2EILH

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eilH00
2EIKH 3AG1H 2EIMH 1OCCH 3AG2H 2OCCH 2EIJH 2EILH 5B1AH 1V54H 5B1BH 3ABLH 5B3SH 1V55H 3ABMH 3ASNH 2Y69H 1OCOH 3ASOH 3WG7H 3X2QH 1OCZH 2DYSH 3AG4H 2EINH 5IY5H 3AG3H 2DYRH 1OCRH 3ABKH 2ZXWH
chains in the Genus database with same CATH superfamily
3E6BA 2QYOA 2DW4A 1MJAA 2F5EA 3GUDA 1IW7F 4A3BJ 3CJQB 3HYIA 3TKYA 4BYYA 2CU7A 2EA2A 4BE0A 2IGNA 3GWZA 1IRGA 4PFOA 2I10A 2CUEA 4XBFA 4IHTA 1KONA 1LE8B 3RIRA 2EPFA 4IF4A 4N4NB 3NQOA 2BHZA 1G2HA 2KRCA 4PK4A 3SXYA 2N8GA 1WJCA 2BVLA 3GTOJ 3OL3A 3IHUA 1YE9A 3RCOA 2ECCA 3IAM2 1XN7A 1V5FA 1OCCH 1FSEA 1IJWC 2E60A 2LY2A 2WV0A 1ERDA 5JI6A 2HKOA 3SZTA 1IN6A 3VYTB 1IDZA 3S14J 3VEPA 3KLOA 3VWBA 2DTRA 4IPAA 4XRMA 1KGSA 2L01A 3X2QH 2CSOA 1R6RA 1PYVA 2MD5A 1YITI 1VQKI 3K6GA 1BIAA 4BBRJ 3ZPLA 3REOA 3GTGJ 2YSRA 1JJ8C 1DP7P 1RR7A 3CJRB 5LHGA 1QQIA 2O5RA 3BPVA 2MH2A 2WB1N 3LSGA 4B47A 1LDDA 1IAWA 1LDKB 4CUGA 2VQCA 4EMSA 1D0XA 2LH9A 2E1NA 4A12A 4BBSJ 1MZBA 3HRSA 4CCLA 2OUMA 4JX5A 3QYEA 2K9MA 4ENMA 3WGGA 4IO9F 3TQNA 3Q0VA 4Y7NJ 2HEOA 3GLLA 1TWHJ 2IA0A 5K7ZA 3CESA 1XS9A 5DCMB 3TDZC 2VBYA 1K6YA 3FBIB 1YX5A 2WY7Q 3VOEA 4G6QA 4HX8A 1N78A 2F5VA 5F08A 2L54A 3PIPF 4FCYA 3FXLA 3L2RA 1KYZA 1JKPC 1HW2A 3G3ZA 1DU6A 1FBUA 1ZTRA 5F04A 1ZGWA 2VJ4A 1P7JA 2X6XA 3KYCB 5DYMA 4ZJZA 4ZYEA 1D8KA 1TP4A 3GTPJ 1QBJA 1W7PB 5ED4A 3FZVA 1LFPA 4XKVA 2GXGA 3HM5A 3S32A 3HOZJ 2L5QA 4Q4ZF 2R7QA 2O9LA 5LGUA 2EH3A 1MBJA 4RBOA 1TWGJ 2OU2A 1B72B 2M34A 4A3MJ 3A2KA 2OTLI 5DS9A 2Z1DA 1W1WE 4MEXF 4WWCA 3L2CA 3M07A 2YUSA 1RRJA 1S9HA 2HZTA 2LBFB 4ESJA 1EH8A 4BQNA 3FBNB 2O03A 5JR3A 3A01B 2IJLA 2VN2A 5HS7A 2Y2ZA 1OCZH 4D1QA 3CCUI 3DLAA 3O3KA 2FOWA 3L9FA 1MSFC 2AXLA 2FE3A 3ZQIA 2CH0A 2HOEA 1TQMA 1TL8A 1EKEA 1AKHA 4BEHB 1VQ8I 3C2GA 1B6AA 1MBFA 1W7PA 5B1AH 5IP6A 4H0EA 4E7KA 2V1UA 4I7HA 1OQYA 4JYKA 2NVTJ 3QOPA 3G1OA 2ZXJA 1R7JA 2IGMA 3DEWA 1ZLKA 4CDGA 1LEBA 2LF7A 4KIBA 1QZZA 3K9TA 4JOMA 1ZN2A 1JE8A 2EFQA 2KJBA 3FHNA 5TISC 3O8GA 3BJOA 2VB6A 4XRSG 1QRYA 1V3FA 3JAMZ 3BR0A 5KNLA 1VQ5I 2XASA 1A35A 3RI4A 1XSDA 3FX3A 1IUFA 2Y48A 3R60A 3VODA 3A01A 2V9PA 1FYMA 2YS9A 3R61A 1Z67A 3IC7A 3OR2C 1SANA 2RAEA 3SDBA 1Z1DA 1JKOC 4UVAA 2RV8A 5EJCA 2PJRA 1OCPA 5K5QA 2XGXA 4CCOA 4BEHA 4A3GJ 4A2UA 1L3LA 2DPUA 4GCVA 3ERMA 2CV0A 1KU2A 1W36D 4L5EA 2Y9YA 2F4IA 3G1MA 4LG3A 1JT6A 4BJ5C 5IP7J 2OQGA 1PJRA 3S2HJ 3QODA 4D5CA 3LMMA 2W85A 3BCAA 5KAFC 1T39A 4HF1A 1Y0UA 5C4XJ 4E6KG 4F55A 1S72I 3H3UA 5JVTA 3JRIA 1LVKA 3QWLA 4LJZF 3HTSB 4XOPA 4II2A 1N25A 5FD5A 4U7BA 2QM3A 2CS3A 2M5WA 2R7WA 4ZZLA 3ZQ7A 5GTHC 2FSWA 3GCMA 2EJRA 3T8RA 3BP8A 3ECHA 2AQEA 4A5NA 3KCCA 4CZCA 5D4RA 4RB2C 1HXDA 4ITVA 4HG2A 4RMNA 3WTUC 2A61A 1HSTA 3JRBA 3RKYA 2Z16A 1UB9A 1YO5C 2RVCA 4L9TA 4IX7A 2VUMJ 3ZXSA 1FP2A 1OR7A 2KHMA 1X3WB 4BU2A 1X2MA 3H3VK 2O8XA 4ZDLA 5FKOA 4EJTA 4X1EA 4X0GA 2K4BA 4QIWN 2Z2SB 4MIMA 2LK2A 2JA6J 1MMSA 1DU0A 1QZEA 1BI3A 1LFBA 2DPDA 4U0VA 3EDPA 5E3MA 2R5YB 3H5NA 4G94A 2NS8A 3QPLA 3K4CA 2YU3A 4R1HA 1BI2A 2EILH 2HTSA 1D1CA 2HOSA 2F2EA 1SD4A 2L3DA 1GXQA 1BJZA 5B66C 1ZRDA 4V2FA 1SEUA 3ZQCA 3GX4X 2MYSA 5L3BA 2NVUB 1OYIA 1R36A 2IT0A 2VIXA 2VJIA 4NHJA 1TNSA 2F5DA 2KRHA 3H35A 2PMHA 1SFEA 3FM5A 2QQBA 2VXDA 3HGYA 3L1PA 3HL2A 4EGYA 3J81K 2IS1A 3GF2A 4U7DA 2HQ5A 1HSJA 2JA5J 4YFXF 1YIOA 4G7OF 3PNVA 4II3A 1GVDA 3CCVI 4KIGA 3G71I 4XNFA 1E0EA 4I0BA 3WE2A 2A69F 4C9YA 4KJZA 2H8RA 1N77A 1KQ8A 3DF8A 1UG0A 5DUIA 3JRFA 4Z6YA 1TWAJ 5IT9K 2DK5A 2HVQA 4DJAA 2OBPA 4CICA 2P0WA 1ZYRF 4LB6B 3RTRA 4KUMA 4HDUA 1HBXG 1S6LA 2QLZA 3RDIA 3CJNA 4N4OB 1Y1WJ 5M3MJ 4FT8A 1R23A 3ELKA 4PZJA 1R71A 5BPDA 2KZGA 3GTKJ 4BQQA 2VBZA 5L3DA 3JR9A 5FKMA 3SFZA 3T1BA 2ISYA 1A36A 3CC2I 3LWFA 2BY2A 3F0CA 1XD7A 2DLLA 3ASNH 1I6HJ 4L18B 2DU9A 2OZ6A 3E6CC 4RAFA 3HEFA 5AONA 1ETKA 1PUFB 2FEZA 1U5TB 1Y8QB 1DQUA 4M3DA 5M5XJ 2OV7A 2WC2A 3TO9A 2UWMA 2M87A 2DAOA 4LD5A 1VFCA 3WHCA 1B9MA 4P1WA 2LTPA 4ON0A 3DU6A 5ERIA 4NB5A 2KP6A 2CUFA 2EFPA 4RGUA 2A05A 5JVGF 4IXAA 2KIMA 1KU7A 2LMDA 2DQLA 3ZQHA 1EH6A 1R1UA 4L5JA 3S2WA 5CPRB 3S1RJ 4HX7A 4BE1A 1OCRH 1XSXA 2ZNYA 1YJWI 3BG7A 1I1GA 1Y6IA 4LOCA 4BY1J 2DA5A 3OMYA 1IN8A 3I4PA 5FFZA 3K69A 3ABUA 1R1TA 4B09A 1U5TA 1T38A 2QKMB 4HPQA 4OIPF 5FGMA 2QSGX 2V9KA 4XSZF 4F52A 1X1CA 3GLXA 2DYSH 2DA7A 1HC8A 2MD0A 2PFBA 4IHYA 4C30A 1Z7LA 2LR8A 3BY6A 2M4GA 1LEAA 2K5CA 3TGNA 4XRSA 2W24A 3SYTA 3DV8A 1MJ9A 3T8TA 4E7IA 2P5KA 4IVNA 3E6DA 2G7UA 3N4MA 3SZGA 2K9QA 4XM3A 1XSVA 5D8KB 5E3NA 5HLIA 1X3UA 1Y0NA 4OMZA 2CWEA 3HOTA 4N9HA 3PO3J 1RESA 2H1KA 1X1AA 2XSJC 1QGPA 2V7FA 4M3BA 3DU5A 1WGXA 3S8PA 4FISA 3R0AA 4HAMA 3RPUD 5DCFA 4NBQA 1BW5A 1VF9A 3OSFA 1MMNA 1YQAA 4KA4A 1HDDC 2JMWA 3BTCA 3HHGA 1V4RA 3IH3A 4L9NA 3RJPA 4UV8A 3RKWA 4E4HA 4XR6A 1FIAA 1USTA 4IHVA 4BGDA 1WJDA 3LSPA 2K3FA 1FSHA 1T56A 3F6VA 2R4GA 3PFYA 3HXLA 4UHTA 4XL9A 1FLIA 4DW6A 4XN3A 5DD8A 1UMQA 3EUHA 4S0HB 2X48A 3L2QA 4RB1A 3GYHX 5LLQA 4A93J 3LAPA 2Z9OA 3KP7A 3JRAA 1FTTA 3EPZA 4I76A 3ZMZA 5D5VB 3E3VA 2BV6A 2Z33A 2PJPA 2HI3A 2ZFUA 1SD6A 3ISPA 4A0ZA 1UJ8A 4UXNA 1AWCA 2KQRA 3W2VA 3CCJI 4LLLA 3ROUA 5F0HA 3E0JB 1MD0A 2BY1A 5HNFA 2EV0A 2L7MP 2DJNA 2VT2A 1LDJA 1FY7A 1OYWA 5CQGA 3V7RA 1ZH5A 3K0LA 5ICEA 4A3IJ 2VPLA 3QP6A 2ZJPF 4BDZA 3M1EA 3Q3SA 3AG1H 3J7AY 2D1VA 4Q47A 3N97A 5FLMJ 2DFEA 3DXJF 3FXUA 3QU6A 1DPRA 1WJFA 5DUKA 1QPMA 2H6CA 4MGRA 1YS7A 3K2ZA 1T6SA 1RPWA 3NAUA 1TQIA 1N75A 3Q5FA 2A6HF 2NXNB 3BTIA 1FBSA 2FQ4A 1BOAA 3DWLE 4IZZA 4C2UA 2X0LA 3F8FA 2MLKA 4G9YA 2R0QC 3HKZA 1IC8A 3BC8A 2FJ1A 1YX3A 4BHPA 1ZK8A 1T33A 1AHDP 4NUBA 3ONQA 3WG7H 2J5PA 3M4OJ 1AOYA 3ZQFA 1ETOA 4KN7X 1CQTA 4Y15A 3ZQGA 3L00A 3PNYA 2BZTA 4EM1A 1JKRC 1G3TA 4FX0A 5GPAA 1FZPB 3J7AO 1XTAA 3HC7A 3DBLB 3WTYC 2MA3A 2M45A 1H89C 2M30A 2D45A 3GFMA 1WVRA 1MBEA 5CVVA 3I59B 3FXMA 2O0YA 3K4MA 2QVOA 2DA1A 1HCRA 1YRNB 3UKGA 2EZKA 3K2AA 4DQ2A 1MDMB 2BGCA 4L5IA 3BG6A 4AIDA 1BC8C 2MFZA 3K7AJ 2ZJ2A 2QEXI 1IDYA 2HXOA 2VBWA 2Z99A 5HS8A 5HLGA 4Y4RA 2DJIA 3HOYJ 3RYPA 3IV5A 3FIWA 1OPCA 2YU9J 5LGNA 1MSEC 2KL4A 3F6OA 3K70C 5IOYA 1J75A 4TV7A 1V54H 3H0DA 2EZHA 3R6SA 2VOPA 1NH3A 4N9IA 5FROA 3KYLA 2M7AA 1ZR4A 3HOWJ 2Y75A 3SFIA 3GTMJ 1YJNI 4MNUA 4B4CA 3QP5A 5EEAA 5E1WA 