2EIKE

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eikE00
2EILE 2DYRE 1OCOE 1V55E 2ZXWE 3ASNE 1OCCE 3X2QE 2DYSE 5IY5E 1OCRE 3AG3E 3AG1E 2EIKE 2EINE 3AG4E 5B1BE 3WG7E 3ABKE 3ABLE 5B3SE 2Y69E 1OCZE 1V54E 3ASOE 2EIJE 2OCCE 5B1AE 3AG2E 2EIME 3ABME
chains in the Genus database with same CATH superfamily
1S0PA 3EIQC 4GA2A 3CLJA 1H0AA 2XPYA 4PUCA 4LUNU 4XZ4A 3CR3A 2AXUA 3TAXA 4G26A 3KEZA 1HU3A 1OXJA 5AYWD 3QNKA 5CRVA 4YVQC 2ZU6B 5AQ9A 1JCQA 4G11A 4ACKA 1MJ0A 5FQ4A 1UW4B 2DYSE 1WDYA 2MRIA 2OEVA 3HYMB 3DSTA 1MX4A 1TNZA 1E90A 5HS0A 3SFZA 3CIAA 3PNTB 4APOA 4WNDA 4B89A 2VTBA 4NIKA 3UKUG 4B94A 5LCWC 3ESKA 4GZ6A 3HIZA 3PS6A 3WG7E 2M63A 3ZUVB 5HI7A 3T5XA 5ARGA 4FLBA 4JEUA 3LY7A 3IKOB 3JUEA 4G23A 1E96B 3ASOE 3SHFA 2VTBB 4CDMA 4F53A 3PRZA 3FUFA 2X6JA 4H7YA 2VSYA 2X6FA 1OWMA 3TWTA 3TWQA 1MHQA 1TNOA 4U63A 3JUIA 3TWUA 4WWNA 4ANVA 2XGOA 1JPLA 4F7AA 4G24A 4A3VA 2HO1A 5D66A 4PS7A 3T9KA 4AOFA 3IXEA 4GYOA 3EU5A 1QQEA 4QQIA 4U96D 3DRAA 5KNHD 3MV3B 4B0ZA 5AENA 3ZEFA 3OAWA 3Q5MA 1A17A 1OY3D 1SQMA 4N2QA 1E8ZA 2OOEA 3CVNA 5AQ7A 3ZHEB 2XCCA 4I1MA 4GCNA 4HRLA 3L08A 2MOWA 5JJ7A 1H19A 3D9MA 2P9PG 4U8VD 1HG5A 3MKQB 3PEUB 4HNAD 3AG3E 1FVHA 1Y8MA 4UQYA 5G05C 4HXIA 2PQNA 3RJVA 4FADA 2J9QA 3S7DA 3JQ0A 3ZHEA 5FTPA 1X5BA 3DXMG 2IFUA 1JWFA 2ETAA 4YNDA 4HOTA 4GTRA 3CVXA 4Y6WA 2GRLA 1N4QA 2WMOA 5AJLA 5JMND 1JUQA 3Q79A 2XEEA 4GTPA 3CVYA 1IQRA 3FTYA 2WXIA 4DJAA 3RO2A 3S7FA 3ZRHA 1MX6A 1X81A 2QYUA 1OCRE 4FHJA 4I2WA 3G2SA 1TN7A 5AIJA 3EIJA 5M72A 3RRUA 2R17C 1MQSA 2P9UG 4L7TA 4RG9A 1RW2A 3UXGA 3LJ3A 3ULYA 3APDA 4XIFA 1UJJA 2B0OE 3B13A 4RG6A 3LY9A 3QB2A 5AN8A 3D9KA 1H2UA 4GB9A 4KBQA 4BTAA 2NYJA 2WMNA 4KVOA 3VTXA 1PC2A 2X6IA 3APFA 2X38A 1E7UA 2LXMA 3PREA 3TG4A 1S64A 1QNFA 3TJPA 4DUIA 1IYGA 3EHMA 4DX2A 3W9FA 3JCKC 4GAAA 1BLXB 5EIDA 3PZ3A 4IN3B 4N2SA 2Y0BG 2WXFA 4WNEA 5E75A 4ME2A 1UOHA 4Q94A 4XEIG 1DNPA 4KVMA 2XGSA 2BEDA 2ZGDA 4G25A 4HI8A 1BI8B 3FUIA 1BI7B 1KPSB 3LVRE 1HFAA 4I17A 1N4PA 2XEVA 3ONKA 5G55A 4JHJA 1LF8A 5ANLA 3VLDA 1WM5A 3L16A 4HB5A 2P9KG 3LYAA 2KCKA 3FULA 1OWLA 1UG3A 3UINC 1Z3YA 3SBTB 3KS2A 3B7UX 3SFXA 3OXFA 3I4GA 3MEKA 5CMWA 3PZ2A 3D3MA 5LP0A 4EQFA 5CCLA 2CG2A 4UUCA 4I43A 2IOLA 2DBAA 3ABKE 4UI9C 5EKQD 2AVPA 4E85A 2LUHA 3RO3A 2AXZA 4JA7A 2WB2A 4K5CA 2WXNA 4K5BA 5D0OD 3AS4A 3QAQA 3ZYQA 1LD8A 1N95A 2ZISA 2VGEA 4JVSA 1ELKA 3CHOA 4R7LA 4UWHA 3E33A 1XGWA 1YA0A 5D2MC 3NQPA 2H6FA 3CK7A 3NOGD 4UWGA 3ULQA 5CRUA 2KBXA 4F1SA 4HORA 1N0QA 3OTNA 1N0RA 3FUEA 2I1KA 3FUJA 3Q9UC 3DEOA 2JLBA 3Q78A 2XPIA 2F0YA 3IHYA 3Q49B 5BV1A 4GTOA 4MKTA 2KCLA 1NA3A 3R9AB 2RFAA 1HG2A 3QARA 1S63A 4C48B 5E76A 4DX5D 3CQCB 1TNBA 3S7JA 5CECB 3PNLB 3OXGA 4FJYA 4I6JA 5LOZA 2JEKA 3MKRA 3EU9A 3TGOA 3UMVA 3OXLA 1INZA 5FWQA 3LDZA 4K0RA 5BXUA 5ENSD 5BPPA 2EINE 3PE4A 2I1JA 4RVBA 3GZSA 4CGWA 4FHKA 3ZXSA 2AJAA 2J09A 3J5PA 2XRYA 3O4ZA 3ABME 2V5FA 5FQ6A 4CRWA 1XNFA 2A5EA 2CFUA 3D9OA 2ETCA 2CHXA 2WM9A 