YDEA 3CIAA 4U8VD 2XS1A 2JABA 3ABME 3MA5A 4LCTA 4GPKA 2Y0BG 4AV7A 3NOGD 5EDSA 4I9EA 3CSFA 4UQYA 1FPPA 5ENRD 1FVFA 5BPPA 4N39A 2FF4A 4DX5D 4U0ZA 5G05C 2ZGDA 1OWLA 4NURA 3ULEG 4N5CA 5AJLA 4PS3A 3UUXA 3ZKJA 3BU8A 2DZNA 4ANUA 5CBOA 2XEHA 3ZN3A 3RRMB 3AG1E 4APOA 1QQEA 1TNBA 4J8SA 2CG2A 2RD0A 2LXMA 2J07A 3ML8A 3UTMA 1TNUA 3MYVA 4WAFA 4JA9A 3DEPA 3FEYA 2EQXA 3FHEA 2Y4UA 2P9SG 1QNFA 1N4QA 4U0SA 3FTZA 1IHBA 4W9RA 3IEGA 4WUYA 1H19A 2R17C 4Y6WA 3QWPA 4JHRA 2QZAA 4BSXA 2L0TB 3PUKA 1K8KG 3FWVA 2H6GA 3D9JA 5HKPA 1MX6A 1TN6A 2WQHA 4DLQA 1JCSA 5AQAA 1E96B 3ZHEA 3FY4A 4H7XA 2KCKA 2WXJA 4FP7A 3RO2A 1N95A 2LAHA 1E90A 4J6IA 4G8LA 3RSEG 4UWLA 5BT1A 4B93B 3B95A 3BUAA 4U07A 3R7QA 2AW6A 2JLBA 4B8AA 4DI4A 3LYAA 2YNQA 5CMWA 4K5CA 3TWXA 2UY1B 3LS8A 3VTXA 2X6JA 4UI9C 1P5QA 4JL0A 3SZ7A 3L17A 4E6HA 3HXEA 5FQ7A 4LNUD 2V4HC 2F8YA 2J09A 3PE4A 3UIOC 4YNDA 2J4BA 4B8CB 4XX5A 2FO1E 2EINE 3TXNA 3ASGA 4HLLA 1FT1A 3B7TA 3CHMA 3UKRG 3JXJA 2VTBA 4XKCA 5ENQD 1OY3D 4TXQA 3URZA 3DRAA 3SFZA 2VYIA 5CECB 3DPDA 1ZBPA 3R9AB 2IF4A 2KXPC 3ONLA 3C98A 3FUFA 4O1OA 5EILA 4X8QA 4G1TA 4ILHB 3PNTB 4GZ6A 2LSVA 2Q7FA 4KVOA 4UI9J 4IRUA 1V54E 3NQPA 4UWGA 4L2YA 3IXEA 1E8YA 4GTRA 4KMOA 1HXIA 4A63B 4UUCA 1SW6A 3SD5A 4GTQA 1Z6TA 4B0ZA 3PDNA 2VGXB 1H2VC 3AU4A 2GROB 3ZGQA 4JB8P 5EIDA 4XE0A 5J08A 5G2NA 3CHSA 3CVNA 3U4TA 2PNNA 3ZUVB 2LNIA 4I6EA 4GB9A 5T4YA 3CHOA 3EIJA 4GYWA 4XIFA 1WM5A 3S7JA 1N52A 3B7BA 2NXPA 5EIBE 4GTPA 1UN8A 4MRUA 1IHGA 3KAEA 2GRRB 3UXGA 3TWQA 3RJVA 2KM4A 1DNPA 2VSYA 4DX6D 4J8FA 1NP7A 5D2MC 3VTYA 5FIOA 1KLXA 1OCCE 3J5QB 3UM0A 3CVPA 2QFCA 5FJYA 3MKRA 2V4LA 2WQ7A 2DIWA 4ACLA 3TG5A 4I1MA 3E33A 2Y4TA 4FJYA 4GCOA 4EZKA 1OT8A 5J90A 4AXHA 3MJWA 1AWCB 2XENA 4I6JA 3JCKC 4N2QA 4UWKA 2XEVA 5CCLA 2IY0C 3D9LA 1OWNA 1HU3A 3CVQA 4Q96A 4HOUA 3CK8A 3TWUA 1H6KA 3APFA 4XZ4A 2QY7A 1INZA 4EBAG 5EYLA 3U9WA 4XEIG 3SF4A 2ZXWE 2DCPA 3APDA 3V79K 1NL4A 4G26A 4PUCA 2J49A 2OCCE 1WY6A 4CGWA 2RKKA 5EYPF 1DCQA 1YA0A 2F37A 3Q9NC 4P29A 3U3WA 2GRQB 1TJCA 1MYOA 5LX8A 2ETBA 4ILGA 4K03A 2I9CA 4CGVA 2MOWA 5ENTD 2WXFA 3PRZA 3U64A 2CHZA 4A3TA 3L9TA 4DK5A 1OCOE 3I3NA 5H7PA 4C0EA 4HORA 2PL2A 4UWHA 2HE0A 4U95D 4AY5A 2X6IA 4A1GA 3IKOB 3QC1A 4PS7A 2J8SD 4U7EB 5CEAA 1MX4A 1N4SA 1KPSB 4GA0A 5LCWJ