4BJTA 4CA0A 1XCBA 4DGWB 3OS2A 4BKXA 2E5ZA 1VQMI 1YRNA 3EETA 2RNGA 3JRGA 3DKYA 3W6VA 1TQPA 5JHUA 1XDUA 4DYQA 4XONA 2JJ7A 1POGA 1WJBA 2COBA 2VE8A 1QHHD 3KFWX 4RM2A 3M8JA 2COMA 2WAEA 3CF5F 4CCKA 5D4SA 2L9SA 3WU0A 3FXOA 1VNDA 2FRHA 4R79A 2QQAA 1IGNA 1U2WA 4KNYA 2LOOA 5HS9A 2CRGA 3I9V2 1X1PA 2QA4I 3IAS2 4M71A 3DKXA 3MMYB 1Z9CA 4XRFA 1UHSA 3E97A 2QUFA 3KETA 4LK0F 4NC8A 3ZOBA 2HYFA 1G3WA 4KISA 4S04A 3OIQA 1SVOA 3RPUA 2XGEA 1GT0C 2NAZA 1UELB 4NC7A 2E7WA 3TMOA 2V4JC 1D8JA 3ZMTA 4OOIA 4YIIA 1U9OA 3BWGA 2Q2EB 1D0YA 2DA2A 4DYRA 2IEKA 4OAYA 4UB6C 5J1RA 1BOBA 2FUG2 3VSKA 5FLVA 3S3OA 3WODF 1D1BA 1ODDA 3TOBA 5ICGA 2V79A 5KHDA 1ITYA 1GDTA 3BTJA 3KE2A 1K4TA 3DCFA 1V5GA 1P4WA 4FX4A 2DCEA 3QRFF 1VQOI 3ZR8X 4HLXA 1L0OC 2JRMA 4G6DA 4KYWA 5B1BH 3FXKA 2DODA 2KIFA 2CO5A 1MMGA 2F4OB 4M3EA 4DIQA 4E7SA 1IN7A 3LSKA 2VL8A 2ETHA 4H4KC 4RDUA 2VPRA 3C7JA 4YRVA 4NQWB 1I39A 4Y3OA 1WH7A 1U3EM 3D1NI 4G8XA 1S7EA 2M9HA 3ZQLA 3DPLC 2BY3A 2F5FA 4DNCA 3BLYA 3FDYA 3H1CA 3I0TA 4YIRX 2PI0A 4BAYA 1LE8A 4UY8I 2CW0F 3BR5A 2Q2EA 4E7JA 1I3QJ 3EYYA 2O3FA 2HXIA 5D8LB 1IO2A 3KEYA 3SHFA 4V2GA 1ZG3A 4PSWA 5ILUA 2HOTA 2EZLA 2JVHA 3HUGB 1I3AA 3FWEA 3Q0UA 4I98B 3PUFA 2XPVA 2OPTA 1UHWA 3OIOA 3QPSA 4DOZA 5K5OA 2RREA 2MLGA 1GUUA 1MH4A 4XLEA 3S16J 1BR2A 1ZREA 2WAQA 2G9WA 4MTDA 4B3XA 1U78A 2DO7A 1KA8A 3CTAA 3KP5A 2XUBA 4NQWA 1ETYA 2DDBA 3G73A 1AU7A 3WGHA 3PFIA 2LREA 3FMQA 1J2XA 4B3AA 2HDCA 3IWZA 2M0MA 2JA2A 3I4NJ 2GA1A 3PIOF 3V4GA 3I53A 3CMYA 5JLWA 1GXPA 1G6NA 3OL4A 4HSTA 1NTCA 3MEXA 3BG3A 4O5VA 2OTJI 2F48A 2DMPA 2LKSA 3CLQA 3CMEI 5IP9J 1OYYA 2R7XA 3HUGA 3KEOA 3JCUC 3I5UA 2JTVA 1JUPA 5BMZA 3RKXA 5KVRA 5F1RA 1MNDA 2O61A 2XKOA 3JAMK 3BQYA 1J9IA 5HNHA 2PX9A 3KEQA 3FMRA 3Q9SA 5EZGA 3VFZA 3FMSA 2X9DA 9ANTA 3HSRA 2LDUA 3CDHA 1Y8RB 5DCMA 3CCQI 2K85A 3CC7I 2KIQA 3EYIA 2MGQA 1J5YA 2K40A 1SMYF 2QKLB 2XAGA 2XSDC 1SMTA 2M0CA 4QTRA 2W25A 1R5HA 2OC6A 2HGCA 1XMAA 5F1JA 1BL0A 1R49A 1Z6RA 2CUJA 1IRXA 3BR1A 1QA6A 1WWXA 3SQNA 3M9AA 2H94A 5B3SH 1MBGA 3FK6A 4MFEA 2BBYA 3W6JB 4G7HF 1K4SA 3G6EI 4IRHA 4FTHA 3GZ6A 1B72A 1O57A 3ASOH 4A0YA 2ID3A 3JTGA 3GTLJ 2X51A 2W7NA 5BPIA 1A6QA 3F9KA 3LSMA 4GYIA 2LBFA 5J8CA 3BOQA 4OU0A 3S1NJ 1D5VA 3CCEI 3IRRA 5TGTA 4W97A 4RAGA 4PJMA 2EIJH 3BROA 4L0YB 2CQKA 5FKLA 2FX0A 3OS1A 2R7RA 1EH7A 5L3EA 1DGWY 2QQ8A 2LY9A 1R58A 4F93B 1B1BA 1WJ5A 3CUQB 3WGIA 2UXXA 2XKPA 5K1YA 4HNTA 1FT9A 3QYBA 3QU3A 1X19A 4ZYHA 4Q5SF 5HLTA 2EB7A 3T0YA 2VE9A 5LD2C 2E7XA 3P9KA 3J80K 1J09A 2GAUA 3H0GJ 4A3DJ 1JT0A 1BW6A 2DT5A 5AIQA 2ISZA 3HPGA 4XKBA 3RZOJ 1WH5A 2CW7A 3BTLA 3E5XA 3VDXA 1OCTC 2G0EA 5D5WB 4ASNA 1E3OC 1MKMA 4FQGA 2ZNZA 3CO7C 1R4NB 4JP0A 2K9NA 2B0LA 3I4MJ 2R3SA 5E20A 3VYUB 1OJLA 5H20A 2UUZA 1V5EA 4F91B 3IP4B 4IQJA 3HIFA 1Z91A 4O6JA 2Z5UA 3G1LA 5DM6F 1FPQA 5E8GA 4CZZA 1X4PA 3MKZA 3EUAA 2XF6A 3I71A 1XGOA 4C3JJ 4RAZA 4XN0A 2JSCA 3H5AA 2ZCWA 2EQRA 1HW1A 2NVYJ 1VQ9I 1R00A 5F64A 2JZYA 4HQEA 4LMYA 4DBQA 2VJJA 1LQ1A 3K1PA 3I58A 1NG7A 4XLPF 4D9JA 2GLOA 5IOZA 1RKWA 3FKJA 2ZXHA 2BHYA 4D7NA 1KQ9A 3HRTA 1F5TA 2QBYB 3F72A 2LC2A 2X6WA 3K4JA 2ME0A 3V7SA 4A3CJ 3CUQC 4A5MA 4BQAA 3BJ6A 1X58A 3TO7A 1EF4A 2BXZA 4E70A 4XIDA 1ETQA 4U0YA 2HU9A 5F0FA 1FOKA 2RQPA 4HNVA 4ZC3A 5FLXK 3WTXC 2VKHA 1IN4A 4I01A 4EEFG 2GZWA 3A02A 2NNYA 1KZHA 3H9GA 5GP9A 1GV5A 2MC3A 5H2FC 5JHFA 2CGPA 2PQ8A 1D5YA 2LNBA 1XB4A 1ZGAA 4QWQA 4MEYF 1ZRCA 5DD4A 1W0UA 2R7SA 5C4JJ 2B7EA 3DEUA 3DPUA 2O7OA 4C3IJ 1ULYA 2ECBA 2R7TA 4M6VA 2XGCA 2L4MA 3GO5A 4IL6C 5IT3A 1T2KA 2QGUA 4ZTFA 2VI6A 2NVXJ 1USSA 2QBYA 2JK3A 2FBHA 4ZDOA 2R7VA 4B48A 1A6IA 4CYCB 1C0WA 2R5YA 2FMLA 5TRDA 1R5ID 1ON1A 2P5LC 2CG4A 4M9SA 1O3QA 2CYYA 2MW8A 3AL0B 5DEQA 3WE3A 4A0XA 1BI0A 4I0AA 5J1YA 1UAAA 1BC7C 1G3SA 1FMWA 4M6XA 1XMXA 5EDNA 3C18A 1Z05A 1UG2A 3GEZA 3LOCA 4HQMA 1HKTA 4XKWA 5GPCA 1NK3P 5M5YJ 1LUJB 1DUXC 2MSYA 1R4MB 3CLOA 4J00A 2LRDA 2P6TA 3PQKA 4OAZA 4Y17A 2GXBA 4LLGF 2KLOA 1HOMA 3K70D 5E17F 4CYDA 3C2BA 1FIPA 4E7ZA 3CMAI 2DA3A 1CF7B 3PQJA 1G4DA 3L09A 1B9NA 2LF8A 4FHTA 3TW7A 3WTZA 2TRTA 3P5JA 1Z21A 1YS6A 4HYEA 2V6EA 1TC3C 1H8AC 4QSHA 1IXRC 3KZZA 4F3QA 3J81Z 1VQPI 2AS5F 2DQRA 3M8FA 4EJUA 5DDGA 1WFXA 3HHHA 3OYGA 2LY1A 3RQIA 5LEJA 4J19A 2V1NA 2XPUA 3B6AA 3OYNA 3F3XA 4C2TA 4XSXF 2LFBA 1HDPA 2PMUA 2FXAA 4UUSB 1NK2P 2L7ZA 3HOVJ 5J4YA 1YW8A 3TOAA 2M8EA 3VYSB 2MG4A 2R93J 1LJ9A 4V19K 2JN6A 4KMUX 2STWA 2X4HA 2WWYA 2W1OA 1S29A 2CFXA 2Q1ZB 3DTIA 1TT0A 4ZZDA 4E7HA 3PM1A 2QENA 2E1OA 4I99C 2EK5A 2ADUA 3OV8A 1YW9A 2HNHA 1PUFA 1D1AA 2HVRA 2KRFA 3M7GA 5JLXA 3FXJA 1KU3A 5CVIA 1FP1D 3GZNB 1CF7A 2UXNA 2IGOA 5J47A 4JBAA 3AL0C 4DZJA 2GIVA 2E5NA 4UB8C 3T5XA 1IF1A 2ZSHB 3HB9A 2DYRH 5CKTA 3JSPA 3A03A 4LGWA 3NEUA 3IRQA 3OYCA 2F6CA 4I09A 2X85A 3LA2A 4UUSA 4KT5C 2JPBA 3W3CA 3ULQB 1V55H 1RETA 1YI2I 1AA7A 2JPCA 2VOOA 3ZMVA 3E5QA 3GFLA 3GVAA 1IRZA 1ZELA 4OIOF 2QZ8A 4WX9A 4M3GA 5IYDJ 2EV6A 3WTWC 4AUXA 4N0BA 1ETXA 3MKYB 4B8XA 2G7HA 2AHQA 2K9LA 3LL7A 3TO6A 5LHHA 1HKQA 4BHBA 1BA5A 4JQFA 1QVUA 1T08B 3JSOA 2NS7A 5K7FA 1WCMJ 3GW2A 3RZDJ 2DA4A 2AO9A 2ZMEC 3CCMI 3P9CA 1D3YA 1QPIA 4L9VA 3E1SA 2HR3A 4P9FA 2K02A 2EFWA 2AXTC 2DFHA 3UNGC 3ZN0A 5GAHJ 2YX7A 1SFUA 1P7IA 4OIRF 1WSUA 3WTTC 2HYJA 3BT9A 2IAIA 2C6YA 1ZG5A 4WCGA 4LK1F 4A6DA 1XX5A 4HX4A 2HQRA 2D2WA 2P7CB 2Y31A 2DMTA 2IGKA 4AWXB 2P4WA 4RGRA 4A6EA 1SAUA 1IZ1A 2V6CA 2J5OA 4IHXA 3GTQJ 1I1SA 3OYLA 2H8WA 2HYGD 1FYLA 5IYBJ 3ZRGA 4MFDA 4NNJA 3JREA 4KITB 3IKVA 3NARA 1TLHB 1YG2A 4XKCA 2WTEA 5LBQA 1LVAA 4QPQA 2LYCA 2H27A 2R7ZJ 1FC3A 3ESWB 1F36A 2XAQA 2BEOA 4AYBA 5HVQC 1QZYA 2IS6A 3TP3A 3U21A 3VSLA 3FF5A 4EATA 5BS6A 2NS0A 4D7MA 5A2QK 1HQCA 3OWTA 2JWTA 1QO0D 3CCYA 5JFRA 2ZBKA 1QHGA 2VQLA 3U9GA 4BQOA 1B59A 4CH7A 3MFKA 4HNUA 4OIQF 4PFPA 3M8EA 1JTXA 2EINH 4Y33A 3CMMA 2FF4A 2DXIA 2WA0A 3IH2A 5DTDA 4EV0A 5CLSA 1U9NA 2DT7B 3U1DA 3WHBA 1SFKA 4CSWA 2HDWA 5HDKA 4A3KJ 1PUEE 4XMYA 1TT5B 4E7LA 2DT6A 4IQ4A 2R92J 3PO2J 1T8IA 5GADJ 1Z3YA 2I5UA 3CP8A 4RLFA 2DFIA 4M73A 3HOUJ 1R5GA 2XF5A 3IWFA 4DYCA 2R5ZB 1JGSA 5H6QA 1ONVA 3GXOA 5H6RA 3M3YJ 3F23A 3BG5A 2M3AA 2EWNA 3WTSC 2P7VB 5E18F 1H0MA 2GOXB 2QCOA 4M72A 2FBIA 2XGDA 2ZJQF 2ZB9A 3A0BC 1F9NA 3G4SI 5CJ9A 2A5WA 3OOPA 4HZFA 4BHCA 3FISA 