2EIKE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eikE00
5B1AE 2DYRE 1OCRE 1OCCE 5IY5E 2OCCE 3AG1E 2DYSE 1OCZE 3AG3E 3ABME 2ZXWE 3WG7E 5B3SE 3ASOE 2EIJE 2EIKE 2EINE 3ABKE 3AG4E 3X2QE 1V55E 3ASNE 2EILE 5B1BE 3ABLE 2Y69E 1V54E 3AG2E 2EIME 1OCOE
chains in the Genus database with same CATH superfamily
3APFA 4JXTA 2CHZA 4DI4A 2E0IA 2AXUA 5EX0A 4WNDA 3BU8A 2L0TB 4GAAA 1HE8A 3LCAA 2EIJE 4XEIG 2XZDG 3E30A 2B6CA 1S64A 3JYSA 3G2VA 4J8EA 3AG2E 3HVEA 4XI0A 4U0UA 1H6PA 3ULQA 3UM1A 3Q7AA 2H6IA 4HFGA 3RO3A 2IU1A 5HQ8A 2IJGX 1FVHA 2XEHA 5FQ7A 3UKRG 1PY1A 5FWQA 3JCKC 3GW4A 3LJ3A 1E8WA 3EHQA 2WM9A 3MEKA 4UWHA 5BV1A 3L17A 3C3RA 5CEAA 4ILHB 5AENA 4N2QA 5JJ6A 2VYIA 4Y6WA 2AXZA 3Q79A 4JD2G 2P9NG 2YNQA 4LNGA 1DVPA 3FU0A 1NL4A 2PM6A 5EYLA 3VTXA 3O48A 4OVVA 2LSUA 4OAVB 2RKKA 3DEPA 1TNYA 3FTSA 3Q75A 5BNWA 3TWVA 4JEUA 4K5AB 4GA2A 3S2AA 3Q73A 3V2OA 2V5QC 4AVXA 2QZAA 3Q7FA 5CCMA 4Q96A 3C98A 4I2WA 4F53A 3AG3E 3GZ1A 5H7PA 1DCEA 2J9QA 1UN8A 5D0QD 2WPVA 2GRNB 1EYHA 2IY0C 2H6HA 5BXOA 1H2VC 2XZTG 2KCLA 4GTSA 4RQIA 4GTPA 4LG6A 4FJYA 4XZ4A 4I1OB 1UOHA 5HKPA 4CZ2D 3CV0A 1IXVA 4MLPA 4EQFA 3SO8A 1G3NB 2C0LA 4TUMA 5EIDA 2L6BA 1V55E 2XGMA 4XIFA 2I1JA 2FEZA 3AS8A 3PRZA 5LCWC 1OWOA 1TJCA 3TGOA 1TN6A 2P9SG 3TWWA 5EKQD 3L13A 4MRUA 3UM2A 3L54A 5FZSA 1HZ4A 1ELWA 4BERA 5EYPF 3T9KA 3QKYA 4KZCA 5EDSA 1MJ0A 1ELKA 4PS3A 2B0OE 4J6IA 4FHJA 1HX8A 2CG2A 2R2LA 1XNFA 3U66A 1FVFA 3ZYLA 4D10C 4BEPA 3FUNA 3FU6A 3KSQA 4U8YD 3FUFA 3QAQA 3FTUA 2KC7A 3DEOA 2WXFA 3L82A 4JC8A 5CRVA 3QJZA 3SBTB 4M3OA 2V0PA 1NZNA 4KVOA 3J5QB 2F8YA 3FU5A 4WAFA 2V4HC 2IEJA 2H6FA 1UW4B 4UWFA 2LXMA 4RLYA 3U9WA 3IV0A 3ZXSA 3DPYA 4LRZA 1KT1A 2IQCA 2R5SA 4J8YA 4WWPA 2WXHA 4G25A 1YMPA 3CSTA 3DPDA 5HRYA 4PDXA 3Q78A 3PZ1A 4J8SA 3S7JA 1OCOE 5KJMA 4R7LA 3ULYA 3IHVA 3CHOA 3JUIA 2GRRB 4N3BA 1AP7A 3SF4A 2VGXA 2J8SD 2GGFA 3ZPJA 4ZFHA 1MZCA 2I9CA 4LSZE 2F0YA 3UM0A 3DSWA 1TR4A 4BTAA 4BETA 2ILRA 4OYSA 3LXUX 3UQ3A 3AJIA 2HYZA 4WUYA 3CHPA 4GZ3A 5BPPA 1A17A 4N3CA 3CIAA 3I5PA 3W9GA 3HXDA 4UWLA 5A6CA 1QYMA 3G2UA 2PQRA 1HG2A 2LAHA 1PC2A 3LS8A 4YNDA 1L5JA 2VSYA 3QOUA 2P2CP 2WXGA 4HS2A 3I4GA 4KMOA 3OXLA 5LP0A 2KZTA 3F6QA 3S7BA 4G11A 4GMRA 1FCHA 2WB2A 4NQ0A 5JHBA 5AQBA 2UY1B 2R05A 4I6GA 3CHRA 4JB8P 2BKGA 3S7DA 5D2MC 4GMJA 3DRAA 4U7EB 1JUQA 1HU3A 3V31A 3IHYA 4O1OA 2XPZA 4RG9A 1MX2A 1MHQA 1A5EA 4U96D 3DWLG 3AAAC 3PS6A 2R03A 2XGOA 3HG0D 1OXJA 3TG5A 3ZRHA 4TRQA 2CFUA 3G2WA 4JHRA 1KT0A 2A5EA 2WXMA 4ME2A 2WXOA 2RG8A 5J08A 1LF8A 3UX4A 3ABME 4I6JA 4I2ZA 3TWTA 3PUKA 5KWDA 5ARGA 1JWGA 5BT1A 2ONDA 3AU5A 3LDZA 5HI7A 3E34A 4XX5A 1D8EA 4TXPA 4Q94A 4RVBA 4GZ5A 5LFAA 2DZNA 2H6GA 3G2TA 4CGVA 3RKVA 4GZCA 2X6HA 2QY7A 3RRNB 4NIKA 4ATGA 5E76A 4JEHA 3SNXA 4M7CA 2I2OA 4HLLA 4GTTA 5C1DA 3FWVA 3AS5A 3RO2A 1WY6A 2Y4UA 2IO3C 3JUEA 3UKUG 4ATZD 2PL2A 3B7UX 3VLEA 4JW1A 1YCSB 1SW6A 3B7SA 3FH7A 2YHCA 5CCLA 5DBKA 2PNNA 2HO1A 1OWNA 2F8XK 5AQ9A 3NOCD 4GB9A 1D9SA 