chains in the Genus database with same CATH topology
3ABKE 1OCOE 1V54E 2EINE 3ABME 3ASNE 2ZXWE 3AG4E 3AG2E 2EIKE 5B3SE 2EIJE 1OCRE 2DYSE 3ASOE 2Y69E 2EIME 5IY5E 3AG3E 5B1AE 1OCCE 1V55E 2EILE 1OCZE 2OCCE 5B1BE 2DYRE 3ABLE 3AG1E 3X2QE 3WG7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABK E;  1OCO E;  1V54 E;  2EIN E;  3ABM E;  3ASN E;  2ZXW E;  3AG4 E;  3AG2 E;  2EIK E;  5B3S E;  2EIJ E;  1OCR E;  2DYS E;  3ASO E;  2Y69 E;  2EIM E;  5IY5 E;  3AG3 E;  5B1A E;  1OCC E;  1V55 E;  2EIL E;  1OCZ E;  2OCC E;  5B1B E;  2DYR E;  3ABL E;  3AG1 E;  3X2Q E;  3WG7 E; 
#chains in the Genus database with same CATH topology
 3G2W A;  3RRN B;  4WNG A;  5B3S E;  5BV1 A;  1Z3Y A;  3I4G A;  4HI8 A;  4J0U A;  4F3V A;  5DIZ A;  2RFM A;  2Y3A A;  5LP0 A;  4JA7 A;  4AOF A;  3QWV A;  5A7D B;  3E37 A;  4HOS A;  3AU5 A;  4TRQ A;  5CMY A;  3DSU A;  4CRW A;  1E8X A;  4BER A;  5FIN A;  3UT4 A;  4A1S A;  2FBN A;  2OEW A;  1LF8 A;  5FQ6 A;  3RRU A;  5B1B E;  2DYR E;  4ABN A;  1EDU A;  3CHQ A;  3B7S A;  3BQO A;  2IOS A;  3L54 A;  2WM9 A;  2P2C P;  3L6A A;  1L5J A;  4RVB A;  3CVY A;  1S63 A;  2ZIS A;  2X3M A;  2DWZ A;  2LUH A;  1VDY A;  3R9M A;  1OXJ A;  4GYY A;  4FHJ A;  1EPU A;  4N3B A;  3VLF A;  2AXU A;  3NZU A;  3G2V A;  2RFA A;  2XGO A;  5BUZ A;  2OEV A;  3MZL B;  2LO6 A;  4L9P A;  1U3C A;  4NAC A;  3LJN A;  1O1T A;  4UQZ A;  5CED B;  5CER B;  3S2A A;  3PS6 A;  1QZ2 A;  4OYS A;  1JCQ A;  2GRL A;  3CVL A;  4CCA A;  4UI9 K;  4V3I A;  3HVE A;  5BW8 C;  3TL5 A;  1E7V A;  2ZU6 B;  2DBA A;  3G2U A;  3SI5 A;  2IFU A;  3T8M A;  4MBG A;  2XEE A;  1PC2 A;  4U63 A;  3FUJ A;  4TXR A;  3SO8 A;  2XCB A;  4GAA A;  3ZYK A;  2CHW A;  3LJ3 A;  4MLP A;  4C9B B;  3L13 A;  4AY6 A;  4G11 A;  4CT4 A;  2HYZ A;  3LY8 A;  3MV2 B;  4APF A;  3W9F A;  2A5E A;  1HS6 A;  4EEC A;  1AP7 A;  1XGW A;  3DSS