1ZR2A 1QU3A 2L7KA 1KYWA 3B02A 3P7NA 1U8RA 5B5EC 3CCRI 2V1XA 4C3HJ 2QSFX 2PMZA 2HOAA 1HA8A 4RAYA 1JTYA 4AU7A 2X6YA 1IG7A 2B9SA 1O3TA 2W4SA 3S1MJ 1WHUA 4UVCA 5ILSA 3H92A 4ESBA 4EVIA 2DBBA 2IW5A 1O4XA 2L4AA 1YLFA 4U88A 2STTA 2VLAA 1F4KA 2XPWA 1R1VA 1DPUA 1ZARA 4KDPA 5FKNA 2R7FA 1D0ZA 1SC7A 3I59A 4HF0A 2FD5A 2PLYA 5FRNA 1VQLI 5E1ZB 4B43A 3RQ4A 1MDMA 4EM0B 1ZG1A 2P81A 1SFXA 3CP2A 1FBQA 3KP3A 2O6GE 1YOVB 1XC5A 1PP7U 4UVBA 2L9RA 2WAFA 3P9IA 3AFHA 3CF2A 2RQQA 2JUCA 3HRUA 4ESFA 1Q1VA 5FD6A 1E17A 1SD7A 1T98A 4XLFA 3CDLA 2X6OA 1HLVA 3NRVA 5BNGA 2BW3B 3OS0A 1P92A 3MZYA 1K83J 4ZDPA 3PNTA 1YYVA 4NC6A 4W1UA 2R7DA 4CXFA 2GBYA 5EYRA 3ABLH 3LFKA 2FQ3A 2JUGA 2HS5A 2ZO4A 3CJTB 3PSIA 1WRJA 3DBRB 4G12A 4RS8A 1FYKA 1RUNA 1FEXA 4R8HA 1SVLA 1JKQC 4FE7A 4ABZA 4PGHA 5IY5H 1FOYA 4LFUA 2DMQA 2EIKH 4A3EJ 2X1EA 4G7ZF 3MZ8A 2VC1A 1Y56A 1X2NA 2FNAA 5D5XB 1FNNA 4A3LJ 2DMUA 2TCTA 4ZH4F 1ZQ3P 3OOUA 2ESNA 4GO1A 3AG2H 1H88C 3BPXA 3HJEA 2V26A 1TTYA 5EEHA 5E79C 4OINF 1OMIA 3COAC 2FOKA 1U0JA 1ON2A 1T0FC 5GTIC 2K7LA 1FMVA 5J40A 3OYJA 3N05A 5IYCJ 1TZLA 4HF2A 2BW3A 2W00A 1IXCA 2QWWA 2XRLA 1A5JA 1JI8A 3QOEA 4MQ9F 4BL0B 1JUSA 1IV6A 3DFGA 3TDUC 2NVQJ 2F5CA 2XB0X 4S05A 3F8CA 4LG0B 4O3MA 4AD9A 4RB0A 2XVCA 3LSJA 2WY8Q 2EZIA 1MMAA 1XGSA 1VQ7I 1ZAOA 3R0JA 2E2HJ 3O6BB 3VYRB 4OMYA 4RM3A 3ZQQA 1Y1VJ 4BY7J 4MTEA 3K4BA 2EA4A 4Y13A 4PJLA 2IPQX 5D6FA 3AG4H 1SFOJ 4EQQA 1LFUP 2CW8A 1GVJA 3FXRA 2XB5A 1WJEA 4U87A 2MBFA 4CGZA 4HV6A 3KZIC 4D5FA 5BQTA 3HG9A 1U8BA 3L2VA 1W4MA 3JTHA 2XDVA 4ZYGA 3H3ZA 1OISA 1WKMA 4A69C 2W84A 2W48A 2E34A 2W57A 4HSRA 4MLOA 3C1DA 5C44J 5CYVA 3J7YJ 1ZLJA 1OCOH 3CDIA 2CQXA 3BZCA 2E1CA 1UCRA 2OAZA 4LG0A 4IOCF 2EV5A 2NYXA 1B4AA 2KJCA 3D0SA 5ILVA 1WI9A 4BXUA 3RSNA 1MNMC 1G8XA 2CJJA 4LITA 3DTKA 2DOEA 5J3LA 2VQHA 4P96A 3FM3A 3K1MA 3I64A 2XC7A 1A31A 3L2UA 1BM9A 3NWTA 3S2DJ 4YELA 2RKHA 1BI1A 1RNLA 3O8HA 2AQFA 2VBXA 1AKHB 2GA2A 2M2EA 4GDFA 2IXSA 4BACA 3QPTA 1DP3A 3WU2C 2H6BA 3D5RC 3S93A 2CFOA 3OR1C 2UZKA 1JJ6C 3TL4X 3S15J 2HKXA 4AVZA 2A6EF 5F6FA 1BR4A 2X1CA 3CZ6A 5CVUA 4CO8A 1GLNA 3SEQA 2EBIA 2FBKA 4IHSA 1VQ6I 1VZ0A 2NOGA 2VKVA 3SZPA 2XAJA 1QVTA 5LEKA 1Z6TA 3TW6A 1WPKA 5CVJA 3C2HA 3I54A 3DPTA 3LA7A 3ZN1A 2LSOA 3BR2A 4LIVA 1REPC 1HKSA 1J0RA 2IA2A 2ZXWH 2PJRB 6PAXA 5HDNA 3D5SC 1BN5A 4B44A 4LLNA 1RUOA 4CCJA 3LFUA 1XPXA 2NRAC 4ZYAA 2GXAA 4PSXA 1A04A 2LG4A 2E2JJ 2CV2A 3F8NA 4AIHA 3DKWA 4DZPA 4L9JA 1YFHA 2QQ9A 2BYVE 4KIFA 2KIUA 3HSFA 2XIGA 3RKQA 3IKTA 1E3PA 1BBYA 4I6ZA 1BIBA 1T95A 3G2BA 1ETVA 1MIJA 2M7BA 2RNJA 2WBMA 5EGOB 3BJAA 3H9JA 3HGGA 3KZYA 3WTVC 1FOXA 5CQEA 4YG2F 1YJ9I 4ZTJA 3GZ5A 4XLHA 3K4KA 4BUPA 2V1DA 3CUOA 2KISA 5KCMA 1TW3A 4UUVA 3F22A 3CQZJ 5HOOA 5D5UB 3W6KB 3IL2A 2KZVA 3I56I 5E3LA 3V42A 1LPQA 1SVMA 2OZUA 4BJ6C 2OCEA 3KIOA 1IXSB 2IP2A 2P6SA 2BXYA 4HA8A 2P8TA 4QLCU 3K4LA 3DEEA 1S3JA 3I3LA 3M1CA 1F1ZA 2Z3YA 2R7OA 1W5SA 4AVPA 3ZP5A 2Y0MA 3HZJA 3F21A 2Y0SA 4YEJA 3OYFA 1J59A 3CUQA 3Q9VA 4JX4A 2VC0A 2KPMA 5EGOA 2ID6A 2Y30A 2XHKA 3LQRA 4YFKF 2KDOA 1U6GA 5ICCA 2PN6A 3ABMH 2K86A 2IA1A 4AYBN 5E8IA 3KP2A 2LVSA 4ENNA 4LB5A 4UV9A 3W2AA 2L2OA 3K1NA 4Y52J 1Y39A 5LHIA 2L9NA 1YW7A 4YIFA 4GGGA 3ZCOA 3OYBA 3BR3A 1K78B 4IJAA 3HKZN 1OLTA 4BS9A 3OYEA 3J80Z 4IOAF 4XQFA 2I8DA 2JVGA 2ZC2A 3U1KA 2LLKA 1Z0XA 3KP6A 3J7ZI 3DQVC 2ZJRF 1STZA 3LSIA 4FASD 3HTUA 1G59A 3JW4A 4C2MJ 3D5LA 2HPMA 2JA8J 1O7FA 1Z77A 3HRMA 5FJ8J 4AIJA 1J7KA 3MQ0A 1MJBA 3OIPA 2JQ7A 2K27A 4M9ZA 1APLC 3V7CA 2RGVA 1VTNC 1RKTA 4AC0A 1S8NA 4PJNA 2PBIA 5AIPA 4IRGA 2DTZA 3HPHA 4XICA 2ELJA 4M3FA 3S3NA 2VODA 1OR7C 3BCBA 4DBRA 1MBKA 3BDDA 3U2RA 2F4MB 2JA7J 4XK4A 4JX6A 1XCVA 3JRDA 4B1RA 1UFMA 4HDVA 1K78A 1ZGJA 1QNTA 5EEGA 4J01A 1ETWA 4G6TB 2M8GX 2OD5A 3MD2A 3K10A 2PMZN 3W2WA 2ZSIB 3SEZA 4M74A 4P55A 4F7ZA 2E71A 3CO6C 2BE5F 1TBXA 4WF2A 1RR8C 2E35A 3CC4I 3MCZA 2VKDA 3LSHA 1SAXA 3QPHA 1P4AA 1YTYA 3VPRA 2E36A 2DDAA 2UV1A 1XDSA 2DMNA 3FKIJ 5D6EA 4GFBA 4JK1X 2WB1A 4PDKA 1FX7A 4F92B 5K5RA 3IH4A 5HDGA 2RN7A 1XGNA 2E2IJ 1E2XA 3OYHA 2HDDA 1JGGA 4IRIA 4L0ZB 3OYKA 3MWMA 3CCSI 1K79A 2HWVA 4KFCA 1HF0A 3KX2A 3AKZA 3OSGA 2DN0A 5FLXZ 3S1QJ 4ZYDA 3LQQA 2EFOA 1IUYA 5LGTA 3GFJA 1X1DA 1IRFA 4XLNF 3LAJA 3EUKL 2HVSA 2YR2A 2Y9ZA 4CYCA 1ORKA 3WU1B 4PGGA 2ELKA 1NHAA 4M9XA 2O8KA 2FU4A 1TW2A 1KU9A 2E19A 2OQRA 3DTEA 4I2OA 2XRNA 2OJED 5E1XA 5F0CA 5ICFA 4A3JJ 2ZMEB 1S7AA 2P5VA 4KICA 2GWRA 1ZHFA 2ELHA 1Z3XA 4HRIA 1K6OA 3KYDB 4XORA 5IT9Z 3ZGKA 4HBLA 1WQ2A 5J4VA 2KT0A 2KMUA 2M1BA 3QQAA 4CCMA 3B73A 1PVEA 1WI3A 2LD5A 1VI0A 1X4OA 4BXXJ 3ML6A 2XV4S 2YX4A 2QF7A 1FOWA 3ABTA 5TJJA 1R9TJ 2KFDA 3L7WA 3O2PE 1YHQI 1Z7UA 1MH3A 4EJWA 3SDGA 2DOAA 2CMPA 3AG3H 3E7LA 5FFXA 4ENKA 4RGXA 4P9UA 1JUMA 4ANJA 2EIMH 3IUOA 5K7HA 2LKXA 5M5WJ 5HLHA 4IKFA 3BG9A 4ETSA 2HFHA 3VB2A 3OY9A 3TEDA 2A3SA 2IVMA 2ZMEA 3V8KA 1Q1HA 1UZCA 1XGMA 4HW0A 4X6AJ 4I02A 1TWCJ 3B6CA 4GYGA 1EJ9A 2DA6A 5LFAA 3V8LA 4WK8F 2PG4A 1P6RA 4WXCA 2IBDA 5HODA 1DGRM 5GAGJ 4OWRB 1BR1A 2JSPA 1EA3A 2Y69H 2JT1A 4BE2A 3OYAA 5FO5A 1VQ4I 5FKKA 3EQLF 3GFIA 3OYDA 3GTJJ 4ENJA 1ZRFA 3MKLA 4UNOA 4AIKA 3ERED 1SD5A 4K2EA 2E1MB 4HEA2 2OA4A 4KMFA 4RA2A 1XMKA 4AM3A 1I27A 1XG1A 5EF6A 5IPAA 4EM2A 2K4JA 1H9TA 2XF7A 3A0HC 1U5TC 2HQNA 1W36C 1B8IB 2GIZA 2CQ7A 1LB2A 1MGTA 3LA3A 2WAQN 2VXZA 1K61A 1TNTA 3FK7A 3L2WA 3H5RA 1S7OA 1MMDA 2GQQA 4IHWA 3I55I 2WV1A 1TWFJ 3PJRA 2Q8KA 4MO7A 3ZMUA 4FE4A 2A6TA 4RLQA 3JRCA 3S3MA 4CHUA 5L3FA 1MW7A 2VONA 4NDLA 1X3ZB 2L7FP 2VKEA 3H9QA 2YPRA 1E3HA 2HQAA 5M3FJ 3MKWB 1LNWA 4BH9A 3DP7A 4P5OA 3HSEA 4Z2YA 1I50J 2GM4A 4KN4X 3S17J 3F8BA 1FWZA 2LP0A 3E5UA 2A07F 1MNEA 1JHHA 4KT6A 3HOSA 2VASA 2ZKZA 2K9SA 3A1YA 3DBHB 3FXQA 4PCQA 4BNCA 3KP4A 2XROA 2FNPA 3BZKA 3RPQA 2V9VA 1FJLA 1B8IA 2D5VA 1F43A 3E6MA 5J8FA 1H9GA 2Q0OA 1M1EB 4U0WA 2FA5A 4FETA 4GRIA 1P4XA 4YFNF 2XAUA 5L3GA 1P2FA 5BOXA 1YIJI 2XAHA 5L3CA 3UR3C 5LRRA 2VT3A 4HV5A 2L02A 2IS2A 4QPOA 1GV2A 3KLNA 3MN2A 1G3YA 2M4KA 4XOTA 2E1MC 2EFNA 3H36A 3SJMA 1RZ4A 3AAFA 1IN5A 5J6XA 3ABKH 4HLYA 2RDPA 3EUHC 2L0KA 3MVPA 1JHFA 5CVRA 3DLLF 2BY0A 3BQZA 3MAJA 5C3EJ 4MQVA 1KQ0A 4GXOA 3GBGA 2IRFG 3LNQA 2IS4A 1P9QC 2ICWG 1I5ZA 2L9VA 3F8MA 4LIUA 4UUTA 5DM7F 4PJJA 4WXDA 1RC9A 1I6XA 