3IBEA 4GZCA 2WVIA 2LXLA 4BSZB 1TJCA 4AVXA 2WXMA 3FWVA 3ZNGA 2IJGX 3FH5A 4UWKA 3ULEG 3DPYA 2X6HA 4U7EB 4AEZC 4OAUC 4J0UA 3D9LA 3BG1B 4D10C 5ENOD 4LERA 1DVPA 1FT1A 5B3SE 1JWGA 3NZSA 4I6GA 3DBSA 3MKQA 4LSZE 2IOSA 4I1OB 3UM0A 3GZ1A 1O5MA 3E30A 4GZDA 2UY1B 4XX5A 3UM1A 5KJKA 2DWZA 5JJ6A 4HLEA 2WQHA 5T3RA 4CT0A 4AIFA 1SZ9A 3URZA 4BX9A 5CBNA 1K1AA 4KXKB 2H6GA 4GYWA 2CHWA 4X8QA 2H6IA 3SNXA 2WXRA 3Q4AB 4TUMA 1WG0A 3PEVB 3FUMA 3HXBA 3HXFA 4DX7D 3DSSA 4EBAA 1HO8A 3MYVA 1HE8A 4LNUD 2WPVA 3RK6A 4L9PA 2P9SG 1E8XA 5J90A 2ZGGA 3UKRG 5ENPD 4G8KA 4GTVA 1OCCE 3C3OA 3NB2A 1ELWA 4PS3A 3UI2A 2HR2A 4I6EA 2QFCA 4JZYA 3I5PA 1N4SA 1O1SA 2PZIA 5BV0A 3UQ3A 2P9IG 4Q96A 1JCSA 3SY2A 4F3VA 1LD7A 4EECA 2OEWA 2YHEA 2EIKE 1D9SA 4J8FA 4PS8A 5CMYA 2VSXE 3ZYKA 4GU5A 1H6KA 5EYLA 1TR4A 4LNBA 2DVWA 4MBGA 2LSUA 3DSWA 1QZ2A 2C2LA 3P1UA 1HZ4A 3CGHA 2QY7A 2XS1A 4WWPA 3G2VA 3DXKG 1Z3XA 2RKKA 3U3WA 2BKGA 4AM9A 1S70B 2RD0A 2R5SA 4ILHB 1KZOA 3QWPA 3LEWA 3VLEA 1D8DA 5G04C 5A6CA 1TYQG 1IQUA 4Q69A 2YINA 4JA9A 2GROB 2XGMA 4FJZA 3L54A 4BEPA 2V4LA 1Y6IA 4HFGA 2KM4A 4J8EA 4U8YD 1KT1A 5CHEE 2MYOA 3KD7A 3V31A 4BSXA 3ONLA 3HXEA 4ABNA 5EX3A 4EZLA 3L13A 4TXPA 4KMOA 4FC8A 5HRYA 4O60A 2IONA 4XI0A 4AY6A 1A5EA 3U9WA 4KZ0A 1HXIA 2Y69E 3FDHA 3NAWA 3RAUA 2F8YA 3E32A 4ANXA 2I6HA 1P5QA 3TWVA 5G2NA 4KZCA 4O1OA 4DK5A 3ZU7B 1EF1C 4ATZD 3P2BA 3C72A 1OWNA 1UN9A 3FY4A 2I2OA 3LJNA 2DIWA 2PL2A 1N94A 2RG8A 1SVXA 3EHNA 3UUXA 3CQGB 1QBQA 5CEDB 4EZKA 3ZXPA 1Z6TA 5B1BE 4BY6A 4FP7A 5BUZA 3RRNB 4Y6CA 4YVOA 3FEXA 3R9MA 3PUJA 3SD5A 4FA6A 1MYOA 1FVFA 3HG0D 3X2QE 5HQ8A 4U95D 4K5AB 3FH7A 2ETBA 2B6CA 1DC2A 4L2LA 3PH0C 4I2ZA 3FUNA 4LCTA 5DIZA 3MX3A 5B1AE 4GA0A 4NURA 4U0UA 3FTSA 3PZ1A 1E8WA 3ASFA 3MA5A 1YCSB 3E37A 4ZFHA 3SZ7A 2FO7A 3NOCD 1AP7A 3U66A 3RRMB 1SW6A 4ATGA 4U04A 4EPZA 2WQ6A 1OWOA 3N71A 2OCCE 3Q7FA 1W3BA 2EIME 3D9HA 4TXQA 2DYRE 4GPKA 3FTUA 4ZHBA 2V5QC 3ESLA 1JCRA 2Y1LE 4J8SA 3FTZA 2J07A 3MGBA 3ML9A 2L6JA 3BUAA 3CHMA 4JPSA 4JD2G 3QWWA 2XRZA 2VGYA 2EILE 5J08A 2GRMA 1OT8A 4DI4A 2IF4A 1HS6A 5LCWJ 3T8KA 2P58C 2XPZA 3U64A 3Q7AA 2WXHA 3ZN3A 1AWCB 1KLXA 2PM6A 4CDNA 3PVLA 2KC7A 2EQXA 3Q47B 1IKND 1IHBA 2XHEA 2WXOA 4KYOB 3V2XA 2ILRA 5KJLA 4GA1A 1HF8A 3EDTB 2F8XK 4LRZA 5ENNA 4N5QA 3FHEA 1WAO1 1QYMA 1DCEA 1BD8A 2QZAA 3FEYA 2J8SD 2J4DA 4ILGA 2XQ0A 4ANUA 3S2AA 1E8YA 4TV3A 1TJFA 5AAOA 2F37A 2VQ2A 3QC1A 2P2CP 2HE0A 3VTYA 5CBOA 3FTWA 3J5QB 4AV7A 3UT4A 1NI1A 1SA4A 2WXKA 4K03A 4FULA 2XZDG 1IHGA 4F6RD 3AJIA 5G05J 3B7SA 2VYIA 2L0TB 3JYSA 3SGHA 3AAAC 3L6AA 5LX8A 5EILA 3JXJA 4H7XA 4TUUA 4QFVA 5JHBA 2R03A 4TXRA 5ENRD 2VGXB 4B8AA 2IY0C 5C1DA 3LXUX 3E34A 4F1PA 4BERA 3FTXA 4ACLA 1D8EA 4HOQA 3D9IA 4RLYA 3HXCA 4DX6D 4HQDA 2AXVA 4BT8A 1N54A 3C5RA 4A63B 3MJWA 2HM8A 3ZIMA 3LS8A 4GTSA 5HKPA 2BUGA 1Q2ZA 5H7PA 4PDXA 2BKKB 2E0IA 1H2TC 4UWFA 1K3ZD 2OVBA 4URKA 4N3CA 2KXPC 4OAVB 2KZTA 1OCZE 4OYSA 2J49A 2XEHA 2Y3AA 4C9BB 2YQ8A 1O1RA 4GZ3A 1IXVA 