A;  4PH4 B;  1JPL A;  4GYO A;  3LY9 A;  4YVO A;  2CHX A;  3FUD A;  1LTX A;  2WPV A;  5AYW D;  3E34 A;  2F8X K;  3P1U A;  3LY7 A;  4CDM A;  1BPO A;  4KBQ A;  1IXV A;  3Q73 A;  2NC9 A;  1O1S A;  5HI7 A;  3TJP A;  1UJJ A;  3LVR E;  2R59 A;  2WB2 A;  5EX0 A;  4GMJ A;  3Q79 A;  2IJG X;  3I4R B;  4I43 A;  4DX2 A;  4ATZ D;  4BTB A;  3D9O A;  4GMR A;  4LNB A;  4N2S A;  1BI8 B;  1KZP A;  3JXI A;  2RG8 A;  3DXK G;  3GZ2 A;  3IHY A;  1YMP A;  2A4Z A;  1DC2 A;  3OTN A;  3CKC A;  4CEM A;  3EHN A;  5LCW C;  3DST A;  4BFR A;  2PQR A;  4RG6 A;  5EKQ D;  4JEH A;  4DI3 A;  3FTV A;  2WXN A;  4LNG A;  1D8E A;  1ELK A;  3G2S A;  4WNE A;  5AQ9 A;  4DUI A;  5JA4 D;  2Y69 E;  4ANV A;  3LKU A;  3HDX A;  3AG3 E;  1HF8 A;  1JWF A;  2GRM A;  3HG0 D;  4B89 A;  3PE3 A;  3RU0 A;  3UMV A;  4HBD A;  4GZD A;  2KZT A;  2XPY A;  3SBS A;  4I1O B;  3Q15 A;  5ARG A;  3T5X A;  3BG1 B;  2AXZ A;  3TWW A;  2EIK E;  4NQ0 A;  3Q75 A;  2BED A;  4YDY A;  3ULQ A;  4Q94 A;  3IHV A;  3HIZ A;  5HQ8 A;  3GYZ A;  1E8W A;  2EIL E;  3LXU X;  3E4B A;  3ZW3 A;  3TWR A;  2B0O E;  2P9N G;  3UM3 A;  2IEJ A;  1YCS B;  3CQC B;  1H2T C;  1X5B A;  3HHM A;  3FTU A;  1BI7 B;  1MHQ A;  3JUI A;  2PM7 A;  2P9L G;  1Y6I A;  1JUQ A;  5AQ7 A;  2H6I A;  3UIN C;  2KCV A;  2HR2 A;  4BT9 A;  5HRY A;  3J5P A;  1HG2 A;  2XS8 A;  4I6G A;  3SBT B;  3HYM B;  3PZ1 A;  3WXX A;  3V2X A;  3Q7F A;  3O48 A;  4U96 D;  2WXR A;  4WWN A;  1MX2 A;  4BSZ B;  3B7R L;  4H7Y A;  4GZ3 A;  4AVX A;  4BX8 A;  3ASD A;  3DSV A;  1HG5 A;  3ZFW A;  2E0I A;  3KSL A;  4KZC A;  2YQ8 A;  1WG0 A;  4NRH B;  2OV8 A;  3FH8 A;  4WNF A;  3MGB A;  1TN7 A;  2LSU A;  2X6H A;  4I1A A;  3UQ3 A;  4KT6 B;  3QK0 A;  3L08 A;  4WWP A;  3Q78 A;  4XKB A;  5E76 A;  4UWF A;  1KZO A;  4KYO B;  3CQG B;  1JCR A;  1BU9 A;  3FTX A;  4FUL A;  4F6R D;  3PH0 C;  4GCN A;  2OND A;  4N5Q A;  2YHC A;  4BY6 A;  4U8Y D;  4U8H A;  3ZYL A;  3SNX A;  4ACK A;  3QB2 A;  1WAO 1;  2MRI A;  3HVE B;  3EDT B;  3D9N A;  4JXT A;  4OVU A;  2ION A;  4HLE A;  2FO7 A;  2A5U