3TL5A 2ETCA 4CGWA 4FA6A 5J90A 4GCNA 2VSNA 5JHAA 3CHMA 2OEVA 4IN3B 3EIQC 2R59A 4BSXA 3ASDA 4Y6CA 4EZKA 5AJLA 5FZQA 4BFRA 5E75A 2XRZA 4N2SA 2M63A 1KZOA 4U0SA 2QYJA 3PDNA 3FH5A 4AEZC 1RW2A 1N94A 4WNGA 4AV7A 4GTOA 4LERA 2ZGDA 4L9PA 4DK5A 2X3MA 4GYYA 2WXIA 3MJWA 2C0MA 3QWPA 3RAUA 2MOWA 3OXGA 4EHMA 4DI3A 3PE4A 3ISMC 3SFXA 5KNHD 4F3VA 3C3QA 2UWJG 4Q69A 1OUVA 5KJKA 2PQNA 4X8QA 3QK0A 2ZIRA 4UQXA 3G2SA 2VGXB 3IKOB 2P9UG 4BSZB 3CK9A 3VLFA 5FJYA 3CEQA 3ONKA 2XEVA 2WMNA 2DIWA 3HXBA 4KBQA 4XE0A 3BQOA 4JL0A 4HOTA 4ILIA 3CVVA 2X6KA 4ILGA 4ABNA 3C72A 3X2QE 3S7FA 3GYZA 2OOEA 1E8XA 2FO1E 2QC9A 4DX1A 5FT9A 4CDMA 4L23A 1NP7A 4F6RD 1Z5SC 3SFZA 3K9IA 3CKCA 4UI9J 2J4BA 1O1TA 3OTNA 4TV3A 4B93B 3TWUA 1WAO1 1XGWA 4U95D 3VLDA 3B7BA 3C3OA 1H0AA 1SA4A 2BF0X 3QB2A 1HG5A 4JPSA 4EZLA 4Z68A 3CVYA 3APCA 3KAEA 4EZJA 4DLOA 3SBSA 3FEXA 4GTVA 2L0IA 2GRLA 4O1PA 3ESKA 4G1TA 3E32A 1HXIA 3FDHA 4GU5A 2MYOA 2RFMA 4DUIA 3R7QA 2CFZA 4UI9C 2Y3AA 2A5UA 3TWRA 3PE3A 2XGSA 2GRQB 4BESA 4HORA 4I9CA 4JHJA 5AARA 4CYMD 4FLBA 4QFVA 5AYWD 4A63B 2V5FA 2C2LA 2KBXA 3JQ1A 3CVXA 4BT9A 1IHBA 3PZDA 1UN9A 1ZBPA 3QARA 3ZN3A 1N11A 2ETAA 1EPUA 3U3WA 1UJKA 2IOLA 3BG1B 3FUMA 4BTBA 3QWWA 2EINE 4H7YA 2IFUA 3QNKA 1FPPA 5LCWJ 3FTVA 2XS1A 4F1PA 4G24A 2XS8A 3KS2A 5CECB 1Z3YA 4KVMA 3E37A 5KBAA 1OCZE 1TNBA 2GW1A 1SA5A 1DNPA 3PH0C 4GZ6A 2LUHA 4APFA 3T8KA 4BX8A 2V4LA 3EHNA 4P29A 3Q5MA 4HI9A 5JMND 1S63A 4GPMA 5BUZA 5KNGA 3FY4A 3CVQA 2IOSA 3EU9A 3ZYMA 1O5MA 1IQUA 3DSTA 3PZ3A 3PEUB 2ZU6B 4HOUA 3MV2B 2P9IG 1H2TC 4HB5A 1BI7B 2VTBA 3MKRA 3L08A 1PAQA 2WXKA 3WXXA 2WXPA 2X6FA 3SZ7A 4XKBA 4WWNA 5FQ8A 3I3NA 1B89A 3N71A 3EHRA 3MGBA 4GMLA 4F1SA 5FZRA 2HE0A 3VTYA 3ZHEA 2R02A 3B7RL 3LVRE 1E8ZA 3V30A 2I1KA 3MA5A 3MX3A 4AXHA 1MX6A 1O1RA 5FIOA 1E90A 2E2EA 2FI7A 1TJFA 5BXUA 5AN8A 1UJJA 3FUJA 5KJLA 2AVPA 1LD7A 3FUEA 4DX7D 4J0UA 3ZW3A 2EIKE 4TXQA 1NFIE 3JXIA 3EU5A 1WG0A 2XPIA 3GZ2A 3DSSA 3ULEG 1HS6A 3CVNA 3CK7A 2AW6A 1X5BA 1HF8A 5BW8C 2J07A 3RIBA 2WXJA 3NAWA 1SVXA 3QWVA 1N4SA 2AWIA 1WM5A 3TXMA 4DJAA 2JABA 2XCCA 4CRWA 1EDUA 1ELRA 4O60A 3HVEB 3LJNA 3UI2A 2IF4A 1IYGA 1UG3A 3D3MA 2EILE 1DC2A 3SHFA 1V54E 5LX8A 5ARFA 1KLXA 3LY7A 4WNFA 2FF4A 4DPRA 3FTZA 3PEVB 3PZ2A 4B0ZA 4YDEA 2XPYA 1KZPA 4AIFA 5EILA 4I17A 4BX9A 1D8DA 4U8HA 4UQZA 4HRMB 4J8FA 1VDYA 4XI9A 2GROB 1WDYA 1BPOA 3UTMA 2J09A 4ANUA 3RSEG 3LYAA 1HFAA 5A7DB 3T5XA 4NACA 3EIJA 3Q49B 4UI9K 3ZFWA 3D9KA 3D9OA 1MYOA 3SQVA 1QZ2A 2RFAA 3RRUA 3LY8A 3D9IA 4PS8A 1BD8A 1JCQA 1FT2A 2NYJA 4GTRA 3U64A 4AOFA 5CBOA 3ASHA 3FTYA 1IHGA 2LAIA 3D9JA 4CT0A 1P5QA 2WMOA 2LXLA 4HQDA 4K5BA 1MQSA 1N0QA 1N9AA 1S0PA 3DXKG 3ZU7B 3IXEA 2NXPA 3RK6A 2GRPB 3GZSA 4KZ0A 5AQ7A 3FHEA 3OAWA 1JPLA 2CHWA 4WNEA 5C2YA 1N0RA 3KD7A 3NBNB 4KXKB 4CT4A 1Q2ZA 3ASGA 3NB2A 3J5PA 5CEDB 4J7WA 4HVBA 4K0RA 3B95A 2KATA 2R17C 3AU4A 2KXPC 3CHQA 4NRHB 1SQMA 2X6IA 4HNAD 2FO7A 5G04J 4EECA 3L22A 4GPKA 4RG6A 4BY6A 3RJVA 3NOGD 4N5CA 