1N52A 2LAIA 5ARFA 4HVBA 4RSYA 3SBSA 2BTDA 4CDRA 5BT1A 3KAEA 1H2VC 2R02A 4DX1A 3GYZA 2KZTB 2OV8A 3TXMA 1NA0A 5FJYA 3B95A 2LAHA 4OVUA 4HI9A 3V2OA 4CYMD 2XS8A 3U4TA 4M7CA 4TRQA 1ZBPA 3CVVA 2I9CA 4V3IA 3IV0A 4N3AA 4W9RA 4BETA 3ZYMA 1N4RA 3CHRA 1WY6A 5FT9A 3HHMA 2Q7FA 5JJTA 3EHRA 3EUVA 3AU5A 3FU6A 4DLQA 5AJDA 3SFYA 5ITZF 3UPVA 5T8IA 2X6KA 4IULA 4GPMA 5BW8C 4J8DA 4AP2A 3AG4E 3UT7A 3ABLE 3NF1A 4DPRA 3RSEG 4U0ZA 3CV0A 4GTQA 2IQCA 3AU4A 1OUVA 3ENEA 3APCA 5FQ7A 2YNQA 4RQIA 1RZ4A 2DCPA 1FT2A 2WXJA 5A7DB 2DZNA 1V55E 3I4RB 1N11A 3CHPA 3FU0A 1LTXA 3KEAA 1ZU2A 2XCBA 3UTMA 4U8HA 3BEEA 1NZNA 1NFIE 3EJNA 4M3OA 4G2VA 3D9PA 4KT6B 3ZVVA 1B89A 1BPOA 2P9NG 1SZAA 2IEJA 3RKVA 4UWLA 4GCOA 3C98A 3PDNA 3C3QA 3CK9A 4BX8A 2UWJG 3CVLA 1NP7A 2CHZA 3R7QA 3C3RA 4L2YA 3TXNA 4GTTA 4C0EA 1H6PA 3EHQA 2ZXWE 2KCVA 4G8LA 4Z68A 3ZFWA 3Q73A 3DWLG 1L5JA 3CSTA 4I9CA 4U07A 5EN5D 2FI7A 3SQVA 1K8KG 1O1TA 5EYPF 3O48A 3F6QA 3IHVA 4LEUA 3I3NA 5FQ8A 3FP3A 3QWVA 3Q9NC 5BNWA 3ZW3A 1E7VA 5KWDA 3SF4A 4J6IA 3MCXA 1OWPA 4JHRA 2WXQA 2V0PA 2FF4A 2JABA 3FUDA 4IYPA 3K9IA 4PH4B 4O6FA 2VSOE 1DCQA 3FH8A 4OVVA 5D0QD 3LPZA 1K1BA 1PY1A 1OCOE 4JW1A 3CHQA 4JB8P 1EDUA 4XI9A 2V8SE 1U3CA 5CCMA 3TG5A 1G3NB 3CSFA 1MZCA 1U2VG 3DPDA 1TNUA 1EPUA 1N9AA 4NRHB 4HS2A 4B93B 4YDWA 4WAFA 5IY5E 4AXHA 4LG6A 3CVUA 4UI9J 5ENQD 3BG0B 3HVEA 4ILIA 2LO6A 1FCHA 4FLHA 5FZRA 4GMLA 5ENTD 4AY5A 3DSUA 4CCAA 3ASDA 4N3BA 4EZJA 5EX0A 2VJ8A 3V79K 3PZDA 5LFAA 2P9LG 3G2UA 3ZGQA 4AJWA 3ZKJA 4GMRA 3CHSA 2NC9A 3SO8A 2VGXA 3JXIA 3UM3A 2IU1A 2WXGA 2CFZA 5BXOA 2E2EA 3FUKA 4CZ2D 3BQOA 3FFLA 3CKBA 2FULA 2GGFA 3L17A 4L23A 2YHCA 3CEQA 3HXDA 1Z5SC 1H6OA 3LCAA 3TWXA 4XKBA 3L22A 4J8YA 5G04J 3IEGA 3G2WA 2NSZA 3LY8A 2J08A 2R2LA 4UQZA 4DRXE 1HX8A 2PM7A 1FPPA 2OVFA 3DEPA 2R59A 4L1BA 1TEZA 3HVEB 3HRAA 2FBNA 1HH8A 2XENA 4CGVA 4FU3A 3W9GA 4JHKA 5KJMA 3QK0A 3PZ4A 1BU9A 3AS5A 4JEHA 4UI9K 5A23A 3KSQA 4A1GA 4A55A 4EHMA 3UIOC 3MV2B 3BU8A 2IO2C 4C0MA 2IO3C 5FZSA 4MS6A 3KSLA 4HLLA 3E4BA 4YDOA 2H6HA 4NQ0A 3ZYLA 2J4BA 4CEMA 3TWWA 3TWSA 5AARA 1UN8A 2MHKA 2L0IA 3WXXA 4YDYA 4APFA 2WQ7A 3UIPC 2GRNB 3AG1E 5C2YA 1PAQA 3PE3A 4GTMA 2CG3A 4G1TA 5KCMA 2Y4TA 1KT0A 1GW6A 3B7BA 3PUKA 3AG2E 2LSVA 4MRUA 3JQ1A 4IRUA 3RU0A 5KBAA 3B7TA 3LVQE 2L9BA 3SI5A 2Y4UA 4GMJA 4N5CA 3RIBA 2ONDA 5T4YA 3T5VA 2GW1A 2QYJA 5JA4D 2EIJE 3TWRA 3HDXA 5KJNA 2A5UA 4JXTA 3UM2A 2VSNA 4HRNA 2A4ZA 3LKUA 3GZ2A 2V4HC 4JL0A 3CVPA 4EBAG 2UY1A 2L6BA 3CVWA 3NZUA 2PNNA 2GRQB 5AQAA 3CVQA 5FZQA 4U0SA 2R05A 3FU5A 3G2TA 4BT9A 4O1PA 4P29A 4NACA 4ANWA 2GRRB 1YYHA 4HBDA 4HRMB 5DBKA 3R7RA 3GW4A 2WXLA 4A3TA 5FINA 3FTVA 2KATA 3CKCA 1NL4A 5CEAA 4A1SA 1UJKA 4WWOA 2FO1E 4I9EA 5EIBE 2RFMA 4LNGA 4GZ5A 4CT4A 4JC8A 2QC9A 3MZLB 2FEZA 3L9TA 4GYYA 2ZIRA 5FIOA 3FUHA 5KNGA 1VDYA 2GRPB 2DZOA 3ASNE 2X3MA 3UT8A 1TN6A 4YDEA 5ANRA 3ISMC 4E6HA 3L82A 3Q15A 3TL5A 3ZPJA 3B7RL 4UQXA 2LNIA 1V54E 1MX2A 1KZPA 2C0LA 4HOSA 3FU3A 3D9NA 3AS8A 3QDNA 2AWIA 2C0MA 1YMPA 4BWRA 4WUYA 3QKYA 1SA5A 2NXPA 3ASHA 3ASGA 3ML8A 4B8CB 2BF0X 3UX4A 5JHAA 3D9JA 3V30A 4N39A 4BFRA 3Q75A 4WNGA 4J7WA 1EYHA 3DSVA 4WNFA 3NBNB 3S7BA 3T8MA 3VLFA 4DI3A 3QOUA 1ZB1A 4XKCA 2WXPA 2PQRA 4BTBA 2XZTG 5EDSA 3CK8A 3QJZA 4BESA 4I1AA 4XE0A 1ELRA 2AW6A 5AQBA 1U3DA 3DSXA 4MLPA 4HOUA 2HYZA 1TN8A 4DLOA 1TNYA 5CERB