A;  4L23 A;  3MV3 B;  3X2Q E;  4CT0 A;  2WXH A;  4LG6 A;  1N4P A;  2IU1 A;  3GZS A;  4JHK A;  4ME2 A;  4URK A;  2L9B A;  4HXI A;  1EF1 C;  3FUI A;  5ANL A;  4DX7 D;  1TR4 A;  4HRL A;  5DBK A;  4TUU A;  1U3D A;  4RSY A;  3ONK A;  3ESL A;  5CBN A;  2XRY A;  4JEU A;  5G04 J;  3ZHE B;  5AIJ A;  3UPV A;  2V8S E;  3FH7 A;  2V5Q C;  1K1B A;  4HOT A;  4DJA A;  3PZD A;  1QYM A;  4ANX A;  5KJK A;  4GZC A;  2XGM A;  3AJI A;  4GTT A;  4N3A A;  4YVQ C;  2KC7 A;  2WXO A;  3D9I A;  4FA6 A;  1RZ4 A;  2UY1 A;  3CR3 A;  3FU5 A;  3EU9 A;  4EQF A;  1HH8 A;  4A55 A;  5AQB A;  4HFG A;  2LAI A;  3FTY A;  3CVU A;  3UT7 A;  5T8I A;  3KEZ A;  2ETA A;  4GU5 A;  2AWI A;  5KCM A;  3CVW A;  2MHK A;  2WXK A;  4CDN A;  4JW1 A;  1OWO A;  2XGS A;  3EUV A;  3ZYQ A;  1OCR E;  3UKU G;  5B1A E;  5LFA A;  2X38 A;  2XCC A;  3EJN A;  2XHE A;  4HOQ A;  3PUJ A;  2XZD G;  3T8K A;  1B89 A;  4I2W A;  4IN3 B;  4J8D A;  2OVF A;  5ITZ F;  4UQX A;  1FVH A;  3FTW A;  2VSN A;  3CHP A;  1UJK A;  3Q47 B;  3NBN B;  2WMO A;  2UWJ G;  2BKG A;  2KZT B;  3L22 A;  3FDH A;  3CLJ A;  3SHF A;  4BX9 A;  3CK9 A;  4LRZ A;  4KZ0 A;  1KT0 A;  2WXI A;  3PZ3 A;  4F1S A;  5CRV A;  3R7R A;  5FZS A;  3B7U X;  3CVX A;  4TUM A;  1IQU A;  3SQV A;  3UM1 A;  3OXG A;  4MS6 A;  3PRE A;  3ZEF A;  4FLB A;  3NB2 A;  4OAV B;  2VGX A;  2F0Y A;  2AVP A;  2VQ2 A;  3B13 A;  4PDX A;  1G3N B;  2B6C A;  4FHK A;  3CST A;  1IYG A;  3C5R A;  3AAA C;  1N9A A;  3PEU B;  4Z68 A;  1NA0 A;  4FLH A;  1D9S A;  1BD8 A;  2KAT A;  5G05 J;  4TXP A;  3WG7 E;  2DZO A;  3ZYM A;  4CDR A;  5BV0 A;  4OAU C;  3ZXP A;  1Z3X A;  3RAU A;  2C2L A;  3Q9U C;  1HFA A;  4RQI A;  5FQ4 A;  4N3C A;  1GW6 A;  2BF0 X;  5G04 C;  3QOU A;  5ARF A;  4L2L A;  3TWT A;  2BKK B;  2FEZ A;  5JHB A;  3AS8 A;  2IOL A;  3G2T A;  3NAW A;  4HRM B;  3CHR A;  5JMN D;  3ZU7 B;  1S64 A;  4BEP A;  3FU6 A;  2DVW A;  3N71 A;  4HQD A;  4K0R A;  4HNA D;  3RO3 A;  1UW4 B;  2FUL A;  3JQ0 A;  2IO3 C;  4I9C A;  3MKQ A;  1NA3 A;  4B94 A;  2IO2 C;  5D0O D;  3QNK A;  2XQ0 A;  