4WXHA 3R4KA 1O3RA 1LKXA 1O3SA 2R7UA 1W0TA 2ACJA 2H09A 2NNNA 1RI7A 2XAFA 3RYRA 1X1BA 2BOLA 1OKRA 2JRTA 2CV1A 1NG6A 1OFCX 2CUZA 4XLAA 3V8JA 2WADA 3LSRA 1WZ2A 3Q0WA 1PDNC 1JXSA 2ZXIA 3BZ6A 4EGZA 2GOMA 3ZMSA 3PL8A 3HDDA 3CCLI 5GAEJ 5EG0B 1IV8A 1W5TA 2LKPA 4CCNA 4EJOA 2HTJA 1BJAA 1PP8F 1S5LC 4EJVA 4RB3C 3CD6I 5A2QZ 1WJAA 2DI3A 2TDXA 2OF7A 4BXFA 2MABA 2A68F 1R22A 4PUSA 4Q48A 2B63J 3KPHA 1HW5A 2CQQA 3PSFA 3WG9A 2MC4A 3FHZA 2R5ZA 1ENHA 5FRMA 2H1LA 2OCCH 2PEXA 3LSTA 2BVMA 5DV5A 1O7LA 3HOXJ 2DK8A 4BDYA 3GMEA 5FB2A 5F27A 2RC4A 4D0PA 1FTZA 1GHCA 2DFFA 2D1HA 3NWSA 3QAHA 2Y0SN 2HPIA 5KK1A 1ACIA 3K4NA 2ME6A 5EG0A 2DOFA 2HZDA 5KAIC 1VQNI 1W7PD 3MZHA 1UHMA 3ZMDA 1K7AA 2A5YB 2CQNA 3C3WA 2K3PA 2ESHA 4A3FJ 2NOJB 4PJ0C 4RGSA 5EZHA 5E3OA 2KKOA 4HOBA 1CGPA 3PUBA 3OYMA 2VJ5A 1RIOH 1DDNA 3JRHA 1T0FA 3A4CA 2FMYA 3TP0A 2X1DA 4M6YA 3QYFA 2KDZA 3ECOA 3OYIA 1MBHA 2ZFWA 5J1UA 4MHGA 2MH9A 5LRSA 4IEJA 2VQGA 3BR6A 3TBIA 2W82A 1EV7A 2QSHX 1W5CC 3HBLA 4XLCA 1ZKGA
chains in the Genus database with same CATH topology
2EIKH 3AG1H 2EIMH 1OCCH 3AG2H 2OCCH 2EIJH 2EILH 5B1AH 1V54H 5B1BH 3ABLH 5B3SH 1V55H 3ABMH 3ASNH 2Y69H 1OCOH 3ASOH 3WG7H 3X2QH 1OCZH 2DYSH 3AG4H 2EINH 5IY5H 3AG3H 2DYRH 1OCRH 3ABKH 2ZXWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIK H;  3AG1 H;  2EIM H;  1OCC H;  3AG2 H;  2OCC H;  2EIJ H;  2EIL H;  5B1A H;  1V54 H;  5B1B H;  3ABL H;  5B3S H;  1V55 H;  3ABM H;  3ASN H;  2Y69 H;  1OCO H;  3ASO H;  3WG7 H;  3X2Q H;  1OCZ H;  2DYS H;  3AG4 H;  2EIN H;  5IY5 H;  3AG3 H;  2DYR H;  1OCR H;  3ABK H;  2ZXW H; 
#chains in the Genus database with same CATH topology
 3E6B A;  2QYO A;  2DW4 A;  1MJA A;  2F5E A;  3GUD A;  1IW7 F;  4A3B J;  3CJQ B;  3HYI A;  3TKY A;  4BYY A;  2CU7 A;  2EA2 A;  4BE0 A;  2IGN A;  3GWZ A;  1IRG A;  4PFO A;  2I10 A;  2CUE A;  4XBF A;  4IHT A;  1KON A;  1LE8 B;  3RIR A;  2EPF A;  4IF4 A;  4N4N B;  3NQO A;  2BHZ A;  1G2H A;  2KRC A;  4PK4 A;  3SXY A;  2N8G A;  1WJC A;  2BVL A;  3GTO J;  3OL3 A;  3IHU A;  1YE9 A;  3RCO A;  2ECC A;  3IAM 2;  1XN7 A;  1V5F A;  1OCC H;  1FSE A;  1IJW C;  2E60 A;  2LY2 A;  2WV0 A;  1ERD A;  5JI6 A;  2HKO A;  3SZT A;  1IN6 A;  3VYT B;  1IDZ A;  3S14 J;  3VEP A;  3KLO A;  3VWB A;  2DTR A;  4IPA A;  4XRM A;  1KGS A;  2L01 A;  3X2Q H;  2CSO A;  1R6R A;  1PYV A;  2MD5 A;  1YIT I;  1VQK I;  3K6G A;  1BIA A;  4BBR J;  3ZPL A;  3REO A;  3GTG J;  2YSR A;  1JJ8 C;  1DP7 P;  1RR7 A;  3CJR B;  5LHG A;  1QQI A;  2O5R A;  3BPV A;  2MH2 A;  2WB1 N;  3LSG A;  4B47 A;  1LDD A;  1IAW A;  1LDK B;  4CUG A;  2VQC A;  4EMS A;  1D0X A;  2LH9 A;  2E1N A;  4A12 A;  4BBS J;  1MZB A;  3HRS A;  4CCL A;  2OUM A;  4JX5 A;  3QYE A;  2K9M A;  4ENM A;  3WGG A;  4IO9 F;  3TQN A;  3Q0V A;  4Y7N J;  2HEO A;  3GLL A;  1TWH J;  2IA0 A;  5K7Z A;  3CES A;  1XS9 A;  5DCM B;  3TDZ C;  2VBY A;  1K6Y A;  3FBI B;  1YX5 A;  2WY7 Q;  3VOE A;  4G6Q A;  4HX8 A;  1N78 A;  2F5V A;  5F08 A;  2L54 A;  3PIP F;  4FCY A;  3FXL A;  3L2R A;  1KYZ A;  1JKP C;  1HW2 A;  3G3Z A;  1DU6 A;  1FBU A;  1ZTR A;  5F04 A;  1ZGW A;  2VJ4 A;  1P7J A;  2X6X A;  3KYC B;  5DYM A;  4ZJZ A;  4ZYE A;  1D8K A;  1TP4 A;  3GTP J;  1QBJ A;  1W7P B;  5ED4 A;  3FZV A;  1LFP A;  4XKV A;  2GXG A;  3HM5 A;  3S32 A;  3HOZ J;  2L5Q A;  4Q4Z F;  2R7Q A;  2O9L A;  5LGU A;  2EH3 A;  1MBJ A;  4RBO A;  1TWG J;  2OU2 A;  1B72 B;  2M34 A;  4A3M J;  3A2K A;  2OTL I;  5DS9 A;  2Z1D A;  1W1W E;  4MEX F;  4WWC A;  3L2C A;  3M07 A;  2YUS A;  1RRJ A;  1S9H A;  2HZT A;  2LBF B;  4ESJ A;  1EH8 A;  4BQN A;  3FBN B;  2O03 A;  5JR3 A;  3A01 B;  2IJL A;  2VN2 A;  5HS7 A;  2Y2Z A;  1OCZ H;  4D1Q A;  3CCU I;  3DLA A;  3O3K A;  2FOW A;  3L9F A;  1MSF C;  2AXL A;  2FE3 A;  3ZQI A;  2CH0 A;  2HOE A;  1TQM A;  1TL8 A;  1EKE A;  1AKH A;  4BEH B;  1VQ8 I;  3C2G A;  1B6A A;  1MBF A;  1W7P A;  5B1A H;  5IP6 A;  4H0E A;  4E7K A;  2V1U A;  4I7H A;  1OQY A;  4JYK A;  2NVT J;  3QOP A;  3G1O A;  2ZXJ A;  1R7J A;  2IGM A;  3DEW A;  1ZLK A;  4CDG A;  1LEB A;  2LF7 A;  4KIB A;  1QZZ A;  3K9T A;  4JOM A;  1ZN2 A;  1JE8 A;  2EFQ A;  2KJB A;  3FHN A;  5TIS C;  3O8G A;  3BJO A;  2VB6 A;  4XRS G;  1QRY A;  1V3F A;  3JAM Z;  3BR0 A;  5KNL A;  1VQ5 I;  2XAS A;  1A35 A;  3RI4 A;  1XSD A;  3FX3 A;  1IUF A;  2Y48 A;  3R60 A;  3VOD A;  3A01 A;  2V9P A;  1FYM A;  2YS9 A;  3R61 A;  1Z67 A;  3IC7 A;  3OR2 C;  1SAN A;  2RAE A;  3SDB A;  1Z1D A;  1JKO C;  4UVA A;  2RV8 A;  5EJC A;  2PJR A;  1OCP A;  5K5Q A;  2XGX A;  4CCO A;  4BEH A;  4A3G J;  4A2U A;  1L3L A;  2DPU A;  4GCV A;  3ERM A;  2CV0 A;  1KU2 A;  1W36 D;  4L5E A;  2Y9Y A;  2F4I A;  3G1M A;  4LG3 A;  1JT6 A;  4BJ5 C;  5IP7 J;  2OQG A;  1PJR A;  3S2H J;  3QOD A;  4D5C A;  3LMM A;  2W85 A;  3BCA A;  5KAF C;  1T39 A;  4HF1 A;  1Y0U A;  5C4X J;  4E6K G;  4F55 A;  1S72 I;  3H3U A;  5JVT A;  3JRI A;  1LVK A;  3QWL A;  4LJZ F;  3HTS B;  4XOP A;  4II2 A;  1N25 A;  5FD5 A;  4U7B A;  2QM3 A;  2CS3 A;  2M5W A;  2R7W A;  4ZZL A;  3ZQ7 A;  5GTH C;  2FSW A;  3GCM A;  2EJR A;  3T8R A;  3BP8 A;  3ECH A;  2AQE A;  4A5N A;  3KCC A;  4CZC A;  5D4R A;  4RB2 C;  1HXD A;  4ITV A;  4HG2 A;  4RMN A;  3WTU C;  2A61 A;  1HST A;  3JRB A;  3RKY A;  2Z16 A;  1UB9 A;  1YO5 C;  2RVC A;  4L9T A;  4IX7 A;  2VUM J;  3ZXS A;  1FP2 A;  1OR7 A;  2KHM A;  1X3W B;  4BU2 A;  1X2M A;  3H3V K;  2O8X A;  4ZDL A;  5FKO A;  4EJT A;  4X1E A;  4X0G A;  2K4B A;  4QIW N;  2Z2S B;  4MIM A;  2LK2 A;  2JA6 J;  1MMS A;  1DU0 A;  1QZE A;  1BI3 A;  1LFB A;  2DPD A;  4U0V A;  3EDP A;  5E3M A;  2R5Y B;  3H5N A;  4G94 A;  2NS8 A;  3QPL A;  3K4C A;  2YU3 A;  4R1H A;  1BI2 A;  2EIL H;  2HTS A;  1D1C A;  2HOS A;  2F2E A;  1SD4 A;  2L3D A;  1GXQ A;  1BJZ A;  5B66 C;  1ZRD A;  4V2F A;  1SEU A;  3ZQC A;  3GX4 X;  2MYS A;  5L3B A;  2NVU B;  1OYI A;  1R36 A;  2IT0 A;  2VIX A;  2VJI A;  4NHJ A;  1TNS A;  2F5D A;  2KRH A;  3H35 A;  2PMH A;  1SFE A;  3FM5 A;  2QQB A;  2VXD A;  3HGY A;  3L1P A;  3HL2 A;  4EGY A;  3J81 K;  2IS1 A;  3GF2 A;  4U7D A;  2HQ5 A;  1HSJ A;  2JA5 J;  4YFX F;  1YIO A;  4G7O F;  3PNV A;  4II3 A;  