chains in the Genus database with same CATH topology
2EILE 2DYRE 1OCOE 1V55E 2ZXWE 3ASNE 1OCCE 3X2QE 2DYSE 5IY5E 1OCRE 3AG3E 3AG1E 2EIKE 2EINE 3AG4E 5B1BE 3WG7E 3ABKE 3ABLE 5B3SE 2Y69E 1OCZE 1V54E 3ASOE 2EIJE 2OCCE 5B1AE 3AG2E 2EIME 3ABME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL E;  2DYR E;  1OCO E;  1V55 E;  2ZXW E;  3ASN E;  1OCC E;  3X2Q E;  2DYS E;  5IY5 E;  1OCR E;  3AG3 E;  3AG1 E;  2EIK E;  2EIN E;  3AG4 E;  5B1B E;  3WG7 E;  3ABK E;  3ABL E;  5B3S E;  2Y69 E;  1OCZ E;  1V54 E;  3ASO E;  2EIJ E;  2OCC E;  5B1A E;  3AG2 E;  2EIM E;  3ABM E; 
#chains in the Genus database with same CATH topology
 1S0P A;  3EIQ C;  4GA2 A;  3CLJ A;  1H0A A;  2XPY A;  4PUC A;  4LUN U;  4XZ4 A;  3CR3 A;  2AXU A;  3TAX A;  4G26 A;  3KEZ A;  1HU3 A;  1OXJ A;  5AYW D;  3QNK A;  5CRV A;  4YVQ C;  2ZU6 B;  5AQ9 A;  1JCQ A;  4G11 A;  4ACK A;  1MJ0 A;  5FQ4 A;  1UW4 B;  2DYS E;  1WDY A;  2MRI A;  2OEV A;  3HYM B;  3DST A;  1MX4 A;  1TNZ A;  1E90 A;  5HS0 A;  3SFZ A;  3CIA A;  3PNT B;  4APO A;  4WND A;  4B89 A;  2VTB A;  4NIK A;  3UKU G;  4B94 A;  5LCW C;  3ESK A;  4GZ6 A;  3HIZ A;  3PS6 A;  3WG7 E;  2M63 A;  3ZUV B;  5HI7 A;  3T5X A;  5ARG A;  4FLB A;  4JEU A;  3LY7 A;  3IKO B;  3JUE A;  4G23 A;  1E96 B;  3ASO E;  3SHF A;  2VTB B;  4CDM A;  4F53 A;  3PRZ A;  3FUF A;  2X6J A;  4H7Y A;  2VSY A;  2X6F A;  1OWM A;  3TWT A;  3TWQ A;  1MHQ A;  1TNO A;  4U63 A;  3JUI A;  3TWU A;  4WWN A;  4ANV A;  2XGO A;  1JPL A;  4F7A A;  4G24 A;  4A3V A;  2HO1 A;  5D66 A;  4PS7 A;  3T9K A;  4AOF A;  3IXE A;  4GYO A;  3EU5 A;  1QQE A;  4QQI A;  4U96 D;  3DRA A;  5KNH D;  3MV3 B;  4B0Z A;  5AEN A;  3ZEF A;  3OAW A;  3Q5M A;  1A17 A;  1OY3 D;  1SQM A;  4N2Q A;  1E8Z A;  2OOE A;  3CVN A;  5AQ7 A;  3ZHE B;  2XCC A;  4I1M A;  4GCN A;  4HRL A;  3L08 A;  2MOW A;  5JJ7 A;  1H19 A;  3D9M A;  2P9P G;  4U8V D;  1HG5 A;  3MKQ B;  3PEU B;  4HNA D;  3AG3 E;  1FVH A;  1Y8M A;  4UQY A;  5G05 C;  4HXI A;  2PQN A;  3RJV A;  4FAD A;  2J9Q A;  3S7D A;  3JQ0 A;  3ZHE A;  5FTP A;  1X5B A;  3DXM G;  2IFU A;  1JWF A;  2ETA A;  4YND A;  4HOT A;  4GTR A;  3CVX A;  4Y6W A;  2GRL A;  1N4Q A;  2WMO A;  5AJL A;  5JMN D;  1JUQ A;  3Q79 A;  2XEE A;  4GTP A;  3CVY A;  1IQR A;  3FTY A;  2WXI A;  4DJA A;  3RO2 A;  3S7F A;  3ZRH A;  1MX6 A;  1X81 A;  2QYU A;  1OCR E;  4FHJ A;  4I2W A;  3G2S A;  1TN7 A;  5AIJ A;  3EIJ A;  5M72 A;  3RRU A;  2R17 C;  1MQS A;  2P9U G;  4L7T A;  4RG9 A;  1RW2 A;  3UXG A;  3LJ3 A;  3ULY A;  3APD A;  4XIF A;  1UJJ A;  2B0O E;  3B13 