3S7D A;  2XPZ A;  5CRU A;  2L6B A;  3EU5 A;  3UT8 A;  4DLO A;  2NYJ A;  3MEK A;  5G55 A;  1MZC A;  1LD8 A;  3ML9 A;  2CFZ A;  4G23 A;  2PM6 A;  1D8D A;  4RLY A;  2VJ8 A;  1HO8 A;  2IQC A;  3ASO E;  5ENP D;  3DPY A;  4GA1 A;  3RK6 A;  3FUH A;  5KNG A;  1HE8 A;  4JZY A;  3LPZ A;  2PZI A;  2WXL A;  2C0L A;  4HS2 A;  2P9P G;  4A3V A;  3ENE A;  4GZ5 A;  5E75 A;  4HI9 A;  4EZL A;  4WWO A;  3TWV A;  3TWS A;  4G2V A;  2OVB A;  4BWR A;  1N0R A;  2FI7 A;  4BES A;  3KSQ A;  2YIN A;  3S7F A;  3C3O A;  2HM8 A;  2P9I G;  2E2E A;  4QFV A;  4FJZ A;  3NZS A;  5KBA A;  2I2O A;  3DWL G;  2P58 C;  3NF1 A;  1TNY A;  1MQS A;  4I17 A;  3Q5M A;  4EZJ A;  3CV0 A;  4EBA A;  3FUL A;  1ELW A;  1UG3 A;  2WXP A;  4BT8 A;  3DSW A;  2XZT G;  3D9M A;  2EIM E;  4NIK A;  5FWQ A;  3EHR A;  3KS2 A;  2JEK A;  3NOC D;  3ZXS A;  4GA2 A;  2WMN A;  1TYQ G;  2P9K G;  4ZFH A;  5KJL A;  3PVL A;  4JD2 G;  3DSX A;  3ABK E;  5ENN A;  3QWW A;  2AJA A;  3AG4 E;  4OVV A;  4CYM D;  1H6O A;  1K1A A;  2XRZ A;  3V2O A;  1ZU2 A;  3V30 A;  4I2Z A;  3E32 A;  3Q49 B;  3QAQ A;  1PAQ A;  4ILI A;  3ABL E;  1IKN D;  2Y1L E;  1S0P A;  1NI1 A;  5KNH D;  3AS4 A;  1SQM A;  2GRP B;  5EX3 A;  3W9G A;  3FTS A;  4F7A A;  3IBE A;  1N94 A;  3FEX A;  4BTA A;  4GTO A;  4O1P A;  2KBX A;  2ETC A;  2VSX E;  3VLD A;  3PNL B;  4DRX E;  2R05 A;  5CCM A;  1ZB1 A;  5AAO A;  1TNZ A;  3FU0 A;  4FAD A;  3VLE A;  1IQR A;  3IV0 A;  2MYO A;  3KD7 A;  4O6F A;  4C0M A;  3UX4 A;  1TNO A;  5C1D A;  5IY5 E;  3SY2 A;  1OWP A;  1H0A A;  1N54 A;  3PEV B;  3CGH A;  3EIQ C;  3JUE A;  1XNF A;  3C72 A;  3HXD A;  2J4D A;  3BG0 B;  3BEE A;  3LDZ A;  3ISM C;  4L7T A;  3D9H A;  5A23 A;  1E8Z A;  1YYH A;  4F1P A;  4AP2 A;  3T5V A;  5FZR A;  1SA5 A;  4U04 A;  2WQ6 A;  4GML A;  3QJZ A;  3L16 A;  2ZIR A;  4R7L A;  2VGE A;  2L6J A;  3RKV A;  1KT1 A;  5BNW A;  1FCH A;  2M63 A;  4LUN U;  3FFL A;  4G24 A;  4K5B A;  4FU3 A;  5ENO D;  1K3Z D;  2WXQ A;  3FUE A;  3K9I A;  4JVS A;  3UI2 A;  5JJ6 A;  4Y6C A;  5KWD A;  3TAX A;  3CVV A;  4M3O