1GVD A;  3CCV I;  4KIG A;  3G71 I;  4XNF A;  1E0E A;  4I0B A;  3WE2 A;  2A69 F;  4C9Y A;  4KJZ A;  2H8R A;  1N77 A;  1KQ8 A;  3DF8 A;  1UG0 A;  5DUI A;  3JRF A;  4Z6Y A;  1TWA J;  5IT9 K;  2DK5 A;  2HVQ A;  4DJA A;  2OBP A;  4CIC A;  2P0W A;  1ZYR F;  4LB6 B;  3RTR A;  4KUM A;  4HDU A;  1HBX G;  1S6L A;  2QLZ A;  3RDI A;  3CJN A;  4N4O B;  1Y1W J;  5M3M J;  4FT8 A;  1R23 A;  3ELK A;  4PZJ A;  1R71 A;  5BPD A;  2KZG A;  3GTK J;  4BQQ A;  2VBZ A;  5L3D A;  3JR9 A;  5FKM A;  3SFZ A;  3T1B A;  2ISY A;  1A36 A;  3CC2 I;  3LWF A;  2BY2 A;  3F0C A;  1XD7 A;  2DLL A;  3ASN H;  1I6H J;  4L18 B;  2DU9 A;  2OZ6 A;  3E6C C;  4RAF A;  3HEF A;  5AON A;  1ETK A;  1PUF B;  2FEZ A;  1U5T B;  1Y8Q B;  1DQU A;  4M3D A;  5M5X J;  2OV7 A;  2WC2 A;  3TO9 A;  2UWM A;  2M87 A;  2DAO A;  4LD5 A;  1VFC A;  3WHC A;  1B9M A;  4P1W A;  2LTP A;  4ON0 A;  3DU6 A;  5ERI A;  4NB5 A;  2KP6 A;  2CUF A;  2EFP A;  4RGU A;  2A05 A;  5JVG F;  4IXA A;  2KIM A;  1KU7 A;  2LMD A;  2DQL A;  3ZQH A;  1EH6 A;  1R1U A;  4L5J A;  3S2W A;  5CPR B;  3S1R J;  4HX7 A;  4BE1 A;  1OCR H;  1XSX A;  2ZNY A;  1YJW I;  3BG7 A;  1I1G A;  1Y6I A;  4LOC A;  4BY1 J;  2DA5 A;  3OMY A;  1IN8 A;  3I4P A;  5FFZ A;  3K69 A;  3ABU A;  1R1T A;  4B09 A;  1U5T A;  1T38 A;  2QKM B;  4HPQ A;  4OIP F;  5FGM A;  2QSG X;  2V9K A;  4XSZ F;  4F52 A;  1X1C A;  3GLX A;  2DYS H;  2DA7 A;  1HC8 A;  2MD0 A;  2PFB A;  4IHY A;  4C30 A;  1Z7L A;  2LR8 A;  3BY6 A;  2M4G A;  1LEA A;  2K5C A;  3TGN A;  4XRS A;  2W24 A;  3SYT A;  3DV8 A;  1MJ9 A;  3T8T A;  4E7I A;  2P5K A;  4IVN A;  3E6D A;  2G7U A;  3N4M A;  3SZG A;  2K9Q A;  4XM3 A;  1XSV A;  5D8K B;  5E3N A;  5HLI A;  1X3U A;  1Y0N A;  4OMZ A;  2CWE A;  3HOT A;  4N9H A;  3PO3 J;  1RES A;  2H1K A;  1X1A A;  2XSJ C;  1QGP A;  2V7F A;  4M3B A;  3DU5 A;  1WGX A;  3S8P A;  4FIS A;  3R0A A;  4HAM A;  3RPU D;  5DCF A;  4NBQ A;  1BW5 A;  1VF9 A;  3OSF A;  1MMN A;  1YQA A;  4KA4 A;  1HDD C;  2JMW A;  3BTC A;  3HHG A;  1V4R A;  3IH3 A;  4L9N A;  3RJP A;  4UV8 A;  3RKW A;  4E4H A;  4XR6 A;  1FIA A;  1UST A;  4IHV A;  4BGD A;  1WJD A;  3LSP A;  2K3F A;  1FSH A;  1T56 A;  3F6V A;  2R4G A;  3PFY A;  3HXL A;  4UHT A;  4XL9 A;  1FLI A;  4DW6 A;  4XN3 A;  5DD8 A;  1UMQ A;  3EUH A;  4S0H B;  2X48 A;  3L2Q A;  4RB1 A;  3GYH X;  5LLQ A;  4A93 J;  3LAP A;  2Z9O A;  3KP7 A;  3JRA A;  1FTT A;  3EPZ A;  4I76 A;  3ZMZ A;  5D5V B;  3E3V A;  2BV6 A;  2Z33 A;  2PJP A;  2HI3 A;  2ZFU A;  1SD6 A;  3ISP A;  4A0Z A;  1UJ8 A;  4UXN A;  1AWC A;  2KQR A;  3W2V A;  3CCJ I;  4LLL A;  3ROU A;  5F0H A;  3E0J B;  1MD0 A;  2BY1 A;  5HNF A;  2EV0 A;  2L7M P;  2DJN A;  2VT2 A;  1LDJ A;  1FY7 A;  1OYW A;  5CQG A;  3V7R A;  1ZH5 A;  3K0L A;  5ICE A;  4A3I J;  2VPL A;  3QP6 A;  2ZJP F;  4BDZ A;  3M1E A;  3Q3S A;  3AG1 H;  3J7A Y;  2D1V A;  4Q47 A;  3N97 A;  5FLM J;  2DFE A;  3DXJ F;  3FXU A;  3QU6 A;  1DPR A;  1WJF A;  5DUK A;  1QPM A;  2H6C A;  4MGR A;  1YS7 A;  3K2Z A;  1T6S A;  1RPW A;  3NAU A;  1TQI A;  1N75 A;  3Q5F A;  2A6H F;  2NXN B;  3BTI A;  1FBS A;  2FQ4 A;  1BOA A;  3DWL E;  4IZZ A;  4C2U A;  2X0L A;  3F8F A;  2MLK A;  4G9Y A;  2R0Q C;  3HKZ A;  1IC8 A;  3BC8 A;  2FJ1 A;  1YX3 A;  4BHP A;  1ZK8 A;  1T33 A;  1AHD P;  4NUB A;  3ONQ A;  3WG7 H;  2J5P A;  3M4O J;  1AOY A;  3ZQF A;  1ETO A;  4KN7 X;  1CQT A;  4Y15 A;  3ZQG A;  3L00 A;  3PNY A;  2BZT A;  4EM1 A;  1JKR C;  1G3T A;  4FX0 A;  5GPA A;  1FZP B;  3J7A O;  1XTA A;  3HC7 A;  3DBL B;  3WTY C;  2MA3 A;  2M45 A;  1H89 C;  2M30 A;  2D45 A;  3GFM A;  1WVR A;  1MBE A;  5CVV A;  3I59 B;  3FXM A;  2O0Y A;  3K4M A;  2QVO A;  2DA1 A;  1HCR A;  1YRN B;  3UKG A;  2EZK A;  3K2A A;  4DQ2 A;  1MDM B;  2BGC A;  4L5I A;  3BG6 A;  4AID A;  1BC8 C;  2MFZ A;  3K7A J;  2ZJ2 A;  2QEX I;  1IDY A;  2HXO A;  2VBW A;  2Z99 A;  5HS8 A;  5HLG A;  4Y4R A;  2DJI A;  3HOY J;  3RYP A;  3IV5 A;  3FIW A;  1OPC A;  2YU9 J;  5LGN A;  1MSE C;  2KL4 A;  3F6O A;  3K70 C;  5IOY A;  1J75 A;  4TV7 A;  1V54 H;  3H0D A;  2EZH A;  3R6S A;  2VOP A;  1NH3 A;  4N9I A;  5FRO A;  3KYL A;  2M7A A;  1ZR4 A;  3HOW J;  2Y75 A;  3SFI A;  3GTM J;  1YJN I;  4MNU A;  4B4C A;  3QP5 A;  5EEA A;  5E1W A;  4BJT A;  4CA0 A;  1XCB A;  4DGW B;  3OS2 A;  4BKX A;  2E5Z A;  1VQM I;  1YRN A;  3EET A;  2RNG A;  3JRG A;  3DKY A;  3W6V A;  1TQP A;  5JHU A;  1XDU A;  4DYQ A;  4XON A;  2JJ7 A;  1POG A;  1WJB A;  2COB A;  2VE8 A;  1QHH D;  3KFW X;  4RM2 A;  3M8J A;  2COM A;  2WAE A;  3CF5 F;  4CCK A;  5D4S A;  2L9S A;  3WU0 A;  3FXO A;  1VND A;  2FRH A;  4R79 A;  2QQA A;  1IGN A;  1U2W A;  4KNY A;  2LOO A;  5HS9 A;  2CRG A;  3I9V 2;  1X1P A;  2QA4 I;  3IAS 2;  4M71 A;  3DKX A;  3MMY B;  1Z9C A;  4XRF A;  1UHS A;  3E97 A;  2QUF A;  3KET A;  4LK0 F;  4NC8 A;  3ZOB A;  2HYF A;  1G3W A;  4KIS A;  4S04 A;  3OIQ A;  1SVO A;  3RPU A;  2XGE A;  1GT0 C;  2NAZ A;  1UEL B;  4NC7 A;  2E7W A;  3TMO A;  2V4J C;  1D8J A;  3ZMT A;  4OOI A;  4YII A;  1U9O A;  3BWG A;  2Q2E B;  1D0Y A;  2DA2 A;  4DYR A;  2IEK A;  4OAY A;  4UB6 C;  5J1R A;  1BOB A;  2FUG 2;  3VSK A;  5FLV A;  3S3O A;  3WOD F;  1D1B A;  1ODD A;  3TOB A;  5ICG A;  2V79 A;  5KHD A;  1ITY A;  1GDT A;  3BTJ A;  3KE2 A;  1K4T A;  3DCF A;  1V5G A;  1P4W A;  4FX4 A;  2DCE A;  3QRF F;  1VQO I;  3ZR8 X;  4HLX A;  1L0O C;  2JRM A;  4G6D A;  4KYW A;  5B1B H;  3FXK A;  2DOD A;  2KIF A;  2CO5 A;  1MMG A;  2F4O B;  4M3E A;  4DIQ A;  4E7S A;  1IN7 A;  3LSK A;  2VL8 A;  2ETH A;  4H4K C;  4RDU A;  2VPR A;  3C7J A;  4YRV A;  4NQW B;  1I39 A;  4Y3O A;  1WH7 A;  1U3E M;  3D1N I;  4G8X A;  1S7E A;  2M9H A;  3ZQL A;  3DPL C;  2BY3 A;  2F5F A;  4DNC A;  3BLY A;  3FDY A;  3H1C A;  3I0T A;  4YIR X;  2PI0 A;  4BAY A;  1LE8 A;  4UY8 I;  2CW0 F;  3BR5 A;  2Q2E A;  4E7J A;  1I3Q J;  3EYY A;  2O3F A;  2HXI A;  5D8L B;  1IO2 A;  3KEY A;  3SHF A;  4V2G A;  1ZG3 A;  4PSW A;  5ILU A;  2HOT A;  2EZL A;  2JVH A;  3HUG B;  1I3A A;  3FWE A;  3Q0U A;  4I98 B;  3PUF A;  2XPV A;  2OPT A;  1UHW A;  3OIO A;  3QPS A;  4DOZ A;  5K5O A;  2RRE A;  2MLG A;  1GUU A;  1MH4 A;  4XLE A;  3S16 