A;  4RG6 A;  3LY9 A;  3QB2 A;  5AN8 A;  3D9K A;  1H2U A;  4GB9 A;  4KBQ A;  4BTA A;  2NYJ A;  2WMN A;  4KVO A;  3VTX A;  1PC2 A;  2X6I A;  3APF A;  2X38 A;  1E7U A;  2LXM A;  3PRE A;  3TG4 A;  1S64 A;  1QNF A;  3TJP A;  4DUI A;  1IYG A;  3EHM A;  4DX2 A;  3W9F A;  3JCK C;  4GAA A;  1BLX B;  5EID A;  3PZ3 A;  4IN3 B;  4N2S A;  2Y0B G;  2WXF A;  4WNE A;  5E75 A;  4ME2 A;  1UOH A;  4Q94 A;  4XEI G;  1DNP A;  4KVM A;  2XGS A;  2BED A;  2ZGD A;  4G25 A;  4HI8 A;  1BI8 B;  3FUI A;  1BI7 B;  1KPS B;  3LVR E;  1HFA A;  4I17 A;  1N4P A;  2XEV A;  3ONK A;  5G55 A;  4JHJ A;  1LF8 A;  5ANL A;  3VLD A;  1WM5 A;  3L16 A;  4HB5 A;  2P9K G;  3LYA A;  2KCK A;  3FUL A;  1OWL A;  1UG3 A;  3UIN C;  1Z3Y A;  3SBT B;  3KS2 A;  3B7U X;  3SFX A;  3OXF A;  3I4G A;  3MEK A;  5CMW A;  3PZ2 A;  3D3M A;  5LP0 A;  4EQF A;  5CCL A;  2CG2 A;  4UUC A;  4I43 A;  2IOL A;  2DBA A;  3ABK E;  4UI9 C;  5EKQ D;  2AVP A;  4E85 A;  2LUH A;  3RO3 A;  2AXZ A;  4JA7 A;  2WB2 A;  4K5C A;  2WXN A;  4K5B A;  5D0O D;  3AS4 A;  3QAQ A;  3ZYQ A;  1LD8 A;  1N95 A;  2ZIS A;  2VGE A;  4JVS A;  1ELK A;  3CHO A;  4R7L A;  4UWH A;  3E33 A;  1XGW A;  1YA0 A;  5D2M C;  3NQP A;  2H6F A;  3CK7 A;  3NOG D;  4UWG A;  3ULQ A;  5CRU A;  2KBX A;  4F1S A;  4HOR A;  1N0Q A;  3OTN A;  1N0R A;  3FUE A;  2I1K A;  3FUJ A;  3Q9U C;  3DEO A;  2JLB A;  3Q78 A;  2XPI A;  2F0Y A;  3IHY A;  3Q49 B;  5BV1 A;  4GTO A;  4MKT A;  2KCL A;  1NA3 A;  3R9A B;  2RFA A;  1HG2 A;  3QAR A;  1S63 A;  4C48 B;  5E76 A;  4DX5 D;  3CQC B;  1TNB A;  3S7J A;  5CEC B;  3PNL B;  3OXG A;  4FJY A;  4I6J A;  5LOZ A;  2JEK A;  3MKR A;  3EU9 A;  3TGO A;  3UMV A;  3OXL A;  1INZ A;  5FWQ A;  3LDZ A;  4K0R A;  5BXU A;  5ENS D;  5BPP A;  2EIN E;  3PE4 A;  2I1J A;  4RVB A;  3GZS A;  4CGW A;  4FHK A;  3ZXS A;  2AJA A;  2J09 A;  3J5P A;  2XRY A;  3O4Z A;  3ABM E;  2V5F A;  5FQ6 A;  4CRW A;  1XNF A;  2A5E A;  2CFU A;  3D9O A;  2ETC A;  2CHX A;  2WM9 A;  3IBE A;  4GZC A;  2WVI A;  2LXL A;  4BSZ B;  1TJC A;  4AVX A;  2WXM A;  3FWV A;  3ZNG A;  2IJG X;  3FH5 A;  4UWK A;  3ULE G;  3DPY A;  2X6H A;  4U7E B;  4AEZ C;  4OAU C;  4J0U A;  3D9L A;  3BG1 B;  4D10 C;  5ENO D;  4LER A;  1DVP A;  1FT1 A;  5B3S E;  1JWG A;  3NZS A;  4I6G A;  3DBS A;  3MKQ A;  4LSZ E;  2IOS A;  4I1O B;  3UM0 A;  3GZ1 A;  1O5M A;  3E30 A;  4GZD A;  2UY1 B;  4XX5 A;  3UM1 A;  5KJK A;  2DWZ A;  5JJ6 A;  4HLE A;  2WQH A;  5T3R A;  4CT0 A;  4AIF A;  1SZ9 A;  3URZ A;  4BX9 A;  5CBN A;  1K1A A;  4KXK B;  2H6G A;  4GYW A;  2CHW A;  4X8Q A;  2H6I A;  3SNX A;  2WXR A;  3Q4A B;  4TUM A;  1WG0 A;  3PEV B;  3FUM A;  3HXB A;  3HXF A;  4DX7 D;  3DSS A;  4EBA A;  1HO8 A;  3MYV A;  1HE8 A;  4LNU D;  2WPV A;  3RK6 A;  4L9P A;  2P9S G;  1E8X A;  5J90 A;  2ZGG A;  3UKR G;  5ENP D;  4G8K A;  4GTV A;  1OCC E;  3C3O A;  3NB2 A;  1ELW A;  4PS3 A;  3UI2 A;  2HR2 A;  4I6E A;  2QFC A;  