A;  4YDW A;  5KJM A;  2BUG A;  1HZ4 A;  1E7U A;  3MX3 A;  1BLX B;  1N0Q A;  4ZHB A;  3KEA A;  3MKQ B;  3ASH A;  1U2V G;  3D3M A;  3QDN A;  1DCE A;  3APC A;  3OXL A;  3ULY A;  4TV3 A;  3JQ1 A;  2PQN A;  3LEW A;  4K5A B;  1X81 A;  3Q4A B;  2WXM A;  4XI0 A;  4C48 B;  3UIP C;  4AIF A;  4L1B A;  2VSO E;  1JWG A;  4AM9 A;  5CHE E;  1DVP A;  4BET A;  1ELR A;  3CKB A;  3D9P A;  1N11 A;  4CZ2 D;  1LD7 A;  3JYS A;  4JPS A;  5EN5 D;  2EIJ E;  4G8K A;  3UM2 A;  5BXU A;  5FTP A;  4ATG A;  1OCZ E;  2KCL A;  3ZVV A;  5KJN A;  4XI9 A;  4YDO A;  2I1J A;  2CG3 A;  2ZGG A;  2P9U G;  3I5P A;  1SVX A;  4EPZ A;  4J7W A;  5FQ8 A;  5AEN A;  3FUK A;  3QAR A;  5C2Y A;  3ZPJ A;  3TG4 A;  3FP3 A;  2V5F A;  3ESK A;  2LXL A;  3SFY A;  1TEZ A;  1N4R A;  3HXB A;  1UN9 A;  2QYJ A;  1PY1 A;  1W3B A;  4MKT A;  3HXC A;  4RG9 A;  2C0M A;  3RIB A;  3GW4 A;  4M7C A;  3SFX A;  3GZ1 A;  3EHM A;  5ENS D;  3C3R A;  1EYH A;  3OAW A;  3HRA A;  2R02 A;  1TN8 A;  3MCX A;  5HS0 A;  4DX1 A;  3SGH A;  4HVB A;  1OUV A;  1A5E A;  3E30 A;  2I1K A;  2BTD A;  2NSZ A;  2X6K A;  4E85 A;  4JC8 A;  2AXV A;  4AJW A;  4IYP A;  3TGO A;  4ANW A;  4PS8 A;  2L0I A;  1QBQ A;  2CFU A;  3U66 A;  1SZ9 A;  3DBS A;  1WDY A;  5JJT A;  2J9Q A;  1Z5S C;  3TXM A;  5AAR A;  1UOH A;  1A17 A;  4IUL A;  3C3Q A;  5D0Q D;  4AEZ C;  1H6P A;  3FH5 A;  3CEQ A;  5JJ7 A;  1MJ0 A;  3O4Z A;  3HXF A;  1O1R A;  2DYS E;  1FT2 A;  2R03 A;  2R5S A;  1H2U A;  2GGF A;  3P2B A;  4Q69 A;  4J8Y A;  2VGY A;  5AJD A;  4FC8 A;  3OXF A;  2OOE A;  4G25 A;  4GTM A;  2J08 A;  3PZ2 A;  4KXK B;  4GPM A;  4LER A;  3L82 A;  4JHJ A;  4LEU A;  4O60 A;  1HX8 A;  4EHM A;  2H6F A;  2GRN B;  3ZRH A;  3QKY A;  2YHE A;  5FZQ A;  3LVQ E;  3Q7A A;  3ASF A;  2VTB B;  4HB5 A;  4QQI A;  2HO1 A;  3D9K A;  5BXO A;  3V31 A;  2WXG A;  1Y8M A;  2QYU A;  4GTS A;  2XPI A;  1RW2 A;  3AS5 A;  3FUM A;  1S70 B;  2R2L A;  5D66 A;  3FU3 A;  4HRN A;  3F6Q A;  3ZNG A;  5A6C A;  3CK7 A;  5JHA A;  3DXM G;  3ASN E;  1NFI E;  2V0P A;  5LOZ A;  4KVM A;  1OWM A;  