2EILH

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eilH00
2Y69H 1V55H 3X2QH 3ABLH 5IY5H 1OCCH 3AG4H 2EILH 3ASOH 2EINH 5B3SH 3ABKH 3ABMH 3ASNH 3AG1H 1V54H 2EIJH 2EIKH 1OCZH 2DYSH 3AG3H 5B1AH 2OCCH 3AG2H 3WG7H 2ZXWH 2EIMH 1OCOH 1OCRH 5B1BH 2DYRH
chains in the Genus database with same CATH superfamily
2BHZA 1Y39A 2XRLA 4QPOA 2DPDA 3S8PA 3HOTA 4Z6YA 4PSXA 1SC7A 3IAM2 5F08A 1RESA 4BU2A 2F5EA 3RKXA 4P1WA 2A6TA 4K2EA 5M3FJ 4YELA 3OV8A 4N9IA 5EZGA 3RCOA 4G7HF 4A12A 2NOJB 1JHFA 1T33A 3OYLA 4W97A 2X1DA 4C2UA 1Y8QB 5DS9A 1Y1VJ 4G8XA 2WV1A 2YX7A 3ERMA 1SVMA 2LDUA 4D9JA 1R5ID 1VQOI 3S1NJ 4JBAA 2DN0A 4IHVA 1WJFA 3BWGA 3TEDA 2NVTJ 3KP3A 3OOPA 4PGHA 1IC8A 3LAPA 1RETA 3IHUA 4AD9A 3W2VA 4EEFG 1TWCJ 1FTZA 4FCYA 2HFHA 3JSOA 2ICWG 2PG4A 3W6JB 2A3SA 2LMDA 1Q1VA 4IL6C 2IT0A 1AWCA 3G2BA 4I09A 4XKCA 4ZDPA 4M9SA 4C30A 1JUSA 2XAUA 1P6RA 4RGRA 2KKOA 5LGUA 3IH4A 3CMEI 1Z91A 1OCOH 3O6BB 2QBYA 4UVCA 1EA3A 4LD5A 5J4VA 1QVUA 1XMAA 3ABLH 1APLC 3CDLA 4GO1A 2HWVA 4S0HB 1Z67A 5DUKA 3ZR8X 5C44J 1DGWY 2W24A 2NXNB 5KAIC 3H9GA 1JKQC 4OAZA 4DW6A 1RC9A 3HEFA 2A6HF 4ENMA 2JN6A 4ZYHA 3OYNA 3ML6A 4G7ZF 1HW5A 5E1XA 2ZNZA 4UUTA 2ECBA 1FSHA 2XB5A 3BG9A 2ZCWA 5H2FC 2I5UA 1V5GA 3S1RJ 1Y6IA 4XLFA 4YIFA 3W6VA 1J0RA 1V4RA 1D3YA 3WG7H 3HKZA 2P5LC 4HW0A 2FX0A 1XGOA 2EIMH 4V2GA 2E36A 3FK6A 3WHBA 3WTSC 2LKSA 1NK3P 3W2AA 2EWNA 3PIPF 3RPUD 3PM1A 3I9V2 2Q0OA 4PJMA 2EQRA 2I10A 3J7AO 2W57A 1D1CA 1S7AA 2Y2ZA 4ITVA 4DBRA 1DDNA 4BQNA 2JA6J 3O3KA 3FX3A 2EFPA 1BJZA 4QLCU 1FYLA 1U2WA 1VZ0A 5EG0B 1LQ1A 1LE8B 1OLTA 3M8FA 3LQRA 2L7KA 1F9NA 1Y0UA 2VKHA 3OMYA 2FSWA 3K4KA 1GV2A 4OAYA 4WK8F 2BY2A 1T0FC 2HS5A 3C7JA 4LG3A 4XNFA 3CMYA 2H6BA 2F4IA 4I76A 4MQ9F 2LP0A 1ODDA 1U5TB 2HYGD 2LF7A 1SVOA 5L3CA 3S3MA 3HL2A 1PP7U 2CFXA 3GLLA 3L2RA 1BI2A 2BVLA 1NG6A 4FISA 2YU9J 3K70D 3ECHA 3K4NA 3U1DA 3H0GJ 1TC3C 2X9DA 1ULYA 4XRSA 3LSKA 1MDMB 5HDGA 2HQNA 4E6KG 1VQ7I 1ETYA 1KU7A 1O3TA 1U3EM 3GTPJ 5LHGA 4RB3C 4PFPA 3CDIA 1G8XA 4XLPF 1YOVB 3FF5A 2DAOA 3RKYA 2FNPA 3E0JB 3P9KA 4CHUA 1XCVA 4HEA2 4G6DA 1HXDA 4IRIA 5IT3A 5A2QZ 2A69F 3EYYA 2CV2A 5FJ8J 1X19A 2VJ5A 1X4PA 2BY3A 2ZB9A 1JHHA 4W1UA 2XB0X 1I1SA 1WH5A 4KISA 2UUZA 5M3MJ 3E6BA 3Q0WA 3QODA 2V6EA 1MNDA 3MWMA 3R6SA 2HYFA 1W36D 3JRIA 1E3PA 2DMTA 2FBHA 1MJBA 3H92A 3RJPA 5M5XJ 3IAS2 5IP6A 1CGPA 1HCRA 3OSFA 3VYTB 1QZZA 4HF1A 3FXRA 5E3OA 3MCZA 1DP3A 1BR2A 3HSFA 4B3XA 3FM3A 1MH3A 4RGXA 2KJCA 1BI1A 4LLGF 4UVBA 4ETSA 1ZQ3P 2NS0A 2M5WA 2CW8A 1OR7A 2X48A 3HTSB 3OR1C 4S04A 1YRNB 4UV8A 1FEXA 4A3GJ 3J81K 2H6CA 2LTPA 1S72I 1WZ2A 4XK4A 1J59A 3H5RA 2R5YB 4L9TA 3NRVA 1JKPC 2P6SA 1IN7A 4LG0A 1RUNA 4IRHA 3H3UA 5C4XJ 5J1UA 3WU0A 3IWFA 3LMMA 1EF4A 3FXMA 4MIMA 4NUBA 2O6GE 4ZTFA 3BT9A 1ZG1A 3HSEA 1DP7P 2DQRA 1S29A 3BOQA 2ZFUA 3K4BA 3M1EA 2ZFWA 4QWQA 4D7NA 5HS9A 1SFKA 3FXQA 2DCEA 3I59A 3ZMZA 1J5YA 1B72B 2JRTA 2EBIA 1XSXA 2M3AA 3DKYA 2VQCA 4DIQA 2JJ7A 3PO2J 4NQWB 2IGOA 4CCMA 3HJEA 3LA7A 2L01A 1YQAA 4RAGA 1TWAJ 2VQHA 3DWLE 1UFMA 4UB8C 1K61A 1TWFJ 2ME0A 5H6QA 3AG2H 9ANTA 5HOOA 2XAFA 3IC7A 4LK0F 1U0JA 3GTQJ 1HSTA 1Z0XA 1OCRH 2P81A 4G6TB 3QQAA 2L4MA 3F8FA 4XLEA 4UXNA 1YITI 5AIQA 3Q0UA 2IGMA 2HNHA 2MABA 1D5YA 4GDFA 1PUFA 4UUVA 4XONA 1FIPA 4FETA 1ZLJA 1B1BA 3WHCA 4O6JA 2HKOA 2IEKA 5FKNA 3W2WA 2QKMB 2IA1A 3OYCA 2CU7A 1HSJA 1B6AA 2BY1A 3ABUA 4M74A 1YYVA 3A2KA 1B9MA 2RGVA 5J1YA 1XSVA 4BH9A 3WG9A 4XN3A 3F8BA 1ENHA 1SAUA 2EPFA 2W00A 3DQVC 3CO6C 2HPIA 2DYRH 3B73A 1FBQA 3I4PA 4X1EA 4IHTA 4TV7A 3V7CA 1MBHA 2HDDA 4B4CA 2GXAA 2CGPA 4BNCA 1W7PA 3PNTA 5EJCA 2ZXIA 5TRDA 3T1BA 4EJWA 1I1GA 2Q8KA 3DTIA 1FOWA 1RKTA 5E79C 3RQIA 4E7IA 2IAIA 3RYRA 1I50J 3PUBA 1LFBA 2XPVA 1YG2A 3HGYA 3SFIA 1R6RA 1IO2A 1E2XA 1UCRA 2DA4A 2ZMEA 1RUOA 4PDKA 2ZSIB 3DV8A 4N4OB 1P7JA 4HX8A 1YS6A 2LC2A 1KQ8A 2B63J 1ZRCA 3QWLA 2IA2A 3A01B 3BTCA 3K4MA 2DODA 2P4WA 4A3LJ 4KUMA 3MAJA 1TT0A 4L9JA 2EZLA 5ICGA 3ZQHA 5J3LA 1I6XA 4HQEA 1MNMC 3LQQA 1Z05A 2O7OA 4NC6A 2W4SA 3RSNA 1ZH5A 2STTA 1FJLA 3SZTA 3TDZC 4G94A 2GQQA 2DW4A 3GUDA 2R7WA 2P6TA 1MMDA 2E5ZA 2CRGA 2BXYA 3LSMA 3QYFA 1FOXA 2R7XA 2P5KA 1OCCH 3ERED 1REPC 4KFCA 3FBNB 2EILH 3KIOA 5DCMA 2MD5A 1XDSA 4MEXF 3HDDA 3LSPA 3QPHA 2N8GA 2MW8A 2W85A 5K7HA 2ELKA 3OS1A 1MMAA 1N78A 1O3RA 2LD5A 4L18B 1SD6A 4C3HJ 1RZ4A 2EFWA 1K6OA 3ZMVA 2K86A 3OYFA 2PMZN 2OU2A 1P4AA 3RPUA 3IUOA 3R0JA 3E5XA 2VBZA 3I64A 1LDKB 4UUSA 4KYWA 4F3QA 4C2TA 3CCJI 3C18A 4D1QA 5FRNA 2V9KA 4HNUA 2DOFA 2X6XA 2QGUA 4A69C 1ERDA 3CLOA 2BW3B 3KP2A 4AWXB 2GZWA 2LFBA 1BW5A 3RI4A 2Y9ZA 2EIJH 1PDNC 1G59A 2DA3A 3I56I 4ZZLA 1U9OA 3Q9SA 1QVTA 1X1DA 1RIOH 1W0UA 4FHTA 1HW1A 1IRZA 3K4JA 4II2A 1AKHA 1OCPA 3BDDA 4A3FJ 2EFOA 2JZYA 3HOSA 1AA7A 3ECOA 3GTGJ 5F1RA 4A0ZA 2DU9A 3UR3C 2HQRA 2IGKA 4M3BA 4RDUA 3TO6A 1X1AA 2K7LA 3NQOA 3P5JA 3W6KB 4JOMA 2ZJPF 3NEUA 3CCMI 3D0SA 4CCNA 1MNEA 2ZJRF 1LFPA 4XLCA 3CUOA 2AXLA 2VLAA 2AO9A 2Y0SA 3BJOA 2A07F 2AQFA 3LWFA 2IPQX 2VJIA 1P7IA 2IP2A 4NC8A 4BQAA 3JREA 4KT6A 2B0LA 4PSWA 4EJOA 5IYCJ 4E7JA 3H9QA 3PNYA 4XM3A 2IS6A 2LYCA 3IV5A 4GGGA 4LLNA 4GXOA 1YO5C 5ERIA 4KIBA 5CVIA 4JX4A 2CFOA 3L7WA 3Q3SA 2DO7A 4CZCA 4ZTJA 1QO0D 1UHSA 4OIRF 1TP4A 2P5VA 2X1EA 4D0PA 4A3MJ 4DNCA 4EATA 2MA3A 4ZYDA 4BAYA 1W5SA 2Y69H 3K1MA 3QP5A 4KA4A 4YRVA 5C3EJ 5LD2C 2O0YA 3KP7A 4JP0A 1AOYA 1IV8A 1OYIA 1MJAA 2ID3A 3SDGA 3HOWJ 2RQQA 1GHCA 5IOZA 4BY1J 3F72A 1X3ZB 5LHIA 3HPHA 1IGNA 5K1YA 1L3LA 4L5JA 4EM1A 3JSPA 2MLGA 3KEOA 1S5LC 4PFOA 5EEGA 1XS9A 1H0MA 4RBOA 1WKMA 4M9XA 4R8HA 3LFUA 5GTIC 2IVMA 2GBYA 5DYMA 2KDZA 1BM9A 1TNTA 2EA2A 2MBFA 3MKLA 3KE2A 4LB6B 1UMQA 4G9YA 3TP0A 4FTHA 2KIFA 4YIRX 1WCMJ 2VIXA 1Q1HA 2KHMA 3CCYA 4RGSA 1VQKI 3ZQ7A 2ESNA 2R3SA 1EV7A 1MMNA 4I02A 3DCFA 1HDPA 1X1CA 1R4MB 3BZ6A 3FK7A 3C3WA 4B1RA 4DBQA 3BTIA 1VQ4I 1LE8A 2DYSH 2K85A 2VB6A 2E60A 4D5CA 2OTLI 2CQNA 1XC5A 3H36A 4OOIA 1LVAA 2BV6A 2DMNA 4BE2A 2LVSA 5K5OA 1V55H 4IOCF 1IDZA 1LVKA 2D1HA 1B9NA 4KIGA 4A0XA 4A2UA 2YX4A 5F0HA 2CO5A 2R7TA 5EDNA 3HYIA 2BY0A 4MEYF 5ICFA 2DFHA 2IW5A 4DQ2A 5HDNA 3RDIA 5JHUA 2WY8Q 4RLFA 2X6WA 4A3CJ 3IWZA 4CO8A 3QP6A 5GADJ 2V79A 2LH9A 3HRMA 4IVNA 2KRFA 1G6NA 2GAUA 4B43A 2GA2A 2BYVE 4AIKA 3KETA 1BOBA 1TWGJ 3HPGA 2QQAA 1HBXG 5F0FA 2KFDA 