4JZY A;  3I5P A;  1N4S A;  1O1S A;  2PZI A;  5BV0 A;  3UQ3 A;  2P9I G;  4Q96 A;  1JCS A;  3SY2 A;  4F3V A;  1LD7 A;  4EEC A;  2OEW A;  2YHE A;  2EIK E;  1D9S A;  4J8F A;  4PS8 A;  5CMY A;  2VSX E;  3ZYK A;  4GU5 A;  1H6K A;  5EYL A;  1TR4 A;  4LNB A;  2DVW A;  4MBG A;  2LSU A;  3DSW A;  1QZ2 A;  2C2L A;  3P1U A;  1HZ4 A;  3CGH A;  2QY7 A;  2XS1 A;  4WWP A;  3G2V A;  3DXK G;  1Z3X A;  2RKK A;  3U3W A;  2BKG A;  4AM9 A;  1S70 B;  2RD0 A;  2R5S A;  4ILH B;  1KZO A;  3QWP A;  3LEW A;  3VLE A;  1D8D A;  5G04 C;  5A6C A;  1TYQ G;  1IQU A;  4Q69 A;  2YIN A;  4JA9 A;  2GRO B;  2XGM A;  4FJZ A;  3L54 A;  4BEP A;  2V4L A;  1Y6I A;  4HFG A;  2KM4 A;  4J8E A;  4U8Y D;  1KT1 A;  5CHE E;  2MYO A;  3KD7 A;  3V31 A;  4BSX A;  3ONL A;  3HXE A;  4ABN A;  5EX3 A;  4EZL A;  3L13 A;  4TXP A;  4KMO A;  4FC8 A;  5HRY A;  4O60 A;  2ION A;  4XI0 A;  4AY6 A;  1A5E A;  3U9W A;  4KZ0 A;  1HXI A;  2Y69 E;  3FDH A;  3NAW A;  3RAU A;  2F8Y A;  3E32 A;  4ANX A;  2I6H A;  1P5Q A;  3TWV A;  5G2N A;  4KZC A;  4O1O A;  4DK5 A;  3ZU7 B;  1EF1 C;  4ATZ D;  3P2B A;  3C72 A;  1OWN A;  1UN9 A;  3FY4 A;  2I2O A;  3LJN A;  2DIW A;  2PL2 A;  1N94 A;  2RG8 A;  1SVX A;  3EHN A;  3UUX A;  3CQG B;  1QBQ A;  5CED B;  4EZK A;  3ZXP A;  1Z6T A;  5B1B E;  4BY6 A;  4FP7 A;  5BUZ A;  3RRN B;  4Y6C A;  4YVO A;  3FEX A;  3R9M A;  3PUJ A;  3SD5 A;  4FA6 A;  1MYO A;  1FVF A;  3HG0 D;  3X2Q E;  5HQ8 A;  4U95 D;  4K5A B;  3FH7 A;  2ETB A;  2B6C A;  1DC2 A;  4L2L A;  3PH0 C;  4I2Z A;  3FUN A;  4LCT A;  5DIZ A;  3MX3 A;  5B1A E;  4GA0 A;  4NUR A;  4U0U A;  3FTS A;  3PZ1 A;  1E8W A;  3ASF A;  3MA5 A;  1YCS B;  3E37 A;  4ZFH A;  3SZ7 A;  2FO7 A;  3NOC D;  1AP7 A;  3U66 A;  3RRM B;  1SW6 A;  4ATG A;  4U04 A;  4EPZ A;  2WQ6 A;  1OWO A;  3N71 A;  2OCC E;  3Q7F A;  1W3B A;  2EIM E;  3D9H A;  4TXQ A;  2DYR E;  4GPK A;  3FTU A;  4ZHB A;  2V5Q C;  3ESL A;  1JCR A;  2Y1L E;  4J8S A;  3FTZ A;  2J07 A;  3MGB A;  3ML9 A;  2L6J A;  3BUA A;  3CHM A;  4JPS A;  4JD2 G;  3QWW A;  2XRZ A;  2VGY A;  2EIL E;  5J08 A;  2GRM A;  1OT8 A;  4DI4 A;  2IF4 A;  1HS6 A;  5LCW J;  3T8K A;  2P58 C;  2XPZ A;  3U64 A;  3Q7A A;  2WXH A;  3ZN3 A;  1AWC B;  1KLX A;  2PM6 A;  4CDN A;  3PVL A;  2KC7 A;  2EQX A;  3Q47 B;  1IKN D;  1IHB A;  2XHE A;  2WXO A;  4KYO B;  3V2X A;  2ILR A;  5KJL A;  4GA1 A;  1HF8 A;  3EDT B;  2F8X K;  4LRZ A;  5ENN A;  4N5Q A;  3FHE A;  1WAO 1;  1QYM A;  1DCE A;  1BD8 A;  2QZA A;  3FEY A;  2J8S D;  2J4D A;  4ILG A;  2XQ0 A;  4ANU A;  3S2A A;  1E8Y A;  4TV3 A;  1TJF A;  5AAO A;  2F37 A;  2VQ2 A;  3QC1 A;  2P2C P;  2HE0 A;  3VTY A;  5CBO A;  3FTW A;  3J5Q B;  4AV7 A;  3UT4 A;  1NI1 A;  1SA4 A;  2WXK A;  4K03 A;  4FUL A;  2XZD G;  1IHG A;  4F6R D;  3AJI A;  5G05 J;  3B7S A;  2VYI A;  2L0T B;  3JYS A;  3SGH A;  3AAA C;  3L6A A;  5LX8 A;  5EIL A;  3JXJ A;  4H7X A;  4TUU A;  4QFV A;  5JHB A;  2R03 A;  