2X6JA 2QYUA 1TEZA 1SZAA 3LVQE 1Y6IA 4A55A 4PS7A 4U63A 4CDNA 3SY2A 3MKQA 4A1SA 2WQ7A 2OEWA 2WXNA 5G04C 4MBGA 4URKA 1E7VA 4A3VA 3TWSA 1TN8A 1TNZA 2BUGA 1U3CA 3HXEA 1GW6A 1JCRA 4B94A 4IRUA 3Q15A 1K8KG 4EPZA 3D9HA 4H7XA 3CHSA 2A4ZA 3CQGB 3V2XA 3B7TA 2DVWA 3UIOC 3ZGQA 3ZVVA 3SGHA 4I43A 2KCKA 4O6FA 5FTPA 5B1BE 2BTDA 1NA3A 2OVBA 2ZGGA 3R9MA 2RD0A 2MHKA 3UMVA 5EIBE 1N4RA 3TAXA 3CKBA 2KM4A 2WQHA 4U0ZA 3D9MA 4JA7A 1LTXA 2ZISA 1QNFA 2VSXE 3PZ4A 1FT1A 5FQ4A 2VGYA 1Z6TA 3ENEA 4IULA 3UIPC 3FUDA 4YDYA 2OV8A 4UUCA 5G05J 4F7AA 5ENRD 4I9EA 2YQ8A 4UQYA 2HM8A 4ANVA 3ASOE 3OXFA 4HLEA 1NA0A 3AG4E 4GZDA 4G26A 1H2UA 4JHKA 2PZIA 1TNUA 3RRMB 1INZA 4HRLA 4WWOA 4YDWA 4C0EA 1K1AA 3NZSA 5ITZF 2IONA 4DLQA 3FEYA 1OWLA 2AXVA 3ML8A 3W9FA 1JWFA 2P9LG 4L7TA 3CVUA 5JJ7A 5FQ6A 1E8YA 3V79K 5G05C 3PUJA 1QQEA 1E7UA 5BV0A 3D9NA 2LSVA 3SI5A 2L9BA 4G8LA 2BKKB 3ZKJA 3HRAA 4ANWA 3TJPA 5CMYA 5A23A 1S70B 3T5VA 2KZTB 5EX3A 2VGEA 1HH8A 3QDNA 4ANXA 5G2NA 3FP3A 5IY5E 3JXJA 3HIZA 3AG1E 5AAOA 5ENOD 2DCPA 2XQ0A 4A3TA 2VJ8A 1BLXB 3ZNGA 2L6JA 3ASNE 3FU3A 1Z3XA 4AM9A 1U3DA 2P9PG 3NZUA 3PVLA 2UY1A 3L6AA 3NQPA 3UM3A 2CG3A 4LCTA 5FINA 3CVWA 3LPZA 5HS0A 3KEZA 3Q4AB 1KPSB 3ABLE 3PNLB 2P9KG 5CRUA 3IBEA 4L2YA 4JZYA 3D9LA 4G2VA 4U04A 3UXGA 4I1AA 1ZU2A 3ZUVB 4K5CA 1TYQG 2J08A 3E4BA 3ONLA 5G55A 2EIME 2YINA 2JLBA 3UINC 3BUAA 2WXQA 2WXRA 4L1BA 3UT7A 3EHMA 3CSFA 2OVFA 2ZXWE 5T8IA 3D9PA 4K03A 1MX4A 4KYOB 4RSYA 1E96B 3T8MA 5CERB 3FH8A 2GRMA 2IO2C 3DBSA 5D66A 1N4QA 2CHXA 1HO8A 5LOZA 2Y4TA 3FFLA 2Q7FA 4FULA 5B3SE 4A1GA 4ZHBA 3MKQB 4G23A 2VQ2A 1ZB1A 4B8CB 4JA9A 2WVIA 4LNBA 1IKND 5T3RA 4AP2A 5ANLA 4CDRA 5ENSD 3HXCA 1N52A 5ENPD 4NURA 5ENNA 5CBNA 3P2BA 3FUIA 2Y1LE 4GTQA 4B89A 5KCMA 4V3IA 3HDXA 1QBQA 3MZLB 4LNUD 1OCCE 4OVUA 3O4ZA 4FP7A 4E6HA 3Q9UC 4BT8A 4KT6B 5EN5D 4W9RA 3PREA 4OAUC 3NF1A 1AWCB 2JEKA 2EQXA 3L16A 3CVPA 4HOQA 1JCSA 2XRYA 4EBAA 3I4RB 4GA0A 3LKUA 5JA4D 3TWQA 3TWXA 3ZEFA 4DX5D 3R7RA 4ACLA 4BWRA 4U07A 4JVSA 1Y8MA 3ZXPA 1H19A 3LY9A 3RU0A 5M72A 3ZYQA 2QFCA 4C9BB 3BEEA 4FHKA 3CK8A 4HRNA 3HHMA 2V8SE 3DXMG 4GYOA 4FADA 3FUHA 2F37A 3CR3A 1OCRE 5CHEE 3UUXA 2OCCE 4APOA 5CMWA 3Q9NC 3AS4A 4MS6A 4PH4B 1IQRA 1OWMA 5AIJA 3LEWA 3DSUA 2NSZA 1LD8A 4DX6D 1OY3D 3UPVA 3SFYA 4FC8A 4PUCA 3ABKE 2FULA 4N5QA 4DRXE 4UWGA 3SD5A 1BI8B 4HBDA 4N39A 2LNIA 2MRIA 3ML9A 2HR2A 2WQ6A 3CQCB 1TNOA 1RZ4A 4GYWA 3APDA 4I6EA 4L2LA 2AJAA 1OWPA 3P1UA 4XKCA 4C48B 3ZYKA 2YHEA 2XENA 1K3ZD 4J8DA 1EF1C 1H6OA 1N95A 3TXNA 3E33A 2DYSE 4FU3A 2BEDA 3WG7E 3CGHA 2I6HA 1X81A 3EJNA 1W3BA 4AY5A 4CCAA 2DBAA 3U4TA 2KCVA 1U2VG 5AQAA 3B13A 4LEUA 4YVQC 1K1BA 1YA0A 1DCQA 1SZ9A 3C5RA 2J49A 4U8VD 3Q47B 3MV3B 4UWKA 2FBNA 2P58C 4G8KA 3BG0B 2X38A 3FTWA 2VTBB 2LO6A 3CVLA 4AY6A 3FTXA 3L9TA 4YDOA 3ASFA 4IYPA 5ENTD 3DSXA 3MYVA 4B8AA 2DZOA 4HOSA 4EBAG 2VSOE 2DWZA 2Y0BG 2Y69E 4ACKA 3ZHEB 4GCOA 2DYRE 2XCBA 4LUNU 4E85A 4GTMA 4CEMA 4FJZA 5D0OD 4YVOA 3R9AB 4FLHA 4I1MA 1OT8A 3DSVA 3TG4A 5ANRA 3EUVA 4HXIA 3JQ0A 4DX2A 4TUUA 3HYMB 1BU9A 5ENQD 4GA1A 3HXFA 2XEEA 4QQIA 1TN7A 1NI1A 2XHEA 3PNTB 5KJNA 5JJTA 5AJDA 4C0MA 2ETBA 1YYHA 3UT4A 3EDTB 2J4DA 3UT8A 4TXRA 1N54A 3URZA 5B1AE 3FUKA 3KSLA 4AJWA 4N3AA 1N4PA 3KEAA 2NC9A 4MKTA 3FULA 3MCXA 5DIZA 5T4YA 3QC1A 3IEGA 3ZIMA 3CLJA 2WXLA 2PM7A 3ESLA 1O1SA 4HI8A 1H6KA