1V55 E;  1NZN A;  2QC9 A;  3T9K A;  5FT9 A;  3LCA A;  2I6H A;  4GTV A;  4DPR A;  3EHQ A;  3AG2 E;  2WVI A;  2H6H A;  1SA4 A;  3DEO A;  4LSZ E;  3S7B A;  4F53 A;  4D10 C;  4J8E A;  1Q2Z A;  5ANR A;  2X6F A;  3FUN A;  1O5M A;  1TJF A;  5AN8 A;  3ZIM A;  5T3R A;  2GW1 A;  5M72 A;  1SZA A;  4WND A;  3PZ4 A;  4U0U A;  2ILR A;  4YDE A;  3CIA A;  4U8V D;  2XS1 A;  2JAB A;  3ABM E;  3MA5 A;  4LCT A;  4GPK A;  2Y0B G;  4AV7 A;  3NOG D;  5EDS A;  4I9E A;  3CSF A;  4UQY A;  1FPP A;  5ENR D;  1FVF A;  5BPP A;  4N39 A;  2FF4 A;  4DX5 D;  4U0Z A;  5G05 C;  2ZGD A;  1OWL A;  4NUR A;  3ULE G;  4N5C A;  5AJL A;  4PS3 A;  3UUX A;  3ZKJ A;  3BU8 A;  2DZN A;  4ANU A;  5CBO A;  2XEH A;  3ZN3 A;  3RRM B;  3AG1 E;  4APO A;  1QQE A;  1TNB A;  4J8S A;  2CG2 A;  2RD0 A;  2LXM A;  2J07 A;  3ML8 A;  3UTM A;  1TNU A;  3MYV A;  4WAF A;  4JA9 A;  3DEP A;  3FEY A;  2EQX A;  3FHE A;  2Y4U A;  2P9S G;  1QNF A;  1N4Q A;  4U0S A;  3FTZ A;  1IHB A;  4W9R A;  3IEG A;  4WUY A;  1H19 A;  2R17 C;  4Y6W A;  3QWP A;  4JHR A;  2QZA A;  4BSX A;  2L0T B;  3PUK A;  1K8K G;  3FWV A;  2H6G A;  3D9J A;  5HKP A;  1MX6 A;  1TN6 A;  2WQH A;  4DLQ A;  1JCS A;  5AQA A;  1E96 B;  3ZHE A;  3FY4 A;  4H7X A;  2KCK A;  2WXJ A;  4FP7 A;  3RO2 A;  1N95 A;  2LAH A;  1E90 A;  4J6I A;  4G8L A;  3RSE G;  4UWL A;  5BT1 A;  4B93 B;  3B95 A;  3BUA A;  4U07 A;  3R7Q A;  2AW6 A;  2JLB A;  4B8A A;  4DI4 A;  3LYA A;  2YNQ A;  5CMW A;  4K5C A;  3TWX A;  2UY1 B;  3LS8 A;  3VTX A;  2X6J A;  4UI9 C;  1P5Q A;  4JL0 A;  3SZ7 A;  3L17 A;  4E6H A;  3HXE A;  5FQ7 A;  4LNU D;  2V4H C;  2F8Y A;  2J09 A;  3PE4 A;  3UIO C;  4YND A;  2J4B A;  4B8C B;  4XX5 A;  2FO1 E;  2EIN E;  3TXN A;  3ASG A;  4HLL A;  1FT1 A;  3B7T A;  3CHM A;  3UKR G;  3JXJ A;  2VTB A;  4XKC A;  5ENQ D;  1OY3 D;  4TXQ A;  3URZ A;  3DRA A;  3SFZ A;  2VYI A;  5CEC B;  3DPD A;  1ZBP A;  3R9A B;  2IF4 A;  2KXP C;  3ONL A;  3C98 A;  3FUF A;  4O1O A;  5EIL A;  4X8Q A;  4G1T A;  4ILH B;  3PNT B;  4GZ6 A;  2LSV A;  2Q7F A;  4KVO A;  4UI9 J;  4IRU