4TXR A;  5ENR D;  2VGX B;  4B8A A;  2IY0 C;  5C1D A;  3LXU X;  3E34 A;  4F1P A;  4BER A;  3FTX A;  4ACL A;  1D8E A;  4HOQ A;  3D9I A;  4RLY A;  3HXC A;  4DX6 D;  4HQD A;  2AXV A;  4BT8 A;  1N54 A;  3C5R A;  4A63 B;  3MJW A;  2HM8 A;  3ZIM A;  3LS8 A;  4GTS A;  5HKP A;  2BUG A;  1Q2Z A;  5H7P A;  4PDX A;  2BKK B;  2E0I A;  1H2T C;  4UWF A;  1K3Z D;  2OVB A;  4URK A;  4N3C A;  2KXP C;  4OAV B;  2KZT A;  1OCZ E;  4OYS A;  2J49 A;  2XEH A;  2Y3A A;  4C9B B;  2YQ8 A;  1O1R A;  4GZ3 A;  1IXV A;  1N52 A;  2LAI A;  5ARF A;  4HVB A;  4RSY A;  3SBS A;  2BTD A;  4CDR A;  5BT1 A;  3KAE A;  1H2V C;  2R02 A;  4DX1 A;  3GYZ A;  2KZT B;  2OV8 A;  3TXM A;  1NA0 A;  5FJY A;  3B95 A;  2LAH A;  4OVU A;  4HI9 A;  3V2O A;  4CYM D;  2XS8 A;  3U4T A;  4M7C A;  4TRQ A;  1ZBP A;  3CVV A;  2I9C A;  4V3I A;  3IV0 A;  4N3A A;  4W9R A;  4BET A;  3ZYM A;  1N4R A;  3CHR A;  1WY6 A;  5FT9 A;  3HHM A;  2Q7F A;  5JJT A;  3EHR A;  3EUV A;  3AU5 A;  3FU6 A;  4DLQ A;  5AJD A;  3SFY A;  5ITZ F;  3UPV A;  5T8I A;  2X6K A;  4IUL A;  4GPM A;  5BW8 C;  4J8D A;  4AP2 A;  3AG4 E;  3UT7 A;  3ABL E;  3NF1 A;  4DPR A;  3RSE G;  4U0Z A;  3CV0 A;  4GTQ A;  2IQC A;  3AU4 A;  1OUV A;  3ENE A;  3APC A;  5FQ7 A;  2YNQ A;  4RQI A;  1RZ4 A;  2DCP A;  1FT2 A;  2WXJ A;  5A7D B;  2DZN A;  1V55 E;  3I4R B;  1N11 A;  3CHP A;  3FU0 A;  1LTX A;  3KEA A;  1ZU2 A;  2XCB A;  3UTM A;  4U8H A;  3BEE A;  1NZN A;  1NFI E;  3EJN A;  4M3O A;  4G2V A;  3D9P A;  4KT6 B;  3ZVV A;  1B89 A;  1BPO A;  2P9N G;  1SZA A;  2IEJ A;  3RKV A;  4UWL A;  4GCO A;  3C98 A;  3PDN A;  3C3Q A;  3CK9 A;  4BX8 A;  2UWJ G;  3CVL A;  1NP7 A;  2CHZ A;  3R7Q A;  3C3R A;  4L2Y A;  3TXN A;  4GTT A;  4C0E A;  1H6P A;  3EHQ A;  2ZXW E;  2KCV A;  4G8L A;  4Z68 A;  3ZFW A;  3Q73 A;  3DWL G;  1L5J A;  3CST A;  4I9C A;  4U07 A;  5EN5 D;  2FI7 A;  3SQV A;  1K8K G;  1O1T A;  5EYP F;  3O48 A;  3F6Q A;  3IHV A;  4LEU A;  3I3N A;  5FQ8 A;  3FP3 A;  3QWV A;  3Q9N C;  5BNW A;  3ZW3 A;  1E7V A;  5KWD A;  3SF4 A;  4J6I A;  3MCX A;  1OWP A;  4JHR A;  2WXQ A;  2V0P A;  2FF4 A;  2JAB A;  3FUD A;  4IYP A;  3K9I A;  4PH4 B;  4O6F A;  2VSO E;  1DCQ A;  3FH8 A;  4OVV A;  5D0Q D;  3LPZ A;  1K1B A;  1PY1 A;  1OCO E;  4JW1 A;  3CHQ A;  4JB8 P;  1EDU A;  4XI9 A;  2V8S E;  1U3C A;  5CCM A;  3TG5 A;  1G3N B;  3CSF A;  1MZC A;  1U2V G;  3DPD A;  1TNU A;  1EPU A;  1N9A A;  4NRH B;  4HS2 A;  4B93 B;  4YDW A;  4WAF A;  5IY5 E;  4AXH A;  4LG6 A;  3CVU A;  4UI9 J;  5ENQ D;  3BG0 B;  3HVE A;  4ILI A;  2LO6 A;  1FCH A;  4FLH A;  5FZR A;  4GML A;  5ENT D;  4AY5 A;  3DSU A;  4CCA A;  3ASD A;  4N3B A;  4EZJ A;  5EX0 A;  2VJ8 A;  3V79 K;  3PZD A;  5LFA A;  2P9L G;  3G2U A;  3ZGQ A;  4AJW A;  3ZKJ A;  4GMR A;  3CHS A;  2NC9 A;  3SO8 A;  2VGX A;  3JXI A;  3UM3 A;  2IU1 A;  2WXG A;  2CFZ A;  5BXO A;  2E2E A;  3FUK A;  4CZ2 D;  3BQO A;  3FFL A;  3CKB A;  2FUL A;  