J;  1BR2 A;  1ZRE A;  2WAQ A;  2G9W A;  4MTD A;  4B3X A;  1U78 A;  2DO7 A;  1KA8 A;  3CTA A;  3KP5 A;  2XUB A;  4NQW A;  1ETY A;  2DDB A;  3G73 A;  1AU7 A;  3WGH A;  3PFI A;  2LRE A;  3FMQ A;  1J2X A;  4B3A A;  2HDC A;  3IWZ A;  2M0M A;  2JA2 A;  3I4N J;  2GA1 A;  3PIO F;  3V4G A;  3I53 A;  3CMY A;  5JLW A;  1GXP A;  1G6N A;  3OL4 A;  4HST A;  1NTC A;  3MEX A;  3BG3 A;  4O5V A;  2OTJ I;  2F48 A;  2DMP A;  2LKS A;  3CLQ A;  3CME I;  5IP9 J;  1OYY A;  2R7X A;  3HUG A;  3KEO A;  3JCU C;  3I5U A;  2JTV A;  1JUP A;  5BMZ A;  3RKX A;  5KVR A;  5F1R A;  1MND A;  2O61 A;  2XKO A;  3JAM K;  3BQY A;  1J9I A;  5HNH A;  2PX9 A;  3KEQ A;  3FMR A;  3Q9S A;  5EZG A;  3VFZ A;  3FMS A;  2X9D A;  9ANT A;  3HSR A;  2LDU A;  3CDH A;  1Y8R B;  5DCM A;  3CCQ I;  2K85 A;  3CC7 I;  2KIQ A;  3EYI A;  2MGQ A;  1J5Y A;  2K40 A;  1SMY F;  2QKL B;  2XAG A;  2XSD C;  1SMT A;  2M0C A;  4QTR A;  2W25 A;  1R5H A;  2OC6 A;  2HGC A;  1XMA A;  5F1J A;  1BL0 A;  1R49 A;  1Z6R A;  2CUJ A;  1IRX A;  3BR1 A;  1QA6 A;  1WWX A;  3SQN A;  3M9A A;  2H94 A;  5B3S H;  1MBG A;  3FK6 A;  4MFE A;  2BBY A;  3W6J B;  4G7H F;  1K4S A;  3G6E I;  4IRH A;  4FTH A;  3GZ6 A;  1B72 A;  1O57 A;  3ASO H;  4A0Y A;  2ID3 A;  3JTG A;  3GTL J;  2X51 A;  2W7N A;  5BPI A;  1A6Q A;  3F9K A;  3LSM A;  4GYI A;  2LBF A;  5J8C A;  3BOQ A;  4OU0 A;  3S1N J;  1D5V A;  3CCE I;  3IRR A;  5TGT A;  4W97 A;  4RAG A;  4PJM A;  2EIJ H;  3BRO A;  4L0Y B;  2CQK A;  5FKL A;  2FX0 A;  3OS1 A;  2R7R A;  1EH7 A;  5L3E A;  1DGW Y;  2QQ8 A;  2LY9 A;  1R58 A;  4F93 B;  1B1B A;  1WJ5 A;  3CUQ B;  3WGI A;  2UXX A;  2XKP A;  5K1Y A;  4HNT A;  1FT9 A;  3QYB A;  3QU3 A;  1X19 A;  4ZYH A;  4Q5S F;  5HLT A;  2EB7 A;  3T0Y A;  2VE9 A;  5LD2 C;  2E7X A;  3P9K A;  3J80 K;  1J09 A;  2GAU A;  3H0G J;  4A3D J;  1JT0 A;  1BW6 A;  2DT5 A;  5AIQ A;  2ISZ A;  3HPG A;  4XKB A;  3RZO J;  1WH5 A;  2CW7 A;  3BTL A;  3E5X A;  3VDX A;  1OCT C;  2G0E A;  5D5W B;  4ASN A;  1E3O C;  1MKM A;  4FQG A;  2ZNZ A;  3CO7 C;  1R4N B;  4JP0 A;  2K9N A;  2B0L A;  3I4M J;  2R3S A;  5E20 A;  3VYU B;  1OJL A;  5H20 A;  2UUZ A;  1V5E A;  4F91 B;  3IP4 B;  4IQJ A;  3HIF A;  1Z91 A;  4O6J A;  2Z5U A;  3G1L A;  5DM6 F;  1FPQ A;  5E8G A;  4CZZ A;  1X4P A;  3MKZ A;  3EUA A;  2XF6 A;  3I71 A;  1XGO A;  4C3J J;  4RAZ A;  4XN0 A;  2JSC A;  3H5A A;  2ZCW A;  2EQR A;  1HW1 A;  2NVY J;  1VQ9 I;  1R00 A;  5F64 A;  2JZY A;  4HQE A;  4LMY A;  4DBQ A;  2VJJ A;  1LQ1 A;  3K1P A;  3I58 A;  1NG7 A;  4XLP F;  4D9J A;  2GLO A;  5IOZ A;  1RKW A;  3FKJ A;  2ZXH A;  2BHY A;  4D7N A;  1KQ9 A;  3HRT A;  1F5T A;  2QBY B;  3F72 A;  2LC2 A;  2X6W A;  3K4J A;  2ME0 A;  3V7S A;  4A3C J;  3CUQ C;  4A5M A;  4BQA A;  3BJ6 A;  1X58 A;  3TO7 A;  1EF4 A;  2BXZ A;  4E70 A;  4XID A;  1ETQ A;  4U0Y A;  2HU9 A;  5F0F A;  1FOK A;  2RQP A;  4HNV A;  4ZC3 A;  5FLX K;  3WTX C;  2VKH A;  1IN4 A;  4I01 A;  4EEF G;  2GZW A;  3A02 A;  2NNY A;  1KZH A;  3H9G A;  5GP9 A;  1GV5 A;  2MC3 A;  5H2F C;  5JHF A;  2CGP A;  2PQ8 A;  1D5Y A;  2LNB A;  1XB4 A;  1ZGA A;  4QWQ A;  4MEY F;  1ZRC A;  5DD4 A;  1W0U A;  2R7S A;  5C4J J;  2B7E A;  3DEU A;  3DPU A;  2O7O A;  4C3I J;  1ULY A;  2ECB A;  2R7T A;  4M6V A;  2XGC A;  2L4M A;  3GO5 A;  4IL6 C;  5IT3 A;  1T2K A;  2QGU A;  4ZTF A;  2VI6 A;  2NVX J;  1USS A;  2QBY A;  2JK3 A;  2FBH A;  4ZDO A;  2R7V A;  4B48 A;  1A6I A;  4CYC B;  1C0W A;  2R5Y A;  2FML A;  5TRD A;  1R5I D;  1ON1 A;  2P5L C;  2CG4 A;  4M9S A;  1O3Q A;  2CYY A;  2MW8 A;  3AL0 B;  5DEQ A;  3WE3 A;  4A0X A;  1BI0 A;  4I0A A;  5J1Y A;  1UAA A;  1BC7 C;  1G3S A;  1FMW A;  4M6X A;  1XMX A;  5EDN A;  3C18 A;  1Z05 A;  1UG2 A;  3GEZ A;  3LOC A;  4HQM A;  1HKT A;  4XKW A;  5GPC A;  1NK3 P;  5M5Y J;  1LUJ B;  1DUX C;  2MSY A;  1R4M B;  3CLO A;  4J00 A;  2LRD A;  2P6T A;  3PQK A;  4OAZ A;  4Y17 A;  2GXB A;  4LLG F;  2KLO A;  1HOM A;  3K70 D;  5E17 F;  4CYD A;  3C2B A;  1FIP A;  4E7Z A;  3CMA I;  2DA3 A;  1CF7 B;  3PQJ A;  1G4D A;  3L09 A;  1B9N A;  2LF8 A;  4FHT A;  3TW7 A;  3WTZ A;  2TRT A;  3P5J A;  1Z21 A;  1YS6 A;  4HYE A;  2V6E A;  1TC3 C;  1H8A C;  4QSH A;  1IXR C;  3KZZ A;  4F3Q A;  3J81 Z;  1VQP I;  2AS5 F;  2DQR A;  3M8F A;  4EJU A;  5DDG A;  1WFX A;  3HHH A;  3OYG A;  2LY1 A;  3RQI A;  5LEJ A;  4J19 A;  2V1N A;  2XPU A;  3B6A A;  3OYN A;  3F3X A;  4C2T A;  4XSX F;  2LFB A;  1HDP A;  2PMU A;  2FXA A;  4UUS B;  1NK2 P;  2L7Z A;  3HOV J;  5J4Y A;  1YW8 A;  3TOA A;  2M8E A;  3VYS B;  2MG4 A;  2R93 J;  1LJ9 A;  4V19 K;  2JN6 A;  4KMU X;  2STW A;  2X4H A;  2WWY A;  2W1O A;  1S29 A;  2CFX A;  2Q1Z B;  3DTI A;  1TT0 A;  4ZZD A;  4E7H A;  3PM1 A;  2QEN A;  2E1O A;  4I99 C;  2EK5 A;  2ADU A;  3OV8 A;  1YW9 A;  2HNH A;  1PUF A;  1D1A A;  2HVR A;  2KRF A;  3M7G A;  5JLX A;  3FXJ A;  1KU3 A;  5CVI A;  1FP1 D;  3GZN B;  1CF7 A;  2UXN A;  2IGO A;  5J47 A;  4JBA A;  3AL0 C;  4DZJ A;  2GIV A;  2E5N A;  4UB8 C;  3T5X A;  1IF1 A;  2ZSH B;  3HB9 A;  2DYR H;  5CKT A;  3JSP A;  3A03 A;  4LGW A;  3NEU A;  3IRQ A;  3OYC A;  2F6C A;  4I09 A;  2X85 A;  3LA2 A;  4UUS A;  4KT5 C;  2JPB A;  3W3C A;  3ULQ B;  1V55 H;  1RET A;  1YI2 I;  1AA7 A;  2JPC A;  2VOO A;  3ZMV A;  3E5Q A;  3GFL A;  3GVA A;  1IRZ A;  1ZEL A;  4OIO F;  2QZ8 A;  4WX9 A;  4M3G A;  5IYD J;  2EV6 A;  3WTW C;  4AUX A;  4N0B A;  1ETX A;  3MKY B;  4B8X A;  2G7H A;  2AHQ A;  2K9L A;  3LL7 A;  3TO6 A;  5LHH A;  1HKQ A;  4BHB A;  1BA5 A;  4JQF A;  1QVU A;  1T08 B;  3JSO A;  2NS7 A;  5K7F A;  1WCM J;  3GW2 A;  3RZD J;  2DA4 A;  2AO9 A;  2ZME C;  3CCM I;  3P9C A;  1D3Y A;  1QPI A;  4L9V A;  3E1S A;  2HR3 A;  4P9F A;  2K02 A;  2EFW A;  2AXT C;  2DFH A;  3UNG C;  3ZN0 A;  5GAH J;  2YX7 A;  1SFU A;  1P7I A;  4OIR F;  1WSU A;  3WTT C;  2HYJ A;  3BT9 A;  2IAI A;  2C6Y A;  1ZG5 A;  4WCG A;  4LK1 F;  4A6D A;  1XX5 A;  4HX4 A;  2HQR A;  2D2W A;  2P7C B;  2Y31 A;  2DMT A;  2IGK A;  4AWX B;  2P4W A;  4RGR A;  4A6E A;  1SAU A;  1IZ1 A;  2V6C A;  2J5O A;  4IHX A;  3GTQ J;  1I1S A;  3OYL A;  2H8W A;  2HYG D;  1FYL A;  5IYB J;  3ZRG A;  4MFD A;  4NNJ A;  3JRE A;  4KIT B;  3IKV A;  3NAR A;  1TLH B;  1YG2 A;  4XKC A;  2WTE A;  5LBQ A;  1LVA A;  4QPQ A;  2LYC A;  2H27 A;  2R7Z J;  1FC3 A;  3ESW B;  1F36 A;  2XAQ A;  2BEO A;  4AYB A;  5HVQ C;  1QZY A;  2IS6 A;  3TP3 A;  3U21 A;  3VSL A;  3FF5 A;  4EAT A;  5BS6 A;  2NS0 A;  4D7M A;  5A2Q K;  1HQC A;  3OWT A;  2JWT A;  1QO0 D;  3CCY A;  5JFR A;  2ZBK A;  1QHG A;  2VQL A;  3U9G A;  4BQO A;  1B59 A;  4CH7 A;  3MFK A;  4HNU A;  4OIQ F;  4PFP A;  3M8E A;  1JTX A;  2EIN H;  4Y33 A;  3CMM A;  2FF4 A;  2DXI A;  2WA0 A;  3IH2 A;  5DTD A;  4EV0 A;  5CLS A;  1U9N A;  2DT7 B;  3U1D A;  3WHB A;  1SFK A;  4CSW A;  2HDW A;  5HDK A;  4A3K J;  1PUE E;  4XMY A;  1TT5 B;  4E7L A;  2DT6 A;  4IQ4 A;  2R92 J;  3PO2 J;  1T8I A;  5GAD J;  1Z3Y A;  2I5U A;  3CP8 A;  4RLF A;  2DFI A;  4M73 A;  3HOU J;  1R5G A;  2XF5 A;  3IWF A;  4DYC A;  2R5Z B;  1JGS A;  5H6Q A;  1ONV A;  3GXO A;  5H6R A;  3M3Y J;  3F23 A;  3BG5 A;  2M3A A;  2EWN A;  3WTS C;  2P7V B;  5E18 F;  1H0M A;  2GOX B;  2QCO A;  4M72 A;  2FBI A;  2XGD A;  2ZJQ F;  2ZB9 A;  3A0B C;  1F9N A;  3G4S I;  5CJ9 A;  2A5W A;  3OOP A;  4HZF A;  4BHC A;  3FIS A;  1ZR2 A;  1QU3 A;  2L7K A;  1KYW A;  3B02 A;  3P7N A;  1U8R A;  5B5E C;  3CCR I;  2V1X A;  4C3H J;  2QSF X;  2PMZ A;  2HOA A;  1HA8 A;  4RAY A;  1JTY A;  4AU7 A;  2X6Y A;  1IG7 A;  2B9S A;  1O3T A;  2W4S A;  3S1M J;  1WHU A;  4UVC A;  5ILS A;  3H92 A;  4ESB A;  4EVI A;  2DBB A;  2IW5 A;  1O4X A;  2L4A A;  1YLF A;  4U88 A;  2STT A;  2VLA A;  1F4K A;  2XPW A;  1R1V A;  1DPU A;  1ZAR A;  4KDP A;  5FKN A;  2R7F A;  1D0Z A;  1SC7 A;  3I59 A;  4HF0 A;  2FD5 A;  2PLY A;  5FRN A;  1VQL I;  5E1Z B;  4B43 A;  3RQ4 A;  1MDM A;  4EM0 B;  1ZG1 A;  2P81 A;  1SFX A;  3CP2 A;  1FBQ A;  3KP3 A;  2O6G E;  1YOV B;  1XC5 A;  1PP7 U;  4UVB A;  2L9R A;  2WAF A;  3P9I A;  3AFH A;  3CF2 A;  2RQQ A;  2JUC A;  3HRU A;  4ESF A;  1Q1V A;  5FD6 A;  1E17 A;  1SD7 A;  1T98 A;  4XLF A;  3CDL A;  2X6O A;  1HLV A;  3NRV A;  5BNG A;  2BW3 B;  3OS0 A;  1P92 A;  3MZY A;  1K83 J;  4ZDP A;  3PNT A;  1YYV A;  4NC6 A;  4W1U A;  2R7D A;  4CXF A;  2GBY A;  5EYR A;  3ABL H;  3LFK A;  2FQ3 A;  2JUG A;  2HS5 A;  2ZO4 A;  3CJT B;  3PSI A;  1WRJ A;  3DBR B;  4G12 A;  4RS8 A;  1FYK A;  1RUN A;  1FEX A;  4R8H A;  1SVL A;  1JKQ C;  4FE7 A;  4ABZ A;  4PGH A;  5IY5 H;  1FOY A;  4LFU A;  2DMQ A;  2EIK H;  4A3E J;  2X1E A;  4G7Z F;  3MZ8 A;  2VC1 A;  1Y56 A;  1X2N A;  2FNA A;  5D5X B;  1FNN A;  4A3L J;  2DMU A;  2TCT A;  4ZH4 F;  1ZQ3 P;  3OOU A;  2ESN A;  4GO1 A;  3AG2 H;  1H88 C;  3BPX A;  3HJE A;  2V26 A;  1TTY A;  5EEH A;  5E79 C;  4OIN F;  1OMI A;  3COA C;  2FOK A;  1U0J A;  1ON2 A;  1T0F C;  5GTI C;  2K7L A;  1FMV A;  5J40 A;  3OYJ A;  3N05 A;  5IYC J;  1TZL A;  4HF2 A;  2BW3 A;  2W00 A;  1IXC A;  2QWW A;  2XRL A;  1A5J A;  1JI8 A;  3QOE A;  4MQ9 F;  4BL0 B;  1JUS A;  1IV6 A;  3DFG A;  3TDU C;  2NVQ J;  2F5C A;  2XB0 X;  4S05 A;  3F8C A;  4LG0 B;  4O3M A;  4AD9 A;  4RB0 A;  2XVC A;  3LSJ A;  2WY8 Q;  2EZI A;  1MMA A;  1XGS A;  1VQ7 I;  1ZAO A;  3R0J A;  2E2H J;  3O6B B;  3VYR B;  4OMY A;  4RM3 A;  3ZQQ A;  1Y1V J;  4BY7 J;  4MTE A;  3K4B A;  2EA4 A;  4Y13 A;  4PJL A;  2IPQ X;  5D6F A;  3AG4 H;  1SFO J;  4EQQ A;  1LFU P;  2CW8 A;  1GVJ A;  3FXR A;  2XB5 A;  1WJE A;  4U87 A;  2MBF A;  4CGZ A;  4HV6 A;  3KZI C;  4D5F A;  5BQT A;  3HG9 A;  1U8B A;  3L2V A;  1W4M A;  3JTH A;  2XDV A;  4ZYG A;  3H3Z A;  1OIS A;  1WKM A;  4A69 C;  2W84 A;  2W48 A;  2E34 A;  2W57 A;  4HSR A;  4MLO A;  3C1D A;  5C44 J;  5CYV A;  3J7Y J;  1ZLJ A;  1OCO H;  3CDI A;  2CQX A;  3BZC A;  2E1C A;  1UCR A;  2OAZ A;  4LG0 A;  4IOC F;  2EV5 A;  2NYX A;  1B4A A;  2KJC A;  3D0S A;  5ILV A;  1WI9 A;  4BXU A;  3RSN A;  1MNM C;  1G8X A;  2CJJ A;  4LIT A;  3DTK A;  2DOE A;  5J3L A;  2VQH A;  4P96 A;  3FM3 A;  3K1M A;  3I64 A;  2XC7 A;  1A31 A;  3L2U A;  1BM9 A;  3NWT A;  3S2D J;  4YEL A;  2RKH A;  1BI1 A;  1RNL A;  3O8H A;  2AQF A;  2VBX A;  1AKH B;  2GA2 A;  2M2E A;  4GDF A;  2IXS A;  4BAC A;  3QPT A;  1DP3 A;  3WU2 C;  2H6B A;  3D5R C;  3S93 A;  2CFO A;  3OR1 C;  2UZK A;  1JJ6 C;  3TL4 X;  3S15 J;  2HKX A;  4AVZ A;  2A6E F;  5F6F A;  1BR4 A;  2X1C A;  3CZ6 A;  5CVU A;  4CO8 A;  1GLN A;  3SEQ A;  2EBI A;  2FBK A;  4IHS A;  1VQ6 I;  1VZ0 A;  2NOG A;  2VKV A;  3SZP A;  2XAJ A;  1QVT A;  5LEK A;  1Z6T A;  3TW6 A;  1WPK A;  5CVJ A;  3C2H A;  3I54 A;  3DPT A;  3LA7 A;  3ZN1 A;  2LSO A;  3BR2 A;  4LIV A;  1REP C;  1HKS A;  1J0R A;  2IA2 A;  2ZXW H;  2PJR B;  6PAX A;  5HDN A;  3D5S C;  1BN5 A;  4B44 A;  4LLN A;  1RUO A;  4CCJ A;  3LFU A;  1XPX A;  2NRA C;  4ZYA A;  2GXA A;  4PSX A;  1A04 A;  2LG4 A;  2E2J J;  2CV2 A;  3F8N A;  4AIH A;  3DKW A;  4DZP A;  4L9J A;  1YFH A;  2QQ9 A;  2BYV E;  4KIF A;  2KIU A;  3HSF A;  2XIG A;  3RKQ A;  3IKT A;  1E3P A;  1BBY A;  4I6Z A;  1BIB A;  1T95 A;  3G2B A;  1ETV A;  1MIJ A;  2M7B A;  2RNJ A;  2WBM A;  5EGO B;  3BJA A;  3H9J A;  3HGG A;  3KZY A;  3WTV C;  1FOX A;  5CQE A;  4YG2 F;  1YJ9 I;  4ZTJ A;  3GZ5 A;  4XLH A;  3K4K A;  4BUP A;  2V1D A;  3CUO A;  2KIS A;  5KCM A;  1TW3 A;  4UUV A;  3F22 A;  3CQZ J;  5HOO A;  5D5U B;  3W6K B;  3IL2 A;  2KZV A;  3I56 I;  5E3L A;  3V42 A;  1LPQ A;  1SVM A;  2OZU A;  4BJ6 C;  2OCE A;  3KIO A;  1IXS B;  2IP2 A;  2P6S A;  2BXY A;  4HA8 A;  2P8T A;  4QLC U;  3K4L A;  3DEE A;  1S3J A;  3I3L A;  3M1C A;  1F1Z A;  2Z3Y A;  2R7O A;  1W5S A;  4AVP A;  3ZP5 A;  2Y0M A;  3HZJ A;  3F21 A;  2Y0S A;  4YEJ A;  3OYF A;  1J59 A;  3CUQ A;  3Q9V A;  4JX4 A;  2VC0 A;  2KPM A;  5EGO A;  2ID6 A;  2Y30 A;  2XHK A;  3LQR A;  4YFK F;  2KDO A;  1U6G A;  5ICC A;  2PN6 A;  3ABM H;  2K86 A;  2IA1 A;  4AYB N;  5E8I A;  3KP2 A;  2LVS A;  4ENN A;  4LB5 A;  4UV9 A;  3W2A A;  2L2O A;  3K1N A;  4Y52 J;  1Y39 A;  5LHI A;  2L9N A;  1YW7 A;  4YIF A;  4GGG A;  3ZCO A;  3OYB A;  3BR3 A;  1K78 B;  4IJA A;  3HKZ N;  1OLT A;  4BS9 A;  3OYE A;  3J80 Z;  4IOA F;  4XQF A;  2I8D A;  2JVG A;  2ZC2 A;  3U1K A;  2LLK A;  1Z0X A;  3KP6 A;  3J7Z I;  3DQV C;  2ZJR F;  1STZ A;  3LSI A;  4FAS