chains in the Genus database with same CATH topology
5B1AE 2DYRE 1OCRE 1OCCE 5IY5E 2OCCE 3AG1E 2DYSE 1OCZE 3AG3E 3ABME 2ZXWE 3WG7E 5B3SE 3ASOE 2EIJE 2EIKE 2EINE 3ABKE 3AG4E 3X2QE 1V55E 3ASNE 2EILE 5B1BE 3ABLE 2Y69E 1V54E 3AG2E 2EIME 1OCOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1A E;  2DYR E;  1OCR E;  1OCC E;  5IY5 E;  2OCC E;  3AG1 E;  2DYS E;  1OCZ E;  3AG3 E;  3ABM E;  2ZXW E;  3WG7 E;  5B3S E;  3ASO E;  2EIJ E;  2EIK E;  2EIN E;  3ABK E;  3AG4 E;  3X2Q E;  1V55 E;  3ASN E;  2EIL E;  5B1B E;  3ABL E;  2Y69 E;  1V54 E;  3AG2 E;  2EIM E;  1OCO E; 
#chains in the Genus database with same CATH topology
 3APF A;  4JXT A;  2CHZ A;  4DI4 A;  2E0I A;  2AXU A;  5EX0 A;  4WND A;  3BU8 A;  2L0T B;  4GAA A;  1HE8 A;  3LCA A;  2EIJ E;  4XEI G;  2XZD G;  3E30 A;  2B6C A;  1S64 A;  3JYS A;  3G2V A;  4J8E A;  3AG2 E;  3HVE A;  4XI0 A;  4U0U A;  1H6P A;  3ULQ A;  3UM1 A;  3Q7A A;  2H6I A;  4HFG A;  3RO3 A;  2IU1 A;  5HQ8 A;  2IJG X;  1FVH A;  2XEH A;  5FQ7 A;  3UKR G;  1PY1 A;  5FWQ A;  3JCK C;  3GW4 A;  3LJ3 A;  1E8W A;  3EHQ A;  2WM9 A;  3MEK A;  4UWH A;  5BV1 A;  3L17 A;  3C3R A;  5CEA A;  4ILH B;  5AEN A;  4N2Q A;  5JJ6 A;  2VYI A;  4Y6W A;  2AXZ A;  3Q79 A;  4JD2 G;  2P9N G;  2YNQ A;  4LNG A;  1DVP A;  3FU0 A;  1NL4 A;  2PM6 A;  5EYL A;  3VTX A;  3O48 A;  4OVV A;  2LSU A;  4OAV B;  2RKK A;  3DEP A;  1TNY A;  3FTS A;  3Q75 A;  5BNW A;  3TWV A;  4JEU A;  4K5A B;  4GA2 A;  3S2A A;  3Q73 A;  3V2O A;  2V5Q C;  4AVX A;  2QZA A;  3Q7F A;  5CCM A;  4Q96 A;  3C98 A;  4I2W A;  4F53 A;  3AG3 E;  3GZ1 A;  5H7P A;  1DCE A;  2J9Q A;  1UN8 A;  5D0Q D;  2WPV A;  2GRN B;  1EYH A;  2IY0 C;  2H6H A;  5BXO A;  1H2V C;  2XZT G;  2KCL A;  4GTS A;  4RQI A;  4GTP A;  4LG6 A;  4FJY A;  4XZ4 A;  4I1O B;  1UOH A;  5HKP A;  4CZ2 D;  3CV0 A;  1IXV A;  4MLP A;  4EQF A;  3SO8 A;  1G3N B;  2C0L A;  4TUM A;  5EID A;  2L6B A;  1V55 E;  2XGM A;  4XIF A;  2I1J A;  2FEZ A;  3AS8 A;  3PRZ A;  5LCW C;  1OWO A;  1TJC A;  3TGO A;  1TN6 A;  2P9S G;  3TWW A;  5EKQ D;  3L13 A;  4MRU A;  3UM2 A;  3L54 A;  5FZS A;  1HZ4 A;  1ELW A;  4BER A;  5EYP F;  3T9K A;  3QKY A;  4KZC A;  5EDS A;  1MJ0 A;  1ELK A;  4PS3 A;  2B0O E;  4J6I A;  4FHJ A;  1HX8 A;  2CG2 A;  2R2L A;  1XNF A;  3U66 A;  1FVF A;  3ZYL A;  4D10 C;  4BEP A;  3FUN A;  3FU6 A;  3KSQ A;  4U8Y D;  3FUF A;  3QAQ A;  3FTU A;  2KC7 A;  3DEO A;  2WXF A;  3L82 A;  4JC8 A;  5CRV A;  3QJZ A;  3SBT B;  4M3O A;  2V0P A;  1NZN A;  4KVO A;  3J5Q B;  2F8Y A;  3FU5 A;  4WAF A;  2V4H C;  2IEJ A;  2H6F A;  1UW4 B;  4UWF A;  2LXM A;  4RLY A;  3U9W A;  3IV0 A;  3ZXS A;  3DPY A;  4LRZ A;  1KT1 A;  2IQC A;  2R5S A;  4J8Y A;  4WWP A;  2WXH A;  4G25 A;  1YMP A;  3CST A;  3DPD A;  5HRY A;  4PDX A;  3Q78 A;  3PZ1 A;  4J8S A;  3S7J A;  1OCO E;  5KJM A;  4R7L A;  3ULY A;  3IHV A;  3CHO A;  3JUI A;  2GRR B;  4N3B A;  1AP7 A;  3SF4 A;  2VGX A;  2J8S D;  2GGF A;  3ZPJ A;  4ZFH A;  1MZC A;  2I9C A;  4LSZ E;  2F0Y A;  3UM0 A;  3DSW A;  1TR4 A;  4BTA A;  4BET A;  2ILR A;  4OYS A;  3LXU X;  3UQ3 A;  3AJI A;  2HYZ A;  4WUY A;  3CHP A;  4GZ3 A;  5BPP A;  1A17 A;  4N3C A;  3CIA A;  3I5P A;  3W9G A;  3HXD A;  4UWL A;  5A6C A;  1QYM A;  3G2U A;  2PQR A;  1HG2 A;  2LAH A;  1PC2 A;  3LS8 A;  4YND A;  1L5J A;  2VSY A;  3QOU A;  2P2C P;  2WXG A;  4HS2 A;  3I4G A;  4KMO A;  3OXL A;  5LP0 A;  2KZT A;  3F6Q A;  3S7B A;  4G11 A;  4GMR A;  1FCH A;  2WB2 A;  4NQ0 A;  5JHB A;  5AQB A;  2UY1 B;  2R05 A;  4I6G A;  3CHR A;  4JB8 P;  2BKG A;  3S7D A;  5D2M C;  4GMJ A;  3DRA A;  4U7E B;  1JUQ A;  1HU3 A;  3V31 A;  3IHY A;  4O1O A;  2XPZ A;  4RG9 A;  1MX2 A;  1MHQ A;  1A5E A;  4U96 D;  3DWL G;  3AAA C;  3PS6 A;  2R03 A;  2XGO A;  3HG0 D;  1OXJ A;  3TG5 A;  3ZRH A;  4TRQ A;  2CFU A;  3G2W A;  4JHR A;  1KT0 A;  2A5E A;  2WXM A;  4ME2 A;  2WXO A;  2RG8 A;  5J08 A;  1LF8 A;  3UX4 A;  3ABM E;  4I6J A;  4I2Z A;  3TWT A;  3PUK A;  5KWD A;  5ARG A;  1JWG A;  5BT1 A;  2OND A;  3AU5 A;  3LDZ A;  5HI7 A;  3E34 A;  4XX5 A;  1D8E A;  4TXP A;  4Q94 A;  4RVB A;  4GZ5 A;  5LFA A;  2DZN A;  2H6G A;  3G2T A;  4CGV A;  3RKV A;  4GZC A;  2X6H A;  2QY7 A;  3RRN B;  4NIK A;  4ATG A;  5E76 A;  4JEH A;  3SNX A;  4M7C A;  2I2O A;  4HLL A;  4GTT A;  5C1D A;  3FWV A;  3AS5 A;  3RO2 A;  1WY6 A;  2Y4U A;  2IO3 C;  3JUE A;  3UKU G;  4ATZ D;  2PL2 A;  3B7U X;  3VLE A;  4JW1 A;  1YCS B;  1SW6 A;  3B7S A;  3FH7 A;  2YHC A;  5CCL A;  5DBK A;  2PNN A;  2HO1 A;  1OWN A;  2F8X K;  5AQ9 A;  3NOC D;  4GB9 A;  1D9S A;  3TL5 A;  2ETC A;  4CGW A;  4FA6 A;  5J90 A;  4GCN A;  2VSN A;  5JHA A;  3CHM A;  2OEV A;  4IN3 B;  3EIQ C;  2R59 A;  4BSX A;  3ASD A;  4Y6C A;  4EZK A;  5AJL A;  5FZQ A;  4BFR A;  5E75 A;  2XRZ A;  4N2S A;  2M63 A;  1KZO A;  4U0S A;  2QYJ A;  3PDN A;  3FH5 A;  4AEZ C;  1RW2 A;  1N94 A;  4WNG A;  4AV7 A;  4GTO A;  4LER A;  2ZGD A;  4L9P A;  4DK5 A;  2X3M A;  4GYY A;  2WXI A;  3MJW A;  2C0M A;  3QWP A;  3RAU A;  2MOW A;  3OXG A;  4EHM A;  4DI3 A;  3PE4 A;  3ISM C;  3SFX A;  5KNH D;  4F3V A;  3C3Q A;  2UWJ G;  4Q69 A;  1OUV A;  5KJK A;  2PQN A;  4X8Q A;  3QK0 A;  2ZIR A;  4UQX A;  3G2S A;  2VGX B;  3IKO B;  2P9U G;  4BSZ B;  3CK9 A;  3VLF A;  5FJY A;  3CEQ A;  3ONK A;  2XEV A;  2WMN A;  2DIW A;  3HXB A;  4KBQ A;  4XE0 A;  3BQO A;  4JL0 A;  4HOT A;  4ILI A;  3CVV A;  2X6K A;  4ILG A;  4ABN A;  3C72 A;  3X2Q E;  3S7F A;  3GYZ A;  2OOE A;  1E8X A;  2FO1 E;  2QC9 A;  4DX1 A;  