2GGF A;  3L17 A;  4L23 A;  2YHC A;  3CEQ A;  3HXD A;  1Z5S C;  1H6O A;  3LCA A;  3TWX A;  4XKB A;  3L22 A;  4J8Y A;  5G04 J;  3IEG A;  3G2W A;  2NSZ A;  3LY8 A;  2J08 A;  2R2L A;  4UQZ A;  4DRX E;  1HX8 A;  2PM7 A;  1FPP A;  2OVF A;  3DEP A;  2R59 A;  4L1B A;  1TEZ A;  3HVE B;  3HRA A;  2FBN A;  1HH8 A;  2XEN A;  4CGV A;  4FU3 A;  3W9G A;  4JHK A;  5KJM A;  3QK0 A;  3PZ4 A;  1BU9 A;  3AS5 A;  4JEH A;  4UI9 K;  5A23 A;  3KSQ A;  4A1G A;  4A55 A;  4EHM A;  3UIO C;  3MV2 B;  3BU8 A;  2IO2 C;  4C0M A;  2IO3 C;  5FZS A;  4MS6 A;  3KSL A;  4HLL A;  3E4B A;  4YDO A;  2H6H A;  4NQ0 A;  3ZYL A;  2J4B A;  4CEM A;  3TWW A;  3TWS A;  5AAR A;  1UN8 A;  2MHK A;  2L0I A;  3WXX A;  4YDY A;  4APF A;  2WQ7 A;  3UIP C;  2GRN B;  3AG1 E;  5C2Y A;  1PAQ A;  3PE3 A;  4GTM A;  2CG3 A;  4G1T A;  5KCM A;  2Y4T A;  1KT0 A;  1GW6 A;  3B7B A;  3PUK A;  3AG2 E;  2LSV A;  4MRU A;  3JQ1 A;  4IRU A;  3RU0 A;  5KBA A;  3B7T A;  3LVQ E;  2L9B A;  3SI5 A;  2Y4U A;  4GMJ A;  4N5C A;  3RIB A;  2OND A;  5T4Y A;  3T5V A;  2GW1 A;  2QYJ A;  5JA4 D;  2EIJ E;  3TWR A;  3HDX A;  5KJN A;  2A5U A;  4JXT A;  3UM2 A;  2VSN A;  4HRN A;  2A4Z A;  3LKU A;  3GZ2 A;  2V4H C;  4JL0 A;  3CVP A;  4EBA G;  2UY1 A;  2L6B A;  3CVW A;  3NZU A;  2PNN A;  2GRQ B;  5AQA A;  3CVQ A;  5FZQ A;  4U0S A;  2R05 A;  3FU5 A;  3G2T A;  4BT9 A;  4O1P A;  4P29 A;  4NAC A;  4ANW A;  2GRR B;  1YYH A;  4HBD A;  4HRM B;  5DBK A;  3R7R A;  3GW4 A;  2WXL A;  4A3T A;  5FIN A;  3FTV A;  2KAT A;  3CKC A;  1NL4 A;  5CEA A;  4A1S A;  1UJK A;  4WWO A;  2FO1 E;  4I9E A;  5EIB E;  2RFM A;  4LNG A;  4GZ5 A;  4CT4 A;  4JC8 A;  2QC9 A;  3MZL B;  2FEZ A;  3L9T A;  4GYY A;  2ZIR A;  5FIO A;  3FUH A;  5KNG A;  1VDY A;  2GRP B;  2DZO A;  3ASN E;  2X3M A;  3UT8 A;  1TN6 A;  4YDE A;  5ANR A;  3ISM C;  4E6H A;  3L82 A;  3Q15 A;  3TL5 A;  3ZPJ A;  3B7R L;  4UQX A;  2LNI A;  1V54 E;  1MX2 A;  1KZP A;  2C0L A;  4HOS A;  3FU3 A;  3D9N A;  3AS8 A;  3QDN A;  2AWI A;  2C0M A;  1YMP A;  4BWR A;  4WUY A;  3QKY A;  1SA5 A;  2NXP A;  3ASH A;  3ASG A;  3ML8 A;  4B8C B;  2BF0 X;  3UX4 A;  5JHA A;  3D9J A;  3V30 A;  4N39 A;  4BFR A;  3Q75 A;  4WNG A;  4J7W A;  1EYH A;  3DSV A;  4WNF A;  3NBN B;  3S7B A;  3T8M A;  3VLF A;  4DI3 A;  3QOU A;  1ZB1 A;  4XKC A;  2WXP A;  2PQR A;  4BTB A;  2XZT G;  5EDS A;  3CK8 A;  3QJZ A;  4BES A;  4I1A A;  4XE0 A;  1ELR A;  2AW6 A;  5AQB A;  1U3D A;  3DSX A;  4MLP A;  4HOU A;  2HYZ A;  1TN8 A;  4DLO A;  1TNY A;  5CER B; 
#chains in the Genus database with same CATH homology
 2EIL E;  2DYR E;  1OCO E;  1V55 E;  2ZXW E;  3ASN E;  1OCC E;  3X2Q E;  2DYS E;  5IY5 E;  1OCR E;  3AG3 E;  3AG1 E;  2EIK E;  2EIN E;  3AG4 E;  5B1B E;  3WG7 E;  3ABK E;  3ABL E;  5B3S E;  2Y69 E;  1OCZ E;  1V54 E;  3ASO E;  2EIJ E;  2OCC E;  5B1A E;  3AG2 E;  2EIM E;  3ABM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...