1XD7A 1PP8F 2M87A 2X6OA 3GFLA 2LLKA 3HRSA 2VE9A 1VFCA 3TQNA 1PVEA 4HDVA 3MMYB 1T39A 2EH3A 5F0CA 2CWEA 1MW7A 3LSHA 3V7RA 4M71A 3BG5A 2YPRA 1Z7UA 2E1MC 5LRRA 4U7BA 2EZHA 3CESA 4XSZF 5LLQA 1W4MA 5LFAA 2KP6A 2H1LA 3CQZJ 1X58A 2XGDA 4IHWA 1K78B 3H0DA 2AXTC 4BXUA 1OYYA 3GZNB 3G73A 3CMMA 4NNJA 4AYBA 2K27A 4PJNA 3MFKA 2XAHA 4A3BJ 2IGNA 2VT2A 5KHDA 1WI9A 4ASNA 1K4SA 2R4GA 1XDUA 1R1UA 4HBLA 4D7MA 3KEYA 4DGWB 1SEUA 3AAFA 2V1XA 5FD5A 2ESHA 2FEZA 1E3HA 4BE0A 5IYBJ 2JQ7A 1WVRA 3FKJA 1VQ5I 2PFBA 1FBSA 4LGWA 1ON1A 4CA0A 4OIOF 3CZ6A 4RLQA 2JA2A 3JTGA 5D5VB 3CCLI 3K0LA 2DOAA 2BZTA 5FROA 2RNJA 3DEWA 2X51A 3FKIJ 4PJJA 2IS4A 3FIWA 3VWBA 3ABTA 3DFGA 1W7PD 2ZKZA 2XHKA 3REOA 1LEBA 2ADUA 3GTKJ 1QPMA 1R23A 2CUJA 3MN2A 2HYJA 1FY7A 3CLQA 4YIIA 5D8KB 2XVCA 3L2WA 2VL8A 4ZYAA 2KDOA 4GCVA 3L2QA 3M4OJ 4AM3A 4R79A 1BI0A 5ED4A 2LY1A 4EQQA 1B72A 2KIMA 1F36A 1QGPA 2P8TA 3FMQA 4PCQA 4KIFA 4Q47A 4O3MA 3L00A 3EETA 5IT9K 2RV8A 3BQZA 1WJEA 1X2NA 3I55I 5E8GA 3HGGA 3SQNA 5B1AH 3DU6A 4A0YA 3ROUA 1TBXA 1I39A 5L3BA 2D45A 4EV0A 2VC1A 1I27A 1S7EA 3K4LA 2EA4A 2HPMA 3CUQC 3ZCOA 1TW3A 2UZKA 1XN7A 4HQMA 3MZYA 5D4SA 2UV1A 3DXJF 4YFXF 1YIJI 2EINH 2LBFB 2HVQA 2CUFA 2GM4A 3GTMJ 1TZLA 2E1CA 1IV6A 2LOOA 1TTYA 4XIDA 2LK2A 3K2ZA 5K7ZA 1F1ZA 3I5UA 5LEJA 4II3A 5K5RA 4A5MA 1STZA 4FT8A 2VKDA 3BLYA 2VKVA 3JR9A 2DPUA 2NVYJ 4L5IA 4XL9A 3V7SA 1TLHB 5JLXA 2Y9YA 1VQPI 1JI8A 1RR8C 2QA4I 4KMFA 4RS8A 1R5GA 4EGZA 5M5YJ 4V19K 2QUFA 2WAQA 5FO5A 4EGYA 1QBJA 2MGQA 1MGTA 4C9YA 3WGGA 4M72A 5FLMJ 2R7RA 1VQLI 4ZDLA 1ZLKA 1J7KA 1GLNA 2TDXA 4ENNA 2HVSA 4A3IJ 4M3DA 1G3YA 2CQKA 1OCTC 2RDPA 4CSWA 2K9NA 3KYDB 2PJRB 5BOXA 1MBKA 5GAGJ 2RAEA 2DK8A 1SFXA 3C2HA 1ZK8A 3E97A 5GPCA 2L7FP 3QPSA 3IH3A 3A02A 3UNGC 2OQGA 5C4JJ 4P9FA 4L0ZB 3M7GA 1IG7A 3K7AJ 3A0BC 1ETKA 4ZDOA 4HPQA 1J75A 3HM5A 2Z5UA 4HOBA 4HZFA 2XDVA 4RAZA 5EGOB 1QPIA 5E1ZB 2E1MB 1ZRFA 2DMUA 3GZ6A 3BQYA 4GYGA 4M6YA 3PJRA 3SZGA 3TO9A 1VI0A 2W25A 3OY9A 3U9GA 3SEQA 2F4OB 2KL4A 2E34A 3C2GA 3FXOA 1HDDC 1VQ6I 1ZYRF 3GTJJ 4JX5A 1HC8A 4IO9F 3X2QH 4IKFA 2J5PA 4RGUA 3VFZA 3HUGA 1YI2I 2VXDA 4OMYA 3OYMA 3AG4H 3K10A 3BZKA 4P96A 1D0ZA 1GV5A 3GFJA 3ZOBA 3GFMA 5EF6A 1YJ9I 2F5VA 1ZREA 1N77A 1GUUA 1F43A 4BXXJ 5FB2A 3WGHA 2MFZA 4CICA 1OPCA 4YG2F 5HS7A 6PAXA 2VPRA 3VYRB 2R5ZA 5DCFA 3OS2A 2DTZA 3C2BA 1P4XA 1ZGJA 2JUCA 4G7OF 2K5CA 4PUSA 3CMAI 4L9NA 1FTTA 1UG0A 3HIFA 1A6IA 4GFBA 1B8IA 2DBBA 2NS8A 5IP9J 1K4TA 4E4HA 2KMUA 1E0EA 2KIUA 3A4CA 2MYSA 1FZPB 2BW3A 5TGTA 1KQ0A 2XGCA 3TBIA 1BI3A 4U87A 4MNUA 3J80Z 1TWHJ 2B7EA 2HOEA 2V6CA 4CYCA 3CO7C 5KAFC 1WPKA 3DTKA 3VSKA 3F22A 2JVHA 4H0EA 3DBHB 1G4DA 3LA2A 4WXDA 2WBMA 1I5ZA 2JSPA 3ZMSA 3J7YJ 5J8CA 1R4NB 5LHHA 2ETHA 1RR7A 4U88A 3L1PA 4IQ4A 4CUGA 1H9TA 2KIQA 2W82A 2YR2A 2GIVA 1JKRC 3RZOJ 3HC7A 1FPQA 2P7CB 4AVZA 1K79A 1XGMA 2DFEA 3S16J 4CGZA 3SFZA 1BIAA 2NNNA 1BR4A 2OTJI 2EFNA 3O2PE 1JT6A 3CUQB 3G1MA 4U0WA 1H8AC 2DTRA 2JA5J 2QSGX 4A93J 4RA2A 1O7LA 4I6ZA 3BG3A 2HTJA 2H27A 4UB6C 4EVIA 1P4WA 4JK1X 5J8FA 3I53A 2ZSHB 2XROA 3WE2A 2FJ1A 4BJTA 3RKWA 5KK1A 4RMNA 3E5QA 1BIBA 1QZEA 3CC4I 1P2FA 3ZQQA 3FHZA 5DM7F 3EDPA 4HLXA 4MFEA 1RI7A 2EV0A 4IEJA 3S2DJ 1XSDA 2OPTA 2KQRA 2XPWA 2V4JC 3GBGA 2BBYA 5FKKA 3BC8A 3S3NA 2XF7A 1ZRDA 3BR3A 1YX3A 1BJAA 1Z6TA 3F23A 1DU6A 2WWYA 4A6DA 4A3EJ 1FC3A 1J9IA 3W3CA 2MLKA 1IZ1A 4PK4A 3GCMA 2FQ4A 3MQ0A 3GVAA 2XF5A 1O57A 1VNDA 5E18F 4J01A 2MSYA 1IN8A 4C2MJ 3DTEA 5E3MA 1D5VA 4CCOA 1OR7C 2ELHA 1R9TJ 1T2KA 1MBGA 3S3OA 1DPRA 1Z77A 4BKXA 3SZPA 3AFHA 4HX4A 4LLLA 2HDCA 4IHXA 3F8CA 5F1JA 2M8EA 3D5RC 4B48A 1E17A 3KP4A 3LSRA 5LRSA 1MMSA 4HG2A 1ZKGA 2QBYB 3E5UA 4HAMA 4BUPA 1CQTA 3F8MA 3WTUC 3GW2A 1R00A 2BEOA 2L4AA 2DJIA 2M34A 5D5UB 1IN6A 1ETVA 4BHPA 2LY9A 1HOMA 1VQ9I 2EIKH 5HLTA 4E7LA 3BCBA 4ESJA 4CCLA 3GF2A 4IHSA 2HZTA 3BR1A 3H5NA 3E6CC 1LPQA 1WJCA 3KZIC 1A6QA 5DD4A 4HYEA 3NARA 4OINF 4ENKA 1T6SA 5B1BH 3KYCB 4BDYA 2OA4A 1FSEA 5IT9Z 2IA0A 2LKPA 2QF7A 2VONA 2K9LA 3TOBA 2DA2A 2WC2A 2IS1A 3Q9VA 4JYKA 3SHFA 5J4YA 4XICA 4HNTA 3L2CA 2FMYA 2L5QA 4I01A 4M6XA 4HF0A 5F64A 2RKHA 3CP8A 1OQYA 1SD4A 2R7VA 5ICEA 1HQCA 3CC2I 1G3SA 3ONQA 2RREA 2H1KA 2O03A 1IF1A 2CMPA 1FP2A 3BROA 4F7ZA 4OIQF 2K40A 5IPAA 4F93B 5K5QA 4XKBA 1X3UA 4BDZA 1KU9A 1T56A 1N25A 3QU3A 5IY5H 3JW4A 3FXKA 2X1CA 2B9SA 2CQQA 4LJZF 5D4RA 4AUXA 1IN4A 1I3AA 4WCGA 3U21A 4CCKA 3AG3H 2R7DA 2Q1ZB 2JT1A 1BC8C 4HF2A 2DT6A 5K7FA 2XC7A 1LDJA 1OMIA 2XGXA 2GOMA 3P9IA 3PL8A 4NDLA 3VPRA 4X0GA 3R0AA 5EEHA 3VDXA 2ZMEC 4PJLA 1KQ9A 4BHBA 2VXZA 3QPTA 3S1MJ 5DDGA 2C6YA 2L3DA 2L54A 1NG7A 4XLHA 1FNNA 4IJAA 3G1OA 1EH6A 3DKWA 2VT3A 4XRFA 2H8RA 2A5WA 2OV7A 3K69A 4OWRB 4Y33A 2GA1A 1KA8A 3R60A 3G1LA 2V7FA 2R7ZJ 3S15J 1E3OC 3TOAA 2XAGA 3WTWC 3PNVA 5F27A 3LL7A 3DEEA 4BACA 1VQMI 2PI0A 1R22A 5L3FA 3N05A 2PBIA 5CJ9A 1FT9A 2Y48A 3TW6A 2E35A 1S8NA 4CH7A 3AKZA 3WTXC 3RKQA 1ZGWA 4HRIA 2VBXA 1KYZA 3ABKH 3HOZJ 3CJRB 3CJNA 3GO5A 3ZMDA 3FXJA 3KZYA 2WA0A 5FKLA 4BEHB 4BBSJ 1VTNC 1RNLA 4AIHA 4I98B 3KZZA 3EUHA 3RTRA 2MC4A 1LKXA 1IUFA 2M8GX 4A3JJ 3A1YA 3K2AA 3HHHA 2PJPA 3WE3A 3HTUA 5F04A 1H9GA 3S1QJ 1USSA 3FXLA 3CDHA 1MZBA 3OL3A 2X85A 3S93A 2VE8A 5ILSA 2DT5A 4PZJA 1C0WA 1QHHD 4LG0B 2VOPA 5TJJA 3VSLA 4ESFA 2ZXHA 4XLNF 4B09A 1JUMA 2XASA 3TO7A 1GDTA 3QOPA 3RYPA 3HSRA 5AIPA 1FP1D 1IXRC 2F5DA 2CG4A 1I3QJ 3SEZA 3GYHX 2M4KA 2F6CA 3WTTC 1IN5A 3RQ4A 5CVVA 5BMZA 1FMWA 4MGRA 4EM0B 1SVLA 3T8RA 3GEZA 5JHFA 4DYQA 2DJNA 2QENA 1ORKA 1WJAA 4LB5A 5FRMA 4ESBA 2KLOA 4P55A 2DA6A 3BZCA 1RKWA 5GAEJ 1WH7A 4G6QA 3OIOA 3K70C 4BQOA 2L9RA 1YFHA 3PQKA 3T5XA 5L3EA 2OCEA 3TDUC 2ME6A 2WAFA 4V2FA 4Y7NJ 2QEXI 2K3FA 5GP9A 2CYYA 3ULQB 3R4KA 3OYIA 3F6VA 5E17F 4PGGA 5BS6A 4ANJA 1KONA 1YTYA 4XKVA 5FKMA 2XRNA 1MD0A 1W1WE 3I71A 5EG0A 1HW2A 2PJRA 2JUGA 4JX6A 3LA3A 4KMUX 4A5NA 2CQXA 2HOTA 2OCCH 2DDBA 3J80K 2EFQA 2BGCA 2WAEA 1FYKA 4BBRJ 5FLXZ 3CCRI 1D8JA 4E70A 1JJ8C 4PJ0C 3PIOF 1GXQA 2K9MA 2JPBA 3PFIA 4XR6A 4IPAA 4A6EA 1Z1DA 2RNGA 1W36C 1U5TA 4MTEA 2DK5A 2F5FA 2VODA 4QPQA 2Q2EB 5EGOA 1JUPA 1S6LA 2AHQA 3FWEA 2ZO4A 4A3DJ 2NS7A 4IHYA 3H1CA 1JGGA 2IS2A 3NWSA 3K1PA 3RZDJ 3HHGA 3PSIA 2L2OA 2X6YA 2QKLB 2ZMEB 4NHJA 1MDMA 5CKTA 2BHYA 4HSTA 3JRDA 3P7NA 5D5XB 2O8KA 4L5EA 3IKVA 1BA5A 2WV0A 1TNSA 5CQGA 2OAZA 2ID6A 1WSUA 3PUFA 2W1OA 3OYDA 5KVRA 1KGSA 2ELJA 2DLLA 2KPMA 1RPWA 1V5EA 2JK3A 4IRGA 3FMSA 1U6GA 3HOYJ 2VASA 4C3JJ 3ZQIA 3KLOA 4FASD 1XMKA 1YW9A 2JTVA 2KZVA 1ZELA 1LUJB 3MZ8A 1EKEA 4ZJZA 5JI6A 4AC0A 2F4MB 3F3XA 2X4HA 1YJNI 1J09A 3DF8A 4LITA 4EMSA 3F6OA 1B59A 4FE7A 2EV6A 2VN2A 1K7AA 2QCOA 2XAQA 1U78A 5FGMA 1JTYA 1ETQA 1ZARA 2QYOA 3B6AA 2G7HA 3WU1B 4H4KC 3MVPA 4J19A 3S2HJ 1X4OA 4XMYA 3IL2A 1L0OC 4I0BA 1Y0NA 5IYDJ 3SJMA 5IP7J 5JLWA 2IRFG 3OYHA 2CV1A 1YRNA 3ZP5A 2WTEA 5JVTA 3MEXA 1UG2A 3OYKA 1KYWA 2R5YA 4BE1A 1MBFA 3N4MA 1LDDA 2HOAA 3J7ZI 1D0XA 2YU3A 3M9AA 5FLVA 1UJ8A 1BC7C 4M3FA 3F21A 3DBLB 1ZAOA 3SXYA 4XORA 3AL0C 1FX7A 1HLVA 3H9JA 1CF7B 2M45A 3OIQA 2XSDC 2FE3A 2NOGA 1HKSA 2JPCA 2P7VB 1AKHB 1MSEC 2PN6A 1KU2A 5L3GA 2XF6A 3OS0A 3M1CA 4AU7A 2DXIA 4NQWA 5DEQA 4LMYA 3VOEA 2HGCA 2DFFA 2FOWA 1ZG5A 2OJED 1KZHA 3FDYA 1LEAA 2GWRA 3GZ5A 3ZMTA 3T0YA 4M3EA 3RIRA 4X6AJ 2VI6A 4E7HA 4XOPA 2M7AA 2HEOA 3H3VK 4YFKF 2I8DA 2EK5A 3MKZA 2KZGA 4KNYA 5BQTA 1WI3A 2A6EF 4AIJA 4MO7A 4MQVA 1MBJA 4YEJA 2JSCA 3BTLA 2BOLA 2Z16A 2L9NA 1A36A 3JCUC 1XGSA 3E7LA 3GLXA 2R0QC 1SMYF 2LRDA 1QQIA 1A5JA 1BR1A 2TRTA 3D1NI 1WJBA 2Y0MA 3G3ZA 2TCTA 1SANA 3E6MA 4BJ5C 4I0AA 3HG9A 1Z7LA 4HSRA 2ZBKA 4IOAF 4WF2A 4I2OA 3DPLC 4WXCA 1T0FA 2FA5A 1JTXA 3OIPA 4Y13A 3OYEA 3B02A 1OYWA 4UVAA 2J5OA 4N0BA 3I4MJ 3FHNA 3Q0VA 2DQLA 1WGXA 2XV4S 2NYXA 3HRUA 5D6EA 2R7SA 3CCQI 4E7KA 3UKGA 2PMZA 1GVJA 5BNGA 2F2EA 1SD5A 3LSGA 5E1WA 3DEUA 1UHWA 2CJJA 2HU9A 3ZGKA 3V4GA 1FIAA 2Y31A 2XKPA 3ZQFA 5D6FA 2CQ7A 2A61A 1XPXA 3OYGA 5CYVA 3G6EI 2LG4A 4DJAA 1MJ9A 2DA1A 2GOXB 3DPUA 4BYYA 3OYBA 1HKQA 2VC0A 4D5FA 3K6GA 4M9ZA 1UB9A 3QU6A 1QNTA 3A01A 5TISC 2NNYA 4HLYA 3WU2C 1Z3YA 3DKXA 2QQ9A 4FE4A 4DZPA 1QZYA 1WQ2A 4XN0A 4YFNF 1YLFA 3TKYA 2NVQJ 1YIOA 1IDYA 2Y0SN 1IJWC 2L7ZA 2K9QA 2V9PA 2JMWA 5CPRB 1YJWI 4WX9A 1POGA 5FKOA 1G3WA 3EUKL 1PJRA 1Y56A 5IOYA 5DM6F 5FFXA 1IRFA 1DGRM 2XGEA 3H35A 3LSJA 4F55A 3N97A 5JR3A 3BJAA 2BXZA 3CCVI 1R71A 2E2HJ 2CSOA 2FQ3A 3S2WA 3IRQA 3JAMZ 4KN4X 2ISYA 2E1OA 1Z3XA 2DDAA 3J7AY 3QYEA 5B66C 3CF2A 2V9VA 4HNVA 4S05A 4F52A 3I4NJ 3CCSI 1T95A 2W7NA 1P9QC 3NAUA 4BY7J 4MTDA 1T8IA 4ZH4F 4FX0A 3WTVC 2DFIA 4EJVA 4IXAA 5HS8A 5J1RA 4WWCA 2AQEA 2QZ8A 1ON2A 3CC7I 1TT5B 2R92J 4QTRA 2EB7A 2NRAC 2M9HA 2V26A 1GXPA 5CLSA 1WHUA 1RRJA 2F48A 2VBWA 5EZHA 4AVPA 2K3PA 1IRGA 3K9TA 2PEXA 2H8WA 1EH8A 2KRHA 4P9UA 1TQPA 2E71A 4HDUA 5E3LA 3ZN0A 4XQFA 3AL0B 4G12A 2KISA 4UHTA 3QAHA 1GVDA 2OD5A 3FZVA 3GXOA 3QPLA 3OL4A 1XX5A 2IBDA 2WB1N 2Z1DA 2NVUB 1H88C 3BG6A 3RPQA 1YE9A 5LGNA 3FISA 1X1PA 4KN7X 2D2WA 4CCJA 3CCUI 2E7XA 4ENJA 2Z99A 1H89C 1ZHFA 3M8EA 5GTHC 2Z33A 3HOVJ 2FBKA 5E20A 2Z3YA 3ZPLA 3DP7A 2V1UA 4EM2A 2HKXA 2VQLA 3HRTA 5KCMA 2CV0A 4OIPF 2VBYA 3V42A 5AONA 2DMPA 2A5YB 4BEHA 3QRFF 3C1DA 1K6YA 4R1HA 3GTLJ 2L9VA 1FOYA 1KU3A 2HXIA 2KRCA 2JVGA 2PQ8A 3COAC 2VJJA 3HXLA 1GT0C 3HZJA 2O5RA 2HR3A 3KLNA 1UELB 3PSFA 1IAWA 4ZZDA 2D1VA 5HNHA 3CJQB 2ZNYA 3BY6A 3K4CA 3V8JA 2RN7A 2R7FA 1ETWA 2HQ5A 2ZJ2A 5FLXK 1QHGA 3KX2A 1ETOA 5B3SH 2EZIA 5HLHA 3CTAA 4RB2C 2M30A 4XRMA 1A35A 4A3KJ 2LR8A 4RM2A 4U0VA 3OR2C 4L0YB 2VJ4A 3LFKA 3LAJA 1I6HJ 2P0WA 3TL4X 1QU3A 2K4JA 2FRHA 1VF9A 2LSOA 2XSJC 3TP3A 2X0LA 3KCCA 1O3SA 3IH2A 1U8BA 2ZJQF 2UXXA 2QWWA 1HKTA 1NK2P 5B5EC 3H5AA 2LY2A 4Y52J 4MHGA 3CJTB 1XGNA 1MH4A 2ZC2A 5DUIA 2RVCA 2H94A 4FX4A 4M73A 4I99C 3ASNH 3E3VA 2VOOA 3CCEI 2D5VA 1U9NA 1LNWA 4OU0A 2O3FA 2FBIA 4GRIA 4U7DA 4AYBN 1NH3A 5HODA 1EJ9A 2COMA 3M3YJ 1SMTA 2CS3A 3LOCA 3JRAA 1Y1WJ 2LKXA 2PLYA 4UV9A 1OISA 2M0MA 1AHDP 2MG4A 3F0CA 1X3WB 1N75A 5DTDA 1T98A 2PMUA 1DQUA 3G4SI 3VYSB 3F8NA 1MIJA 1XMXA 4Y4RA 5CQEA 5ILUA 5BPDA 4O5VA 1MMGA 1TQMA 3FMRA 4KICA 3JTHA 4LIVA 1Z9CA 2FUG2 3AG1H 1WRJA 1UHMA 5GPAA 3GFIA 4IF4A 3PQJA 4CXFA 1ZR4A 1R7JA 3VYUB 5JVGF 1XCBA 3LSTA 3HB9A 1AU7A 3IRRA 2JA7J 3DLLF 1IW7F 1PUEE 2BE5F 3OYAA 5H6RA 3R61A 2VQGA 1FBUA 1K83J 3IP4B 3OOUA 2G9WA 2GIZA 2EZKA 5D8LB 2FU4A 3A03A 3ASOH 1XTAA 3O8GA 2Q2EA 3FXUA 5E8IA 4N4NB 4HV6A 3B6CA 4M3GA 2XUBA 2LREA 4GYIA 2O61A 2M2EA 1HA8A 3MZHA 1TQIA 2MD0A 3KEQA 2CW7A 1D0YA 4XBFA 4LOCA 1JJ6C 3BPXA 4MFDA 3TW7A 3L9FA 1Z21A 5L3DA 1LFUP 1X2MA 2HTSA 5CVJA 4ZYGA 4Y15A 3BTJA 2UWMA 4EJTA 4HX7A 1JGSA 1ETXA 5GAHJ 3MD2A 2HXOA 2DI3A 4LK1F 5ICCA 1OJLA 1HF0A 3BR5A 3MKYB 2VKEA 5J47A 1NTCA 2QSHX 2KJBA 4M6VA 4IZZA 2XPUA 3QOEA 4Y17A 3HOXJ 3GWZA 1K78A 3JRBA 2QLZA 3MKWB 3HUGB 2R93J 1BW6A 2DMQA 4RB0A 4N9HA 3I3LA 1UAAA 4BHCA 3HKZN 2QQBA 1DU0A 2G7UA 2O9LA 2M0CA 5ILVA 1USTA 4ZYEA 1V54H 1OCZH 5LGTA 1XG1A 2OBPA 2WAQN 1ZN2A 2R5ZB 1FOKA 4U0YA 3CD6I 3DPTA 3ESWB 2DOEA 2R7OA 2R7QA 3HOUJ 2HZDA 2W84A 3EPZA 4F91B 1Y8RB 4NBQA 2YUSA 1R1TA 2ACJA 1B8IB 3KP6A 2DT7B 2GXGA 2HQAA 2V1NA 1IXSB 3K1NA 1JKOC 2RC4A 3DLAA 3LNQA 3IKTA 1ONVA 3EUAA 3BJ6A 1UZCA 2IXSA 1R49A 3U2RA 5HDKA 1LB2A 2XKOA 5H20A 4DYRA 3TMOA 4BXFA 2OF7A 2QSFX 3SYTA 2CW0F 2DA7A 1FMVA 4CYCB 2E2IJ 3ZRGA 1O4XA 2PX9A 1G2HA 2XIGA 1IRXA 1S3JA 2HDWA 1CF7A 4NC7A 1SFOJ 2ZXWH 2E7WA 1F4KA 1WWXA 3GMEA 2JRMA 4FQGA 1ZGAA 2L02A 1JT0A 2NVXJ 4B47A 1T08B 4LIUA 5DV5A 3WTYC 3JRHA 1QA6A 2OUMA 3I58A 2OZUA 4XSXF 3FM5A 1MKMA 2NAZA 1R1VA 2VUMJ 4Q5SF 1S9HA 4J00A 1S7OA 3H3ZA 3GTOJ 1V5FA 2E2JJ 2K02A 1TW2A 3BPVA 3NWTA 3JRCA 2LF8A 5F6FA 4E7ZA 2EJRA 5LBQA 4KJZA 4Q48A 3EQLF 3ZXSA 4IX7A 2STWA 2RQPA 2Z2SB 5KNLA 2EV5A 1FWZA 1OFCX 5HLIA 2FXAA 2V1DA 5HLGA 2FF4A 1O7FA 2PMHA 3QYBA 2L0KA 2BVMA 4F92B 2W48A 3I59B 2LBFA 2JA8J 2Y30A 1O3QA 2OQRA 4MLOA 3VODA 3JAMK 3ZMUA 5EEAA 1BOAA 1SAXA 1D1AA 2G0EA 3S14J 2R7UA 2HI3A 3P9CA 2QQ8A 5CVRA 4CZZA 2KT0A 5JFRA 2VPLA 3BCAA 4RAYA 2FOKA 3EUHC 3ZN1A 3WGIA 2L7MP 1FYMA 1ITYA 1PUFB 2WADA 4RAFA 2E1NA 1DPUA 3KYLA 4Y3OA 1U8RA 2GXBA 3VEPA 2UXNA 2FMLA 2H09A 3BG7A 4OMZA 1W0TA 4B3AA 1BL0A 1JXSA 2ZXJA 3S17J 4ON0A 1VQNI 2HOSA 3OWTA 1OKRA 5A2QK 4IQJA 1XB4A 3ISPA 4KT5C 3EYIA 5E3NA 4HV5A 3Q5FA 3J81Z 3OSGA 1BBYA 4RB1A 1J2XA 4XOTA 3L09A 4DZJA 3ZQCA 1BN5A 3BR2A 2WB1A 2DA5A 3O8HA 4NB5A 1YW8A 3SDBA 3KFWX 2E19A 1W7PB 3ABMH 3HBLA 3KPHA 3I0TA 3T8TA 3D5LA 2K9SA 5CVUA 3DU5A 3WTZA 4CDGA 2ISZA 2E5NA 1W5TA 2K4BA 2M1BA 2CUZA 2JWTA 4ZC3A 4B44A 3GX4X 4BL0B 4WXHA 3FBIB 