5FT9 A;  4CDM A;  4L23 A;  1NP7 A;  4F6R D;  1Z5S C;  3SFZ A;  3K9I A;  3CKC A;  4UI9 J;  2J4B A;  1O1T A;  3OTN A;  4TV3 A;  4B93 B;  3TWU A;  1WAO 1;  1XGW A;  4U95 D;  3VLD A;  3B7B A;  3C3O A;  1H0A A;  1SA4 A;  2BF0 X;  3QB2 A;  1HG5 A;  4JPS A;  4EZL A;  4Z68 A;  3CVY A;  3APC A;  3KAE A;  4EZJ A;  4DLO A;  3SBS A;  3FEX A;  4GTV A;  2L0I A;  2GRL A;  4O1P A;  3ESK A;  4G1T A;  3E32 A;  1HXI A;  3FDH A;  4GU5 A;  2MYO A;  2RFM A;  4DUI A;  3R7Q A;  2CFZ A;  4UI9 C;  2Y3A A;  2A5U A;  3TWR A;  3PE3 A;  2XGS A;  2GRQ B;  4BES A;  4HOR A;  4I9C A;  4JHJ A;  5AAR A;  4CYM D;  4FLB A;  4QFV A;  5AYW D;  4A63 B;  2V5F A;  2C2L A;  2KBX A;  3JQ1 A;  3CVX A;  4BT9 A;  1IHB A;  3PZD A;  1UN9 A;  1ZBP A;  3QAR A;  3ZN3 A;  1N11 A;  2ETA A;  1EPU A;  3U3W A;  1UJK A;  2IOL A;  3BG1 B;  3FUM A;  4BTB A;  3QWW A;  2EIN E;  4H7Y A;  2IFU A;  3QNK A;  1FPP A;  5LCW J;  3FTV A;  2XS1 A;  4F1P A;  4G24 A;  2XS8 A;  3KS2 A;  5CEC B;  1Z3Y A;  4KVM A;  3E37 A;  5KBA A;  1OCZ E;  1TNB A;  2GW1 A;  1SA5 A;  1DNP A;  3PH0 C;  4GZ6 A;  2LUH A;  4APF A;  3T8K A;  4BX8 A;  2V4L A;  3EHN A;  4P29 A;  3Q5M A;  4HI9 A;  5JMN D;  1S63 A;  4GPM A;  5BUZ A;  5KNG A;  3FY4 A;  3CVQ A;  2IOS A;  3EU9 A;  3ZYM A;  1O5M A;  1IQU A;  3DST A;  3PZ3 A;  3PEU B;  2ZU6 B;  4HOU A;  3MV2 B;  2P9I G;  1H2T C;  4HB5 A;  1BI7 B;  2VTB A;  3MKR A;  3L08 A;  1PAQ A;  2WXK A;  3WXX A;  2WXP A;  2X6F A;  3SZ7 A;  4XKB A;  4WWN A;  5FQ8 A;  3I3N A;  1B89 A;  3N71 A;  3EHR A;  3MGB A;  4GML A;  4F1S A;  5FZR A;  2HE0 A;  3VTY A;  3ZHE A;  2R02 A;  3B7R L;  3LVR E;  1E8Z A;  3V30 A;  2I1K A;  3MA5 A;  3MX3 A;  4AXH A;  1MX6 A;  1O1R A;  5FIO A;  1E90 A;  2E2E A;  2FI7 A;  1TJF A;  5BXU A;  5AN8 A;  1UJJ A;  3FUJ A;  5KJL A;  2AVP A;  1LD7 A;  3FUE A;  4DX7 D;  4J0U A;  3ZW3 A;  2EIK E;  4TXQ A;  1NFI E;  3JXI A;  3EU5 A;  1WG0 A;  2XPI A;  3GZ2 A;  3DSS A;  3ULE G;  1HS6 A;  3CVN A;  3CK7 A;  2AW6 A;  1X5B A;  1HF8 A;  5BW8 C;  2J07 A;  3RIB A;  2WXJ A;  3NAW A;  1SVX A;  3QWV A;  1N4S A;  2AWI A;  1WM5 A;  3TXM A;  4DJA A;  2JAB A;  2XCC A;  4CRW A;  1EDU A;  1ELR A;  4O60 A;  3HVE B;  3LJN A;  3UI2 A;  2IF4 A;  1IYG A;  1UG3 A;  3D3M A;  2EIL E;  1DC2 A;  3SHF A;  1V54 E;  5LX8 A;  5ARF A;  1KLX A;  3LY7 A;  4WNF A;  2FF4 A;  4DPR A;  3FTZ A;  3PEV B;  3PZ2 A;  4B0Z A;  4YDE A;  2XPY A;  1KZP A;  4AIF A;  5EIL A;  4I17 A;  4BX9 A;  1D8D A;  4U8H A;  4UQZ A;  4HRM B;  4J8F A;  1VDY A;  4XI9 A;  2GRO B;  1WDY A;  1BPO A;  3UTM A;  2J09 A;  4ANU A;  3RSE G;  3LYA A;  1HFA A;  5A7D B;  3T5X A;  4NAC A;  3EIJ A;  3Q49 B;  4UI9 K;  3ZFW A;  3D9K A;  3D9O A;  1MYO A;  3SQV A;  1QZ2 A;  2RFA A;  3RRU A;  3LY8 A;  3D9I A;  4PS8 A;  1BD8 A;  1JCQ A;  1FT2 A;  2NYJ A;  4GTR A;  3U64 A;  4AOF A;  5CBO A;  3ASH A;  3FTY A;  1IHG A;  2LAI A;  3D9J A;  4CT0 A;  1P5Q A;  2WMO A;  