A;  1V54 E;  3NQP A;  4UWG A;  4L2Y A;  3IXE A;  1E8Y A;  4GTR A;  4KMO A;  1HXI A;  4A63 B;  4UUC A;  1SW6 A;  3SD5 A;  4GTQ A;  1Z6T A;  4B0Z A;  3PDN A;  2VGX B;  1H2V C;  3AU4 A;  2GRO B;  3ZGQ A;  4JB8 P;  5EID A;  4XE0 A;  5J08 A;  5G2N A;  3CHS A;  3CVN A;  3U4T A;  2PNN A;  3ZUV B;  2LNI A;  4I6E A;  4GB9 A;  5T4Y A;  3CHO A;  3EIJ A;  4GYW A;  4XIF A;  1WM5 A;  3S7J A;  1N52 A;  3B7B A;  2NXP A;  5EIB E;  4GTP A;  1UN8 A;  4MRU A;  1IHG A;  3KAE A;  2GRR B;  3UXG A;  3TWQ A;  3RJV A;  2KM4 A;  1DNP A;  2VSY A;  4DX6 D;  4J8F A;  1NP7 A;  5D2M C;  3VTY A;  5FIO A;  1KLX A;  1OCC E;  3J5Q B;  3UM0 A;  3CVP A;  2QFC A;  5FJY A;  3MKR A;  2V4L A;  2WQ7 A;  2DIW A;  4ACL A;  3TG5 A;  4I1M A;  3E33 A;  2Y4T A;  4FJY A;  4GCO A;  4EZK A;  1OT8 A;  5J90 A;  4AXH A;  3MJW A;  1AWC B;  2XEN A;  4I6J A;  3JCK C;  4N2Q A;  4UWK A;  2XEV A;  5CCL A;  2IY0 C;  3D9L A;  1OWN A;  1HU3 A;  3CVQ A;  4Q96 A;  4HOU A;  3CK8 A;  3TWU A;  1H6K A;  3APF A;  4XZ4 A;  2QY7 A;  1INZ A;  4EBA G;  5EYL A;  3U9W A;  4XEI G;  3SF4 A;  2ZXW E;  2DCP A;  3APD A;  3V79 K;  1NL4 A;  4G26 A;  4PUC A;  2J49 A;  2OCC E;  1WY6 A;  4CGW A;  2RKK A;  5EYP F;  1DCQ A;  1YA0 A;  2F37 A;  3Q9N C;  4P29 A;  3U3W A;  2GRQ B;  1TJC A;  1MYO A;  5LX8 A;  2ETB A;  4ILG A;  4K03 A;  2I9C A;  4CGV A;  2MOW A;  5ENT D;  2WXF A;  3PRZ A;  3U64 A;  2CHZ A;  4A3T A;  3L9T A;  4DK5 A;  1OCO E;  3I3N A;  5H7P A;  4C0E A;  4HOR A;  2PL2 A;  4UWH A;  2HE0 A;  4U95 D;  4AY5 A;  2X6I A;  4A1G A;  3IKO B;  3QC1 A;  4PS7 A;  2J8S D;  4U7E B;  5CEA A;  1MX4 A;  1N4S A;  1KPS B;  4GA0 A;  5LCW J; 
#chains in the Genus database with same CATH homology
 3ABK E;  1OCO E;  1V54 E;  2EIN E;  3ABM E;  3ASN E;  2ZXW E;  3AG4 E;  3AG2 E;  2EIK E;  5B3S E;  2EIJ E;  1OCR E;  2DYS E;  3ASO E;  2Y69 E;  2EIM E;  5IY5 E;  3AG3 E;  5B1A E;  1OCC E;  1V55 E;  2EIL E;  1OCZ E;  2OCC E;  5B1B E;  2DYR E;  3ABL E;  3AG1 E;  3X2Q E;  3WG7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...