1D8KA 2OZ6A 2OC6A 3BR0A 1A04A 1VQ8I 4XRSG 1PYVA 2O8XA 1T38A 1MSFC 1WJDA 4EJUA 2CH0A 3PO3J 5DD8A 4AIDA 1YW7A 2HVRA 3BP8A 5J40A 3V8LA 2A68F 2Z9OA 1W5CC 2A05A 1G3TA 2COBA 1V3FA 3L2UA 4UNOA 4UY8I 2M4GA 2MC3A 2Y75A 2ECCA 2WY7Q 3A0HC 1P92A 3D5SC 5FFZA 3JRFA 1YS7A 1EH7A 4QIWN 1YX5A 1A31A 2IJLA 3I54A 1F5TA 4KITB 5LEKA 1X1BA 4LFUA 3CF5F 3F9KA 3WODF 1WFXA 5J6XA 1R5HA 3KP5A 4BQQA 5D5WB 3ZQLA 4JQFA 2AS5F 4CYDA 5DCMB 4DOZA 2FNAA 1TL8A 3DBRB 3VB2A 1Z6RA 2CUEA 3M8JA 3OYJA 1ZR2A 3ZQGA 1U5TC 3L2VA 1SFEA 4L9VA 5EYRA 1D1BA 3E1SA 3V8KA 4BGDA 5FD6A 3PFYA 3BR6A 5BPIA 2MH2A 4XKWA 4BS9A 3ELKA 5HNFA 3M07A 4B8XA 4ABZA 4E7SA 3LSIA 4I7HA 4KDPA 3E6DA 1MBEA 4BJ6C 1ZG3A 4XLAA 4UUSB 2FD5A 1LJ9A 2YS9A 4P5OA 1B4AA 3U1KA 2M7BA 1R36A 4C3IJ 1SFUA 1ACIA 1ZTRA 1NHAA 1FLIA 1SD7A 2L9SA 2QVOA 1IUYA 4HA8A 4QSHA 1R58A 2XAJA 1JE8A 1M1EB 1YHQI 5HVQC 2YSRA 4Q4ZF 3CUQA 4RM3A 3G71I 1DUXC 1IXCA 3TGNA 2GLOA 4Z2YA 2LNBA 2MH9A 3JRGA 3S32A 5M5WJ 1WJ5A 1QRYA 3CP2A 4DYCA 2F5CA 2QM3A
chains in the Genus database with same CATH topology
2Y69H 1V55H 3X2QH 3ABLH 5IY5H 1OCCH 3AG4H 2EILH 3ASOH 2EINH 5B3SH 3ABKH 3ABMH 3ASNH 3AG1H 1V54H 2EIJH 2EIKH 1OCZH 2DYSH 3AG3H 5B1AH 2OCCH 3AG2H 3WG7H 2ZXWH 2EIMH 1OCOH 1OCRH 5B1BH 2DYRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y69 H;  1V55 H;  3X2Q H;  3ABL H;  5IY5 H;  1OCC H;  3AG4 H;  2EIL H;  3ASO H;  2EIN H;  5B3S H;  3ABK H;  3ABM H;  3ASN H;  3AG1 H;  1V54 H;  2EIJ H;  2EIK H;  1OCZ H;  2DYS H;  3AG3 H;  5B1A H;  2OCC H;  3AG2 H;  3WG7 H;  2ZXW H;  2EIM H;  1OCO H;  1OCR H;  5B1B H;  2DYR H; 
#chains in the Genus database with same CATH topology
 2BHZ A;  1Y39 A;  2XRL A;  4QPO A;  2DPD A;  3S8P A;  3HOT A;  4Z6Y A;  4PSX A;  1SC7 A;  3IAM 2;  5F08 A;  1RES A;  4BU2 A;  2F5E A;  3RKX A;  4P1W A;  2A6T A;  4K2E A;  5M3F J;  4YEL A;  3OV8 A;  4N9I A;  5EZG A;  3RCO A;  4G7H F;  4A12 A;  2NOJ B;  1JHF A;  1T33 A;  3OYL A;  4W97 A;  2X1D A;  4C2U A;  1Y8Q B;  5DS9 A;  1Y1V J;  4G8X A;  2WV1 A;  2YX7 A;  3ERM A;  1SVM A;  2LDU A;  4D9J A;  1R5I D;  1VQO I;  3S1N J;  4JBA A;  2DN0 A;  4IHV A;  1WJF A;  3BWG A;  3TED A;  2NVT J;  3KP3 A;  3OOP A;  4PGH A;  1IC8 A;  3LAP A;  1RET A;  3IHU A;  4AD9 A;  3W2V A;  4EEF G;  1TWC J;  1FTZ A;  4FCY A;  2HFH A;  3JSO A;  2ICW G;  2PG4 A;  3W6J B;  2A3S A;  2LMD A;  1Q1V A;  4IL6 C;  2IT0 A;  1AWC A;  3G2B A;  4I09 A;  4XKC A;  4ZDP A;  4M9S A;  4C30 A;  1JUS A;  2XAU A;  1P6R A;  4RGR A;  2KKO A;  5LGU A;  3IH4 A;  3CME I;  1Z91 A;  1OCO H;  3O6B B;  2QBY A;  4UVC A;  1EA3 A;  4LD5 A;  5J4V A;  1QVU A;  1XMA A;  3ABL H;  1APL C;  3CDL A;  4GO1 A;  2HWV A;  4S0H B;  1Z67 A;  5DUK A;  3ZR8 X;  5C44 J;  1DGW Y;  2W24 A;  2NXN B;  5KAI C;  3H9G A;  1JKQ C;  4OAZ A;  4DW6 A;  1RC9 A;  3HEF A;  2A6H F;  4ENM A;  2JN6 A;  4ZYH A;  3OYN A;  3ML6 A;  4G7Z F;  1HW5 A;  5E1X A;  2ZNZ A;  4UUT A;  2ECB A;  1FSH A;  2XB5 A;  3BG9 A;  2ZCW A;  5H2F C;  2I5U A;  1V5G A;  3S1R J;  1Y6I A;  4XLF A;  4YIF A;  3W6V A;  1J0R A;  1V4R A;  1D3Y A;  3WG7 H;  3HKZ A;  2P5L C;  4HW0 A;  2FX0 A;  1XGO A;  2EIM H;  4V2G A;  2E36 A;  3FK6 A;  3WHB A;  3WTS C;  2LKS A;  1NK3 P;  3W2A A;  2EWN A;  3PIP F;  3RPU D;  3PM1 A;  3I9V 2;  2Q0O A;  4PJM A;  2EQR A;  2I10 A;  3J7A O;  2W57 A;  1D1C A;  1S7A A;  2Y2Z A;  4ITV A;  4DBR A;  1DDN A;  4BQN A;  2JA6 J;  3O3K A;  3FX3 A;  2EFP A;  1BJZ A;  4QLC U;  1FYL A;  1U2W A;  1VZ0 A;  5EG0 B;  1LQ1 A;  1LE8 B;  1OLT A;  3M8F A;  3LQR A;  2L7K A;  1F9N A;  1Y0U A;  2VKH A;  3OMY A;  2FSW A;  3K4K A;  1GV2 A;  4OAY A;  4WK8 F;  2BY2 A;  1T0F C;  2HS5 A;  3C7J A;  4LG3 A;  4XNF A;  3CMY A;  2H6B A;  2F4I A;  4I76 A;  4MQ9 F;  2LP0 A;  1ODD A;  1U5T B;  2HYG D;  2LF7 A;  1SVO A;  5L3C A;  3S3M A;  3HL2 A;  1PP7 U;  2CFX A;  3GLL A;  3L2R A;  1BI2 A;  2BVL A;  1NG6 A;  4FIS A;  2YU9 J;  3K70 D;  3ECH A;  3K4N A;  3U1D A;  3H0G J;  1TC3 C;  2X9D A;  1ULY A;  4XRS A;  3LSK A;  1MDM B;  5HDG A;  2HQN A;  4E6K G;  1VQ7 I;  1ETY A;  1KU7 A;  1O3T A;  1U3E M;  3GTP J;  5LHG A;  4RB3 C;  4PFP A;  3CDI A;  1G8X A;  4XLP F;  1YOV B;  3FF5 A;  2DAO A;  3RKY A;  2FNP A;  3E0J B;  3P9K A;  4CHU A;  1XCV A;  4HEA 2;  4G6D A;  1HXD A;  4IRI A;  5IT3 A;  5A2Q Z;  2A69 F;  3EYY A;  2CV2 A;  5FJ8 J;  1X19 A;  2VJ5 A;  1X4P A;  2BY3 A;  2ZB9 A;  1JHH A;  4W1U A;  2XB0 X;  1I1S A;  1WH5 A;  4KIS A;  2UUZ A;  5M3M J;  3E6B A;  3Q0W A;  3QOD A;  2V6E A;  1MND A;  3MWM A;  3R6S A;  2HYF A;  1W36 D;  3JRI A;  1E3P A;  2DMT A;  2FBH A;  1MJB A;  3H92 A;  3RJP A;  5M5X J;  3IAS 2;  5IP6 A;  1CGP A;  1HCR A;  3OSF A;  3VYT B;  1QZZ A;  4HF1 A;  3FXR A;  5E3O A;  3MCZ A;  1DP3 A;  1BR2 A;  3HSF A;  4B3X A;  3FM3 A;  1MH3 A;  4RGX A;  2KJC A;  1BI1 A;  4LLG F;  4UVB A;  4ETS A;  1ZQ3 P;  2NS0 A;  2M5W A;  2CW8 A;  1OR7 A;  2X48 A;  3HTS B;  3OR1 C;  4S04 A;  1YRN B;  4UV8 A;  1FEX A;  4A3G J;  3J81 K;  2H6C A;  2LTP A;  1S72 I;  1WZ2 A;  4XK4 A;  1J59 A;  3H5R A;  2R5Y B;  4L9T A;  3NRV A;  1JKP C;  2P6S A;  1IN7 A;  4LG0 A;  1RUN A;  4IRH A;  3H3U A;  5C4X J;  5J1U A;  3WU0 A;  3IWF A;  3LMM A;  1EF4 A;  3FXM A;  4MIM A;  4NUB A;  2O6G E;  4ZTF A;  3BT9 A;  1ZG1 A;  3HSE A;  1DP7 P;  2DQR A;  1S29 A;  3BOQ A;  2ZFU A;  3K4B A;  3M1E A;  2ZFW A;  4QWQ A;  4D7N A;  5HS9 A;  1SFK A;  3FXQ A;  2DCE A;  3I59 A;  3ZMZ A;  1J5Y A;  1B72 B;  2JRT A;  2EBI A;  1XSX A;  2M3A A;  3DKY A;  2VQC A;  4DIQ A;  2JJ7 A;  3PO2 J;  4NQW B;  2IGO A;  4CCM A;  3HJE A;  3LA7 A;  2L01 A;  1YQA A;  4RAG A;  1TWA J;  2VQH A;  3DWL E;  1UFM A;  4UB8 C;  1K61 A;  1TWF J;  2ME0 A;  5H6Q A;  3AG2 H;  9ANT A;  5HOO A;  2XAF A;  3IC7 A;  4LK0 F;  1U0J A;  3GTQ J;  1HST A;  1Z0X A;  1OCR H;  2P81 A;  4G6T B;  3QQA A;  2L4M A;  3F8F A;  4XLE A;  4UXN A;  1YIT I;  5AIQ A;  3Q0U A;  2IGM A;  2HNH A;  2MAB A;  1D5Y A;  4GDF A;  1PUF A;  4UUV A;  4XON A;  1FIP A;  4FET A;  1ZLJ A;  1B1B A;  3WHC A;  4O6J A;  2HKO A;  2IEK A;  5FKN A;  3W2W A;  2QKM B;  2IA1 A;  3OYC A;  2CU7 A;  1HSJ A;  1B6A A;  2BY1 A;  3ABU A;  4M74 A;  