2LXL A;  4HQD A;  4K5B A;  1MQS A;  1N0Q A;  1N9A A;  1S0P A;  3DXK G;  3ZU7 B;  3IXE A;  2NXP A;  3RK6 A;  2GRP B;  3GZS A;  4KZ0 A;  5AQ7 A;  3FHE A;  3OAW A;  1JPL A;  2CHW A;  4WNE A;  5C2Y A;  1N0R A;  3KD7 A;  3NBN B;  4KXK B;  4CT4 A;  1Q2Z A;  3ASG A;  3NB2 A;  3J5P A;  5CED B;  4J7W A;  4HVB A;  4K0R A;  3B95 A;  2KAT A;  2R17 C;  3AU4 A;  2KXP C;  3CHQ A;  4NRH B;  1SQM A;  2X6I A;  4HNA D;  2FO7 A;  5G04 J;  4EEC A;  3L22 A;  4GPK A;  4RG6 A;  4BY6 A;  3RJV A;  3NOG D;  4N5C A;  2X6J A;  2QYU A;  1TEZ A;  1SZA A;  3LVQ E;  1Y6I A;  4A55 A;  4PS7 A;  4U63 A;  4CDN A;  3SY2 A;  3MKQ A;  4A1S A;  2WQ7 A;  2OEW A;  2WXN A;  5G04 C;  4MBG A;  4URK A;  1E7V A;  4A3V A;  3TWS A;  1TN8 A;  1TNZ A;  2BUG A;  1U3C A;  3HXE A;  1GW6 A;  1JCR A;  4B94 A;  4IRU A;  3Q15 A;  1K8K G;  4EPZ A;  3D9H A;  4H7X A;  3CHS A;  2A4Z A;  3CQG B;  3V2X A;  3B7T A;  2DVW A;  3UIO C;  3ZGQ A;  3ZVV A;  3SGH A;  4I43 A;  2KCK A;  4O6F A;  5FTP A;  5B1B E;  2BTD A;  1NA3 A;  2OVB A;  2ZGG A;  3R9M A;  2RD0 A;  2MHK A;  3UMV A;  5EIB E;  1N4R A;  3TAX A;  3CKB A;  2KM4 A;  2WQH A;  4U0Z A;  3D9M A;  4JA7 A;  1LTX A;  2ZIS A;  1QNF A;  2VSX E;  3PZ4 A;  1FT1 A;  5FQ4 A;  2VGY A;  1Z6T A;  3ENE A;  4IUL A;  3UIP C;  3FUD A;  4YDY A;  2OV8 A;  4UUC A;  5G05 J;  4F7A A;  5ENR D;  4I9E A;  2YQ8 A;  4UQY A;  2HM8 A;  4ANV A;  3ASO E;  3OXF A;  4HLE A;  1NA0 A;  3AG4 E;  4GZD A;  4G26 A;  1H2U A;  4JHK A;  2PZI A;  1TNU A;  3RRM B;  1INZ A;  4HRL A;  4WWO A;  4YDW A;  4C0E A;  1K1A A;  3NZS A;  5ITZ F;  2ION A;  4DLQ A;  3FEY A;  1OWL A;  2AXV A;  3ML8 A;  3W9F A;  1JWF A;  2P9L G;  4L7T A;  3CVU A;  5JJ7 A;  5FQ6 A;  1E8Y A;  3V79 K;  5G05 C;  3PUJ A;  1QQE A;  1E7U A;  5BV0 A;  3D9N A;  2LSV A;  3SI5 A;  2L9B A;  4G8L A;  2BKK B;  3ZKJ A;  3HRA A;  4ANW A;  3TJP A;  5CMY A;  5A23 A;  1S70 B;  3T5V A;  2KZT B;  5EX3 A;  2VGE A;  1HH8 A;  3QDN A;  4ANX A;  5G2N A;  3FP3 A;  5IY5 E;  3JXJ A;  3HIZ A;  3AG1 E;  5AAO A;  5ENO D;  2DCP A;  2XQ0 A;  4A3T A;  2VJ8 A;  1BLX B;  3ZNG A;  2L6J A;  3ASN E;  3FU3 A;  1Z3X A;  4AM9 A;  1U3D A;  2P9P G;  3NZU A;  3PVL A;  2UY1 A;  3L6A A;  3NQP A;  3UM3 A;  2CG3 A;  4LCT A;  5FIN A;  3CVW A;  3LPZ A;  5HS0 A;  3KEZ A;  3Q4A B;  1KPS B;  3ABL E;  3PNL B;  2P9K G;  5CRU A;  3IBE A;  4L2Y A;  4JZY A;  3D9L A;  4G2V A;  4U04 A;  3UXG A;  4I1A A;  1ZU2 A;  3ZUV B;  4K5C A;  1TYQ G;  2J08 A;  3E4B A;  3ONL A;  5G55 A;  2EIM E;  2YIN A;  2JLB A;  3UIN C;  3BUA A;  2WXQ A;  2WXR A;  4L1B A;  3UT7 A;  3EHM A;  3CSF A;  2OVF A;  2ZXW E;  5T8I A;  3D9P A;  4K03 A;  1MX4 A;  4KYO B;  4RSY A;  1E96 B;  3T8M A;  5CER B;  3FH8 A;  2GRM A;  2IO2 C;  3DBS A;  5D66 A;  1N4Q A;  2CHX A;  1HO8 A;  5LOZ A;  2Y4T A;  3FFL A;  2Q7F A;  4FUL A;  5B3S E;  4A1G A;  4ZHB A;  3MKQ B;  4G23 A;  2VQ2 A;  1ZB1 A;  4B8C B;  4JA9 A;  2WVI A;  