D;  3HTU A;  1G59 A;  3JW4 A;  4C2M J;  3D5L A;  2HPM A;  2JA8 J;  1O7F A;  1Z77 A;  3HRM A;  5FJ8 J;  4AIJ A;  1J7K A;  3MQ0 A;  1MJB A;  3OIP A;  2JQ7 A;  2K27 A;  4M9Z A;  1APL C;  3V7C A;  2RGV A;  1VTN C;  1RKT A;  4AC0 A;  1S8N A;  4PJN A;  2PBI A;  5AIP A;  4IRG A;  2DTZ A;  3HPH A;  4XIC A;  2ELJ A;  4M3F A;  3S3N A;  2VOD A;  1OR7 C;  3BCB A;  4DBR A;  1MBK A;  3BDD A;  3U2R A;  2F4M B;  2JA7 J;  4XK4 A;  4JX6 A;  1XCV A;  3JRD A;  4B1R A;  1UFM A;  4HDV A;  1K78 A;  1ZGJ A;  1QNT A;  5EEG A;  4J01 A;  1ETW A;  4G6T B;  2M8G X;  2OD5 A;  3MD2 A;  3K10 A;  2PMZ N;  3W2W A;  2ZSI B;  3SEZ A;  4M74 A;  4P55 A;  4F7Z A;  2E71 A;  3CO6 C;  2BE5 F;  1TBX A;  4WF2 A;  1RR8 C;  2E35 A;  3CC4 I;  3MCZ A;  2VKD A;  3LSH A;  1SAX A;  3QPH A;  1P4A A;  1YTY A;  3VPR A;  2E36 A;  2DDA A;  2UV1 A;  1XDS A;  2DMN A;  3FKI J;  5D6E A;  4GFB A;  4JK1 X;  2WB1 A;  4PDK A;  1FX7 A;  4F92 B;  5K5R A;  3IH4 A;  5HDG A;  2RN7 A;  1XGN A;  2E2I J;  1E2X A;  3OYH A;  2HDD A;  1JGG A;  4IRI A;  4L0Z B;  3OYK A;  3MWM A;  3CCS I;  1K79 A;  2HWV A;  4KFC A;  1HF0 A;  3KX2 A;  3AKZ A;  3OSG A;  2DN0 A;  5FLX Z;  3S1Q J;  4ZYD A;  3LQQ A;  2EFO A;  1IUY A;  5LGT A;  3GFJ A;  1X1D A;  1IRF A;  4XLN F;  3LAJ A;  3EUK L;  2HVS A;  2YR2 A;  2Y9Z A;  4CYC A;  1ORK A;  3WU1 B;  4PGG A;  2ELK A;  1NHA A;  4M9X A;  2O8K A;  2FU4 A;  1TW2 A;  1KU9 A;  2E19 A;  2OQR A;  3DTE A;  4I2O A;  2XRN A;  2OJE D;  5E1X A;  5F0C A;  5ICF A;  4A3J J;  2ZME B;  1S7A A;  2P5V A;  4KIC A;  2GWR A;  1ZHF A;  2ELH A;  1Z3X A;  4HRI A;  1K6O A;  3KYD B;  4XOR A;  5IT9 Z;  3ZGK A;  4HBL A;  1WQ2 A;  5J4V A;  2KT0 A;  2KMU A;  2M1B A;  3QQA A;  4CCM A;  3B73 A;  1PVE A;  1WI3 A;  2LD5 A;  1VI0 A;  1X4O A;  4BXX J;  3ML6 A;  2XV4 S;  2YX4 A;  2QF7 A;  1FOW A;  3ABT A;  5TJJ A;  1R9T J;  2KFD A;  3L7W A;  3O2P E;  1YHQ I;  1Z7U A;  1MH3 A;  4EJW A;  3SDG A;  2DOA A;  2CMP A;  3AG3 H;  3E7L A;  5FFX A;  4ENK A;  4RGX A;  4P9U A;  1JUM A;  4ANJ A;  2EIM H;  3IUO A;  5K7H A;  2LKX A;  5M5W J;  5HLH A;  4IKF A;  3BG9 A;  4ETS A;  2HFH A;  3VB2 A;  3OY9 A;  3TED A;  2A3S A;  2IVM A;  2ZME A;  3V8K A;  1Q1H A;  1UZC A;  1XGM A;  4HW0 A;  4X6A J;  4I02 A;  1TWC J;  3B6C A;  4GYG A;  1EJ9 A;  2DA6 A;  5LFA A;  3V8L A;  4WK8 F;  2PG4 A;  1P6R A;  4WXC A;  2IBD A;  5HOD A;  1DGR M;  5GAG J;  4OWR B;  1BR1 A;  2JSP A;  1EA3 A;  2Y69 H;  2JT1 A;  4BE2 A;  3OYA A;  5FO5 A;  1VQ4 I;  5FKK A;  3EQL F;  3GFI A;  3OYD A;  3GTJ J;  4ENJ A;  1ZRF A;  3MKL A;  4UNO A;  4AIK A;  3ERE D;  1SD5 A;  4K2E A;  2E1M B;  4HEA 2;  2OA4 A;  4KMF A;  4RA2 A;  1XMK A;  4AM3 A;  1I27 A;  1XG1 A;  5EF6 A;  5IPA A;  4EM2 A;  2K4J A;  1H9T A;  2XF7 A;  3A0H C;  1U5T C;  2HQN A;  1W36 C;  1B8I B;  2GIZ A;  2CQ7 A;  1LB2 A;  1MGT A;  3LA3 A;  2WAQ N;  2VXZ A;  1K61 A;  1TNT A;  3FK7 A;  3L2W A;  3H5R A;  1S7O A;  1MMD A;  2GQQ A;  4IHW A;  3I55 I;  2WV1 A;  1TWF J;  3PJR A;  2Q8K A;  4MO7 A;  3ZMU A;  4FE4 A;  2A6T A;  4RLQ A;  3JRC A;  3S3M A;  4CHU A;  5L3F A;  1MW7 A;  2VON A;  4NDL A;  1X3Z B;  2L7F P;  2VKE A;  3H9Q A;  2YPR A;  1E3H A;  2HQA A;  5M3F J;  3MKW B;  1LNW A;  4BH9 A;  3DP7 A;  4P5O A;  3HSE A;  4Z2Y A;  1I50 J;  2GM4 A;  4KN4 X;  3S17 J;  3F8B A;  1FWZ A;  2LP0 A;  3E5U A;  2A07 F;  1MNE A;  1JHH A;  4KT6 A;  3HOS A;  2VAS A;  2ZKZ A;  2K9S A;  3A1Y A;  3DBH B;  3FXQ A;  4PCQ A;  4BNC A;  3KP4 A;  2XRO A;  2FNP A;  3BZK A;  3RPQ A;  2V9V A;  1FJL A;  1B8I A;  2D5V A;  1F43 A;  3E6M A;  5J8F A;  1H9G A;  2Q0O A;  1M1E B;  4U0W A;  2FA5 A;  4FET A;  4GRI A;  1P4X A;  4YFN F;  2XAU A;  5L3G A;  1P2F A;  5BOX A;  1YIJ I;  2XAH A;  5L3C A;  3UR3 C;  5LRR A;  2VT3 A;  4HV5 A;  2L02 A;  2IS2 A;  4QPO A;  1GV2 A;  3KLN A;  3MN2 A;  1G3Y A;  2M4K A;  4XOT A;  2E1M C;  2EFN A;  3H36 A;  3SJM A;  1RZ4 A;  3AAF A;  1IN5 A;  5J6X A;  3ABK H;  4HLY A;  2RDP A;  3EUH C;  2L0K A;  3MVP A;  1JHF A;  5CVR A;  3DLL F;  2BY0 A;  3BQZ A;  3MAJ A;  5C3E J;  4MQV A;  1KQ0 A;  4GXO A;  3GBG A;  2IRF G;  3LNQ A;  2IS4 A;  1P9Q C;  2ICW G;  1I5Z A;  2L9V A;  3F8M A;  4LIU A;  4UUT A;  5DM7 F;  4PJJ A;  4WXD A;  1RC9 A;  1I6X A;  4WXH A;  3R4K A;  1O3R A;  1LKX A;  1O3S A;  2R7U A;  1W0T A;  2ACJ A;  2H09 A;  2NNN A;  1RI7 A;  2XAF A;  3RYR A;  1X1B A;  2BOL A;  1OKR A;  2JRT A;  2CV1 A;  1NG6 A;  1OFC X;  2CUZ A;  4XLA A;  3V8J A;  2WAD A;  3LSR A;  1WZ2 A;  3Q0W A;  1PDN C;  1JXS A;  2ZXI A;  3BZ6 A;  4EGZ A;  2GOM A;  3ZMS A;  3PL8 A;  3HDD A;  3CCL I;  5GAE J;  5EG0 B;  1IV8 A;  1W5T A;  2LKP A;  4CCN A;  4EJO A;  2HTJ A;  1BJA A;  1PP8 F;  1S5L C;  4EJV A;  4RB3 C;  3CD6 I;  5A2Q Z;  1WJA A;  2DI3 A;  2TDX A;  2OF7 A;  4BXF A;  2MAB A;  2A68 F;  1R22 A;  4PUS A;  4Q48 A;  2B63 J;  3KPH A;  1HW5 A;  2CQQ A;  3PSF A;  3WG9 A;  2MC4 A;  3FHZ A;  2R5Z A;  1ENH A;  5FRM A;  2H1L A;  2OCC H;  2PEX A;  3LST A;  2BVM A;  5DV5 A;  1O7L A;  3HOX J;  2DK8 A;  4BDY A;  3GME A;  5FB2 A;  5F27 A;  2RC4 A;  4D0P A;  1FTZ A;  1GHC A;  2DFF A;  2D1H A;  3NWS A;  3QAH A;  2Y0S N;  2HPI A;  5KK1 A;  1ACI A;  3K4N A;  2ME6 A;  5EG0 A;  2DOF A;  2HZD A;  5KAI C;  1VQN I;  1W7P D;  3MZH A;  1UHM A;  3ZMD A;  1K7A A;  2A5Y B;  2CQN A;  3C3W A;  2K3P A;  2ESH A;  4A3F J;  2NOJ B;  4PJ0 C;  4RGS A;  5EZH A;  5E3O A;  2KKO A;  4HOB A;  1CGP A;  3PUB A;  3OYM A;  2VJ5 A;  1RIO H;  1DDN A;  3JRH A;  1T0F A;  3A4C A;  2FMY A;  3TP0 A;  2X1D A;  4M6Y A;  3QYF A;  2KDZ A;  3ECO A;  3OYI A;  1MBH A;  2ZFW A;  5J1U A;  4MHG A;  2MH9 A;  5LRS A;  4IEJ A;  2VQG A;  3BR6 A;  3TBI A;  2W82 A;  1EV7 A;  2QSH X;  1W5C C;  3HBL A;  4XLC A;  1ZKG A; 
#chains in the Genus database with same CATH homology
 2EIK H;  3AG1 H;  2EIM H;  1OCC H;  3AG2 H;  2OCC H;  2EIJ H;  2EIL H;  5B1A H;  1V54 H;  5B1B H;  3ABL H;  5B3S H;  1V55 H;  3ABM H;  3ASN H;  2Y69 H;  1OCO H;  3ASO H;  3WG7 H;  3X2Q H;  1OCZ H;  2DYS H;  3AG4 H;  2EIN H;  5IY5 H;  3AG3 H;  2DYR H;  1OCR H;  3ABK H;  2ZXW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...