1YYV A;  3A2K A;  1B9M A;  2RGV A;  5J1Y A;  1XSV A;  4BH9 A;  3WG9 A;  4XN3 A;  3F8B A;  1ENH A;  1SAU A;  2EPF A;  2W00 A;  3DQV C;  3CO6 C;  2HPI A;  2DYR H;  3B73 A;  1FBQ A;  3I4P A;  4X1E A;  4IHT A;  4TV7 A;  3V7C A;  1MBH A;  2HDD A;  4B4C A;  2GXA A;  2CGP A;  4BNC A;  1W7P A;  3PNT A;  5EJC A;  2ZXI A;  5TRD A;  3T1B A;  4EJW A;  1I1G A;  2Q8K A;  3DTI A;  1FOW A;  1RKT A;  5E79 C;  3RQI A;  4E7I A;  2IAI A;  3RYR A;  1I50 J;  3PUB A;  1LFB A;  2XPV A;  1YG2 A;  3HGY A;  3SFI A;  1R6R A;  1IO2 A;  1E2X A;  1UCR A;  2DA4 A;  2ZME A;  1RUO A;  4PDK A;  2ZSI B;  3DV8 A;  4N4O B;  1P7J A;  4HX8 A;  1YS6 A;  2LC2 A;  1KQ8 A;  2B63 J;  1ZRC A;  3QWL A;  2IA2 A;  3A01 B;  3BTC A;  3K4M A;  2DOD A;  2P4W A;  4A3L J;  4KUM A;  3MAJ A;  1TT0 A;  4L9J A;  2EZL A;  5ICG A;  3ZQH A;  5J3L A;  1I6X A;  4HQE A;  1MNM C;  3LQQ A;  1Z05 A;  2O7O A;  4NC6 A;  2W4S A;  3RSN A;  1ZH5 A;  2STT A;  1FJL A;  3SZT A;  3TDZ C;  4G94 A;  2GQQ A;  2DW4 A;  3GUD A;  2R7W A;  2P6T A;  1MMD A;  2E5Z A;  2CRG A;  2BXY A;  3LSM A;  3QYF A;  1FOX A;  2R7X A;  2P5K A;  1OCC H;  3ERE D;  1REP C;  4KFC A;  3FBN B;  2EIL H;  3KIO A;  5DCM A;  2MD5 A;  1XDS A;  4MEX F;  3HDD A;  3LSP A;  3QPH A;  2N8G A;  2MW8 A;  2W85 A;  5K7H A;  2ELK A;  3OS1 A;  1MMA A;  1N78 A;  1O3R A;  2LD5 A;  4L18 B;  1SD6 A;  4C3H J;  1RZ4 A;  2EFW A;  1K6O A;  3ZMV A;  2K86 A;  3OYF A;  2PMZ N;  2OU2 A;  1P4A A;  3RPU A;  3IUO A;  3R0J A;  3E5X A;  2VBZ A;  3I64 A;  1LDK B;  4UUS A;  4KYW A;  4F3Q A;  4C2T A;  3CCJ I;  3C18 A;  4D1Q A;  5FRN A;  2V9K A;  4HNU A;  2DOF A;  2X6X A;  2QGU A;  4A69 C;  1ERD A;  3CLO A;  2BW3 B;  3KP2 A;  4AWX B;  2GZW A;  2LFB A;  1BW5 A;  3RI4 A;  2Y9Z A;  2EIJ H;  1PDN C;  1G59 A;  2DA3 A;  3I56 I;  4ZZL A;  1U9O A;  3Q9S A;  1QVT A;  1X1D A;  1RIO H;  1W0U A;  4FHT A;  1HW1 A;  1IRZ A;  3K4J A;  4II2 A;  1AKH A;  1OCP A;  3BDD A;  4A3F J;  2EFO A;  2JZY A;  3HOS A;  1AA7 A;  3ECO A;  3GTG J;  5F1R A;  4A0Z A;  2DU9 A;  3UR3 C;  2HQR A;  2IGK A;  4M3B A;  4RDU A;  3TO6 A;  1X1A A;  2K7L A;  3NQO A;  3P5J A;  3W6K B;  4JOM A;  2ZJP F;  3NEU A;  3CCM I;  3D0S A;  4CCN A;  1MNE A;  2ZJR F;  1LFP A;  4XLC A;  3CUO A;  2AXL A;  2VLA A;  2AO9 A;  2Y0S A;  3BJO A;  2A07 F;  2AQF A;  3LWF A;  2IPQ X;  2VJI A;  1P7I A;  2IP2 A;  4NC8 A;  4BQA A;  3JRE A;  4KT6 A;  2B0L A;  4PSW A;  4EJO A;  5IYC J;  4E7J A;  3H9Q A;  3PNY A;  4XM3 A;  2IS6 A;  2LYC A;  3IV5 A;  4GGG A;  4LLN A;  4GXO A;  1YO5 C;  5ERI A;  4KIB A;  5CVI A;  4JX4 A;  2CFO A;  3L7W A;  3Q3S A;  2DO7 A;  4CZC A;  4ZTJ A;  1QO0 D;  1UHS A;  4OIR F;  1TP4 A;  2P5V A;  2X1E A;  4D0P A;  4A3M J;  4DNC A;  4EAT A;  2MA3 A;  4ZYD A;  4BAY A;  1W5S A;  2Y69 H;  3K1M A;  3QP5 A;  4KA4 A;  4YRV A;  5C3E J;  5LD2 C;  2O0Y A;  3KP7 A;  4JP0 A;  1AOY A;  1IV8 A;  1OYI A;  1MJA A;  2ID3 A;  3SDG A;  3HOW J;  2RQQ A;  1GHC A;  5IOZ A;  4BY1 J;  3F72 A;  1X3Z B;  5LHI A;  3HPH A;  1IGN A;  5K1Y A;  1L3L A;  4L5J A;  4EM1 A;  3JSP A;  2MLG A;  3KEO A;  1S5L C;  4PFO A;  5EEG A;  1XS9 A;  1H0M A;  4RBO A;  1WKM A;  4M9X A;  4R8H A;  3LFU A;  5GTI C;  2IVM A;  2GBY A;  5DYM A;  2KDZ A;  1BM9 A;  1TNT A;  2EA2 A;  2MBF A;  3MKL A;  3KE2 A;  4LB6 B;  1UMQ A;  4G9Y A;  3TP0 A;  4FTH A;  2KIF A;  4YIR X;  1WCM J;  2VIX A;  1Q1H A;  2KHM A;  3CCY A;  4RGS A;  1VQK I;  3ZQ7 A;  2ESN A;  2R3S A;  1EV7 A;  1MMN A;  4I02 A;  3DCF A;  1HDP A;  1X1C A;  1R4M B;  3BZ6 A;  3FK7 A;  3C3W A;  4B1R A;  4DBQ A;  3BTI A;  1VQ4 I;  1LE8 A;  2DYS H;  2K85 A;  2VB6 A;  2E60 A;  4D5C A;  2OTL I;  2CQN A;  1XC5 A;  3H36 A;  4OOI A;  1LVA A;  2BV6 A;  2DMN A;  4BE2 A;  2LVS A;  5K5O A;  1V55 H;  4IOC F;  1IDZ A;  1LVK A;  2D1H A;  1B9N A;  4KIG A;  4A0X A;  4A2U A;  2YX4 A;  5F0H A;  2CO5 A;  2R7T A;  5EDN A;  3HYI A;  2BY0 A;  4MEY F;  5ICF A;  2DFH A;  2IW5 A;  4DQ2 A;  5HDN A;  3RDI A;  5JHU A;  2WY8 Q;  4RLF A;  2X6W A;  4A3C J;  3IWZ A;  4CO8 A;  3QP6 A;  5GAD J;  2V79 A;  2LH9 A;  3HRM A;  4IVN A;  2KRF A;  1G6N A;  2GAU A;  4B43 A;  2GA2 A;  2BYV E;  4AIK A;  3KET A;  1BOB A;  1TWG J;  3HPG A;  2QQA A;  1HBX G;  5F0F A;  2KFD A;  1XD7 A;  1PP8 F;  2M87 A;  2X6O A;  3GFL A;  2LLK A;  3HRS A;  2VE9 A;  1VFC A;  3TQN A;  1PVE A;  4HDV A;  3MMY B;  1T39 A;  2EH3 A;  5F0C A;  2CWE A;  1MW7 A;  3LSH A;  3V7R A;  4M71 A;  3BG5 A;  2YPR A;  1Z7U A;  2E1M C;  5LRR A;  4U7B A;  2EZH A;  3CES A;  4XSZ F;  5LLQ A;  1W4M A;  5LFA A;  2KP6 A;  2H1L A;  3CQZ J;  1X58 A;  2XGD A;  4IHW A;  1K78 B;  3H0D A;  2AXT C;  4BXU A;  1OYY A;  3GZN B;  3G73 A;  3CMM A;  4NNJ A;  4AYB A;  2K27 A;  4PJN A;  3MFK A;  2XAH A;  4A3B J;  2IGN A;  2VT2 A;  5KHD A;  1WI9 A;  4ASN A;  1K4S A;  2R4G A;  1XDU A;  1R1U A;  4HBL A;  4D7M A;  3KEY A;  4DGW B;  1SEU A;  3AAF A;  2V1X A;  5FD5 A;  2ESH A;  2FEZ A;  1E3H A;  4BE0 A;  5IYB J;  2JQ7 A;  1WVR A;  3FKJ A;  1VQ5 I;  2PFB A;  1FBS A;  4LGW A;  1ON1 A;  4CA0 A;  4OIO F;  3CZ6 A;  4RLQ A;  2JA2 A;  3JTG A;  5D5V B;  3CCL I;  3K0L A;  2DOA A;  2BZT A;  5FRO A;  2RNJ A;  3DEW A;  2X51 A;  3FKI J;  4PJJ A;  2IS4 A;  3FIW A;  3VWB A;  3ABT A;  3DFG A;  1W7P D;  2ZKZ A;  2XHK A;  3REO A;  1LEB A;  2ADU A;  3GTK J;  1QPM A;  1R23 A;  2CUJ A;  3MN2 A;  2HYJ A;  1FY7 A;  3CLQ A;  4YII A;  5D8K B;  2XVC A;  3L2W A;  2VL8 A;  4ZYA A;  2KDO A;  4GCV A;  3L2Q A;  3M4O J;  4AM3 A;  4R79 A;  1BI0 A;  5ED4 A;  2LY1 A;  4EQQ A;  1B72 A;  2KIM A;  1F36 A;  1QGP A;  2P8T A;  3FMQ A;  4PCQ A;  4KIF A;  4Q47 A;  4O3M A;  3L00 A;  3EET A;  5IT9 K;  2RV8 A;  3BQZ A;  1WJE A;  1X2N A;  3I55 I;  5E8G A;  3HGG A;  3SQN A;  5B1A H;  3DU6 A;  4A0Y A;  3ROU A;  1TBX A;  1I39 A;  5L3B A;  2D45 A;  4EV0 A;  2VC1 A;  1I27 A;  1S7E A;  3K4L A;  2EA4 A;  2HPM A;  3CUQ C;  3ZCO A;  1TW3 A;  2UZK A;  1XN7 A;  4HQM A;  3MZY A;  5D4S A;  2UV1 A;  3DXJ F;  4YFX F;  1YIJ I;  2EIN H;  2LBF B;  2HVQ A;  2CUF A;  2GM4 A;  3GTM J;  1TZL A;  2E1C A;  1IV6 A;  2LOO A;  1TTY A;  4XID A;  2LK2 A;  3K2Z A;  5K7Z A;  1F1Z A;  3I5U A;  5LEJ A;  4II3 A;  5K5R A;  4A5M A;  1STZ A;  4FT8 A;  2VKD A;  3BLY A;  2VKV A;  3JR9 A;  2DPU A;  2NVY J;  4L5I A;  4XL9 A;  3V7S A;  1TLH B;  5JLX A;  2Y9Y A;  1VQP I;  1JI8 A;  1RR8 C;  2QA4 I;  4KMF A;  4RS8 A;  1R5G A;  4EGZ A;  5M5Y J;  4V19 K;  2QUF A;  2WAQ A;  5FO5 A;  4EGY A;  1QBJ A;  2MGQ A;  1MGT A;  4C9Y A;  3WGG A;  4M72 A;  5FLM J;  2R7R A;  1VQL I;  4ZDL A;  1ZLK A;  1J7K A;  1GLN A;  2TDX A;  4ENN A;  2HVS A;  4A3I J;  4M3D A;  1G3Y A;  2CQK A;  1OCT C;  2RDP A;  4CSW A;  2K9N A;  3KYD B;  2PJR B;  5BOX A;  1MBK A;  5GAG J;  2RAE A;  2DK8 A;  1SFX A;  3C2H A;  1ZK8 A;  3E97 A;  5GPC A;  2L7F P;  3QPS A;  3IH3 A;  3A02 A;  3UNG C;  2OQG A;  5C4J J;  4P9F A;  4L0Z B;  3M7G A;  1IG7 A;  3K7A J;  3A0B C;  1ETK A;  4ZDO A;  4HPQ A;  1J75 A;  3HM5 A;  2Z5U A;  4HOB A;  4HZF A;  2XDV A;  4RAZ A;  5EGO B;  1QPI A;  5E1Z B;  2E1M B;  1ZRF A;  2DMU A;  3GZ6 A;  3BQY A;  4GYG A;  4M6Y A;  3PJR A;  3SZG A;  3TO9 A;  1VI0 A;  2W25 A;  3OY9 A;  3U9G A;  3SEQ A;  2F4O B;  2KL4 A;  2E34 A;  3C2G A;  3FXO A;  1HDD C;  1VQ6 I;  1ZYR F;  3GTJ J;  4JX5 A;  1HC8 A;  4IO9 F;  3X2Q H;  4IKF A;  2J5P A;  4RGU A;  3VFZ A;  3HUG A;  1YI2 I;  2VXD A;  4OMY A;  3OYM A;  3AG4 H;  3K10 A;  3BZK A;  4P96 A;  1D0Z A;  1GV5 A;  3GFJ A;  3ZOB A;  3GFM A;  5EF6 A;  1YJ9 I;  2F5V A;  1ZRE A;  1N77 A;  1GUU A;  1F43 A;  4BXX J;  5FB2 A;  3WGH A;  2MFZ A;  4CIC A;  1OPC A;  4YG2 F;  5HS7 A;  6PAX A;  2VPR A;  3VYR B;  2R5Z A;  5DCF A;  3OS2 A;  2DTZ A;  3C2B A;  1P4X A;  1ZGJ A;  2JUC A;  4G7O F;  2K5C A;  4PUS A;  3CMA I;  4L9N A;  1FTT A;  1UG0 A;  3HIF A;  1A6I A;  4GFB A;  1B8I A;  2DBB A;  2NS8 A;  5IP9 J;  1K4T A;  4E4H A;  2KMU A;  1E0E A;  2KIU A;  3A4C A;  2MYS A;  1FZP B;  2BW3 A;  5TGT A;  1KQ0 A;  2XGC A;  3TBI A;  1BI3 A;  4U87 A;  4MNU A;  3J80 Z;  1TWH J;  2B7E A;  2HOE A;  2V6C A;  4CYC A;  3CO7 C;  5KAF C;  1WPK A;  3DTK A;  3VSK A;  3F22 A;  2JVH A;  4H0E A;  3DBH B;  1G4D A;  3LA2 A;  4WXD A;  2WBM A;  1I5Z A;  2JSP A;  3ZMS A;  3J7Y J;  5J8C A;  1R4N B;  5LHH A;  2ETH A;  1RR7 A;  4U88 A;  3L1P A;  4IQ4 A;  4CUG A;  1H9T A;  2KIQ A;  2W82 A;  2YR2 A;  2GIV A;  1JKR C;  3RZO J;  3HC7 A;  1FPQ A;  2P7C B;  4AVZ A;  1K79 A;  1XGM A;  2DFE A;  3S16 J;  4CGZ A;  3SFZ A;  1BIA A;  2NNN A;  1BR4 A;  2OTJ I;  2EFN A;  3O2P E;  1JT6 A;  3CUQ B;  3G1M A;  4U0W A;  1H8A C;  2DTR A;  2JA5 J;  2QSG X;  4A93 J;  4RA2 A;  1O7L A;  4I6Z A;  3BG3 A;  2HTJ A;  2H27 A;  4UB6 C;  4EVI A;  1P4W A;  4JK1 X;  5J8F A;  3I53 A;  2ZSH B;  2XRO A;  3WE2 A;  2FJ1 A;  4BJT A;  3RKW A;  5KK1 A;  4RMN A;  3E5Q A;  1BIB A;  1QZE A;  3CC4 I;  1P2F A;  3ZQQ A;  3FHZ A;  5DM7 F;  3EDP A;  4HLX A;  4MFE A;  1RI7 A;  2EV0 A;  4IEJ A;  3S2D J;  1XSD A;  2OPT A;  2KQR A;  2XPW A;  2V4J C;  3GBG A;  2BBY A;  5FKK A;  3BC8 A;  3S3N A;  2XF7 A;  1ZRD A;  3BR3 A;  1YX3 A;  1BJA A;  1Z6T A;  3F23 A;  1DU6 A;  2WWY A;  4A6D A;  4A3E J;  1FC3 A;  1J9I A;  3W3C A;  2MLK A;  1IZ1 A;  4PK4 A;  3GCM A;  2FQ4 A;  3MQ0 A;  3GVA A;  2XF5 A;  1O57 A;  1VND A;  5E18 F;  4J01 A;  2MSY A;  1IN8 A;  4C2M J;  3DTE A;  5E3M A;  1D5V A;  4CCO A;  1OR7 C;  2ELH A;  1R9T J;  1T2K A;  1MBG A;  3S3O A;  1DPR A;  1Z77 A;  4BKX A;  3SZP A;  3AFH A;  4HX4 A;  4LLL A;  2HDC A;  4IHX A;  3F8C A;  5F1J A;  2M8E A;  3D5R C;  4B48 A;  1E17 A;  3KP4 A;  3LSR A;  5LRS A;  1MMS A;  4HG2 A;  1ZKG A;  2QBY B;  3E5U A;  4HAM A;  4BUP A;  1CQT A;  3F8M A;  3WTU C;  3GW2 A;  1R00 A;  2BEO A;  2L4A A;  2DJI A;  2M34 A;  5D5U B;  1IN6 A;  1ETV A;  4BHP A;  2LY9 A;  1HOM A;  1VQ9 I;  2EIK H;  5HLT A;  4E7L A;  3BCB A;  4ESJ A;  4CCL A;  3GF2 A;  4IHS A;  2HZT A;  3BR1 A;  3H5N A;  3E6C C;  1LPQ A;  1WJC A;  3KZI C;  1A6Q A;  5DD4 A;  4HYE A;  3NAR A;  4OIN F;  4ENK A;  1T6S A;  5B1B H;  3KYC B;  4BDY A;  2OA4 A;  1FSE A;  5IT9 Z;  2IA0 A;  2LKP A;  2QF7 A;  2VON A;  2K9L A;  3TOB A;  2DA2 A;  2WC2 A;  2IS1 A;  3Q9V A;  4JYK A;  3SHF A;  5J4Y A;  4XIC A;  4HNT A;  3L2C A;  2FMY A;  2L5Q A;  4I01 A;  4M6X A;  4HF0 A;  5F64 A;  2RKH A;  3CP8 A;  1OQY A;  1SD4 A;  2R7V A;  5ICE A;  1HQC A;  3CC2 I;  1G3S A;  3ONQ A;  2RRE A;  2H1K A;  2O03 A;  1IF1 A;  2CMP A;  1FP2 A;  3BRO A;  4F7Z A;  4OIQ F;  2K40 A;  5IPA A;  4F93 B;  5K5Q A;  4XKB A;  1X3U A;  4BDZ A;  1KU9 A;  1T56 A;  1N25 A;  3QU3 A;  5IY5 H;  3JW4 A;  3FXK A;  2X1C A;  2B9S A;  2CQQ A;  4LJZ F;  5D4R A;  4AUX A;  1IN4 A;  1I3A A;  4WCG A;  3U21 A;  4CCK A;  3AG3 H;  2R7D A;  2Q1Z B;  2JT1 A;  1BC8 C;  4HF2 A;  2DT6 A;  5K7F A;  2XC7 A;  1LDJ A;  1OMI A;  2XGX A;  2GOM A;  3P9I A;  3PL8 A;  4NDL A;  3VPR A;  4X0G A;  3R0A A;  5EEH A;  3VDX A;  2ZME C;  4PJL A;  1KQ9 A;  4BHB A;  2VXZ A;  3QPT A;  3S1M J;  5DDG A;  2C6Y A;  2L3D A;  2L54 A;  1NG7 A;  4XLH A;  1FNN A;  4IJA A;  3G1O A;  1EH6 A;  3DKW A;  2VT3 A;  4XRF A;  2H8R A;  2A5W A;  2OV7 A;  3K69 A;  4OWR B;  4Y33 A;  2GA1 A;  1KA8 A;  3R60 A;  3G1L A;  2V7F A;  2R7Z J;  3S15 J;  1E3O C;  3TOA A;  2XAG A;  3WTW C;  3PNV A;  5F27 A;  3LL7 A;  3DEE A;  4BAC A;  1VQM I;  2PI0 A;  1R22 A;  5L3F A;  3N05 A;  2PBI A;  5CJ9 A;  1FT9 A;  2Y48 A;  3TW6 A;  2E35 A;  1S8N A;  4CH7 A;  3AKZ A;  3WTX C;  3RKQ A;  1ZGW A;  4HRI A;  2VBX A;  1KYZ A;  3ABK H;  3HOZ J;  3CJR B;  3CJN A;  3GO5 A;  3ZMD A;  3FXJ A;  3KZY A;  2WA0 A;  5FKL A;  4BEH B;  4BBS J;  1VTN C;  1RNL A;  4AIH A;  4I98 B;  3KZZ A;  3EUH A;  3RTR A;  2MC4 A;  1LKX A;  1IUF A;  2M8G X;  4A3J J;  3A1Y A;  3K2A A;  3HHH A;  2PJP A;  3WE3 A;  3HTU A;  5F04 A;  1H9G A;  3S1Q J;  1USS A;  3FXL A;  3CDH A;  1MZB A;  3OL3 A;  2X85 A;  3S93 A;  2VE8 A;  5ILS A;  2DT5 A;  4PZJ A;  1C0W A;  1QHH D;  4LG0 B;  2VOP A;  5TJJ A;  3VSL A;  4ESF A;  2ZXH A;  4XLN F;  4B09 A;  1JUM A;  2XAS A;  3TO7 A;  1GDT A;  3QOP A;  3RYP A;  3HSR A;  5AIP A;  1FP1 D;  1IXR C;  2F5D A;  2CG4 A;  1I3Q J;  3SEZ A;  3GYH X;  2M4K A;  2F6C A;  3WTT C;  1IN5 A;  3RQ4 A;  5CVV A;  5BMZ A;  1FMW A;  4MGR A;  4EM0 B;  1SVL A;  3T8R A;  3GEZ A;  5JHF