4LNB A;  1IKN D;  5T3R A;  4AP2 A;  5ANL A;  4CDR A;  5ENS D;  3HXC A;  1N52 A;  5ENP D;  4NUR A;  5ENN A;  5CBN A;  3P2B A;  3FUI A;  2Y1L E;  4GTQ A;  4B89 A;  5KCM A;  4V3I A;  3HDX A;  1QBQ A;  3MZL B;  4LNU D;  1OCC E;  4OVU A;  3O4Z A;  4FP7 A;  4E6H A;  3Q9U C;  4BT8 A;  4KT6 B;  5EN5 D;  4W9R A;  3PRE A;  4OAU C;  3NF1 A;  1AWC B;  2JEK A;  2EQX A;  3L16 A;  3CVP A;  4HOQ A;  1JCS A;  2XRY A;  4EBA A;  3I4R B;  4GA0 A;  3LKU A;  5JA4 D;  3TWQ A;  3TWX A;  3ZEF A;  4DX5 D;  3R7R A;  4ACL A;  4BWR A;  4U07 A;  4JVS A;  1Y8M A;  3ZXP A;  1H19 A;  3LY9 A;  3RU0 A;  5M72 A;  3ZYQ A;  2QFC A;  4C9B B;  3BEE A;  4FHK A;  3CK8 A;  4HRN A;  3HHM A;  2V8S E;  3DXM G;  4GYO A;  4FAD A;  3FUH A;  2F37 A;  3CR3 A;  1OCR E;  5CHE E;  3UUX A;  2OCC E;  4APO A;  5CMW A;  3Q9N C;  3AS4 A;  4MS6 A;  4PH4 B;  1IQR A;  1OWM A;  5AIJ A;  3LEW A;  3DSU A;  2NSZ A;  1LD8 A;  4DX6 D;  1OY3 D;  3UPV A;  3SFY A;  4FC8 A;  4PUC A;  3ABK E;  2FUL A;  4N5Q A;  4DRX E;  4UWG A;  3SD5 A;  1BI8 B;  4HBD A;  4N39 A;  2LNI A;  2MRI A;  3ML9 A;  2HR2 A;  2WQ6 A;  3CQC B;  1TNO A;  1RZ4 A;  4GYW A;  3APD A;  4I6E A;  4L2L A;  2AJA A;  1OWP A;  3P1U A;  4XKC A;  4C48 B;  3ZYK A;  2YHE A;  2XEN A;  1K3Z D;  4J8D A;  1EF1 C;  1H6O A;  1N95 A;  3TXN A;  3E33 A;  2DYS E;  4FU3 A;  2BED A;  3WG7 E;  3CGH A;  2I6H A;  1X81 A;  3EJN A;  1W3B A;  4AY5 A;  4CCA A;  2DBA A;  3U4T A;  2KCV A;  1U2V G;  5AQA A;  3B13 A;  4LEU A;  4YVQ C;  1K1B A;  1YA0 A;  1DCQ A;  1SZ9 A;  3C5R A;  2J49 A;  4U8V D;  3Q47 B;  3MV3 B;  4UWK A;  2FBN A;  2P58 C;  4G8K A;  3BG0 B;  2X38 A;  3FTW A;  2VTB B;  2LO6 A;  3CVL A;  4AY6 A;  3FTX A;  3L9T A;  4YDO A;  3ASF A;  4IYP A;  5ENT D;  3DSX A;  3MYV A;  4B8A A;  2DZO A;  4HOS A;  4EBA G;  2VSO E;  2DWZ A;  2Y0B G;  2Y69 E;  4ACK A;  3ZHE B;  4GCO A;  2DYR E;  2XCB A;  4LUN U;  4E85 A;  4GTM A;  4CEM A;  4FJZ A;  5D0O D;  4YVO A;  3R9A B;  4FLH A;  4I1M A;  1OT8 A;  3DSV A;  3TG4 A;  5ANR A;  3EUV A;  4HXI A;  3JQ0 A;  4DX2 A;  4TUU A;  3HYM B;  1BU9 A;  5ENQ D;  4GA1 A;  3HXF A;  2XEE A;  4QQI A;  1TN7 A;  1NI1 A;  2XHE A;  3PNT B;  5KJN A;  5JJT A;  5AJD A;  4C0M A;  2ETB A;  1YYH A;  3UT4 A;  3EDT B;  2J4D A;  3UT8 A;  4TXR A;  1N54 A;  3URZ A;  5B1A E;  3FUK A;  3KSL A;  4AJW A;  4N3A A;  1N4P A;  3KEA A;  2NC9 A;  4MKT A;  3FUL A;  3MCX A;  5DIZ A;  5T4Y A;  3QC1 A;  3IEG A;  3ZIM A;  3CLJ A;  2WXL A;  2PM7 A;  3ESL A;  1O1S A;  4HI8 A;  1H6K A; 
#chains in the Genus database with same CATH homology
 5B1A E;  2DYR E;  1OCR E;  1OCC E;  5IY5 E;  2OCC E;  3AG1 E;  2DYS E;  1OCZ E;  3AG3 E;  3ABM E;  2ZXW E;  3WG7 E;  5B3S E;  3ASO E;  2EIJ E;  2EIK E;  2EIN E;  3ABK E;  3AG4 E;  3X2Q E;  1V55 E;  3ASN E;  2EIL E;  5B1B E;  3ABL E;  2Y69 E;  1V54 E;  3AG2 E;  2EIM E;  1OCO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...