A;  4DYQ A;  2DJN A;  2QEN A;  1ORK A;  1WJA A;  4LB5 A;  5FRM A;  4ESB A;  2KLO A;  4P55 A;  2DA6 A;  3BZC A;  1RKW A;  5GAE J;  1WH7 A;  4G6Q A;  3OIO A;  3K70 C;  4BQO A;  2L9R A;  1YFH A;  3PQK A;  3T5X A;  5L3E A;  2OCE A;  3TDU C;  2ME6 A;  2WAF A;  4V2F A;  4Y7N J;  2QEX I;  2K3F A;  5GP9 A;  2CYY A;  3ULQ B;  3R4K A;  3OYI A;  3F6V A;  5E17 F;  4PGG A;  5BS6 A;  4ANJ A;  1KON A;  1YTY A;  4XKV A;  5FKM A;  2XRN A;  1MD0 A;  1W1W E;  3I71 A;  5EG0 A;  1HW2 A;  2PJR A;  2JUG A;  4JX6 A;  3LA3 A;  4KMU X;  4A5N A;  2CQX A;  2HOT A;  2OCC H;  2DDB A;  3J80 K;  2EFQ A;  2BGC A;  2WAE A;  1FYK A;  4BBR J;  5FLX Z;  3CCR I;  1D8J A;  4E70 A;  1JJ8 C;  4PJ0 C;  3PIO F;  1GXQ A;  2K9M A;  2JPB A;  3PFI A;  4XR6 A;  4IPA A;  4A6E A;  1Z1D A;  2RNG A;  1W36 C;  1U5T A;  4MTE A;  2DK5 A;  2F5F A;  2VOD A;  4QPQ A;  2Q2E B;  5EGO A;  1JUP A;  1S6L A;  2AHQ A;  3FWE A;  2ZO4 A;  4A3D J;  2NS7 A;  4IHY A;  3H1C A;  1JGG A;  2IS2 A;  3NWS A;  3K1P A;  3RZD J;  3HHG A;  3PSI A;  2L2O A;  2X6Y A;  2QKL B;  2ZME B;  4NHJ A;  1MDM A;  5CKT A;  2BHY A;  4HST A;  3JRD A;  3P7N A;  5D5X B;  2O8K A;  4L5E A;  3IKV A;  1BA5 A;  2WV0 A;  1TNS A;  5CQG A;  2OAZ A;  2ID6 A;  1WSU A;  3PUF A;  2W1O A;  3OYD A;  5KVR A;  1KGS A;  2ELJ A;  2DLL A;  2KPM A;  1RPW A;  1V5E A;  2JK3 A;  4IRG A;  3FMS A;  1U6G A;  3HOY J;  2VAS A;  4C3J J;  3ZQI A;  3KLO A;  4FAS D;  1XMK A;  1YW9 A;  2JTV A;  2KZV A;  1ZEL A;  1LUJ B;  3MZ8 A;  1EKE A;  4ZJZ A;  5JI6 A;  4AC0 A;  2F4M B;  3F3X A;  2X4H A;  1YJN I;  1J09 A;  3DF8 A;  4LIT A;  4EMS A;  3F6O A;  1B59 A;  4FE7 A;  2EV6 A;  2VN2 A;  1K7A A;  2QCO A;  2XAQ A;  1U78 A;  5FGM A;  1JTY A;  1ETQ A;  1ZAR A;  2QYO A;  3B6A A;  2G7H A;  3WU1 B;  4H4K C;  3MVP A;  4J19 A;  3S2H J;  1X4O A;  4XMY A;  3IL2 A;  1L0O C;  4I0B A;  1Y0N A;  5IYD J;  3SJM A;  5IP7 J;  5JLW A;  2IRF G;  3OYH A;  2CV1 A;  1YRN A;  3ZP5 A;  2WTE A;  5JVT A;  3MEX A;  1UG2 A;  3OYK A;  1KYW A;  2R5Y A;  4BE1 A;  1MBF A;  3N4M A;  1LDD A;  2HOA A;  3J7Z I;  1D0X A;  2YU3 A;  3M9A A;  5FLV A;  1UJ8 A;  1BC7 C;  4M3F A;  3F21 A;  3DBL B;  1ZAO A;  3SXY A;  4XOR A;  3AL0 C;  1FX7 A;  1HLV A;  3H9J A;  1CF7 B;  2M45 A;  3OIQ A;  2XSD C;  2FE3 A;  2NOG A;  1HKS A;  2JPC A;  2P7V B;  1AKH B;  1MSE C;  2PN6 A;  1KU2 A;  5L3G A;  2XF6 A;  3OS0 A;  3M1C A;  4AU7 A;  2DXI A;  4NQW A;  5DEQ A;  4LMY A;  3VOE A;  2HGC A;  2DFF A;  2FOW A;  1ZG5 A;  2OJE D;  1KZH A;  3FDY A;  1LEA A;  2GWR A;  3GZ5 A;  3ZMT A;  3T0Y A;  4M3E A;  3RIR A;  4X6A J;  2VI6 A;  4E7H A;  4XOP A;  2M7A A;  2HEO A;  3H3V K;  4YFK F;  2I8D A;  2EK5 A;  3MKZ A;  2KZG A;  4KNY A;  5BQT A;  1WI3 A;  2A6E F;  4AIJ A;  4MO7 A;  4MQV A;  1MBJ A;  4YEJ A;  2JSC A;  3BTL A;  2BOL A;  2Z16 A;  2L9N A;  1A36 A;  3JCU C;  1XGS A;  3E7L A;  3GLX A;  2R0Q C;  1SMY F;  2LRD A;  1QQI A;  1A5J A;  1BR1 A;  2TRT A;  3D1N I;  1WJB A;  2Y0M A;  3G3Z A;  2TCT A;  1SAN A;  3E6M A;  4BJ5 C;  4I0A A;  3HG9 A;  1Z7L A;  4HSR A;  2ZBK A;  4IOA F;  4WF2 A;  4I2O A;  3DPL C;  4WXC A;  1T0F A;  2FA5 A;  1JTX A;  3OIP A;  4Y13 A;  3OYE A;  3B02 A;  1OYW A;  4UVA A;  2J5O A;  4N0B A;  3I4M J;  3FHN A;  3Q0V A;  2DQL A;  1WGX A;  2XV4 S;  2NYX A;  3HRU A;  5D6E A;  2R7S A;  3CCQ I;  4E7K A;  3UKG A;  2PMZ A;  1GVJ A;  5BNG A;  2F2E A;  1SD5 A;  3LSG A;  5E1W A;  3DEU A;  1UHW A;  2CJJ A;  2HU9 A;  3ZGK A;  3V4G A;  1FIA A;  2Y31 A;  2XKP A;  3ZQF A;  5D6F A;  2CQ7 A;  2A61 A;  1XPX A;  3OYG A;  5CYV A;  3G6E I;  2LG4 A;  4DJA A;  1MJ9 A;  2DA1 A;  2GOX B;  3DPU A;  4BYY A;  3OYB A;  1HKQ A;  2VC0 A;  4D5F A;  3K6G A;  4M9Z A;  1UB9 A;  3QU6 A;  1QNT A;  3A01 A;  5TIS C;  2NNY A;  4HLY A;  3WU2 C;  1Z3Y A;  3DKX A;  2QQ9 A;  4FE4 A;  4DZP A;  1QZY A;  1WQ2 A;  4XN0 A;  4YFN F;  1YLF A;  3TKY A;  2NVQ J;  1YIO A;  1IDY A;  2Y0S N;  1IJW C;  2L7Z A;  2K9Q A;  2V9P A;  2JMW A;  5CPR B;  1YJW I;  4WX9 A;  1POG A;  5FKO A;  1G3W A;  3EUK L;  1PJR A;  1Y56 A;  5IOY A;  5DM6 F;  5FFX A;  1IRF A;  1DGR M;  2XGE A;  3H35 A;  3LSJ A;  4F55 A;  3N97 A;  5JR3 A;  3BJA A;  2BXZ A;  3CCV I;  1R71 A;  2E2H J;  2CSO A;  2FQ3 A;  3S2W A;  3IRQ A;  3JAM Z;  4KN4 X;  2ISY A;  2E1O A;  1Z3X A;  2DDA A;  3J7A Y;  3QYE A;  5B66 C;  3CF2 A;  2V9V A;  4HNV A;  4S05 A;  4F52 A;  3I4N J;  3CCS I;  1T95 A;  2W7N A;  1P9Q C;  3NAU A;  4BY7 J;  4MTD A;  1T8I A;  4ZH4 F;  4FX0 A;  3WTV C;  2DFI A;  4EJV A;  4IXA A;  5HS8 A;  5J1R A;  4WWC A;  2AQE A;  2QZ8 A;  1ON2 A;  3CC7 I;  1TT5 B;  2R92 J;  4QTR A;  2EB7 A;  2NRA C;  2M9H A;  2V26 A;  1GXP A;  5CLS A;  1WHU A;  1RRJ A;  2F48 A;  2VBW A;  5EZH A;  4AVP A;  2K3P A;  1IRG A;  3K9T A;  2PEX A;  2H8W A;  1EH8 A;  2KRH A;  4P9U A;  1TQP A;  2E71 A;  4HDU A;  5E3L A;  3ZN0 A;  4XQF A;  3AL0 B;  4G12 A;  2KIS A;  4UHT A;  3QAH A;  1GVD A;  2OD5 A;  3FZV A;  3GXO A;  3QPL A;  3OL4 A;  1XX5 A;  2IBD A;  2WB1 N;  2Z1D A;  2NVU B;  1H88 C;  3BG6 A;  3RPQ A;  1YE9 A;  5LGN A;  3FIS A;  1X1P A;  4KN7 X;  2D2W A;  4CCJ A;  3CCU I;  2E7X A;  4ENJ A;  2Z99 A;  1H89 C;  1ZHF A;  3M8E A;  5GTH C;  2Z33 A;  3HOV J;  2FBK A;  5E20 A;  2Z3Y A;  3ZPL A;  3DP7 A;  2V1U A;  4EM2 A;  2HKX A;  2VQL A;  3HRT A;  5KCM A;  2CV0 A;  4OIP F;  2VBY A;  3V42 A;  5AON A;  2DMP A;  2A5Y B;  4BEH A;  3QRF F;  3C1D A;  1K6Y A;  4R1H A;  3GTL J;  2L9V A;  1FOY A;  1KU3 A;  2HXI A;  2KRC A;  2JVG A;  2PQ8 A;  3COA C;  2VJJ A;  3HXL A;  1GT0 C;  3HZJ A;  2O5R A;  2HR3 A;  3KLN A;  1UEL B;  3PSF A;  1IAW A;  4ZZD A;  2D1V A;  5HNH A;  3CJQ B;  2ZNY A;  3BY6 A;  3K4C A;  3V8J A;  2RN7 A;  2R7F A;  1ETW A;  2HQ5 A;  2ZJ2 A;  5FLX K;  1QHG A;  3KX2 A;  1ETO A;  5B3S H;  2EZI A;  5HLH A;  3CTA A;  4RB2 C;  2M30 A;  4XRM A;  1A35 A;  4A3K J;  2LR8 A;  4RM2 A;  4U0V A;  3OR2 C;  4L0Y B;  2VJ4 A;  3LFK A;  3LAJ A;  1I6H J;  2P0W A;  3TL4 X;  1QU3 A;  2K4J A;  2FRH A;  1VF9 A;  2LSO A;  2XSJ C;  3TP3 A;  2X0L A;  3KCC A;  1O3S A;  3IH2 A;  1U8B A;  2ZJQ F;  2UXX A;  2QWW A;  1HKT A;  1NK2 P;  5B5E C;  3H5A A;  2LY2 A;  4Y52 J;  4MHG A;  3CJT B;  1XGN A;  1MH4 A;  2ZC2 A;  5DUI A;  2RVC A;  2H94 A;  4FX4 A;  4M73 A;  4I99 C;  3ASN H;  3E3V A;  2VOO A;  3CCE I;  2D5V A;  1U9N A;  1LNW A;  4OU0 A;  2O3F A;  2FBI A;  4GRI A;  4U7D A;  4AYB N;  1NH3 A;  5HOD A;  1EJ9 A;  2COM A;  3M3Y J;  1SMT A;  2CS3 A;  3LOC A;  3JRA A;  1Y1W J;  2LKX A;  2PLY A;  4UV9 A;  1OIS A;  2M0M A;  1AHD P;  2MG4 A;  3F0C A;  1X3W B;  1N75 A;  5DTD A;  1T98 A;  2PMU A;  1DQU A;  3G4S I;  3VYS B;  3F8N A;  1MIJ A;  1XMX A;  4Y4R A;  5CQE A;  5ILU A;  5BPD A;  4O5V A;  1MMG A;  1TQM A;  3FMR A;  4KIC A;  3JTH A;  4LIV A;  1Z9C A;  2FUG 2;  3AG1 H;  1WRJ A;  1UHM A;  5GPA A;  3GFI A;  4IF4 A;  3PQJ A;  4CXF A;  1ZR4 A;  1R7J A;  3VYU B;  5JVG F;  1XCB A;  3LST A;  3HB9 A;  1AU7 A;  3IRR A;  2JA7 J;  3DLL F;  1IW7 F;  1PUE E;  2BE5 F;  3OYA A;  5H6R A;  3R61 A;  2VQG A;  1FBU A;  1K83 J;  3IP4 B;  3OOU A;  2G9W A;  2GIZ A;  2EZK A;  5D8L B;  2FU4 A;  3A03 A;  3ASO H;  1XTA A;  3O8G A;  2Q2E A;  3FXU A;  5E8I A;  4N4N B;  4HV6 A;  3B6C A;  4M3G A;  2XUB A;  2LRE A;  4GYI A;  2O61 A;  2M2E A;  1HA8 A;  3MZH A;  1TQI A;  2MD0 A;  3KEQ A;  2CW7 A;  1D0Y A;  4XBF A;  4LOC A;  1JJ6 C;  3BPX A;  4MFD A;  3TW7 A;  3L9F A;  1Z21 A;  5L3D A;  1LFU P;  1X2M A;  2HTS A;  5CVJ A;  4ZYG A;  4Y15 A;  3BTJ A;  2UWM A;  4EJT A;  4HX7 A;  1JGS A;  1ETX A;  5GAH J;  3MD2 A;  2HXO A;  2DI3 A;  4LK1 F;  5ICC A;  1OJL A;  1HF0 A;  3BR5 A;  3MKY B;  2VKE A;  5J47 A;  1NTC A;  2QSH X;  2KJB A;  4M6V A;  4IZZ A;  2XPU A;  3QOE A;  4Y17 A;  3HOX J;  3GWZ A;  1K78 A;  3JRB A;  2QLZ A;  3MKW B;  3HUG B;  2R93 J;  1BW6 A;  2DMQ A;  4RB0 A;  4N9H A;  3I3L A;  1UAA A;  4BHC A;  3HKZ N;  2QQB A;  1DU0 A;  2G7U A;  2O9L A;  2M0C A;  5ILV A;  1UST A;  4ZYE A;  1V54 H;  1OCZ H;  5LGT A;  1XG1 A;  2OBP A;  2WAQ N;  1ZN2 A;  2R5Z B;  1FOK A;  4U0Y A;  3CD6 I;  3DPT A;  3ESW B;  2DOE A;  2R7O A;  2R7Q A;  3HOU J;  2HZD A;  2W84 A;  3EPZ A;  4F91 B;  1Y8R B;  4NBQ A;  2YUS A;  1R1T A;  2ACJ A;  1B8I B;  3KP6 A;  2DT7 B;  2GXG A;  2HQA A;  2V1N A;  1IXS B;  3K1N A;  1JKO C;  2RC4 A;  3DLA A;  3LNQ A;  3IKT A;  1ONV A;  3EUA A;  3BJ6 A;  1UZC A;  2IXS A;  1R49 A;  3U2R A;  5HDK A;  1LB2 A;  2XKO A;  5H20 A;  4DYR A;  3TMO A;  4BXF A;  2OF7 A;  2QSF X;  3SYT A;  2CW0 F;  2DA7 A;  1FMV A;  4CYC B;  2E2I J;  3ZRG A;  1O4X A;  2PX9 A;  1G2H A;  2XIG A;  1IRX A;  1S3J A;  2HDW A;  1CF7 A;  4NC7 A;  1SFO J;  2ZXW H;  2E7W A;  1F4K A;  1WWX A;  3GME A;  2JRM A;  4FQG A;  1ZGA A;  2L02 A;  1JT0 A;  2NVX J;  4B47 A;  1T08 B;  4LIU A;  5DV5 A;  3WTY C;  3JRH A;  1QA6 A;  2OUM A;  3I58 A;  2OZU A;  4XSX F;  3FM5 A;  1MKM A;  2NAZ A;  1R1V A;  2VUM J;  4Q5S F;  1S9H A;  4J00 A;  1S7O A;  3H3Z A;  3GTO J;  1V5F A;  2E2J J;  2K02 A;  1TW2 A;  3BPV A;  3NWT A;  3JRC A;  2LF8 A;  5F6F A;  4E7Z A;  2EJR A;  5LBQ A;  4KJZ A;  4Q48 A;  3EQL F;  3ZXS A;  4IX7 A;  2STW A;  2RQP A;  2Z2S B;  5KNL A;  2EV5 A;  1FWZ A;  1OFC X;  5HLI A;  2FXA A;  2V1D A;  5HLG A;  2FF4 A;  1O7F A;  2PMH A;  3QYB A;  2L0K A;  2BVM A;  4F92 B;  2W48 A;  3I59 B;  2LBF A;  2JA8 J;  2Y30 A;  1O3Q A;  2OQR A;  4MLO A;  3VOD A;  3JAM K;  3ZMU A;  5EEA A;  1BOA A;  1SAX A;  1D1A A;  2G0E A;  3S14 J;  2R7U A;  2HI3 A;  3P9C A;  2QQ8 A;  5CVR A;  4CZZ A;  2KT0 A;  5JFR A;  2VPL A;  3BCA A;  4RAY A;  2FOK A;  3EUH C;  3ZN1 A;  3WGI A;  2L7M P;  1FYM A;  1ITY A;  1PUF B;  2WAD A;  4RAF A;  2E1N A;  1DPU A;  3KYL A;  4Y3O A;  1U8R A;  2GXB A;  3VEP A;  2UXN A;  2FML A;  2H09 A;  3BG7 A;  4OMZ A;  1W0T A;  4B3A A;  1BL0 A;  1JXS A;  2ZXJ A;  3S17 J;  4ON0 A;  1VQN I;  2HOS A;  3OWT A;  1OKR A;  5A2Q K;  4IQJ A;  1XB4 A;  3ISP A;  4KT5 C;  3EYI A;  5E3N A;  4HV5 A;  3Q5F A;  3J81 Z;  3OSG A;  1BBY A;  4RB1 A;  1J2X A;  4XOT A;  3L09 A;  4DZJ A;  3ZQC A;  1BN5 A;  3BR2 A;  2WB1 A;  2DA5 A;  3O8H A;  4NB5 A;  1YW8 A;  3SDB A;  3KFW X;  2E19 A;  1W7P B;  3ABM H;  3HBL A;  3KPH A;  3I0T A;  3T8T A;  3D5L A;  2K9S A;  5CVU A;  3DU5 A;  3WTZ A;  4CDG A;  2ISZ A;  2E5N A;  1W5T A;  2K4B A;  2M1B A;  2CUZ A;  2JWT A;  4ZC3 A;  4B44 A;  3GX4 X;  4BL0 B;  4WXH A;  3FBI B;  1D8K A;  2OZ6 A;  2OC6 A;  3BR0 A;  1A04 A;  1VQ8 I;  4XRS G;  1PYV A;  2O8X A;  1T38 A;  1MSF C;  1WJD A;  4EJU A;  2CH0 A;  3PO3 J;  5DD8 A;  4AID A;  1YW7 A;  2HVR A;  3BP8 A;  5J40 A;  3V8L A;  2A68 F;  2Z9O A;  1W5C C;  2A05 A;  1G3T A;  2COB A;  1V3F A;  3L2U A;  4UNO A;  4UY8 I;  2M4G A;  2MC3 A;  2Y75 A;  2ECC A;  2WY7 Q;  3A0H C;  1P92 A;  3D5S C;  5FFZ A;  3JRF A;  1YS7 A;  1EH7 A;  4QIW N;  1YX5 A;  1A31 A;  2IJL A;  3I54 A;  1F5T A;  4KIT B;  5LEK A;  1X1B A;  4LFU A;  3CF5 F;  3F9K A;  3WOD F;  1WFX A;  5J6X A;  1R5H A;  3KP5 A;  4BQQ A;  5D5W B;  3ZQL A;  4JQF A;  2AS5 F;  4CYD A;  5DCM B;  4DOZ A;  2FNA A;  1TL8 A;  3DBR B;  3VB2 A;  1Z6R A;  2CUE A;  3M8J A;  3OYJ A;  1ZR2 A;  3ZQG A;  1U5T C;  3L2V A;  1SFE A;  4L9V A;  5EYR A;  1D1B A;  3E1S A;  3V8K A;  4BGD A;  5FD6 A;  3PFY A;  3BR6 A;  5BPI A;  2MH2 A;  4XKW A;  4BS9 A;  3ELK A;  5HNF A;  3M07 A;  4B8X A;  4ABZ A;  4E7S A;  3LSI A;  4I7H A;  4KDP A;  3E6D A;  1MBE A;  4BJ6 C;  1ZG3 A;  4XLA A;  4UUS B;  2FD5 A;  1LJ9 A;  2YS9 A;  4P5O A;  1B4A A;  3U1K A;  2M7B A;  1R36 A;  4C3I J;  1SFU A;  1ACI A;  1ZTR A;  1NHA A;  1FLI A;  1SD7 A;  2L9S A;  2QVO A;  1IUY A;  4HA8 A;  4QSH A;  1R58 A;  2XAJ A;  1JE8 A;  1M1E B;  1YHQ I;  5HVQ C;  2YSR A;  4Q4Z F;  3CUQ A;  4RM3 A;  3G71 I;  1DUX C;  1IXC A;  3TGN A;  2GLO A;  4Z2Y A;  2LNB A;  2MH9 A;  3JRG A;  3S32 A;  5M5W J;  1WJ5 A;  1QRY A;  3CP2 A;  4DYC A;  2F5C A;  2QM3 A; 
#chains in the Genus database with same CATH homology
 2Y69 H;  1V55 H;  3X2Q H;  3ABL H;  5IY5 H;  1OCC H;  3AG4 H;  2EIL H;  3ASO H;  2EIN H;  5B3S H;  3ABK H;  3ABM H;  3ASN H;  3AG1 H;  1V54 H;  2EIJ H;  2EIK H;  1OCZ H;  2DYS H;  3AG3 H;  5B1A H;  2OCC H;  3AG2 H;  3WG7 H;  2ZXW H;  2EIM H;  1OCO H;  1OCR H;  5B1B H;  2DYR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...